3CU3A

Crystal structure of a domain of unknown function with a cystatin-like fold (npun_r1993) from nostoc punctiforme pcc 73102 at 2.00 a resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
162
structure length
162
Chain Sequence
TTTADESAIRAFHRQMIDAWNRGSGEGFAAPFSETADFITFEGTHLKGRKEIAAFHQQAFDTVVKGTRLEGEVDFVRFVNSQLALMLVVIRVILPGQTETSASRDSLPLYVVTKGDEGWQIEGLLNTRKLTLERQFFLDDFDSLSAEAQRQVTDLVASLKQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Domain of unknown function with a cystatin-like fold
publication title Crystal structure of Domain of Unknown Function with a Cystatin-like Fold (ZP_00107529.1) from Nostoc punctiforme PCC 73102 at 2.00 A resolution
rcsb
source organism Nostoc punctiforme
molecule tags Metal binding protein
total genus 49
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2008-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14534 DUF4440 Domain of unknown function (DUF4440)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3cu3A00
3M8CA 1BUQA 3GWRA 3ER7A 5IG4A 4WP5A 1HKXA 3OWYA 4HM0B 1W02A 1QMAA 1Q40B 3VSYA 3MHEA 2RCDA 3F9SA 5IEPA 3NM2A 4XB5A 3GZXB 1UUWB 1GY5A 1JN5A 1UUVB 1DMMA 4R9KA 4XDVA 2F99A 2BMOB 2XR8B 4HM4B 3DXOA 1OH0A 3RGAA 5AIFA 2R4IA 5IG0A 3B7CA 3F8XA 5KP4A 1U5OA 2RGQA 4N3VA 2GEYA 2YFIB 4HZ9B 5AIGA 2OWPA 4OUQA 5AEUB 3MG1A 2GEXA 5IG3A 1QJGA 3NV0B 1OCVA 4GB5A 5CK6A 3FSDA 3I0YA 1OF5B 3UNLA 3NBRA 3F7XA 4XBTA 3SOAA 4PEJA 3JUMA 1VZZA 3LYGA 2F98A 2K54A 3MG2A 7STDA 4OVMA 3EJVA 3K7CA 2HMNB 1E3VA 4H3UA 4X2OA 3EBTA 2A15A 3UJMA 3DM8A 3G0KA 5D81A 2HMMB 3OXAA 1Z1SA 2RFRA 3G16A 2IMJA 3KE7A 5IERA 2GBWB 2B24B 2QIYA 3H51A 5G2GA 4XBXA 4XDWA 5IEOA 1O7NB 4XBYA 3KKGA 2CHCA 5AIIA 3NXJA 1TP6A 1S5AA 3G8ZA 4J8TA 2QGUA 5BVBA 1W6YA 3VGNA 3IPTA 5D83A 3FH1A 3WMDA 1Q40A 3BLZA 3EF8A 4HM7B 4K1UA 5DREA 4KVHA 6STDA 4R9LA 1ULIB 2YFLB 1IDPA 3FLJA 1C7HA 1O7MB 4LEHA 3OWSA 1JKGB 2Z7AA 3H3HA 2BMQB 4HM2B 4L7KA 4WYKB 5JPPA 4HVNA 4FCMA 8CHOA 1NDOB 3LZAA 3KSPA 1AR0A 1GY7A 2CKFB 3F40A 3FZWA 1E3RA 1OGXA 4IIAA 5CF2A 1OHOA 1A2KA 2HMOB 2STDA 1SJWA 1WQLB 3JUOA 5KP1A 3NV0A 3T8UA 3GZRA 3B4PA 2HMKB 1OF5A 3FF0A 1DMNA 1ULJB 3A76A 4MJDA 3S5CA 1ZO2A 4X2HA 5AIHA 1EG9B 1OHPA 3STDA 2B1XB 1O7WB 3OWUA 5IF6A 1O7HB 3MSOA 3F8HA 5CXOA 2XSHB 4R1KA 4LMIA 4HZBB 3MKIA 3BB9A 3T8NA 1TUHA 3ROBA 3OX9A 2Z77A 5EVHA 3EHCA 3NUVA 3EX9A 4HM8B 4HKVB 5AI1A 2PZVA 1GS3A 4I4KA 1ASKA 4HM6B 1STDA 1W00A 5CLKA 3DZLA 5AEWB 5BXQA 3GZYB 1JN5B 2XSOB 1OPYA 1W01A 3EQQB 2JQ5A 4K1VA 3CNXA 3JUNA 5HGRA 3EN8A 3F14A 4HM5B 5KP3A 3FKAA 4J9AA 4HM1B 5DRVA 5IG5A 3MG3A 3E99A 3Q90A 3SOYA 1Q42A 2I9WA 3CNMA 3GRDA 5CF1A 3CPOA 1JB4A 3K0ZA 3GZBA 3EN1B 3JUPA 2GXFA 3FF2A 4Q53A 4L8PA 5TGNA 4U13A 3SEDA 2HMLB 1CQSA 1GY6A 1OUNA 1JKGA 4HM3B 1NU3A 5D82A 2HMJB 4ORLA 3OV4A 4HJLB 4WYKA 3DMCA 3EBYA 1EA2A 3KZTA 2UX0A 3HX8A 1E97A 3F7SA 1JB2A 1GYBA 3HZPA 2YFJB 2F86B 1ISKA 4L8OA 3EC9A 3B8LA 3RGRA 5JPUA 1K41A 4STDA 2XRXB 3CU3A 2W2CA 3DUKA 1O7GB 2BNGA 3D9RA 5STDA 1JB5A 4RZMA 1OHSA 3NHXA 1DMQA 1O7PB 3FGYA 2INXA 3B4OA 5IENA 4CDLA 4FCJA 5FW5A 4WWUC 2GBXB 4LGQA 3JUQA 1OGZA 3MYTA 2Z76A 4XM4A 3HK4A 1NWWA 1ZX2A 2BMRB 3ECFA
chains in the Genus database with same CATH superfamily
1UI7A 1K734 4N6V0 5M1AA 4FMAA 3CC43 1GOUA 2F4YA 4QWTA 2KRTA 3M8CA 2CG1A 1W2B2 1BUQA 1IYYA 4O8SA 1GOVA 2OTJ3 1PY3A 1ROAA 3ER7A 3GWRA 1WMPA 3T0UA 4K61A 5IG4A 4WP5A 2W03A 1HKXA 3OWYA 3MPHA 4HM0B 1YNVX 2OOVC 1W02A 1X1UA 1KD14 1QMAA 1NB3I 4JF8A 4BU4A 1Q40B 3KCHA 3WR2A 3VSYA 3MHEA 4KT3B 1CH0A 2RCDA 3F9SA 5IEPA 1AY7A 1TU5A 2P05A 1RGEA 3NM2A 4XB5A 1CYUA 1SIHA 3FCSB 3IMAB 4EBGA 3N8BA 2UGIA 3GZXB 4AKZA 1UUWB 2ZL8A 5IW9A 1STFI 1GY5A 1JN5A 1TTOA 1UUVB 1DMMA 4R9KA 4N6LA 1N8QA 1B27A 1EEJA 4XDVA 2F99A 2F5WA 1BOXA 1BNJA 2KAAA 5AYRB 2BMOB 3PCRA 1LQGC 4CCVA 2XR8B 3CCJ3 4HM4B 1QVG2 3OW22 1Q864 3DXOA 1N8R4 1OH0A 1DETA 1GSPA 3NM7A 1Q824 3RGAA 3GAXA 3JVCA 2P0MA 5AIFA 1IK3A 2R4IA 4FMBA 5IG0A 3LTBA 4N6NB 1VQO3 3B7CA 1PFPA 7RNTA 3NBBA 1I0XA 3F8XA 1JBRA 1LOVA 2WGQA 5KP4A 1U5OA 1VQP3 3Q1CA 4RNTA 2RGQA 2CWVA 1UGIA 2XF3A 3AMOB 1MWSA 3DGYA 1TRPA 2W9QA 3DGLA 1VQ43 4GSPA 2CX0A 1BRIA 2KF4A 2GEYA 4N3VA 3WOEB 2YFIB 1IVXA 4HZ9B 1FGQA 1DVCA 3CCL3 2HOHA 1VQM3 4HAAA 4BTYA 2GSPA 2BO9B 5AIGA 3BIRA 2OWPA 4OUQA 1YGWA 1X1YA 2LYXA 1DE3A 3LTDA 1FGTA 3UL5A 5AEUB 3J7Yd 1T2HA 1TJDA 4MEIA 2C11A 3MG1A 1KQS2 2GEXA 5IG3A 3DH2A 1QJGA 3NV0B 1UUGB 6GSPA 3CCR3 1Q7HA 3WA3A 2IUJA 1OCVA 4GB5A 5CK6A 1KWIA 5JBSA 1IV7A 1NJI4 1BRGA 1EKMA 4KFFA 1BVIA 1I2EA 1NO3A 1YIJ3 1FW7A 3FSDA 2IUKA 3I0YA 4WFOA 1OF5B 3MWZA 3AGOA 3UNLA 5BU4A 3NBRA 3F7XA 4XBTA 2FGTA 4GL6A 1WMNA 3G6E3 3DGNA 1FYSA 3SOAA 4HBRA 3CCV3 1AVKA 1IT8A 4PEJA 4AEQA 1RSNA 1VQK3 2XGNA 3JUMA 1VZZA 1CYVA 1BRSA 3LTAA 3LYGA 1RN7A 1S723 4LZIA 1TRQA 2F98A 1GD3A 2K54A 3MG2A 2D42A 1FGRA 4I5QA 7STDA 1RGHA 1JZDA 3I553 4OVMA 2L1SA 3EJVA 3K7CA 1RNTA 3X3XA 2HMNB 1C54A 1EQKA 1E3VA 4H3UA 3KN4A 4KZ1A 4X2OA 1B3SA 3EBTA 1LQMB 1MWRA 3WDGB 2A15A 3ZFZA 3UJMA 4LSOA 3D4AA 2GU3A 1W6CA 3DM8A 4BTXA 3G0KA 5D81A 2HMMB 1QVF2 3OXAA 5G1LA 2H0IA 8RNTA 1YIT3 1Z1SA 1ZGXA 3LT9A 1D6UA 3RNTA 3UB1A 2CW9A 3U1WA 2RFRA 3G16A 2IMJA 1VQN3 1B20A 3BNBA 1MWTA 3KE7A 1RDSA 3D5GA 1MGRA 5IERA 3CD63 1U8CB 2GBWB 2ZA4A 4RNYA 2E2UA 2B24B 1YHQ3 1IVVA 3D5IA 3PCSA 3PGBA 2QIYA 3H51A 1UCJA 5G2GA 1MNLA 2M7OA 2W56A 4XBXA 4XDWA 5IEOA 1UCIA 1O7NB 2OCTA 3CCE3 4IPBA 1M904 3LMLA 2CG0A 2OQEA 1EUIC 1UCLA 1SIIA 3AGNA 1HU9A 3KKGA 4XBYA 2CHCA 5AIIA 3URPA 3NXJA 1K9M4 1TP6A 1S5AA 2O3OA 3G8ZA 4J8TA 2CC3A 2QGUA 2YX9A 3X3ZA 3DY5A 1JRQA 3ZG0A 3ALAA 2QEX3 4TX4A 1BRHA 2IYJA 5BVBA 1VQ73 4N6TA 2BU4A 1W6YA 2ZHXB 1BRNL 1BSCA 1YJW3 2UUGC 3VGNA 3IPTA 5D83A 3FH1A 3WMDA 2MC8A 1CEWI 1D6YA 2CX1A 3EE1A 1Q40A 2MF7A 1UGHI 1M1K4 3BLZA 4N6OB 3EF8A 4HM7B 2SARA 5G1KA 3CCM3 4K1UA 3NX0A 5DREA 1VQ63 4KVHA 6STDA 4R9LA 1ULIB 2YFLB 4KFDA 1IDPA 2IA7A 1FZUA 1B2ZA 3CC73 3FLJA 1C7HA 1Q814 1O7MB 2K3DA 4CPKA 1MOLA 1FA3A 3CME3 2KF3A 4J5KA 4LEHA 1BUJA 3OWSA 3KIIA 1JKGB 2XH9A 2Z7AA 3A5EA 3H3HA 2ZDJA 2BMQB 2RNTA 4HM2B 1WNHA 3HI7A 1M1XB 4L7KA 4WYKB 1LNHA 1BSAA 5JPPA 2WGOA 4HVNA 1IQXA 4FCMA 4FMCA 8CHOA 1YVBI 1BIRA 1NDOB 4IT7A 3LZAA 1MGWA 3HIGA 3KSPA 2WOFA 1RN4A 1VQ83 2P09A 3WHOA 3N54B 3UL6A 1G96A 1AR0A 1GY7A 2CKFB 2K0MA 3AMOA 3F40A 3FZWA 1LRAA 1E3RA 1T2IA 1I0VA 2SBLA 1RGLA 2CWTA 1OGXA 2FXTA 1SQWA 1BNEA 3U97A 1QAFA 1WTHA 4EXRA 4IIAA 1BRJA 1LOXA 4MMYB 2PNCA 4H61A 3VF1A 3LTCA 5CF2A 1RJOA 1OHOA 1I8VA 1W7CA 3V98A 1DYUA 1RGCA 2C4BA 1B2SA 1LXEA 4JRFA 1BNRA 3QK9A 1A2KA 2ML5A 1RKYA 2HMOB 1I3IA 2STDA 1B2UA 1SJWA 1WQLB 3JUOA 5KP1A 2XFTA 4HOHA 3SLUA 3NV0A 3T8UA 3ZG5A 3GZRA 3CXC2 1Q7Y4 3S28A 1BNGA 1TFOA 1VQQA 1W6GA 1FGOA 2V1LA 1OACA 2OTL3 3B4PA 1UW1A 2HMKB 1AVLA 1OF5A 4BTWA 2Y74A 1RMSA 3CCQ3 1QAKA 6RNTA 3LT8A 3FF0A 3EB8A 3G713 1YVSA 1DMNA 1ULJB 1SARA 1YJ93 3A76A 4FCZA 4MJDA 1ROVA 1ZS7A 3O8YA 3S5CA 1RGKA 1IQ8A 1ZO2A 2OQEC 4X2HA 5AIHA 3WA2X 1WMOA 1R4YA 1N9JA 1RTUA 1EG9B 1OHPA 3STDA 1RCKA 3K9MC 2Z6BA 3PS8A 4EYCA 1RLSA 3NBJA 2B1XB 1RCLA 5BIRA 1O7WB 3OWUA 5IF6A 3G4S3 1O7HB 5LC7A 1RN1A 1BSBA 1W5ZA 2C10A 2Q07A 3MSOA 3F8HA 5CXOA 2AAEA 2XSHB 4R1KA 4LMIA 4HZBB 1YI23 1A90A 4GHOA 1V74A 3MKIA 2E2VA 3BB9A 1JZOA 1HYFA 4KFEA 4BIRA 1V57A 3T8NA 1TUHA 1N5HA 3CCU3 4O02B 2JDIH 4N6UA 3FG1A 1IQYA 3NQYA 3S29A 2CWUA 3ROBA 2RSXA 4MMZB 5HOHA 1DVDA 2P38A 2XGLA 3OX9A 1K28A 3X41A 1D6ZA 2Z77A 5EVHA 2W0QA 3EHCA 1LNIA 2D1WA 2RBIA 1B2MA 3RDEA 3NUVA 1US1A 1BANA 3EX9A 3SVAA 4HM8B 4HKVB 1GMQA 5EQLA 5AI1A 2KXGA 2PZVA 5GSPA 1GS3A 2J8XB 2H0GA 3IJEB 1ASKA 4I4KA 1VQ53 1F8NA 1JJ22 3DGOA 2XEPA 1IVWA 2GU1A 3AHWA 5ELJA 1R4CA 4HM6B 1STDA 1IVUA 1W00A 5CLKA 4EC6A 4FMDA 4EW5A 3DZLA 1A2PA 3PYJA 1NB5I 5AEWB 2WOHA 1YGEA 5BXQA 3GZYB 4BL2A 7GSPA 1GOYA 1RRLA 4RBNA 3V99A 2H0HA 3D79A 1JN5B 1JBSA 3K63A 3BNCA 2XSOB 1YJN3 1OPYA 3WODG 1W01A 5ELUA 3I563 3EQQB 2JQ5A 1JNQA 4AKYA 4K1VA 2CFLA 3CNXA 1BNFA 3JUNA 1MWUA 5HGRA 5LC6A 3EN8A 3F14A 4MMXB 4HM5B 1T3BA 5KP3A 3FKAA 2L4VA 3QRDA 4J9AA 2W9PA 4HM1B 5DRVA 5IG5A 3MG3A 1I3FA 2F56A 2FNQA 3E99A 3Q90A 3SOYA 3CC23 2ML6A 1VQL3 1TIJA 1Q42A 1RNBA 3X40A 2I9WA 1N9EA 3CNMA 3GRDA 1W4NA 1N5PA 5CF1A 3CPOA 1AV4A 4BL3A 1JB4A 1BRKA 4R4KA 1K8A4 4NREA 3HIIA 1BNIA 3K0ZA 3GZBA 2R41A 3EN1B 1AQZA 1RGGA 4NPBA 1GMRA 4FR9A 3JUPA 2GXFA 3FF2A 4Q53A 3S67A 1A2VA 4L8PA 2O9UX 3SYUA 5TGNA 3CPW2 4U13A 3CCS3 2BT3A 1LOWA 1B2XA 2OOVA 2HMLB 3SEDA 1CQSA 1X1WA 3LXUX 4O2HA 1GY6A 1OUNA 1UCKA 3SXXA 1JKGA 1PYLA 1NU3A 4HM3B 4N6MA 2HMJB 3LOYA 5D82A 3TDGA 4ORLA 3OV4A 4HJLB 2CFDA 4WYKA 4EV5A 5RNTA 1T5YA 3DMCA 1RHLA 3AHSA 1GD4A 3FG3A 3EBYA 1I70A 1BAOA 3V92A 1EA2A 1IU7A 1V58A 2LQVA 1VQ93 3BNDA 3KZTA 2UX0A 3D3LA 1I2FA 3HX8A 3N9HA 3PZWA 1A67A 1BSEA 1E97A 2E2TA 3F7SA 3GSPA 3S27A 2CFKA 2W04A 1JB2A 4RNZA 1IT7A 1GYBA 3HZPA 3X3YA 1KC84 2YFJB 1FUSA 1B21A 3LH4A 5FGOA 4HYZA 1BU4A 5A0OB 1J2BA 3Q2PA 2CIUA 5EEOA 4CJNA 3KSED 2F86B 1ISKA 1RRHA 4L8OA 3BNEA 3EC9A 3B8LA 4DKIA 1LVNA 3RGRA 1TFKA 1RGAA 5JPUA 1K41A 5M18A 4STDA 2XRXB 3DGMA 3CU3A 2F5MA 1UDII 1HZ1A 2W2CA 4O3VA 3DUKA 3X42A 5I97A 1O7GB 2WO0A 1FUTA 2BNGA 3D9RA 5STDA 3L0RA 3HOHA 1JB5A 2BHMA 3NQZA 3WOFB 4NHFA 1NNVA 4RZMA 1OHSA 2KCDA 9RNTA 1JBTA 1LOYA 2QA43 3NHXA 5AYSC 2AADA 1DMQA 1O7PB 3FG4A 3PXMA 1L5GB 3FGYA 2INXA 3BU4A 2W6JH 1KSIA 3B4OA 1W2ZA 4CDLA 5IENA 3K5TA 4OK0A 2BIRA 1BSDA 4FCJA 2XFSA 1IV9A 1FGMA 4J5GA 2CFGA 1I2GA 2IY2A 5FW5A 2CK3H 4WWUC 2GBXB 4ILFA 3CMA3 1SPUA 4G1MB 1M9GA 1PU4A 5M19A 1Q9EA 2CFWA 2P0XA 3KFQC 4LGQA 4EV2A 2CH9A 1G02A 3JUQA 1QALA 2KF6A 1OGZA 1X1XA 2W56B 3MYTA 1BGSA 4R80A 1UI8A 1Y4KA 1GMPA 4LYLB 4WHAA 2Z76A 3Q3FA 4XM4A 2Y73A 3SX1A 4ZM8A 3HK4A 1NWWA 1ZX2A 1RGFA 1BNSA 2KF5A 4K90B 1FUWA 1JV2B 1G0TA 2BMRB 3ECFA
chains in the Genus database with same CATH topology
1UI7A 1K734 4N6V0 4FMAA 3CC43 4QWTA 2KRTA 3M8CA 2CG1A 1W2B2 1BUQA 4O8SA 2OTJ3 1ROAA 3GWRA 3ER7A 1WMPA 3T0UA 4K61A 5IG4A 4WP5A 2W03A 1HKXA 3OWYA 3MPHA 4HM0B 2OOVC 1W02A 1KD14 1QMAA 1NB3I 4JF8A 1Q40B 3VSYA 3MHEA 2RCDA 3F9SA 5IEPA 1TU5A 2P05A 3NM2A 1CYUA 4XB5A 1SIHA 3FCSB 3IMAB 4EBGA 3N8BA 3GZXB 5IW9A 4AKZA 1UUWB 2ZL8A 1STFI 1GY5A 1JN5A 1UUVB 1DMMA 4R9KA 4N6LA 1N8QA 4XDVA 2F99A 5AYRB 2BMOB 3PCRA 4CCVA 2XR8B 3CCJ3 4HM4B 1QVG2 3OW22 1Q864 3DXOA 1N8R4 1OH0A 3NM7A 1Q824 3RGAA 3GAXA 3JVCA 2P0MA 5AIFA 1IK3A 2R4IA 4FMBA 5IG0A 3LTBA 4N6NB 1VQO3 3B7CA 1PFPA 3NBBA 3F8XA 2WGQA 5KP4A 1U5OA 1VQP3 3Q1CA 2RGQA 2CWVA 2XF3A 3AMOB 2W9QA 3DGLA 1VQ43 4N3VA 2GEYA 3WOEB 2YFIB 1IVXA 4HZ9B 1FGQA 1DVCA 3CCL3 1VQM3 4BTYA 2BO9B 5AIGA 2OWPA 4OUQA 2LYXA 3LTDA 1FGTA 3UL5A 5AEUB 3J7Yd 1KQS2 4MEIA 2C11A 3MG1A 2GEXA 5IG3A 1QJGA 3NV0B 3CCR3 3WA3A 2IUJA 1OCVA 4GB5A 5CK6A 1KWIA 5JBSA 1IV7A 1NJI4 1EKMA 4KFFA 1NO3A 1YIJ3 3FSDA 2IUKA 3I0YA 4WFOA 1OF5B 3MWZA 3UNLA 3NBRA 3F7XA 4XBTA 2FGTA 4GL6A 1WMNA 3G6E3 3DGNA 3SOAA 3CCV3 4HBRA 1AVKA 1IT8A 4PEJA 4AEQA 1VQK3 2XGNA 3JUMA 1VZZA 1CYVA 3LTAA 3LYGA 1RN7A 1S723 4LZIA 2F98A 1GD3A 2K54A 3MG2A 2D42A 1FGRA 7STDA 3I553 4OVMA 3EJVA 3K7CA 3X3XA 2HMNB 1EQKA 1E3VA 4H3UA 3KN4A 4KZ1A 4X2OA 3EBTA 3WDGB 2A15A 3UJMA 4LSOA 2GU3A 1W6CA 3DM8A 4BTXA 3G0KA 5D81A 2HMMB 1QVF2 3OXAA 1YIT3 1Z1SA 3LT9A 3UB1A 1D6UA 3U1WA 2CW9A 2RFRA 3G16A 2IMJA 1VQN3 3BNBA 3KE7A 3CD63 5IERA 1U8CB 2GBWB 4RNYA 2E2UA 2B24B 1YHQ3 1IVVA 3PCSA 3PGBA 2QIYA 3H51A 5G2GA 1MNLA 2M7OA 2W56A 4XBXA 4XDWA 5IEOA 1O7NB 2OCTA 3CCE3 4IPBA 1M904 3LMLA 2CG0A 2OQEA 1SIIA 1HU9A 3KKGA 4XBYA 2CHCA 5AIIA 3NXJA 1K9M4 1TP6A 1S5AA 2O3OA 3G8ZA 4J8TA 2CC3A 2QGUA 2YX9A 3X3ZA 3DY5A 1JRQA 3ALAA 2QEX3 4TX4A 5BVBA 1VQ73 4N6TA 1W6YA 1YJW3 3VGNA 3IPTA 5D83A 3FH1A 3WMDA 2MC8A 1CEWI 1D6YA 3EE1A 1Q40A 2MF7A 1M1K4 3BLZA 4N6OB 3EF8A 4HM7B 3CCM3 4K1UA 3NX0A 5DREA 1VQ63 4KVHA 6STDA 4R9LA 1ULIB 2YFLB 4KFDA 1IDPA 2IA7A 3CC73 3FLJA 1C7HA 1Q814 1O7MB 1FA3A 1MOLA 3CME3 4LEHA 3OWSA 3KIIA 1JKGB 2XH9A 2Z7AA 3H3HA 2ZDJA 2BMQB 4HM2B 4L7KA 1WNHA 3HI7A 1M1XB 4WYKB 1LNHA 5JPPA 2WGOA 4HVNA 1IQXA 4FCMA 4FMCA 8CHOA 1YVBI 1NDOB 4IT7A 3LZAA 3HIGA 3KSPA 2WOFA 1VQ83 2P09A 3N54B 3UL6A 1G96A 1AR0A 1GY7A 2CKFB 2K0MA 3AMOA 3F40A 3FZWA 1E3RA 2SBLA 2CWTA 1OGXA 2FXTA 1SQWA 3U97A 1QAFA 1WTHA 4EXRA 4IIAA 1LOXA 4MMYB 2PNCA 4H61A 3VF1A 3LTCA 5CF2A 1RJOA 1OHOA 1W7CA 3V98A 1DYUA 1LXEA 4JRFA 3QK9A 1A2KA 2ML5A 1RKYA 2HMOB 2STDA 1SJWA 1WQLB 3JUOA 5KP1A 2XFTA 3CXC2 3SLUA 3NV0A 3T8UA 3GZRA 1Q7Y4 3S28A 1TFOA 1W6GA 1FGOA 2V1LA 1OACA 2OTL3 3B4PA 1UW1A 2HMKB 1AVLA 1OF5A 4BTWA 2Y74A 3CCQ3 1QAKA 3LT8A 3FF0A 3EB8A 3G713 1DMNA 1ULJB 1YJ93 3A76A 4FCZA 4MJDA 1ROVA 3O8YA 3S5CA 1IQ8A 1ZO2A 2OQEC 4X2HA 5AIHA 3WA2X 1WMOA 1N9JA 1EG9B 1OHPA 3STDA 3K9MC 2Z6BA 3PS8A 4EYCA 3NBJA 2B1XB 1O7WB 3OWUA 5IF6A 3G4S3 1O7HB 5LC7A 1W5ZA 2C10A 2Q07A 3MSOA 3F8HA 5CXOA 1YI23 2XSHB 4R1KA 4LMIA 4HZBB 1A90A 1V74A 3MKIA 2E2VA 3BB9A 4KFEA 3T8NA 1TUHA 1N5HA 3CCU3 4O02B 2JDIH 4N6UA 3FG1A 1IQYA 3NQYA 3S29A 2CWUA 3ROBA 2RSXA 4MMZB 1DVDA 2P38A 2XGLA 3OX9A 1K28A 3X41A 1D6ZA 2Z77A 5EVHA 2W0QA 3EHCA 2D1WA 3RDEA 3NUVA 1US1A 3EX9A 3SVAA 4HM8B 4HKVB 5EQLA 5AI1A 2KXGA 2PZVA 1GS3A 3IJEB 1ASKA 4I4KA 1VQ53 1F8NA 1JJ22 3DGOA 2XEPA 1IVWA 2GU1A 5ELJA 1R4CA 4HM6B 1STDA 1IVUA 1W00A 5CLKA 4EC6A 4FMDA 3DZLA 3PYJA 1NB5I 5AEWB 2WOHA 1YGEA 5BXQA 3GZYB 1RRLA 4RBNA 3V99A 1JN5B 3K63A 3BNCA 2XSOB 1YJN3 1OPYA 3WODG 1W01A 5ELUA 3I563 3EQQB 2JQ5A 1JNQA 4AKYA 4K1VA 2CFLA 3CNXA 3JUNA 5HGRA 5LC6A 3EN8A 3F14A 4MMXB 4HM5B 5KP3A 3FKAA 2L4VA 3QRDA 4J9AA 2W9PA 4HM1B 5DRVA 5IG5A 3MG3A 3E99A 2FNQA 3Q90A 3SOYA 3CC23 2ML6A 1VQL3 1TIJA 1Q42A 3X40A 2I9WA 1N9EA 3CNMA 3GRDA 1W4NA 1N5PA 5CF1A 3CPOA 1AV4A 1JB4A 4R4KA 1K8A4 4NREA 3HIIA 3K0ZA 3GZBA 3EN1B 4FR9A 3JUPA 2GXFA 3FF2A 4Q53A 3S67A 1A2VA 4L8PA 2O9UX 5TGNA 3CPW2 4U13A 3CCS3 2BT3A 2OOVA 3SEDA 2HMLB 1CQSA 3LXUX 4O2HA 1GY6A 1OUNA 3SXXA 1JKGA 4HM3B 1NU3A 4N6MA 5D82A 2HMJB 3LOYA 3TDGA 4ORLA 3OV4A 4HJLB 2CFDA 4WYKA 4EV5A 1T5YA 3DMCA 1GD4A 3FG3A 3EBYA 3V92A 1EA2A 1IU7A 2LQVA 1VQ93 3BNDA 3KZTA 2UX0A 3D3LA 3HX8A 3N9HA 3PZWA 1A67A 1E97A 2E2TA 3F7SA 3S27A 2CFKA 2W04A 1JB2A 4RNZA 1IT7A 1GYBA 3HZPA 3X3YA 1KC84 2YFJB 3LH4A 5FGOA 4HYZA 5A0OB 1J2BA 3Q2PA 2CIUA 5EEOA 3KSED 2F86B 1ISKA 1RRHA 4L8OA 3BNEA 3EC9A 3B8LA 1LVNA 3RGRA 1TFKA 5JPUA 1K41A 4STDA 2XRXB 3DGMA 3CU3A 2W2CA 4O3VA 3DUKA 3X42A 5I97A 1O7GB 2WO0A 2BNGA 3D9RA 5STDA 3L0RA 3WOFB 1JB5A 2BHMA 3NQZA 4NHFA 4RZMA 1OHSA 2KCDA 2QA43 3NHXA 5AYSC 3FG4A 1DMQA 1O7PB 3PXMA 1L5GB 3FGYA 2INXA 2W6JH 1KSIA 3B4OA 1W2ZA 4CDLA 5IENA 3K5TA 4OK0A 4FCJA 2XFSA 1IV9A 1FGMA 2CFGA 5FW5A 2CK3H 4WWUC 2GBXB 3CMA3 1SPUA 4G1MB 1M9GA 1PU4A 2CFWA 2P0XA 4LGQA 3KFQC 4EV2A 2CH9A 3JUQA 1QALA 1OGZA 2W56B 3MYTA 4R80A 1UI8A 1Y4KA 4WHAA 4ZM8A 3SX1A 2Z76A 4XM4A 2Y73A 3HK4A 1NWWA 1ZX2A 4K90B 1FUWA 1JV2B 2BMRB 3ECFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M8C A;  1BUQ A;  3GWR A;  3ER7 A;  5IG4 A;  4WP5 A;  1HKX A;  3OWY A;  4HM0 B;  1W02 A;  1QMA A;  1Q40 B;  3VSY A;  3MHE A;  2RCD A;  3F9S A;  5IEP A;  3NM2 A;  4XB5 A;  3GZX B;  1UUW B;  1GY5 A;  1JN5 A;  1UUV B;  1DMM A;  4R9K A;  4XDV A;  2F99 A;  2BMO B;  2XR8 B;  4HM4 B;  3DXO A;  1OH0 A;  3RGA A;  5AIF A;  2R4I A;  5IG0 A;  3B7C A;  3F8X A;  5KP4 A;  1U5O A;  2RGQ A;  4N3V A;  2GEY A;  2YFI B;  4HZ9 B;  5AIG A;  2OWP A;  4OUQ A;  5AEU B;  3MG1 A;  2GEX A;  5IG3 A;  1QJG A;  3NV0 B;  1OCV A;  4GB5 A;  5CK6 A;  3FSD A;  3I0Y A;  1OF5 B;  3UNL A;  3NBR A;  3F7X A;  4XBT A;  3SOA A;  4PEJ A;  3JUM A;  1VZZ A;  3LYG A;  2F98 A;  2K54 A;  3MG2 A;  7STD A;  4OVM A;  3EJV A;  3K7C A;  2HMN B;  1E3V A;  4H3U A;  4X2O A;  3EBT A;  2A15 A;  3UJM A;  3DM8 A;  3G0K A;  5D81 A;  2HMM B;  3OXA A;  1Z1S A;  2RFR A;  3G16 A;  2IMJ A;  3KE7 A;  5IER A;  2GBW B;  2B24 B;  2QIY A;  3H51 A;  5G2G A;  4XBX A;  4XDW A;  5IEO A;  1O7N B;  4XBY A;  3KKG A;  2CHC A;  5AII A;  3NXJ A;  1TP6 A;  1S5A A;  3G8Z A;  4J8T A;  2QGU A;  5BVB A;  1W6Y A;  3VGN A;  3IPT A;  5D83 A;  3FH1 A;  3WMD A;  1Q40 A;  3BLZ A;  3EF8 A;  4HM7 B;  4K1U A;  5DRE A;  4KVH A;  6STD A;  4R9L A;  1ULI B;  2YFL B;  1IDP A;  3FLJ A;  1C7H A;  1O7M B;  4LEH A;  3OWS A;  1JKG B;  2Z7A A;  3H3H A;  2BMQ B;  4HM2 B;  4L7K A;  4WYK B;  5JPP A;  4HVN A;  4FCM A;  8CHO A;  1NDO B;  3LZA A;  3KSP A;  1AR0 A;  1GY7 A;  2CKF B;  3F40 A;  3FZW A;  1E3R A;  1OGX A;  4IIA A;  5CF2 A;  1OHO A;  1A2K A;  2HMO B;  2STD A;  1SJW A;  1WQL B;  3JUO A;  5KP1 A;  3NV0 A;  3T8U A;  3GZR A;  3B4P A;  2HMK B;  1OF5 A;  3FF0 A;  1DMN A;  1ULJ B;  3A76 A;  4MJD A;  3S5C A;  1ZO2 A;  4X2H A;  5AIH A;  1EG9 B;  1OHP A;  3STD A;  2B1X B;  1O7W B;  3OWU A;  5IF6 A;  1O7H B;  3MSO A;  3F8H A;  5CXO A;  2XSH B;  4R1K A;  4LMI A;  4HZB B;  3MKI A;  3BB9 A;  3T8N A;  1TUH A;  3ROB A;  3OX9 A;  2Z77 A;  5EVH A;  3EHC A;  3NUV A;  3EX9 A;  4HM8 B;  4HKV B;  5AI1 A;  2PZV A;  1GS3 A;  4I4K A;  1ASK A;  4HM6 B;  1STD A;  1W00 A;  5CLK A;  3DZL A;  5AEW B;  5BXQ A;  3GZY B;  1JN5 B;  2XSO B;  1OPY A;  1W01 A;  3EQQ B;  2JQ5 A;  4K1V A;  3CNX A;  3JUN A;  5HGR A;  3EN8 A;  3F14 A;  4HM5 B;  5KP3 A;  3FKA A;  4J9A A;  4HM1 B;  5DRV A;  5IG5 A;  3MG3 A;  3E99 A;  3Q90 A;  3SOY A;  1Q42 A;  2I9W A;  3CNM A;  3GRD A;  5CF1 A;  3CPO A;  1JB4 A;  3K0Z A;  3GZB A;  3EN1 B;  3JUP A;  2GXF A;  3FF2 A;  4Q53 A;  4L8P A;  5TGN A;  4U13 A;  3SED A;  2HML B;  1CQS A;  1GY6 A;  1OUN A;  1JKG A;  4HM3 B;  1NU3 A;  5D82 A;  2HMJ B;  4ORL A;  3OV4 A;  4HJL B;  4WYK A;  3DMC A;  3EBY A;  1EA2 A;  3KZT A;  2UX0 A;  3HX8 A;  1E97 A;  3F7S A;  1JB2 A;  1GYB A;  3HZP A;  2YFJ B;  2F86 B;  1ISK A;  4L8O A;  3EC9 A;  3B8L A;  3RGR A;  5JPU A;  1K41 A;  4STD A;  2XRX B;  3CU3 A;  2W2C A;  3DUK A;  1O7G B;  2BNG A;  3D9R A;  5STD A;  1JB5 A;  4RZM A;  1OHS A;  3NHX A;  1DMQ A;  1O7P B;  3FGY A;  2INX A;  3B4O A;  5IEN A;  4CDL A;  4FCJ A;  5FW5 A;  4WWU C;  2GBX B;  4LGQ A;  3JUQ A;  1OGZ A;  3MYT A;  2Z76 A;  4XM4 A;  3HK4 A;  1NWW A;  1ZX2 A;  2BMR B;  3ECF A; 
#chains in the Genus database with same CATH topology
 1UI7 A;  1K73 4;  4N6V 0;  5M1A A;  4FMA A;  3CC4 3;  1GOU A;  2F4Y A;  4QWT A;  2KRT A;  3M8C A;  2CG1 A;  1W2B 2;  1BUQ A;  1IYY A;  4O8S A;  1GOV A;  2OTJ 3;  1PY3 A;  1ROA A;  3ER7 A;  3GWR A;  1WMP A;  3T0U A;  4K61 A;  5IG4 A;  4WP5 A;  2W03 A;  1HKX A;  3OWY A;  3MPH A;  4HM0 B;  1YNV X;  2OOV C;  1W02 A;  1X1U A;  1KD1 4;  1QMA A;  1NB3 I;  4JF8 A;  4BU4 A;  1Q40 B;  3KCH A;  3WR2 A;  3VSY A;  3MHE A;  4KT3 B;  1CH0 A;  2RCD A;  3F9S A;  5IEP A;  1AY7 A;  1TU5 A;  2P05 A;  1RGE A;  3NM2 A;  4XB5 A;  1CYU A;  1SIH A;  3FCS B;  3IMA B;  4EBG A;  3N8B A;  2UGI A;  3GZX B;  4AKZ A;  1UUW B;  2ZL8 A;  5IW9 A;  1STF I;  1GY5 A;  1JN5 A;  1TTO A;  1UUV B;  1DMM A;  4R9K A;  4N6L A;  1N8Q A;  1B27 A;  1EEJ A;  4XDV A;  2F99 A;  2F5W A;  1BOX A;  1BNJ A;  2KAA A;  5AYR B;  2BMO B;  3PCR A;  1LQG C;  4CCV A;  2XR8 B;  3CCJ 3;  4HM4 B;  1QVG 2;  3OW2 2;  1Q86 4;  3DXO A;  1N8R 4;  1OH0 A;  1DET A;  1GSP A;  3NM7 A;  1Q82 4;  3RGA A;  3GAX A;  3JVC A;  2P0M A;  5AIF A;  1IK3 A;  2R4I A;  4FMB A;  5IG0 A;  3LTB A;  4N6N B;  1VQO 3;  3B7C A;  1PFP A;  7RNT A;  3NBB A;  1I0X A;  3F8X A;  1JBR A;  1LOV A;  2WGQ A;  5KP4 A;  1U5O A;  1VQP 3;  3Q1C A;  4RNT A;  2RGQ A;  2CWV A;  1UGI A;  2XF3 A;  3AMO B;  1MWS A;  3DGY A;  1TRP A;  2W9Q A;  3DGL A;  1VQ4 3;  4GSP A;  2CX0 A;  1BRI A;  2KF4 A;  2GEY A;  4N3V A;  3WOE B;  2YFI B;  1IVX A;  4HZ9 B;  1FGQ A;  1DVC A;  3CCL 3;  2HOH A;  1VQM 3;  4HAA A;  4BTY A;  2GSP A;  2BO9 B;  5AIG A;  3BIR A;  2OWP A;  4OUQ A;  1YGW A;  1X1Y A;  2LYX A;  1DE3 A;  3LTD A;  1FGT A;  3UL5 A;  5AEU B;  3J7Y d;  1T2H A;  1TJD A;  4MEI A;  2C11 A;  3MG1 A;  1KQS 2;  2GEX A;  5IG3 A;  3DH2 A;  1QJG A;  3NV0 B;  1UUG B;  6GSP A;  3CCR 3;  1Q7H A;  3WA3 A;  2IUJ A;  1OCV A;  4GB5 A;  5CK6 A;  1KWI A;  5JBS A;  1IV7 A;  1NJI 4;  1BRG A;  1EKM A;  4KFF A;  1BVI A;  1I2E A;  1NO3 A;  1YIJ 3;  1FW7 A;  3FSD A;  2IUK A;  3I0Y A;  4WFO A;  1OF5 B;  3MWZ A;  3AGO A;  3UNL A;  5BU4 A;  3NBR A;  3F7X A;  4XBT A;  2FGT A;  4GL6 A;  1WMN A;  3G6E 3;  3DGN A;  1FYS A;  3SOA A;  4HBR A;  3CCV 3;  1AVK A;  1IT8 A;  4PEJ A;  4AEQ A;  1RSN A;  1VQK 3;  2XGN A;  3JUM A;  1VZZ A;  1CYV A;  1BRS A;  3LTA A;  3LYG A;  1RN7 A;  1S72 3;  4LZI A;  1TRQ A;  2F98 A;  1GD3 A;  2K54 A;  3MG2 A;  2D42 A;  1FGR A;  4I5Q A;  7STD A;  1RGH A;  1JZD A;  3I55 3;  4OVM A;  2L1S A;  3EJV A;  3K7C A;  1RNT A;  3X3X A;  2HMN B;  1C54 A;  1EQK A;  1E3V A;  4H3U A;  3KN4 A;  4KZ1 A;  4X2O A;  1B3S A;  3EBT A;  1LQM B;  1MWR A;  3WDG B;  2A15 A;  3ZFZ A;  3UJM A;  4LSO A;  3D4A A;  2GU3 A;  1W6C A;  3DM8 A;  4BTX A;  3G0K A;  5D81 A;  2HMM B;  1QVF 2;  3OXA A;  5G1L A;  2H0I A;  8RNT A;  1YIT 3;  1Z1S A;  1ZGX A;  3LT9 A;  1D6U A;  3RNT A;  3UB1 A;  2CW9 A;  3U1W A;  2RFR A;  3G16 A;  2IMJ A;  1VQN 3;  1B20 A;  3BNB A;  1MWT A;  3KE7 A;  1RDS A;  3D5G A;  1MGR A;  5IER A;  3CD6 3;  1U8C B;  2GBW B;  2ZA4 A;  4RNY A;  2E2U A;  2B24 B;  1YHQ 3;  1IVV A;  3D5I A;  3PCS A;  3PGB A;  2QIY A;  3H51 A;  1UCJ A;  5G2G A;  1MNL A;  2M7O A;  2W56 A;  4XBX A;  4XDW A;  5IEO A;  1UCI A;  1O7N B;  2OCT A;  3CCE 3;  4IPB A;  1M90 4;  3LML A;  2CG0 A;  2OQE A;  1EUI C;  1UCL A;  1SII A;  3AGN A;  1HU9 A;  3KKG A;  4XBY A;  2CHC A;  5AII A;  3URP A;  3NXJ A;  1K9M 4;  1TP6 A;  1S5A A;  2O3O A;  3G8Z A;  4J8T A;  2CC3 A;  2QGU A;  2YX9 A;  3X3Z A;  3DY5 A;  1JRQ A;  3ZG0 A;  3ALA A;  2QEX 3;  4TX4 A;  1BRH A;  2IYJ A;  5BVB A;  1VQ7 3;  4N6T A;  2BU4 A;  1W6Y A;  2ZHX B;  1BRN L;  1BSC A;  1YJW 3;  2UUG C;  3VGN A;  3IPT A;  5D83 A;  3FH1 A;  3WMD A;  2MC8 A;  1CEW I;  1D6Y A;  2CX1 A;  3EE1 A;  1Q40 A;  2MF7 A;  1UGH I;  1M1K 4;  3BLZ A;  4N6O B;  3EF8 A;  4HM7 B;  2SAR A;  5G1K A;  3CCM 3;  4K1U A;  3NX0 A;  5DRE A;  1VQ6 3;  4KVH A;  6STD A;  4R9L A;  1ULI B;  2YFL B;  4KFD A;  1IDP A;  2IA7 A;  1FZU A;  1B2Z A;  3CC7 3;  3FLJ A;  1C7H A;  1Q81 4;  1O7M B;  2K3D A;  4CPK A;  1MOL A;  1FA3 A;  3CME 3;  2KF3 A;  4J5K A;  4LEH A;  1BUJ A;  3OWS A;  3KII A;  1JKG B;  2XH9 A;  2Z7A A;  3A5E A;  3H3H A;  2ZDJ A;  2BMQ B;  2RNT A;  4HM2 B;  1WNH A;  3HI7 A;  1M1X B;  4L7K A;  4WYK B;  1LNH A;  1BSA A;  5JPP A;  2WGO A;  4HVN A;  1IQX A;  4FCM A;  4FMC A;  8CHO A;  1YVB I;  1BIR A;  1NDO B;  4IT7 A;  3LZA A;  1MGW A;  3HIG A;  3KSP A;  2WOF A;  1RN4 A;  1VQ8 3;  2P09 A;  3WHO A;  3N54 B;  3UL6 A;  1G96 A;  1AR0 A;  1GY7 A;  2CKF B;  2K0M A;  3AMO A;  3F40 A;  3FZW A;  1LRA A;  1E3R A;  1T2I A;  1I0V A;  2SBL A;  1RGL A;  2CWT A;  1OGX A;  2FXT A;  1SQW A;  1BNE A;  3U97 A;  1QAF A;  1WTH A;  4EXR A;  4IIA A;  1BRJ A;  1LOX A;  4MMY B;  2PNC A;  4H61 A;  3VF1 A;  3LTC A;  5CF2 A;  1RJO A;  1OHO A;  1I8V A;  1W7C A;  3V98 A;  1DYU A;  1RGC A;  2C4B A;  1B2S A;  1LXE A;  4JRF A;  1BNR A;  3QK9 A;  1A2K A;  2ML5 A;  1RKY A;  2HMO B;  1I3I A;  2STD A;  1B2U A;  1SJW A;  1WQL B;  3JUO A;  5KP1 A;  2XFT A;  4HOH A;  3SLU A;  3NV0 A;  3T8U A;  3ZG5 A;  3GZR A;  3CXC 2;  1Q7Y 4;  3S28 A;  1BNG A;  1TFO A;  1VQQ A;  1W6G A;  1FGO A;  2V1L A;  1OAC A;  2OTL 3;  3B4P A;  1UW1 A;  2HMK B;  1AVL A;  1OF5 A;  4BTW A;  2Y74 A;  1RMS A;  3CCQ 3;  1QAK A;  6RNT A;  3LT8 A;  3FF0 A;  3EB8 A;  3G71 3;  1YVS A;  1DMN A;  1ULJ B;  1SAR A;  1YJ9 3;  3A76 A;  4FCZ A;  4MJD A;  1ROV A;  1ZS7 A;  3O8Y A;  3S5C A;  1RGK A;  1IQ8 A;  1ZO2 A;  2OQE C;  4X2H A;  5AIH A;  3WA2 X;  1WMO A;  1R4Y A;  1N9J A;  1RTU A;  1EG9 B;  1OHP A;  3STD A;  1RCK A;  3K9M C;  2Z6B A;  3PS8 A;  4EYC A;  1RLS A;  3NBJ A;  2B1X B;  1RCL A;  5BIR A;  1O7W B;  3OWU A;  5IF6 A;  3G4S 3;  1O7H B;  5LC7 A;  1RN1 A;  1BSB A;  1W5Z A;  2C10 A;  2Q07 A;  3MSO A;  3F8H A;  5CXO A;  2AAE A;  2XSH B;  4R1K A;  4LMI A;  4HZB B;  1YI2 3;  1A90 A;  4GHO A;  1V74 A;  3MKI A;  2E2V A;  3BB9 A;  1JZO A;  1HYF A;  4KFE A;  4BIR A;  1V57 A;  3T8N A;  1TUH A;  1N5H A;  3CCU 3;  4O02 B;  2JDI H;  4N6U A;  3FG1 A;  1IQY A;  3NQY A;  3S29 A;  2CWU A;  3ROB A;  2RSX A;  4MMZ B;  5HOH A;  1DVD A;  2P38 A;  2XGL A;  3OX9 A;  1K28 A;  3X41 A;  1D6Z A;  2Z77 A;  5EVH A;  2W0Q A;  3EHC A;  1LNI A;  2D1W A;  2RBI A;  1B2M A;  3RDE A;  3NUV A;  1US1 A;  1BAN A;  3EX9 A;  3SVA A;  4HM8 B;  4HKV B;  1GMQ A;  5EQL A;  5AI1 A;  2KXG A;  2PZV A;  5GSP A;  1GS3 A;  2J8X B;  2H0G A;  3IJE B;  1ASK A;  4I4K A;  1VQ5 3;  1F8N A;  1JJ2 2;  3DGO A;  2XEP A;  1IVW A;  2GU1 A;  3AHW A;  5ELJ A;  1R4C A;  4HM6 B;  1STD A;  1IVU A;  1W00 A;  5CLK A;  4EC6 A;  4FMD A;  4EW5 A;  3DZL A;  1A2P A;  3PYJ A;  1NB5 I;  5AEW B;  2WOH A;  1YGE A;  5BXQ A;  3GZY B;  4BL2 A;  7GSP A;  1GOY A;  1RRL A;  4RBN A;  3V99 A;  2H0H A;  3D79 A;  1JN5 B;  1JBS A;  3K63 A;  3BNC A;  2XSO B;  1YJN 3;  1OPY A;  3WOD G;  1W01 A;  5ELU A;  3I56 3;  3EQQ B;  2JQ5 A;  1JNQ A;  4AKY A;  4K1V A;  2CFL A;  3CNX A;  1BNF A;  3JUN A;  1MWU A;  5HGR A;  5LC6 A;  3EN8 A;  3F14 A;  4MMX B;  4HM5 B;  1T3B A;  5KP3 A;  3FKA A;  2L4V A;  3QRD A;  4J9A A;  2W9P A;  4HM1 B;  5DRV A;  5IG5 A;  3MG3 A;  1I3F A;  2F56 A;  2FNQ A;  3E99 A;  3Q90 A;  3SOY A;  3CC2 3;  2ML6 A;  1VQL 3;  1TIJ A;  1Q42 A;  1RNB A;  3X40 A;  2I9W A;  1N9E A;  3CNM A;  3GRD A;  1W4N A;  1N5P A;  5CF1 A;  3CPO A;  1AV4 A;  4BL3 A;  1JB4 A;  1BRK A;  4R4K A;  1K8A 4;  4NRE A;  3HII A;  1BNI A;  3K0Z A;  3GZB A;  2R41 A;  3EN1 B;  1AQZ A;  1RGG A;  4NPB A;  1GMR A;  4FR9 A;  3JUP A;  2GXF A;  3FF2 A;  4Q53 A;  3S67 A;  1A2V A;  4L8P A;  2O9U X;  3SYU A;  5TGN A;  3CPW 2;  4U13 A;  3CCS 3;  2BT3 A;  1LOW A;  1B2X A;  2OOV A;  2HML B;  3SED A;  1CQS A;  1X1W A;  3LXU X;  4O2H A;  1GY6 A;  1OUN A;  1UCK A;  3SXX A;  1JKG A;  1PYL A;  1NU3 A;  4HM3 B;  4N6M A;  2HMJ B;  3LOY A;  5D82 A;  3TDG A;  4ORL A;  3OV4 A;  4HJL B;  2CFD A;  4WYK A;  4EV5 A;  5RNT A;  1T5Y A;  3DMC A;  1RHL A;  3AHS A;  1GD4 A;  3FG3 A;  3EBY A;  1I70 A;  1BAO A;  3V92 A;  1EA2 A;  1IU7 A;  1V58 A;  2LQV A;  1VQ9 3;  3BND A;  3KZT A;  2UX0 A;  3D3L A;  1I2F A;  3HX8 A;  3N9H A;  3PZW A;  1A67 A;  1BSE A;  1E97 A;  2E2T A;  3F7S A;  3GSP A;  3S27 A;  2CFK A;  2W04 A;  1JB2 A;  4RNZ A;  1IT7 A;  1GYB A;  3HZP A;  3X3Y A;  1KC8 4;  2YFJ B;  1FUS A;  1B21 A;  3LH4 A;  5FGO A;  4HYZ A;  1BU4 A;  5A0O B;  1J2B A;  3Q2P A;  2CIU A;  5EEO A;  4CJN A;  3KSE D;  2F86 B;  1ISK A;  1RRH A;  4L8O A;  3BNE A;  3EC9 A;  3B8L A;  4DKI A;  1LVN A;  3RGR A;  1TFK A;  1RGA A;  5JPU A;  1K41 A;  5M18 A;  4STD A;  2XRX B;  3DGM A;  3CU3 A;  2F5M A;  1UDI I;  1HZ1 A;  2W2C A;  4O3V A;  3DUK A;  3X42 A;  5I97 A;  1O7G B;  2WO0 A;  1FUT A;  2BNG A;  3D9R A;  5STD A;  3L0R A;  3HOH A;  1JB5 A;  2BHM A;  3NQZ A;  3WOF B;  4NHF A;  1NNV A;  4RZM A;  1OHS A;  2KCD A;  9RNT A;  1JBT A;  1LOY A;  2QA4 3;  3NHX A;  5AYS C;  2AAD A;  1DMQ A;  1O7P B;  3FG4 A;  3PXM A;  1L5G B;  3FGY A;  2INX A;  3BU4 A;  2W6J H;  1KSI A;  3B4O A;  1W2Z A;  4CDL A;  5IEN A;  3K5T A;  4OK0 A;  2BIR A;  1BSD A;  4FCJ A;  2XFS A;  1IV9 A;  1FGM A;  4J5G A;  2CFG A;  1I2G A;  2IY2 A;  5FW5 A;  2CK3 H;  4WWU C;  2GBX B;  4ILF A;  3CMA 3;  1SPU A;  4G1M B;  1M9G A;  1PU4 A;  5M19 A;  1Q9E A;  2CFW A;  2P0X A;  3KFQ C;  4LGQ A;  4EV2 A;  2CH9 A;  1G02 A;  3JUQ A;  1QAL A;  2KF6 A;  1OGZ A;  1X1X A;  2W56 B;  3MYT A;  1BGS A;  4R80 A;  1UI8 A;  1Y4K A;  1GMP A;  4LYL B;  4WHA A;  2Z76 A;  3Q3F A;  4XM4 A;  2Y73 A;  3SX1 A;  4ZM8 A;  3HK4 A;  1NWW A;  1ZX2 A;  1RGF A;  1BNS A;  2KF5 A;  4K90 B;  1FUW A;  1JV2 B;  1G0T A;  2BMR B;  3ECF A; 
#chains in the Genus database with same CATH homology
 1UI7 A;  1K73 4;  4N6V 0;  4FMA A;  3CC4 3;  4QWT A;  2KRT A;  3M8C A;  2CG1 A;  1W2B 2;  1BUQ A;  4O8S A;  2OTJ 3;  1ROA A;  3GWR A;  3ER7 A;  1WMP A;  3T0U A;  4K61 A;  5IG4 A;  4WP5 A;  2W03 A;  1HKX A;  3OWY A;  3MPH A;  4HM0 B;  2OOV C;  1W02 A;  1KD1 4;  1QMA A;  1NB3 I;  4JF8 A;  1Q40 B;  3VSY A;  3MHE A;  2RCD A;  3F9S A;  5IEP A;  1TU5 A;  2P05 A;  3NM2 A;  1CYU A;  4XB5 A;  1SIH A;  3FCS B;  3IMA B;  4EBG A;  3N8B A;  3GZX B;  5IW9 A;  4AKZ A;  1UUW B;  2ZL8 A;  1STF I;  1GY5 A;  1JN5 A;  1UUV B;  1DMM A;  4R9K A;  4N6L A;  1N8Q A;  4XDV A;  2F99 A;  5AYR B;  2BMO B;  3PCR A;  4CCV A;  2XR8 B;  3CCJ 3;  4HM4 B;  1QVG 2;  3OW2 2;  1Q86 4;  3DXO A;  1N8R 4;  1OH0 A;  3NM7 A;  1Q82 4;  3RGA A;  3GAX A;  3JVC A;  2P0M A;  5AIF A;  1IK3 A;  2R4I A;  4FMB A;  5IG0 A;  3LTB A;  4N6N B;  1VQO 3;  3B7C A;  1PFP A;  3NBB A;  3F8X A;  2WGQ A;  5KP4 A;  1U5O A;  1VQP 3;  3Q1C A;  2RGQ A;  2CWV A;  2XF3 A;  3AMO B;  2W9Q A;  3DGL A;  1VQ4 3;  4N3V A;  2GEY A;  3WOE B;  2YFI B;  1IVX A;  4HZ9 B;  1FGQ A;  1DVC A;  3CCL 3;  1VQM 3;  4BTY A;  2BO9 B;  5AIG A;  2OWP A;  4OUQ A;  2LYX A;  3LTD A;  1FGT A;  3UL5 A;  5AEU B;  3J7Y d;  1KQS 2;  4MEI A;  2C11 A;  3MG1 A;  2GEX A;  5IG3 A;  1QJG A;  3NV0 B;  3CCR 3;  3WA3 A;  2IUJ A;  1OCV A;  4GB5 A;  5CK6 A;  1KWI A;  5JBS A;  1IV7 A;  1NJI 4;  1EKM A;  4KFF A;  1NO3 A;  1YIJ 3;  3FSD A;  2IUK A;  3I0Y A;  4WFO A;  1OF5 B;  3MWZ A;  3UNL A;  3NBR A;  3F7X A;  4XBT A;  2FGT A;  4GL6 A;  1WMN A;  3G6E 3;  3DGN A;  3SOA A;  3CCV 3;  4HBR A;  1AVK A;  1IT8 A;  4PEJ A;  4AEQ A;  1VQK 3;  2XGN A;  3JUM A;  1VZZ A;  1CYV A;  3LTA A;  3LYG A;  1RN7 A;  1S72 3;  4LZI A;  2F98 A;  1GD3 A;  2K54 A;  3MG2 A;  2D42 A;  1FGR A;  7STD A;  3I55 3;  4OVM A;  3EJV A;  3K7C A;  3X3X A;  2HMN B;  1EQK A;  1E3V A;  4H3U A;  3KN4 A;  4KZ1 A;  4X2O A;  3EBT A;  3WDG B;  2A15 A;  3UJM A;  4LSO A;  2GU3 A;  1W6C A;  3DM8 A;  4BTX A;  3G0K A;  5D81 A;  2HMM B;  1QVF 2;  3OXA A;  1YIT 3;  1Z1S A;  3LT9 A;  3UB1 A;  1D6U A;  3U1W A;  2CW9 A;  2RFR A;  3G16 A;  2IMJ A;  1VQN 3;  3BNB A;  3KE7 A;  3CD6 3;  5IER A;  1U8C B;  2GBW B;  4RNY A;  2E2U A;  2B24 B;  1YHQ 3;  1IVV A;  3PCS A;  3PGB A;  2QIY A;  3H51 A;  5G2G A;  1MNL A;  2M7O A;  2W56 A;  4XBX A;  4XDW A;  5IEO A;  1O7N B;  2OCT A;  3CCE 3;  4IPB A;  1M90 4;  3LML A;  2CG0 A;  2OQE A;  1SII A;  1HU9 A;  3KKG A;  4XBY A;  2CHC A;  5AII A;  3NXJ A;  1K9M 4;  1TP6 A;  1S5A A;  2O3O A;  3G8Z A;  4J8T A;  2CC3 A;  2QGU A;  2YX9 A;  3X3Z A;  3DY5 A;  1JRQ A;  3ALA A;  2QEX 3;  4TX4 A;  5BVB A;  1VQ7 3;  4N6T A;  1W6Y A;  1YJW 3;  3VGN A;  3IPT A;  5D83 A;  3FH1 A;  3WMD A;  2MC8 A;  1CEW I;  1D6Y A;  3EE1 A;  1Q40 A;  2MF7 A;  1M1K 4;  3BLZ A;  4N6O B;  3EF8 A;  4HM7 B;  3CCM 3;  4K1U A;  3NX0 A;  5DRE A;  1VQ6 3;  4KVH A;  6STD A;  4R9L A;  1ULI B;  2YFL B;  4KFD A;  1IDP A;  2IA7 A;  3CC7 3;  3FLJ A;  1C7H A;  1Q81 4;  1O7M B;  1FA3 A;  1MOL A;  3CME 3;  4LEH A;  3OWS A;  3KII A;  1JKG B;  2XH9 A;  2Z7A A;  3H3H A;  2ZDJ A;  2BMQ B;  4HM2 B;  4L7K A;  1WNH A;  3HI7 A;  1M1X B;  4WYK B;  1LNH A;  5JPP A;  2WGO A;  4HVN A;  1IQX A;  4FCM A;  4FMC A;  8CHO A;  1YVB I;  1NDO B;  4IT7 A;  3LZA A;  3HIG A;  3KSP A;  2WOF A;  1VQ8 3;  2P09 A;  3N54 B;  3UL6 A;  1G96 A;  1AR0 A;  1GY7 A;  2CKF B;  2K0M A;  3AMO A;  3F40 A;  3FZW A;  1E3R A;  2SBL A;  2CWT A;  1OGX A;  2FXT A;  1SQW A;  3U97 A;  1QAF A;  1WTH A;  4EXR A;  4IIA A;  1LOX A;  4MMY B;  2PNC A;  4H61 A;  3VF1 A;  3LTC A;  5CF2 A;  1RJO A;  1OHO A;  1W7C A;  3V98 A;  1DYU A;  1LXE A;  4JRF A;  3QK9 A;  1A2K A;  2ML5 A;  1RKY A;  2HMO B;  2STD A;  1SJW A;  1WQL B;  3JUO A;  5KP1 A;  2XFT A;  3CXC 2;  3SLU A;  3NV0 A;  3T8U A;  3GZR A;  1Q7Y 4;  3S28 A;  1TFO A;  1W6G A;  1FGO A;  2V1L A;  1OAC A;  2OTL 3;  3B4P A;  1UW1 A;  2HMK B;  1AVL A;  1OF5 A;  4BTW A;  2Y74 A;  3CCQ 3;  1QAK A;  3LT8 A;  3FF0 A;  3EB8 A;  3G71 3;  1DMN A;  1ULJ B;  1YJ9 3;  3A76 A;  4FCZ A;  4MJD A;  1ROV A;  3O8Y A;  3S5C A;  1IQ8 A;  1ZO2 A;  2OQE C;  4X2H A;  5AIH A;  3WA2 X;  1WMO A;  1N9J A;  1EG9 B;  1OHP A;  3STD A;  3K9M C;  2Z6B A;  3PS8 A;  4EYC A;  3NBJ A;  2B1X B;  1O7W B;  3OWU A;  5IF6 A;  3G4S 3;  1O7H B;  5LC7 A;  1W5Z A;  2C10 A;  2Q07 A;  3MSO A;  3F8H A;  5CXO A;  1YI2 3;  2XSH B;  4R1K A;  4LMI A;  4HZB B;  1A90 A;  1V74 A;  3MKI A;  2E2V A;  3BB9 A;  4KFE A;  3T8N A;  1TUH A;  1N5H A;  3CCU 3;  4O02 B;  2JDI H;  4N6U A;  3FG1 A;  1IQY A;  3NQY A;  3S29 A;  2CWU A;  3ROB A;  2RSX A;  4MMZ B;  1DVD A;  2P38 A;  2XGL A;  3OX9 A;  1K28 A;  3X41 A;  1D6Z A;  2Z77 A;  5EVH A;  2W0Q A;  3EHC A;  2D1W A;  3RDE A;  3NUV A;  1US1 A;  3EX9 A;  3SVA A;  4HM8 B;  4HKV B;  5EQL A;  5AI1 A;  2KXG A;  2PZV A;  1GS3 A;  3IJE B;  1ASK A;  4I4K A;  1VQ5 3;  1F8N A;  1JJ2 2;  3DGO A;  2XEP A;  1IVW A;  2GU1 A;  5ELJ A;  1R4C A;  4HM6 B;  1STD A;  1IVU A;  1W00 A;  5CLK A;  4EC6 A;  4FMD A;  3DZL A;  3PYJ A;  1NB5 I;  5AEW B;  2WOH A;  1YGE A;  5BXQ A;  3GZY B;  1RRL A;  4RBN A;  3V99 A;  1JN5 B;  3K63 A;  3BNC A;  2XSO B;  1YJN 3;  1OPY A;  3WOD G;  1W01 A;  5ELU A;  3I56 3;  3EQQ B;  2JQ5 A;  1JNQ A;  4AKY A;  4K1V A;  2CFL A;  3CNX A;  3JUN A;  5HGR A;  5LC6 A;  3EN8 A;  3F14 A;  4MMX B;  4HM5 B;  5KP3 A;  3FKA A;  2L4V A;  3QRD A;  4J9A A;  2W9P A;  4HM1 B;  5DRV A;  5IG5 A;  3MG3 A;  3E99 A;  2FNQ A;  3Q90 A;  3SOY A;  3CC2 3;  2ML6 A;  1VQL 3;  1TIJ A;  1Q42 A;  3X40 A;  2I9W A;  1N9E A;  3CNM A;  3GRD A;  1W4N A;  1N5P A;  5CF1 A;  3CPO A;  1AV4 A;  1JB4 A;  4R4K A;  1K8A 4;  4NRE A;  3HII A;  3K0Z A;  3GZB A;  3EN1 B;  4FR9 A;  3JUP A;  2GXF A;  3FF2 A;  4Q53 A;  3S67 A;  1A2V A;  4L8P A;  2O9U X;  5TGN A;  3CPW 2;  4U13 A;  3CCS 3;  2BT3 A;  2OOV A;  3SED A;  2HML B;  1CQS A;  3LXU X;  4O2H A;  1GY6 A;  1OUN A;  3SXX A;  1JKG A;  4HM3 B;  1NU3 A;  4N6M A;  5D82 A;  2HMJ B;  3LOY A;  3TDG A;  4ORL A;  3OV4 A;  4HJL B;  2CFD A;  4WYK A;  4EV5 A;  1T5Y A;  3DMC A;  1GD4 A;  3FG3 A;  3EBY A;  3V92 A;  1EA2 A;  1IU7 A;  2LQV A;  1VQ9 3;  3BND A;  3KZT A;  2UX0 A;  3D3L A;  3HX8 A;  3N9H A;  3PZW A;  1A67 A;  1E97 A;  2E2T A;  3F7S A;  3S27 A;  2CFK A;  2W04 A;  1JB2 A;  4RNZ A;  1IT7 A;  1GYB A;  3HZP A;  3X3Y A;  1KC8 4;  2YFJ B;  3LH4 A;  5FGO A;  4HYZ A;  5A0O B;  1J2B A;  3Q2P A;  2CIU A;  5EEO A;  3KSE D;  2F86 B;  1ISK A;  1RRH A;  4L8O A;  3BNE A;  3EC9 A;  3B8L A;  1LVN A;  3RGR A;  1TFK A;  5JPU A;  1K41 A;  4STD A;  2XRX B;  3DGM A;  3CU3 A;  2W2C A;  4O3V A;  3DUK A;  3X42 A;  5I97 A;  1O7G B;  2WO0 A;  2BNG A;  3D9R A;  5STD A;  3L0R A;  3WOF B;  1JB5 A;  2BHM A;  3NQZ A;  4NHF A;  4RZM A;  1OHS A;  2KCD A;  2QA4 3;  3NHX A;  5AYS C;  3FG4 A;  1DMQ A;  1O7P B;  3PXM A;  1L5G B;  3FGY A;  2INX A;  2W6J H;  1KSI A;  3B4O A;  1W2Z A;  4CDL A;  5IEN A;  3K5T A;  4OK0 A;  4FCJ A;  2XFS A;  1IV9 A;  1FGM A;  2CFG A;  5FW5 A;  2CK3 H;  4WWU C;  2GBX B;  3CMA 3;  1SPU A;  4G1M B;  1M9G A;  1PU4 A;  2CFW A;  2P0X A;  4LGQ A;  3KFQ C;  4EV2 A;  2CH9 A;  3JUQ A;  1QAL A;  1OGZ A;  2W56 B;  3MYT A;  4R80 A;  1UI8 A;  1Y4K A;  4WHA A;  4ZM8 A;  3SX1 A;  2Z76 A;  4XM4 A;  2Y73 A;  3HK4 A;  1NWW A;  1ZX2 A;  4K90 B;  1FUW A;  1JV2 B;  2BMR B;  3ECF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...