3CU3A

Crystal structure of a domain of unknown function with a cystatin-like fold (npun_r1993) from nostoc punctiforme pcc 73102 at 2.00 a resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
162
structure length
162
Chain Sequence
TTTADESAIRAFHRQMIDAWNRGSGEGFAAPFSETADFITFEGTHLKGRKEIAAFHQQAFDTVVKGTRLEGEVDFVRFVNSQLALMLVVIRVILPGQTETSASRDSLPLYVVTKGDEGWQIEGLLNTRKLTLERQFFLDDFDSLSAEAQRQVTDLVASLKQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Domain of Unknown Function with a Cystatin-like Fold (ZP_00107529.1) from Nostoc punctiforme PCC 73102 at 2.00 A resolution
rcsb
source organism Nostoc punctiforme
molecule tags Metal binding protein
molecule keywords Domain of unknown function with a cystatin-like fold
total genus 49
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2008-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14534 DUF4440 Domain of unknown function (DUF4440)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3cu3A00
3FZWA 1C7HA 1E97A 2CHCA 4U13A 1WQLB 3JUNA 3F40A 2BMRB 3VSYA 1NU3A 3MKIA 2BNGA 1OCVA 3OWSA 2B1XB 1JKGB 4HM1B 1DMQA 4J9AA 1HKXA 1W01A 2B24B 3OWUA 4HM6B 1E3RA 2R4IA 3B4OA 3JUOA 3MG1A 1JKGA 3B4PA 4ORLA 4HZBB 1DMNA 1NDOB 1QMAA 3B8LA 3E99A 3F9SA 3GWRA 3KKGA 3HX8A 3LZAA 4HM2B 2GEYA 3JUMA 3SOAA 4L8PA 4X2HA 4XM4A 2QIYA 4GB5A 2W2CA 3BB9A 5AIIA 3EN1B 1O7NB 3GZXB 3G0KA 4LGQA 5IERA 4L7KA 1VZZA 3ROBA 3FH1A 2I9WA 2INXA 3S5CA 3F8XA 3KZTA 4FCMA 3A76A 3KSPA 1SJWA 4R9LA 1JN5B 4XDWA 3T8UA 3MYTA 3VGNA 5D83A 5TGNA 3OXAA 1ASKA 1U5OA 3JUQA 1EG9B 4Q53A 4WYKB 3FGYA 5JPUA 7STDA 1Z1SA 5IF6A 1UUWB 2Z76A 2Z77A 1OGZA 4HVNA 1NWWA 1ULIB 1W02A 4RZMA 2JQ5A 5AEUB 1ISKA 4PEJA 1A2KA 1GS3A 1O7PB 5AI1A 4WWUC 4KVHA 1AR0A 3NUVA 4HM0B 4N3VA 2XRXB 3F7SA 4FCJA 4OVMA 3Q90A 5EVHA 1UUVB 1O7HB 2UX0A 3WMDA 5G2GA 1GYBA 2GXFA 2RFRA 2YFIB 3DMCA 2XR8B 3OV4A 1ZX2A 5AIGA 4HM5B 1OF5B 2GEXA 3MG3A 4HM3B 2HMLB 2YFJB 3EBTA 4IIAA 3RGRA 5BVBA 4XBYA 3EHCA 3KE7A 1OUNA 3NV0A 3SEDA 5CF1A 4K1UA 4CDLA 1IDPA 2HMMB 1GY7A 1O7GB 1TP6A 1CQSA 4R1KA 4I4KA 3SOYA 3LYGA 3GZYB 4STDA 1OGXA 3B7CA 5IG4A 5IEPA 5KP4A 3F8HA 4HM8B 3F14A 1S5AA 3JUPA 3ECFA 4WYKA 5IEOA 5BXQA 5KP1A 2STDA 3CNMA 3FKAA 3UNLA 3CPOA 5CXOA 3G8ZA 3EJVA 3EQQB 1GY6A 3IPTA 1GY5A 5IENA 5CF2A 3T8NA 1K41A 2F99A 5AIHA 2YFLB 4XDVA 4MJDA 4OUQA 1OHSA 3H51A 5IG0A 2HMOB 4WP5A 3EN8A 3DZLA 3FF0A 3D9RA 3FSDA 5AIFA 3BLZA 4HM7B 3STDA 2BMOB 3MHEA 1Q40A 3UJMA 2OWPA 1ULJB 1TUHA 4HJLB 3K0ZA 1OF5A 1JB2A 3NHXA 2XSOB 1Q40B 3I0YA 3OWYA 2RGQA 4HKVB 5DREA 5HGRA 1W6YA 3K7CA 1DMMA 4XBTA 5KP3A 3NV0B 5STDA 3GZBA 3RGAA 2GBXB 4J8TA 5AEWB 1STDA 3DUKA 3ER7A 3H3HA 2F86B 1O7WB 1JB4A 2A15A 3FF2A 3G16A 3MSOA 1OHOA 4L8OA 4R9KA 1W00A 5D81A 3MG2A 2RCDA 5D82A 5DRVA 1EA2A 3CNXA 2HMNB 5IG5A 4K1VA 3GZRA 4HM4B 5CK6A 4HZ9B 1ZO2A 1E3VA 2GBWB 2F98A 3DM8A 3EX9A 1Q42A 3M8CA 1OH0A 1QJGA 4X2OA 1BUQA 3CU3A 3EC9A 1O7MB 2HMKB 2HMJB 5CLKA 5JPPA 1OPYA 3EBYA 4XBXA 2K54A 2PZVA 4H3UA 3OX9A 2CKFB 4LMIA 3NXJA 2QGUA 3NBRA 6STDA 2IMJA 1JN5A 3GRDA 1OHPA 2XSHB 2BMQB 4XB5A 3DXOA 8CHOA 5IG3A 4LEHA 1JB5A 2Z7AA 3EF8A 3HZPA 3NM2A 5FW5A 3HK4A 3F7XA 3FLJA
chains in the Genus database with same CATH superfamily
1NU3A 4BU4A 3WR2A 2BU4A 5G1LA 3G4S3 1D6YA 4HM6B 2CC3A 1GOYA 4XDVA 5AIGA 1GOVA 4HZBB 1QMAA 1NDOB 3BNDA 3E99A 3GWRA 3CMA3 2P05A 1PYLA 3LMLA 2MC8A 2E2VA 4O2HA 3SX1A 2BO9B 2HOHA 3KFQC 4X2HA 4AEQA 4BTYA 2QIYA 4IT7A 2W2CA 1WMPA 1SIHA 3G0KA 4N6NB 3CXC2 4L7KA 1VZZA 1B2SA 2INXA 2IY2A 6RNTA 1SJWA 4R9LA 4JRFA 4XDWA 4MMXB 3MYTA 5D83A 3JUQA 4WYKB 1B3SA 1EUIC 2W03A 3FGYA 2AAEA 1FUSA 1Z1SA 2SBLA 1RCLA 1PFPA 2Z77A 1BSDA 3BU4A 1HU9A 3CCR3 1W6GA 2JQ5A 5AEUB 1Q864 1A2KA 2C4BA 1RN4A 4KVHA 1BRKA 3CC73 1UGIA 1R4YA 3F7SA 4EXRA 1O7HB 5G2GA 2GXFA 1KQS2 1N5HA 4O02B 2R41A 3Q2PA 1D6UA 1YIT3 2GEXA 7GSPA 2YFJB 5RNTA 3CCQ3 1R4CA 3G713 1OUNA 1K9M4 4OK0A 4BIRA 3QK9A 5M18A 1YIJ3 1B2UA 1FGQA 4EBGA 3EE1A 3SOYA 2FNQA 1BNIA 1K28A 3B7CA 1TRPA 1YJN3 1FUTA 3PCSA 1M9GA 1JBRA 2STDA 1RNTA 2CK3H 3V98A 1BNJA 3EJVA 4N6OB 3LXUX 1GY5A 1GSPA 3D3LA 1G02A 1A2PA 3BNCA 1X1WA 2HMOB 1EQKA 1LOXA 3Q3FA 3DZLA 3FF0A 5AIFA 4HM7B 3LT8A 3MHEA 2OWPA 1AVLA 1ULJB 2CIUA 2P38A 4HJLB 5DREA 3X3ZA 4HOHA 1JNQA 5I97A 3D4AA 4JF8A 5STDA 1IQYA 3GZBA 3I563 3DUKA 2F86B 5KP1A 2KF3A 5DRVA 5D81A 2C10A 1CYUA 3S67A 4CPKA 1IQ8A 3CNXA 4ILFA 1MWTA 5IG5A 1BRJA 1VQL3 1KC84 5M1AA 3L0RA 1IVWA 1IT7A 1E3VA 4MMZB 3DM8A 2CFGA 4N6UA 4X2OA 1QJGA 2QEX3 2CX0A 2H0IA 4LZIA 3EC9A 1VQ73 2HMKB 3BNEA 5CLKA 2CG1A 2V1LA 3CCS3 1V57A 3AHSA 4H3UA 2D42A 2XH9A 1V58A 6STDA 2P0XA 3HIGA 1OHPA 4N6TA 1BNFA 3WODG 4NREA 1RGLA 1I3FA 5A0OB 3NBJA 4BL2A 3NM2A 3EF8A 1X1YA 4N6LA 3FLJA 4R1KA 4J5GA 2PNCA 3FZWA 1E97A 3AMOA 4U13A 1WQLB 3SLUA 1STFI 2BMRB 2CFKA 3WDGB 1OCVA 2OQEA 2B1XB 4KT3B 1JKGB 1BGSA 1IT8A 1HKXA 3MWZA 2B24B 3LTAA 3OWUA 1F8NA 4FMCA 3B4OA 3JUOA 4XBTA 1DMNA 2CWTA 1SIIA 4J5KA 1UCJA 1T2IA 2GEYA 2UGIA 3NQYA 1JZDA 1GD4A 1ZS7A 1TIJA 3JUMA 4L8PA 5BU4A 1RRLA 2KXGA 1TFKA 1RRHA 4GB5A 4FMDA 3BB9A 5AIIA 3EN1B 1BRSA 4FMAA 5IERA 2Y73A 1HYFA 1JRQA 1BAOA 1UW1A 2XEPA 3S5CA 3X3YA 1T2HA 4FCMA 1U8CB 1DE3A 1IVVA 2H0GA 1JZOA 1FYSA 4DKIA 3OXAA 1ASKA 1U5OA 4N6MA 4EV5A 3CCL3 3N54B 4EC6A 1SARA 2CFWA 1RHLA 1W2ZA 2KRTA 3FCSB 3JVCA 4EW5A 4RZMA 4AKYA 3AMOB 1NWWA 1YI23 1ISKA 4PEJA 5AI1A 1GS3A 1FA3A 1BVIA 1NO3A 2CWUA 2ZDJA 3LH4A 3NUVA 2W6JH 4OVMA 1N9JA 4FCJA 1DYUA 5EVHA 1RKYA 2YFIB 3DMCA 3LT9A 3I553 2XR8B 1BRNL 2WO0A 4HM5B 1RDSA 2Z6BA 3MG3A 2F5MA 4IIAA 3IJEB 5BVBA 3WA2X 4XBYA 3SEDA 5CF1A 4CDLA 1NB3I 1J2BA 1N8QA 1N8R4 1GY7A 1JBTA 1VQQA 1CQSA 1JJ22 1I2FA 4STDA 1YVBI 2E2UA 1BNRA 4RBNA 3F8HA 3PGBA 2K0MA 3F14A 3JUPA 1VQ43 3UNLA 1G96A 4MEIA 5IENA 1QVF2 1VQN3 3S28A 1I0VA 3IPTA 2F99A 1BSCA 2IA7A 2OOVC 1RGGA 1CH0A 3QRDA 4NHFA 5IG0A 2KCDA 3CCJ3 2RSXA 3U97A 5EEOA 3CPW2 1RN1A 1OACA 1WMOA 2BMOB 4K90B 3UJMA 2ML6A 2XGNA 3DGLA 5BIRA 1VQM3 2LYXA 1Q7Y4 2O9UX 1BRGA 1JB2A 2XSOB 3I0YA 3K9MC 4HKVB 5HGRA 1LOVA 3K7CA 3NV0B 1BANA 3A5EA 2BIRA 1IYYA 1STDA 3N8BA 3H3HA 3LTBA 1JB4A 2A15A 3LTDA 3UB1A 1KWIA 1IVXA 2W04A 2CFLA 2L4VA 1EA2A 2OOVA 3RNTA 4EV2A 1TJDA 3U1WA 1DETA 3DGNA 1Q824 4HZ9B 3M8CA 1MGWA 2BT3A 2F98A 3EX9A 1Q42A 1I2GA 1OH0A 2K3DA 2XFTA 1IV7A 2W56A 3RDEA 1BRHA 3CC43 2JDIH 1HZ1A 1FGRA 3EBYA 3WHOA 1LNIA 2PZVA 2OCTA 2CKFB 3HI7A 3OX9A 3NXJA 3PYJA 3K5TA 2IMJA 1FUWA 2KF6A 1RGHA 2XSHB 3AGNA 3NBBA 1WNHA 4XB5A 4WFOA 3DXOA 5IG3A 1YNVX 3BNBA 1JB5A 1UCIA 1DVCA 2GSPA 4R80A 4GSPA 3RGAA 3F7XA 4WHAA 3CC23 3CCU3 1FW7A 2W9PA 2CHCA 2ZL8A 1NB5I 1RMSA 3VSYA 1MOLA 3MKIA 2BNGA 3OWSA 2IUKA 3KSED 3X41A 1UI7A 4HM1B 1DMQA 1W01A 2R4IA 4ORLA 1JKGA 3B4PA 4LYLB 3LZAA 1ZGXA 3F9SA 3HX8A 1TTOA 1BUJA 1TFOA 1TRQA 3FG4A 3KIIA 1RLSA 2L1SA 4O8SA 1Q9EA 1KSIA 2FGTA 1T5YA 3FG3A 3ROBA 1EKMA 3WA3A 3ALAA 1RGCA 2F56A 3A76A 3KSPA 4CCVA 4RNZA 2CWVA 3KN4A 2AADA 1NNVA 2XFSA 3VGNA 1NJI4 3NQZA 1W7CA 1EG9B 2XF3A 7STDA 1IQXA 1OGZA 1ULIB 1W02A 2E2TA 3WOFB 1O7PB 1W6CA 3UL5A 5GSPA 1Q814 1QAKA 1AR0A 4HM0B 1B2MA 1X1UA 2XRXB 1QVG2 2H0HA 3Q90A 1UUVB 2KF4A 2UX0A 3MPHA 1LNHA 3WMDA 2RFRA 1RGKA 3OV4A 4KFDA 1OF5B 3EBTA 3O8YA 1GMPA 4BL3A 4GL6A 4FR9A 3BIRA 3EHCA 3KE7A 3NV0A 1VQ53 2OTL3 4K1UA 4QWTA 2CH9A 1B20A 1BIRA 2HMMB 1W2B2 2MF7A 1TP6A 3CCM3 2BHMA 3CCV3 2Q07A 3GZYB 3LYGA 1OGXA 1WTHA 5LC6A 5IG4A 5IEPA 1BU4A 5KP4A 1YHQ3 1AV4A 1MWUA 1S5AA 3ZFZA 1BNGA 1RNBA 5G1KA 3AHWA 1UUGB 3J7Yd 1A90A 1G0TA 5CXOA 8RNTA 3G8ZA 3EQQB 1GY6A 3LOYA 5CF2A 3D5GA 1IV9A 4MJDA 1T3BA 1OHSA 3H51A 1A2VA 1I8VA 3D9RA 3BLZA 3Q1CA 1Q40A 4FCZA 1LVNA 2C11A 1LXEA 3K0ZA 1OF5A 1PY3A 2KAAA 1Q40B 1AY7A 2RGQA 5KP3A 1YJ93 2OQEC 1B2ZA 1O7WB 4AKZA 4R9KA 1BOXA 1M1XB 1MWSA 2W9QA 2RCDA 5D82A 4R4KA 3V92A 1B21A 4IPBA 1KD14 2W56B 1AVKA 4K1VA 5FGOA 1MGRA 3GZRA 1GOUA 3HK4A 4KFFA 1ZO2A 4KFEA 5ELJA 9RNTA 5IW9A 1I70A 2P0MA 1VQ93 4GHOA 3D79A 1V74A 1BSBA 3FG1A 1BUQA 1O7MB 1SPUA 4KZ1A 2D1WA 3LTCA 1OPYA 1YGEA 3UL6A 5JPPA 1CYVA 2W0QA 4O3VA 2K54A 1ROVA 2ZHXB 3IMAB 2QGUA 2ZA4A 1YJW3 1JN5A 2UUGC 2QA43 8CHOA 3WOEB 1UDII 2Z7AA 4LEHA 3S27A 5FW5A 2OTJ3 4EYCA 3PXMA 1C7HA 2CFDA 1LRAA 3JUNA 3F40A 1A67A 1M1K4 4J9AA 4ZM8A 1UCLA 2CX1A 1E3RA 3MG1A 2RBIA 2XGLA 3B8LA 1FZUA 2F5WA 3KKGA 3AGOA 4HM2B 1I0XA 5ELUA 3SOAA 1X1XA 1EEJA 2IYJA 3HOHA 4N6V0 1ROAA 4XM4A 1CEWI 1YGWA 1UI8A 1B2XA 1O7NB 3GZXB 3NM7A 4LGQA 1N5PA 3FH1A 4FMBA 2I9WA 3X42A 1IVUA 1D6ZA 3F8XA 3KZTA 1FGOA 2ML5A 3D5IA 1JN5B 3T8UA 4TX4A 3HIIA 1K734 5TGNA 5LC7A 4HBRA 1QAFA 1PU4A 2WGQA 5JPUA 4Q53A 3SVAA 3SYUA 1K8A4 5IF6A 1UUWB 2Z76A 4HVNA 3X40A 1S723 3EB8A 5AYSC 2RNTA 3ZG5A 4WWUC 1LQMB 2SARA 4N3VA 1M904 3DGMA 4CJNA 1VQP3 1B27A 3X3XA 1GD3A 2WOHA 1GYBA 1LQGC 1RN7A 1SQWA 2F4YA 3KCHA 1DVDA 1ZX2A 4RNYA 1TU5A 1RGFA 4HM3B 2HMLB 3RGRA 2CW9A 2FXTA 2GU3A 1LOWA 3PS8A 1IDPA 1MNLA 3DGOA 2KF5A 1O7GB 1VQO3 1VQ63 3K63A 3T0UA 4I4KA 1RGEA 3DGYA 1QALA 3N9HA 1GMQA 4HM8B 1JV2B 6GSPA 5BXQA 3ECFA 4WYKA 5IEOA 2O3OA 2M7OA 3CNMA 1GMRA 3FKAA 3PCRA 3CPOA 4MMYB 5AYRB 3S29A 3G6E3 1C54A 4NPBA 3T8NA 1K41A 4LSOA 1RTUA 1RCKA 2YFLB 2J8XB 4OUQA 5AIHA 1BNSA 4WP5A 1UGHI 4K61A 5M19A 3EN8A 3FSDA 5JBSA 3PZWA 1W5ZA 1Q7HA 2WGOA 3STDA 2CG0A 1AQZA 2YX9A 1BSEA 1TUHA 3URPA 3NHXA 3OWYA 7RNTA 1RGAA 1BSAA 1JBSA 1L5GB 4BTWA 1W6YA 1DMMA 1FGTA 4HYZA 2GBXB 4J8TA 1RJOA 5AEWB 2IUJA 3ER7A 3SXXA 3FF2A 3MSOA 4G1MB 4L8OA 3G16A 3CME3 1OHOA 1W00A 3MG2A 3NX0A 3TDGA 1BRIA 1I3IA 1WMNA 2HMNB 2GU1A 1VQK3 3V99A 1UCKA 1IK3A 4HM4B 1VQ83 3GAXA 5CK6A 2GBWB 3ZG0A 5HOHA 2P09A 5EQLA 1US1A 1FGMA 3CU3A 3VF1A 1N9EA 1RSNA 2HMJB 1MWRA 4RNTA 4XBXA 1IU7A 1W4NA 3DH2A 4H61A 1BNEA 4LMIA 3NBRA 2Y74A 4I5QA 3CCE3 1YVSA 3GRDA 2WOFA 4HAAA 3OW22 3CD63 2BMQB 1I2EA 4BTXA 3HZPA 3DY5A 1LOYA 1Y4KA 3GSPA 2LQVA
chains in the Genus database with same CATH topology
1NU3A 3G4S3 1D6YA 4HM6B 2CC3A 4XDVA 5AIGA 4HZBB 1QMAA 1NDOB 3BNDA 3E99A 3GWRA 3CMA3 2P05A 3LMLA 2MC8A 2E2VA 4O2HA 3SX1A 2BO9B 4X2HA 3KFQC 4AEQA 4BTYA 2QIYA 4IT7A 2W2CA 1WMPA 1SIHA 3G0KA 4N6NB 3CXC2 4L7KA 1VZZA 2INXA 1SJWA 4R9LA 4JRFA 4XDWA 4MMXB 3MYTA 5D83A 3JUQA 4WYKB 2W03A 3FGYA 2SBLA 1Z1SA 1PFPA 2Z77A 3CCR3 1HU9A 1W6GA 2JQ5A 5AEUB 1Q864 1A2KA 4KVHA 3CC73 3F7SA 4EXRA 1O7HB 5G2GA 2GXFA 1KQS2 1N5HA 4O02B 3Q2PA 1D6UA 1YIT3 2GEXA 2YFJB 3CCQ3 1R4CA 3G713 1OUNA 1K9M4 4OK0A 3QK9A 1YIJ3 1FGQA 4EBGA 3EE1A 3SOYA 2FNQA 1K28A 3B7CA 1YJN3 3PCSA 1M9GA 2STDA 2CK3H 3V98A 3EJVA 4N6OB 3LXUX 1GY5A 3D3LA 3BNCA 2HMOB 1EQKA 1LOXA 3DZLA 3FF0A 5AIFA 4HM7B 3LT8A 3MHEA 2OWPA 1AVLA 1ULJB 2CIUA 2P38A 4HJLB 5DREA 3X3ZA 1JNQA 5I97A 4JF8A 5STDA 1IQYA 3GZBA 3I563 3DUKA 2F86B 5KP1A 5DRVA 5D81A 2C10A 1CYUA 3S67A 1IQ8A 3CNXA 5IG5A 1VQL3 1KC84 3L0RA 1IVWA 1IT7A 1E3VA 4MMZB 3DM8A 2CFGA 4N6UA 4X2OA 1QJGA 2QEX3 4LZIA 3EC9A 1VQ73 2HMKB 3BNEA 5CLKA 2CG1A 2V1LA 3CCS3 4H3UA 2D42A 2XH9A 6STDA 2P0XA 3HIGA 1OHPA 4N6TA 3WODG 4NREA 5A0OB 3NBJA 3NM2A 3EF8A 4N6LA 3FLJA 4R1KA 2PNCA 3FZWA 1E97A 3AMOA 4U13A 1WQLB 3SLUA 1STFI 2BMRB 2CFKA 3WDGB 1OCVA 2OQEA 2B1XB 1JKGB 1IT8A 1HKXA 3MWZA 2B24B 3LTAA 3OWUA 1F8NA 4FMCA 3B4OA 3JUOA 4XBTA 1DMNA 2CWTA 1SIIA 2GEYA 3NQYA 1GD4A 3JUMA 1TIJA 4L8PA 1RRLA 2KXGA 1TFKA 1RRHA 4GB5A 4FMDA 3BB9A 5AIIA 3EN1B 4FMAA 5IERA 2Y73A 1JRQA 2XEPA 1UW1A 3X3YA 3S5CA 4FCMA 1U8CB 1IVVA 4EV5A 3OXAA 1ASKA 1U5OA 4N6MA 3CCL3 3N54B 4EC6A 2CFWA 1W2ZA 2KRTA 3FCSB 3JVCA 4RZMA 4AKYA 3AMOB 1NWWA 1YI23 1ISKA 4PEJA 5AI1A 1GS3A 1FA3A 1NO3A 2CWUA 2ZDJA 3LH4A 3NUVA 2W6JH 4OVMA 1N9JA 4FCJA 1DYUA 5EVHA 1RKYA 3DMCA 2YFIB 3LT9A 3I553 2XR8B 2WO0A 4HM5B 2Z6BA 3MG3A 4IIAA 3IJEB 5BVBA 3WA2X 4XBYA 3SEDA 5CF1A 4CDLA 1NB3I 1J2BA 1N8QA 1N8R4 1GY7A 1CQSA 1JJ22 4STDA 1YVBI 2E2UA 4RBNA 3F8HA 3PGBA 2K0MA 3F14A 3JUPA 1VQ43 3UNLA 1G96A 4MEIA 5IENA 1QVF2 1VQN3 3S28A 3IPTA 2F99A 2IA7A 2OOVC 3QRDA 5IG0A 4NHFA 2KCDA 3CCJ3 2RSXA 3U97A 5EEOA 3CPW2 1OACA 1WMOA 2BMOB 4K90B 3UJMA 2ML6A 2XGNA 3DGLA 1VQM3 2LYXA 1Q7Y4 2O9UX 1JB2A 2XSOB 3I0YA 3K9MC 4HKVB 5HGRA 3K7CA 3NV0B 1STDA 3N8BA 3H3HA 3LTBA 1JB4A 2A15A 3LTDA 3UB1A 1KWIA 1IVXA 2W04A 2CFLA 2L4VA 1EA2A 2OOVA 4EV2A 3U1WA 3DGNA 1Q824 4HZ9B 3M8CA 2BT3A 2F98A 3EX9A 1Q42A 1OH0A 2XFTA 1IV7A 2W56A 3RDEA 3CC43 2JDIH 1FGRA 3EBYA 2PZVA 2OCTA 2CKFB 3HI7A 3OX9A 3NXJA 3PYJA 3K5TA 2IMJA 1FUWA 2XSHB 3NBBA 1WNHA 4XB5A 4WFOA 3DXOA 5IG3A 3BNBA 1JB5A 1DVCA 4R80A 3RGAA 3F7XA 4WHAA 3CC23 3CCU3 2W9PA 2CHCA 2ZL8A 1NB5I 3VSYA 1MOLA 3MKIA 2BNGA 3OWSA 2IUKA 3KSED 3X41A 1UI7A 4HM1B 1DMQA 1W01A 2R4IA 4ORLA 1JKGA 3B4PA 3LZAA 3F9SA 3HX8A 1TFOA 3FG4A 3KIIA 4O8SA 1KSIA 2FGTA 1T5YA 3FG3A 3ROBA 1EKMA 3WA3A 3ALAA 3A76A 3KSPA 4CCVA 4RNZA 2CWVA 3KN4A 3VGNA 1NJI4 2XFSA 3NQZA 1W7CA 1EG9B 2XF3A 7STDA 1IQXA 1OGZA 1ULIB 1W02A 2E2TA 3WOFB 1O7PB 1W6CA 3UL5A 1Q814 1QAKA 1AR0A 4HM0B 2XRXB 1QVG2 3Q90A 1UUVB 2UX0A 3MPHA 1LNHA 3WMDA 2RFRA 3OV4A 4KFDA 1OF5B 3EBTA 3O8YA 4GL6A 4FR9A 3EHCA 3KE7A 1VQ53 3NV0A 2OTL3 4K1UA 4QWTA 2CH9A 2HMMB 1W2B2 2MF7A 1TP6A 3CCM3 2BHMA 3CCV3 2Q07A 3GZYB 3LYGA 1OGXA 1WTHA 5LC6A 5IG4A 5IEPA 5KP4A 1YHQ3 1AV4A 1S5AA 3J7Yd 1A90A 5CXOA 3G8ZA 3EQQB 1GY6A 3LOYA 5CF2A 1IV9A 4MJDA 1OHSA 3H51A 1A2VA 3D9RA 3BLZA 3Q1CA 1Q40A 4FCZA 1LVNA 2C11A 1LXEA 3K0ZA 1OF5A 1Q40B 2RGQA 5KP3A 1YJ93 2OQEC 1O7WB 4AKZA 4R9KA 1M1XB 2W9QA 2RCDA 5D82A 4R4KA 3V92A 4IPBA 1KD14 2W56B 1AVKA 4K1VA 5FGOA 3GZRA 3HK4A 4KFFA 1ZO2A 4KFEA 5ELJA 5IW9A 1VQ93 2P0MA 1V74A 1BUQA 3FG1A 1O7MB 1SPUA 4KZ1A 2D1WA 3LTCA 1OPYA 1YGEA 3UL6A 5JPPA 1CYVA 2W0QA 4O3VA 2K54A 1ROVA 3IMAB 2QGUA 1YJW3 1JN5A 2QA43 8CHOA 3WOEB 4LEHA 2Z7AA 3S27A 5FW5A 2OTJ3 4EYCA 3PXMA 1C7HA 2CFDA 3JUNA 3F40A 1A67A 1M1K4 4J9AA 4ZM8A 1E3RA 3MG1A 2XGLA 3B8LA 3KKGA 4HM2B 5ELUA 3SOAA 4XM4A 4N6V0 1ROAA 1CEWI 1UI8A 1O7NB 3GZXB 3NM7A 4LGQA 1N5PA 3FH1A 4FMBA 2I9WA 3X42A 1IVUA 1D6ZA 3F8XA 3KZTA 1FGOA 2ML5A 3T8UA 1JN5B 4TX4A 3HIIA 1K734 5TGNA 5LC7A 4HBRA 1QAFA 1PU4A 2WGQA 5JPUA 4Q53A 3SVAA 1K8A4 5IF6A 1UUWB 2Z76A 4HVNA 3X40A 1S723 3EB8A 5AYSC 4WWUC 4N3VA 1M904 3DGMA 1VQP3 3X3XA 1GD3A 2WOHA 1GYBA 1RN7A 1SQWA 1DVDA 1ZX2A 4RNYA 1TU5A 4HM3B 2HMLB 3RGRA 2CW9A 2FXTA 2GU3A 3PS8A 1IDPA 1MNLA 3DGOA 1O7GB 1VQO3 1VQ63 3K63A 3T0UA 4I4KA 1QALA 3N9HA 4HM8B 1JV2B 5BXQA 3ECFA 4WYKA 5IEOA 2O3OA 2M7OA 3CNMA 3FKAA 3PCRA 3CPOA 4MMYB 5AYRB 3S29A 3G6E3 3T8NA 1K41A 4LSOA 5AIHA 2YFLB 4OUQA 4WP5A 4K61A 3EN8A 3FSDA 5JBSA 3PZWA 1W5ZA 3STDA 2WGOA 2CG0A 2YX9A 1TUHA 3NHXA 3OWYA 1L5GB 4BTWA 1W6YA 1DMMA 1FGTA 4HYZA 2GBXB 4J8TA 1RJOA 5AEWB 2IUJA 3ER7A 3SXXA 3FF2A 3MSOA 4G1MB 4L8OA 3G16A 3CME3 1OHOA 1W00A 3MG2A 3NX0A 3TDGA 1WMNA 2HMNB 2GU1A 1VQK3 3V99A 1IK3A 4HM4B 1VQ83 3GAXA 5CK6A 2GBWB 2P09A 5EQLA 1US1A 1FGMA 3CU3A 3VF1A 1N9EA 2HMJB 4XBXA 1IU7A 1W4NA 4H61A 4LMIA 3NBRA 2Y74A 3CCE3 3GRDA 2WOFA 3OW22 3CD63 2BMQB 4BTXA 3HZPA 3DY5A 1Y4KA 2LQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FZW A;  1C7H A;  1E97 A;  2CHC A;  4U13 A;  1WQL B;  3JUN A;  3F40 A;  2BMR B;  3VSY A;  1NU3 A;  3MKI A;  2BNG A;  1OCV A;  3OWS A;  2B1X B;  1JKG B;  4HM1 B;  1DMQ A;  4J9A A;  1HKX A;  1W01 A;  2B24 B;  3OWU A;  4HM6 B;  1E3R A;  2R4I A;  3B4O A;  3JUO A;  3MG1 A;  1JKG A;  3B4P A;  4ORL A;  4HZB B;  1DMN A;  1NDO B;  1QMA A;  3B8L A;  3E99 A;  3F9S A;  3GWR A;  3KKG A;  3HX8 A;  3LZA A;  4HM2 B;  2GEY A;  3JUM A;  3SOA A;  4L8P A;  4X2H A;  4XM4 A;  2QIY A;  4GB5 A;  2W2C A;  3BB9 A;  5AII A;  3EN1 B;  1O7N B;  3GZX B;  3G0K A;  4LGQ A;  5IER A;  4L7K A;  1VZZ A;  3ROB A;  3FH1 A;  2I9W A;  2INX A;  3S5C A;  3F8X A;  3KZT A;  4FCM A;  3A76 A;  3KSP A;  1SJW A;  4R9L A;  1JN5 B;  4XDW A;  3T8U A;  3MYT A;  3VGN A;  5D83 A;  5TGN A;  3OXA A;  1ASK A;  1U5O A;  3JUQ A;  1EG9 B;  4Q53 A;  4WYK B;  3FGY A;  5JPU A;  7STD A;  1Z1S A;  5IF6 A;  1UUW B;  2Z76 A;  2Z77 A;  1OGZ A;  4HVN A;  1NWW A;  1ULI B;  1W02 A;  4RZM A;  2JQ5 A;  5AEU B;  1ISK A;  4PEJ A;  1A2K A;  1GS3 A;  1O7P B;  5AI1 A;  4WWU C;  4KVH A;  1AR0 A;  3NUV A;  4HM0 B;  4N3V A;  2XRX B;  3F7S A;  4FCJ A;  4OVM A;  3Q90 A;  5EVH A;  1UUV B;  1O7H B;  2UX0 A;  3WMD A;  5G2G A;  1GYB A;  2GXF A;  2RFR A;  2YFI B;  3DMC A;  2XR8 B;  3OV4 A;  1ZX2 A;  5AIG A;  4HM5 B;  1OF5 B;  2GEX A;  3MG3 A;  4HM3 B;  2HML B;  2YFJ B;  3EBT A;  4IIA A;  3RGR A;  5BVB A;  4XBY A;  3EHC A;  3KE7 A;  1OUN A;  3NV0 A;  3SED A;  5CF1 A;  4K1U A;  4CDL A;  1IDP A;  2HMM B;  1GY7 A;  1O7G B;  1TP6 A;  1CQS A;  4R1K A;  4I4K A;  3SOY A;  3LYG A;  3GZY B;  4STD A;  1OGX A;  3B7C A;  5IG4 A;  5IEP A;  5KP4 A;  3F8H A;  4HM8 B;  3F14 A;  1S5A A;  3JUP A;  3ECF A;  4WYK A;  5IEO A;  5BXQ A;  5KP1 A;  2STD A;  3CNM A;  3FKA A;  3UNL A;  3CPO A;  5CXO A;  3G8Z A;  3EJV A;  3EQQ B;  1GY6 A;  3IPT A;  1GY5 A;  5IEN A;  5CF2 A;  3T8N A;  1K41 A;  2F99 A;  5AIH A;  2YFL B;  4XDV A;  4MJD A;  4OUQ A;  1OHS A;  3H51 A;  5IG0 A;  2HMO B;  4WP5 A;  3EN8 A;  3DZL A;  3FF0 A;  3D9R A;  3FSD A;  5AIF A;  3BLZ A;  4HM7 B;  3STD A;  2BMO B;  3MHE A;  1Q40 A;  3UJM A;  2OWP A;  1ULJ B;  1TUH A;  4HJL B;  3K0Z A;  1OF5 A;  1JB2 A;  3NHX A;  2XSO B;  1Q40 B;  3I0Y A;  3OWY A;  2RGQ A;  4HKV B;  5DRE A;  5HGR A;  1W6Y A;  3K7C A;  1DMM A;  4XBT A;  5KP3 A;  3NV0 B;  5STD A;  3GZB A;  3RGA A;  2GBX B;  4J8T A;  5AEW B;  1STD A;  3DUK A;  3ER7 A;  3H3H A;  2F86 B;  1O7W B;  1JB4 A;  2A15 A;  3FF2 A;  3G16 A;  3MSO A;  1OHO A;  4L8O A;  4R9K A;  1W00 A;  5D81 A;  3MG2 A;  2RCD A;  5D82 A;  5DRV A;  1EA2 A;  3CNX A;  2HMN B;  5IG5 A;  4K1V A;  3GZR A;  4HM4 B;  5CK6 A;  4HZ9 B;  1ZO2 A;  1E3V A;  2GBW B;  2F98 A;  3DM8 A;  3EX9 A;  1Q42 A;  3M8C A;  1OH0 A;  1QJG A;  4X2O A;  1BUQ A;  3CU3 A;  3EC9 A;  1O7M B;  2HMK B;  2HMJ B;  5CLK A;  5JPP A;  1OPY A;  3EBY A;  4XBX A;  2K54 A;  2PZV A;  4H3U A;  3OX9 A;  2CKF B;  4LMI A;  3NXJ A;  2QGU A;  3NBR A;  6STD A;  2IMJ A;  1JN5 A;  3GRD A;  1OHP A;  2XSH B;  2BMQ B;  4XB5 A;  3DXO A;  8CHO A;  5IG3 A;  4LEH A;  1JB5 A;  2Z7A A;  3EF8 A;  3HZP A;  3NM2 A;  5FW5 A;  3HK4 A;  3F7X A;  3FLJ A; 
#chains in the Genus database with same CATH topology
 1NU3 A;  4BU4 A;  3WR2 A;  2BU4 A;  5G1L A;  3G4S 3;  1D6Y A;  4HM6 B;  2CC3 A;  1GOY A;  4XDV A;  5AIG A;  1GOV A;  4HZB B;  1QMA A;  1NDO B;  3BND A;  3E99 A;  3GWR A;  3CMA 3;  2P05 A;  1PYL A;  3LML A;  2MC8 A;  2E2V A;  4O2H A;  3SX1 A;  2BO9 B;  2HOH A;  3KFQ C;  4X2H A;  4AEQ A;  4BTY A;  2QIY A;  4IT7 A;  2W2C A;  1WMP A;  1SIH A;  3G0K A;  4N6N B;  3CXC 2;  4L7K A;  1VZZ A;  1B2S A;  2INX A;  2IY2 A;  6RNT A;  1SJW A;  4R9L A;  4JRF A;  4XDW A;  4MMX B;  3MYT A;  5D83 A;  3JUQ A;  4WYK B;  1B3S A;  1EUI C;  2W03 A;  3FGY A;  2AAE A;  1FUS A;  1Z1S A;  2SBL A;  1RCL A;  1PFP A;  2Z77 A;  1BSD A;  3BU4 A;  1HU9 A;  3CCR 3;  1W6G A;  2JQ5 A;  5AEU B;  1Q86 4;  1A2K A;  2C4B A;  1RN4 A;  4KVH A;  1BRK A;  3CC7 3;  1UGI A;  1R4Y A;  3F7S A;  4EXR A;  1O7H B;  5G2G A;  2GXF A;  1KQS 2;  1N5H A;  4O02 B;  2R41 A;  3Q2P A;  1D6U A;  1YIT 3;  2GEX A;  7GSP A;  2YFJ B;  5RNT A;  3CCQ 3;  1R4C A;  3G71 3;  1OUN A;  1K9M 4;  4OK0 A;  4BIR A;  3QK9 A;  5M18 A;  1YIJ 3;  1B2U A;  1FGQ A;  4EBG A;  3EE1 A;  3SOY A;  2FNQ A;  1BNI A;  1K28 A;  3B7C A;  1TRP A;  1YJN 3;  1FUT A;  3PCS A;  1M9G A;  1JBR A;  2STD A;  1RNT A;  2CK3 H;  3V98 A;  1BNJ A;  3EJV A;  4N6O B;  3LXU X;  1GY5 A;  1GSP A;  3D3L A;  1G02 A;  1A2P A;  3BNC A;  1X1W A;  2HMO B;  1EQK A;  1LOX A;  3Q3F A;  3DZL A;  3FF0 A;  5AIF A;  4HM7 B;  3LT8 A;  3MHE A;  2OWP A;  1AVL A;  1ULJ B;  2CIU A;  2P38 A;  4HJL B;  5DRE A;  3X3Z A;  4HOH A;  1JNQ A;  5I97 A;  3D4A A;  4JF8 A;  5STD A;  1IQY A;  3GZB A;  3I56 3;  3DUK A;  2F86 B;  5KP1 A;  2KF3 A;  5DRV A;  5D81 A;  2C10 A;  1CYU A;  3S67 A;  4CPK A;  1IQ8 A;  3CNX A;  4ILF A;  1MWT A;  5IG5 A;  1BRJ A;  1VQL 3;  1KC8 4;  5M1A A;  3L0R A;  1IVW A;  1IT7 A;  1E3V A;  4MMZ B;  3DM8 A;  2CFG A;  4N6U A;  4X2O A;  1QJG A;  2QEX 3;  2CX0 A;  2H0I A;  4LZI A;  3EC9 A;  1VQ7 3;  2HMK B;  3BNE A;  5CLK A;  2CG1 A;  2V1L A;  3CCS 3;  1V57 A;  3AHS A;  4H3U A;  2D42 A;  2XH9 A;  1V58 A;  6STD A;  2P0X A;  3HIG A;  1OHP A;  4N6T A;  1BNF A;  3WOD G;  4NRE A;  1RGL A;  1I3F A;  5A0O B;  3NBJ A;  4BL2 A;  3NM2 A;  3EF8 A;  1X1Y A;  4N6L A;  3FLJ A;  4R1K A;  4J5G A;  2PNC A;  3FZW A;  1E97 A;  3AMO A;  4U13 A;  1WQL B;  3SLU A;  1STF I;  2BMR B;  2CFK A;  3WDG B;  1OCV A;  2OQE A;  2B1X B;  4KT3 B;  1JKG B;  1BGS A;  1IT8 A;  1HKX A;  3MWZ A;  2B24 B;  3LTA A;  3OWU A;  1F8N A;  4FMC A;  3B4O A;  3JUO A;  4XBT A;  1DMN A;  2CWT A;  1SII A;  4J5K A;  1UCJ A;  1T2I A;  2GEY A;  2UGI A;  3NQY A;  1JZD A;  1GD4 A;  1ZS7 A;  1TIJ A;  3JUM A;  4L8P A;  5BU4 A;  1RRL A;  2KXG A;  1TFK A;  1RRH A;  4GB5 A;  4FMD A;  3BB9 A;  5AII A;  3EN1 B;  1BRS A;  4FMA A;  5IER A;  2Y73 A;  1HYF A;  1JRQ A;  1BAO A;  1UW1 A;  2XEP A;  3S5C A;  3X3Y A;  1T2H A;  4FCM A;  1U8C B;  1DE3 A;  1IVV A;  2H0G A;  1JZO A;  1FYS A;  4DKI A;  3OXA A;  1ASK A;  1U5O A;  4N6M A;  4EV5 A;  3CCL 3;  3N54 B;  4EC6 A;  1SAR A;  2CFW A;  1RHL A;  1W2Z A;  2KRT A;  3FCS B;  3JVC A;  4EW5 A;  4RZM A;  4AKY A;  3AMO B;  1NWW A;  1YI2 3;  1ISK A;  4PEJ A;  5AI1 A;  1GS3 A;  1FA3 A;  1BVI A;  1NO3 A;  2CWU A;  2ZDJ A;  3LH4 A;  3NUV A;  2W6J H;  4OVM A;  1N9J A;  4FCJ A;  1DYU A;  5EVH A;  1RKY A;  2YFI B;  3DMC A;  3LT9 A;  3I55 3;  2XR8 B;  1BRN L;  2WO0 A;  4HM5 B;  1RDS A;  2Z6B A;  3MG3 A;  2F5M A;  4IIA A;  3IJE B;  5BVB A;  3WA2 X;  4XBY A;  3SED A;  5CF1 A;  4CDL A;  1NB3 I;  1J2B A;  1N8Q A;  1N8R 4;  1GY7 A;  1JBT A;  1VQQ A;  1CQS A;  1JJ2 2;  1I2F A;  4STD A;  1YVB I;  2E2U A;  1BNR A;  4RBN A;  3F8H A;  3PGB A;  2K0M A;  3F14 A;  3JUP A;  1VQ4 3;  3UNL A;  1G96 A;  4MEI A;  5IEN A;  1QVF 2;  1VQN 3;  3S28 A;  1I0V A;  3IPT A;  2F99 A;  1BSC A;  2IA7 A;  2OOV C;  1RGG A;  1CH0 A;  3QRD A;  4NHF A;  5IG0 A;  2KCD A;  3CCJ 3;  2RSX A;  3U97 A;  5EEO A;  3CPW 2;  1RN1 A;  1OAC A;  1WMO A;  2BMO B;  4K90 B;  3UJM A;  2ML6 A;  2XGN A;  3DGL A;  5BIR A;  1VQM 3;  2LYX A;  1Q7Y 4;  2O9U X;  1BRG A;  1JB2 A;  2XSO B;  3I0Y A;  3K9M C;  4HKV B;  5HGR A;  1LOV A;  3K7C A;  3NV0 B;  1BAN A;  3A5E A;  2BIR A;  1IYY A;  1STD A;  3N8B A;  3H3H A;  3LTB A;  1JB4 A;  2A15 A;  3LTD A;  3UB1 A;  1KWI A;  1IVX A;  2W04 A;  2CFL A;  2L4V A;  1EA2 A;  2OOV A;  3RNT A;  4EV2 A;  1TJD A;  3U1W A;  1DET A;  3DGN A;  1Q82 4;  4HZ9 B;  3M8C A;  1MGW A;  2BT3 A;  2F98 A;  3EX9 A;  1Q42 A;  1I2G A;  1OH0 A;  2K3D A;  2XFT A;  1IV7 A;  2W56 A;  3RDE A;  1BRH A;  3CC4 3;  2JDI H;  1HZ1 A;  1FGR A;  3EBY A;  3WHO A;  1LNI A;  2PZV A;  2OCT A;  2CKF B;  3HI7 A;  3OX9 A;  3NXJ A;  3PYJ A;  3K5T A;  2IMJ A;  1FUW A;  2KF6 A;  1RGH A;  2XSH B;  3AGN A;  3NBB A;  1WNH A;  4XB5 A;  4WFO A;  3DXO A;  5IG3 A;  1YNV X;  3BNB A;  1JB5 A;  1UCI A;  1DVC A;  2GSP A;  4R80 A;  4GSP A;  3RGA A;  3F7X A;  4WHA A;  3CC2 3;  3CCU 3;  1FW7 A;  2W9P A;  2CHC A;  2ZL8 A;  1NB5 I;  1RMS A;  3VSY A;  1MOL A;  3MKI A;  2BNG A;  3OWS A;  2IUK A;  3KSE D;  3X41 A;  1UI7 A;  4HM1 B;  1DMQ A;  1W01 A;  2R4I A;  4ORL A;  1JKG A;  3B4P A;  4LYL B;  3LZA A;  1ZGX A;  3F9S A;  3HX8 A;  1TTO A;  1BUJ A;  1TFO A;  1TRQ A;  3FG4 A;  3KII A;  1RLS A;  2L1S A;  4O8S A;  1Q9E A;  1KSI A;  2FGT A;  1T5Y A;  3FG3 A;  3ROB A;  1EKM A;  3WA3 A;  3ALA A;  1RGC A;  2F56 A;  3A76 A;  3KSP A;  4CCV A;  4RNZ A;  2CWV A;  3KN4 A;  2AAD A;  1NNV A;  2XFS A;  3VGN A;  1NJI 4;  3NQZ A;  1W7C A;  1EG9 B;  2XF3 A;  7STD A;  1IQX A;  1OGZ A;  1ULI B;  1W02 A;  2E2T A;  3WOF B;  1O7P B;  1W6C A;  3UL5 A;  5GSP A;  1Q81 4;  1QAK A;  1AR0 A;  4HM0 B;  1B2M A;  1X1U A;  2XRX B;  1QVG 2;  2H0H A;  3Q90 A;  1UUV B;  2KF4 A;  2UX0 A;  3MPH A;  1LNH A;  3WMD A;  2RFR A;  1RGK A;  3OV4 A;  4KFD A;  1OF5 B;  3EBT A;  3O8Y A;  1GMP A;  4BL3 A;  4GL6 A;  4FR9 A;  3BIR A;  3EHC A;  3KE7 A;  3NV0 A;  1VQ5 3;  2OTL 3;  4K1U A;  4QWT A;  2CH9 A;  1B20 A;  1BIR A;  2HMM B;  1W2B 2;  2MF7 A;  1TP6 A;  3CCM 3;  2BHM A;  3CCV 3;  2Q07 A;  3GZY B;  3LYG A;  1OGX A;  1WTH A;  5LC6 A;  5IG4 A;  5IEP A;  1BU4 A;  5KP4 A;  1YHQ 3;  1AV4 A;  1MWU A;  1S5A A;  3ZFZ A;  1BNG A;  1RNB A;  5G1K A;  3AHW A;  1UUG B;  3J7Y d;  1A90 A;  1G0T A;  5CXO A;  8RNT A;  3G8Z A;  3EQQ B;  1GY6 A;  3LOY A;  5CF2 A;  3D5G A;  1IV9 A;  4MJD A;  1T3B A;  1OHS A;  3H51 A;  1A2V A;  1I8V A;  3D9R A;  3BLZ A;  3Q1C A;  1Q40 A;  4FCZ A;  1LVN A;  2C11 A;  1LXE A;  3K0Z A;  1OF5 A;  1PY3 A;  2KAA A;  1Q40 B;  1AY7 A;  2RGQ A;  5KP3 A;  1YJ9 3;  2OQE C;  1B2Z A;  1O7W B;  4AKZ A;  4R9K A;  1BOX A;  1M1X B;  1MWS A;  2W9Q A;  2RCD A;  5D82 A;  4R4K A;  3V92 A;  1B21 A;  4IPB A;  1KD1 4;  2W56 B;  1AVK A;  4K1V A;  5FGO A;  1MGR A;  3GZR A;  1GOU A;  3HK4 A;  4KFF A;  1ZO2 A;  4KFE A;  5ELJ A;  9RNT A;  5IW9 A;  1I70 A;  2P0M A;  1VQ9 3;  4GHO A;  3D79 A;  1V74 A;  1BSB A;  3FG1 A;  1BUQ A;  1O7M B;  1SPU A;  4KZ1 A;  2D1W A;  3LTC A;  1OPY A;  1YGE A;  3UL6 A;  5JPP A;  1CYV A;  2W0Q A;  4O3V A;  2K54 A;  1ROV A;  2ZHX B;  3IMA B;  2QGU A;  2ZA4 A;  1YJW 3;  1JN5 A;  2UUG C;  2QA4 3;  8CHO A;  3WOE B;  1UDI I;  2Z7A A;  4LEH A;  3S27 A;  5FW5 A;  2OTJ 3;  4EYC A;  3PXM A;  1C7H A;  2CFD A;  1LRA A;  3JUN A;  3F40 A;  1A67 A;  1M1K 4;  4J9A A;  4ZM8 A;  1UCL A;  2CX1 A;  1E3R A;  3MG1 A;  2RBI A;  2XGL A;  3B8L A;  1FZU A;  2F5W A;  3KKG A;  3AGO A;  4HM2 B;  1I0X A;  5ELU A;  3SOA A;  1X1X A;  1EEJ A;  2IYJ A;  3HOH A;  4N6V 0;  1ROA A;  4XM4 A;  1CEW I;  1YGW A;  1UI8 A;  1B2X A;  1O7N B;  3GZX B;  3NM7 A;  4LGQ A;  1N5P A;  3FH1 A;  4FMB A;  2I9W A;  3X42 A;  1IVU A;  1D6Z A;  3F8X A;  3KZT A;  1FGO A;  2ML5 A;  3D5I A;  1JN5 B;  3T8U A;  4TX4 A;  3HII A;  1K73 4;  5TGN A;  5LC7 A;  4HBR A;  1QAF A;  1PU4 A;  2WGQ A;  5JPU A;  4Q53 A;  3SVA A;  3SYU A;  1K8A 4;  5IF6 A;  1UUW B;  2Z76 A;  4HVN A;  3X40 A;  1S72 3;  3EB8 A;  5AYS C;  2RNT A;  3ZG5 A;  4WWU C;  1LQM B;  2SAR A;  4N3V A;  1M90 4;  3DGM A;  4CJN A;  1VQP 3;  1B27 A;  3X3X A;  1GD3 A;  2WOH A;  1GYB A;  1LQG C;  1RN7 A;  1SQW A;  2F4Y A;  3KCH A;  1DVD A;  1ZX2 A;  4RNY A;  1TU5 A;  1RGF A;  4HM3 B;  2HML B;  3RGR A;  2CW9 A;  2FXT A;  2GU3 A;  1LOW A;  3PS8 A;  1IDP A;  1MNL A;  3DGO A;  2KF5 A;  1O7G B;  1VQO 3;  1VQ6 3;  3K63 A;  3T0U A;  4I4K A;  1RGE A;  3DGY A;  1QAL A;  3N9H A;  1GMQ A;  4HM8 B;  1JV2 B;  6GSP A;  5BXQ A;  3ECF A;  4WYK A;  5IEO A;  2O3O A;  2M7O A;  3CNM A;  1GMR A;  3FKA A;  3PCR A;  3CPO A;  4MMY B;  5AYR B;  3S29 A;  3G6E 3;  1C54 A;  4NPB A;  3T8N A;  1K41 A;  4LSO A;  1RTU A;  1RCK A;  2YFL B;  2J8X B;  4OUQ A;  5AIH A;  1BNS A;  4WP5 A;  1UGH I;  4K61 A;  5M19 A;  3EN8 A;  3FSD A;  5JBS A;  3PZW A;  1W5Z A;  1Q7H A;  2WGO A;  3STD A;  2CG0 A;  1AQZ A;  2YX9 A;  1BSE A;  1TUH A;  3URP A;  3NHX A;  3OWY A;  7RNT A;  1RGA A;  1BSA A;  1JBS A;  1L5G B;  4BTW A;  1W6Y A;  1DMM A;  1FGT A;  4HYZ A;  2GBX B;  4J8T A;  1RJO A;  5AEW B;  2IUJ A;  3ER7 A;  3SXX A;  3FF2 A;  3MSO A;  4G1M B;  4L8O A;  3G16 A;  3CME 3;  1OHO A;  1W00 A;  3MG2 A;  3NX0 A;  3TDG A;  1BRI A;  1I3I A;  1WMN A;  2HMN B;  2GU1 A;  1VQK 3;  3V99 A;  1UCK A;  1IK3 A;  4HM4 B;  1VQ8 3;  3GAX A;  5CK6 A;  2GBW B;  3ZG0 A;  5HOH A;  2P09 A;  5EQL A;  1US1 A;  1FGM A;  3CU3 A;  3VF1 A;  1N9E A;  1RSN A;  2HMJ B;  1MWR A;  4RNT A;  4XBX A;  1IU7 A;  1W4N A;  3DH2 A;  4H61 A;  1BNE A;  4LMI A;  3NBR A;  2Y74 A;  4I5Q A;  3CCE 3;  1YVS A;  3GRD A;  2WOF A;  4HAA A;  3OW2 2;  3CD6 3;  2BMQ B;  1I2E A;  4BTX A;  3HZP A;  3DY5 A;  1LOY A;  1Y4K A;  3GSP A;  2LQV A; 
#chains in the Genus database with same CATH homology
 1NU3 A;  3G4S 3;  1D6Y A;  4HM6 B;  2CC3 A;  4XDV A;  5AIG A;  4HZB B;  1QMA A;  1NDO B;  3BND A;  3E99 A;  3GWR A;  3CMA 3;  2P05 A;  3LML A;  2MC8 A;  2E2V A;  4O2H A;  3SX1 A;  2BO9 B;  4X2H A;  3KFQ C;  4AEQ A;  4BTY A;  2QIY A;  4IT7 A;  2W2C A;  1WMP A;  1SIH A;  3G0K A;  4N6N B;  3CXC 2;  4L7K A;  1VZZ A;  2INX A;  1SJW A;  4R9L A;  4JRF A;  4XDW A;  4MMX B;  3MYT A;  5D83 A;  3JUQ A;  4WYK B;  2W03 A;  3FGY A;  2SBL A;  1Z1S A;  1PFP A;  2Z77 A;  3CCR 3;  1HU9 A;  1W6G A;  2JQ5 A;  5AEU B;  1Q86 4;  1A2K A;  4KVH A;  3CC7 3;  3F7S A;  4EXR A;  1O7H B;  5G2G A;  2GXF A;  1KQS 2;  1N5H A;  4O02 B;  3Q2P A;  1D6U A;  1YIT 3;  2GEX A;  2YFJ B;  3CCQ 3;  1R4C A;  3G71 3;  1OUN A;  1K9M 4;  4OK0 A;  3QK9 A;  1YIJ 3;  1FGQ A;  4EBG A;  3EE1 A;  3SOY A;  2FNQ A;  1K28 A;  3B7C A;  1YJN 3;  3PCS A;  1M9G A;  2STD A;  2CK3 H;  3V98 A;  3EJV A;  4N6O B;  3LXU X;  1GY5 A;  3D3L A;  3BNC A;  2HMO B;  1EQK A;  1LOX A;  3DZL A;  3FF0 A;  5AIF A;  4HM7 B;  3LT8 A;  3MHE A;  2OWP A;  1AVL A;  1ULJ B;  2CIU A;  2P38 A;  4HJL B;  5DRE A;  3X3Z A;  1JNQ A;  5I97 A;  4JF8 A;  5STD A;  1IQY A;  3GZB A;  3I56 3;  3DUK A;  2F86 B;  5KP1 A;  5DRV A;  5D81 A;  2C10 A;  1CYU A;  3S67 A;  1IQ8 A;  3CNX A;  5IG5 A;  1VQL 3;  1KC8 4;  3L0R A;  1IVW A;  1IT7 A;  1E3V A;  4MMZ B;  3DM8 A;  2CFG A;  4N6U A;  4X2O A;  1QJG A;  2QEX 3;  4LZI A;  3EC9 A;  1VQ7 3;  2HMK B;  3BNE A;  5CLK A;  2CG1 A;  2V1L A;  3CCS 3;  4H3U A;  2D42 A;  2XH9 A;  6STD A;  2P0X A;  3HIG A;  1OHP A;  4N6T A;  3WOD G;  4NRE A;  5A0O B;  3NBJ A;  3NM2 A;  3EF8 A;  4N6L A;  3FLJ A;  4R1K A;  2PNC A;  3FZW A;  1E97 A;  3AMO A;  4U13 A;  1WQL B;  3SLU A;  1STF I;  2BMR B;  2CFK A;  3WDG B;  1OCV A;  2OQE A;  2B1X B;  1JKG B;  1IT8 A;  1HKX A;  3MWZ A;  2B24 B;  3LTA A;  3OWU A;  1F8N A;  4FMC A;  3B4O A;  3JUO A;  4XBT A;  1DMN A;  2CWT A;  1SII A;  2GEY A;  3NQY A;  1GD4 A;  3JUM A;  1TIJ A;  4L8P A;  1RRL A;  2KXG A;  1TFK A;  1RRH A;  4GB5 A;  4FMD A;  3BB9 A;  5AII A;  3EN1 B;  4FMA A;  5IER A;  2Y73 A;  1JRQ A;  2XEP A;  1UW1 A;  3X3Y A;  3S5C A;  4FCM A;  1U8C B;  1IVV A;  4EV5 A;  3OXA A;  1ASK A;  1U5O A;  4N6M A;  3CCL 3;  3N54 B;  4EC6 A;  2CFW A;  1W2Z A;  2KRT A;  3FCS B;  3JVC A;  4RZM A;  4AKY A;  3AMO B;  1NWW A;  1YI2 3;  1ISK A;  4PEJ A;  5AI1 A;  1GS3 A;  1FA3 A;  1NO3 A;  2CWU A;  2ZDJ A;  3LH4 A;  3NUV A;  2W6J H;  4OVM A;  1N9J A;  4FCJ A;  1DYU A;  5EVH A;  1RKY A;  3DMC A;  2YFI B;  3LT9 A;  3I55 3;  2XR8 B;  2WO0 A;  4HM5 B;  2Z6B A;  3MG3 A;  4IIA A;  3IJE B;  5BVB A;  3WA2 X;  4XBY A;  3SED A;  5CF1 A;  4CDL A;  1NB3 I;  1J2B A;  1N8Q A;  1N8R 4;  1GY7 A;  1CQS A;  1JJ2 2;  4STD A;  1YVB I;  2E2U A;  4RBN A;  3F8H A;  3PGB A;  2K0M A;  3F14 A;  3JUP A;  1VQ4 3;  3UNL A;  1G96 A;  4MEI A;  5IEN A;  1QVF 2;  1VQN 3;  3S28 A;  3IPT A;  2F99 A;  2IA7 A;  2OOV C;  3QRD A;  5IG0 A;  4NHF A;  2KCD A;  3CCJ 3;  2RSX A;  3U97 A;  5EEO A;  3CPW 2;  1OAC A;  1WMO A;  2BMO B;  4K90 B;  3UJM A;  2ML6 A;  2XGN A;  3DGL A;  1VQM 3;  2LYX A;  1Q7Y 4;  2O9U X;  1JB2 A;  2XSO B;  3I0Y A;  3K9M C;  4HKV B;  5HGR A;  3K7C A;  3NV0 B;  1STD A;  3N8B A;  3H3H A;  3LTB A;  1JB4 A;  2A15 A;  3LTD A;  3UB1 A;  1KWI A;  1IVX A;  2W04 A;  2CFL A;  2L4V A;  1EA2 A;  2OOV A;  4EV2 A;  3U1W A;  3DGN A;  1Q82 4;  4HZ9 B;  3M8C A;  2BT3 A;  2F98 A;  3EX9 A;  1Q42 A;  1OH0 A;  2XFT A;  1IV7 A;  2W56 A;  3RDE A;  3CC4 3;  2JDI H;  1FGR A;  3EBY A;  2PZV A;  2OCT A;  2CKF B;  3HI7 A;  3OX9 A;  3NXJ A;  3PYJ A;  3K5T A;  2IMJ A;  1FUW A;  2XSH B;  3NBB A;  1WNH A;  4XB5 A;  4WFO A;  3DXO A;  5IG3 A;  3BNB A;  1JB5 A;  1DVC A;  4R80 A;  3RGA A;  3F7X A;  4WHA A;  3CC2 3;  3CCU 3;  2W9P A;  2CHC A;  2ZL8 A;  1NB5 I;  3VSY A;  1MOL A;  3MKI A;  2BNG A;  3OWS A;  2IUK A;  3KSE D;  3X41 A;  1UI7 A;  4HM1 B;  1DMQ A;  1W01 A;  2R4I A;  4ORL A;  1JKG A;  3B4P A;  3LZA A;  3F9S A;  3HX8 A;  1TFO A;  3FG4 A;  3KII A;  4O8S A;  1KSI A;  2FGT A;  1T5Y A;  3FG3 A;  3ROB A;  1EKM A;  3WA3 A;  3ALA A;  3A76 A;  3KSP A;  4CCV A;  4RNZ A;  2CWV A;  3KN4 A;  3VGN A;  1NJI 4;  2XFS A;  3NQZ A;  1W7C A;  1EG9 B;  2XF3 A;  7STD A;  1IQX A;  1OGZ A;  1ULI B;  1W02 A;  2E2T A;  3WOF B;  1O7P B;  1W6C A;  3UL5 A;  1Q81 4;  1QAK A;  1AR0 A;  4HM0 B;  2XRX B;  1QVG 2;  3Q90 A;  1UUV B;  2UX0 A;  3MPH A;  1LNH A;  3WMD A;  2RFR A;  3OV4 A;  4KFD A;  1OF5 B;  3EBT A;  3O8Y A;  4GL6 A;  4FR9 A;  3EHC A;  3KE7 A;  1VQ5 3;  3NV0 A;  2OTL 3;  4K1U A;  4QWT A;  2CH9 A;  2HMM B;  1W2B 2;  2MF7 A;  1TP6 A;  3CCM 3;  2BHM A;  3CCV 3;  2Q07 A;  3GZY B;  3LYG A;  1OGX A;  1WTH A;  5LC6 A;  5IG4 A;  5IEP A;  5KP4 A;  1YHQ 3;  1AV4 A;  1S5A A;  3J7Y d;  1A90 A;  5CXO A;  3G8Z A;  3EQQ B;  1GY6 A;  3LOY A;  5CF2 A;  1IV9 A;  4MJD A;  1OHS A;  3H51 A;  1A2V A;  3D9R A;  3BLZ A;  3Q1C A;  1Q40 A;  4FCZ A;  1LVN A;  2C11 A;  1LXE A;  3K0Z A;  1OF5 A;  1Q40 B;  2RGQ A;  5KP3 A;  1YJ9 3;  2OQE C;  1O7W B;  4AKZ A;  4R9K A;  1M1X B;  2W9Q A;  2RCD A;  5D82 A;  4R4K A;  3V92 A;  4IPB A;  1KD1 4;  2W56 B;  1AVK A;  4K1V A;  5FGO A;  3GZR A;  3HK4 A;  4KFF A;  1ZO2 A;  4KFE A;  5ELJ A;  5IW9 A;  1VQ9 3;  2P0M A;  1V74 A;  1BUQ A;  3FG1 A;  1O7M B;  1SPU A;  4KZ1 A;  2D1W A;  3LTC A;  1OPY A;  1YGE A;  3UL6 A;  5JPP A;  1CYV A;  2W0Q A;  4O3V A;  2K54 A;  1ROV A;  3IMA B;  2QGU A;  1YJW 3;  1JN5 A;  2QA4 3;  8CHO A;  3WOE B;  4LEH A;  2Z7A A;  3S27 A;  5FW5 A;  2OTJ 3;  4EYC A;  3PXM A;  1C7H A;  2CFD A;  3JUN A;  3F40 A;  1A67 A;  1M1K 4;  4J9A A;  4ZM8 A;  1E3R A;  3MG1 A;  2XGL A;  3B8L A;  3KKG A;  4HM2 B;  5ELU A;  3SOA A;  4XM4 A;  4N6V 0;  1ROA A;  1CEW I;  1UI8 A;  1O7N B;  3GZX B;  3NM7 A;  4LGQ A;  1N5P A;  3FH1 A;  4FMB A;  2I9W A;  3X42 A;  1IVU A;  1D6Z A;  3F8X A;  3KZT A;  1FGO A;  2ML5 A;  3T8U A;  1JN5 B;  4TX4 A;  3HII A;  1K73 4;  5TGN A;  5LC7 A;  4HBR A;  1QAF A;  1PU4 A;  2WGQ A;  5JPU A;  4Q53 A;  3SVA A;  1K8A 4;  5IF6 A;  1UUW B;  2Z76 A;  4HVN A;  3X40 A;  1S72 3;  3EB8 A;  5AYS C;  4WWU C;  4N3V A;  1M90 4;  3DGM A;  1VQP 3;  3X3X A;  1GD3 A;  2WOH A;  1GYB A;  1RN7 A;  1SQW A;  1DVD A;  1ZX2 A;  4RNY A;  1TU5 A;  4HM3 B;  2HML B;  3RGR A;  2CW9 A;  2FXT A;  2GU3 A;  3PS8 A;  1IDP A;  1MNL A;  3DGO A;  1O7G B;  1VQO 3;  1VQ6 3;  3K63 A;  3T0U A;  4I4K A;  1QAL A;  3N9H A;  4HM8 B;  1JV2 B;  5BXQ A;  3ECF A;  4WYK A;  5IEO A;  2O3O A;  2M7O A;  3CNM A;  3FKA A;  3PCR A;  3CPO A;  4MMY B;  5AYR B;  3S29 A;  3G6E 3;  3T8N A;  1K41 A;  4LSO A;  5AIH A;  2YFL B;  4OUQ A;  4WP5 A;  4K61 A;  3EN8 A;  3FSD A;  5JBS A;  3PZW A;  1W5Z A;  3STD A;  2WGO A;  2CG0 A;  2YX9 A;  1TUH A;  3NHX A;  3OWY A;  1L5G B;  4BTW A;  1W6Y A;  1DMM A;  1FGT A;  4HYZ A;  2GBX B;  4J8T A;  1RJO A;  5AEW B;  2IUJ A;  3ER7 A;  3SXX A;  3FF2 A;  3MSO A;  4G1M B;  4L8O A;  3G16 A;  3CME 3;  1OHO A;  1W00 A;  3MG2 A;  3NX0 A;  3TDG A;  1WMN A;  2HMN B;  2GU1 A;  1VQK 3;  3V99 A;  1IK3 A;  4HM4 B;  1VQ8 3;  3GAX A;  5CK6 A;  2GBW B;  2P09 A;  5EQL A;  1US1 A;  1FGM A;  3CU3 A;  3VF1 A;  1N9E A;  2HMJ B;  4XBX A;  1IU7 A;  1W4N A;  4H61 A;  4LMI A;  3NBR A;  2Y74 A;  3CCE 3;  3GRD A;  2WOF A;  3OW2 2;  3CD6 3;  2BMQ B;  4BTX A;  3HZP A;  3DY5 A;  1Y4K A;  2LQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...