3CU5A

Crystal structure of a two component transcriptional regulator arac from clostridium phytofermentans isdg
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
130
structure length
124
Chain Sequence
SLRILIVDDEKLTRDGLIANINWKALSFDQIDQADDGINAIQIALKHPPNVLLTDVRMPRMDGIELVDNILKLYPDCSVIFMSGYSDKEYLRAIRYVEKPIDPSEIMDALKQSIQTVLQHQAQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a two component transcriptional regulator AraC from Clostridium phytofermentans ISDg.
rcsb
source organism Clostridium phytofermentans isdg
molecule tags Transcription regulator
molecule keywords Two component transcriptional regulator, AraC family
total genus 35
structure length 124
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3cu5A00
3NNDA 4RV5A 3EJWA 3ROFA 4MQEA 3EQ2A 4HYEA 3CLKA 1DBQA 2WJWA 3M9WA 2LP4Y 4YLEA 3N6VA 4P1ZA 4RXTA 3LOPA 3A3KA 5EWMB 1K68A 4MYRA 1U2PA 1QO0A 2L18A 3LUFA 5BQ3A 3Q7TA 4ETNA 3RVLA 4ETIA 4W5RA 3E61A 2E4ZA 4RK0A 3A0RB 1Z2EA 1NY5A 4YO7A 3OM0A 4WWHA 3FMVA 5DLEA 1PEAA 4WXMA 1ZESA 3LMKA 3OMXA 3SG0A 1AB5A 5KWSA 1A04A 3RVMA 4KVFA 1QNLA 2PMCA 3DGFC 4QYMA 2PUFA 4MGEA 1GUBA 2H3HA 4Z4GA 3JY6A 3RVKA 1BDIA 3LKVA 5HSGA 3NHMA 2LPMA 1ZAYA 3GBVA 5B3JC 5TPWA 3HJFA 2I6FA 1SXHA 2BGGA 2QU7A 3MF4A 5IUNC 1BA2A 1LJLA 4S04A 4XASA 4RS3A 1TM2A 3HDVA 4EYGA 4KMRA 3RVQA 4Z4HA 2FLWA 2GBPA 1U0SY 1A2OA 3IPCA 3QLTA 2M98A 3OLYA 5KC8A 4FE7A 4MQEB 1Z16A 1JHZA 3LUDA 4Q6BA 3CZCA 1KMIY 2FLKA 3NNSA 5TE9A 3D02A 4WUTA 2MYUA 4RSMA 1OXKB 5IULC 3KJXA 2AYZA 3HEBA 2FEPA 3UUGA 2FVYA 2CHEA 3W9SA 3M9XA 1LBIA 4W5TA 1JFSA 3IDOA 4S05A 4YWHA 1PNRA 1E6KA 4IGAA 4PE5B 3QLUC 4KQCA 3IP6A 1EHCA 1HEYA 3KKEA 3EAFA 3SY8A 3GWGA 2QVGA 3IP7A 4MS4A 3C6QA 5JNSA 3O2JA 1LJUA 1YK1A 2FQXA 4QPJC 1GUDA 1R8JA 5GQSA 4MR8B 2B4AA 4MPTA 4OLAA 2O20A 4WXEA 4MR7B 1QKKA 2FSPA 3MYYA 3QLVA 3L49A 4YCSA 3RVNA 2MYPA 4Z99A 1QPZA 1L5YA 4D6YA 2FW0A 1DG9A 4N0PA 2WY2D 2PUAA 4LDZA 1YS7A 5GOTA 4EVRA 3LTEA 1JDNA 1JDPA 4MR9B 2Q5CA 3DLBA 4F12A 4G0MA 4JASB 2FMKA 4QYWA 1E6LA 4YP9A 3OQOA 1DRKA 1MIHA 5CNJA 1QP7A 2FEWB 2KYRA 3C3WA 3QEMB 1QQBA 3RVJA 1KRXA 4MR7A 3F6PA 4KV7A 2W42A 1Z25A 4O1IA 4YGXB 4Z4EA 1D5WA 4MRMA 1APBA 2YHAA 4H3HB 4N76A 1JBEA 3HZHA 3IP5A 2IPAB 3O2SB 2L19A 3C97A 2FEKA 2PL1A 4DQDA 2VYCA 3HUTA 4P98A 1U8TA 1VLZA 4F8JA 4EVSA 4DADA 2A9RA 3CTPA 5ED4A 2QXYA 1GCGA 2FMIA 1XHFA 2DRIA 4RK4A 3EULA 2VUIB 3H5OA 3Q9SA 4MR8A 2PAFA 4OBBA 1DCFA 5JNWA 4KPYA 1ZH2A 3A0UA 2JBAA 3F6CA 4Z0NA 4OATA 7ABPA 4TLLB 2E4VA 5JNUA 2HQOA 1QO0D 4RK7A 4LRQA 4O1HA 4N47A 2IPMA 1M2FA 2GX6A 2F8TA 3Q7SA 3H5TA 2VUHB 1JFTA 3S99A 5JS1A 4IF4A 5HKOA 3KCNA 4Z9BA 4QICA 3OO1A 3EODA 2JK1A 3LUJA 3JTEA 3B2NA 4ZMSA 4DN6A 3CNBA 4FE4A 4ZYLA 3RVOA 1FFSA 3OLZA 3M6MD 1LK0A 5BR1A 3FFWA 1JLKA 1JYFA 3T8YA 2GKGA 4RK5A 1MB3A 2E4YA 2RDMA 2IPLA 4H3KB 4RZSA 4NCAA 1VKRA 3TX6A 3NBMA 3OQMA 3TD9A 1USGA 2E4WA 3Q41A 1TLFA 5KQPA 4MQFB 2QSJA 2FMFA 3N0WA 8ABPA 5CHYA 1RPJA 2P9HA 4LE2A 5TPZD 1J56A 1DCMA 1BVHA 3H6HA 4TN5A 4LX8A 3CG4A 4RY0A 3N53A 3H1FA 4LDAA 4KQ9A 4RKQA 2PUDA 2A9QA 4F11A 5T3YA 1B00A 1GCAA 1Z18A 1ISSA 5TQ2A 4YV7A 4KNYA 1NXWA 3O1IC 3G85A 3JVDA 4KFCA 4G0YA 1D2AA 3GA5A 4Q6WA 3GV0A 3DLHA 4RU1A 1FSPA 4RKRA 2HSGA 5DTEA 4GNRA 1D4ZA 1P6UA 1RXIA 4F3TA 2LBPA 3IPAA 3L6UA 2PUBA 2OQRA 4OTZA 4IMJB 1FFGA 2JVKA 1ZH4A 5D2CA 3TB6A 2R47A 5TQ2B 2IPNA 3HS3A 5IEJA 1A0OA 1JX6A 4KRFA 2QVCA 1RXEA 3OLWA 3Q15C 2E4XA 1TJYA 1DJMA 1E6MA 1M2EA 3HV2A 3GYBA 3RH0A 1QP0A 1KGSA 3OLVA 3LUHA 3JPWA 2IOYA 1M5TA 2ID9A 4JA2A 5C5EA 3D8UA 3OLXA 6CHYA 3LUGA 3RVPA 1U04A 3I45A 2CHFA 1IIBA 5PNTA 3GT7A 4OG2A 4NV3A 1U2QA 1T34A 5CNMA 3BREA 3C3KA 5KQGA 4XAQA 3IP9A 3MIZA 3SNKA 3P9YA 1Z26A 5IC5A 1QQAA 2B1JA 5BRJA 1P8AA 1MB0A 2FKAA 3A10A 4MAAA 3GRCA 1URPA 3SM9A 2PE5A 4RY8A 5DCLA 3QX8A 4W5OA 4CBVA 2FTKE 3BRSA 2MSKA 3KS9A 1Z17A 4N0QA 3GL9A 1E2BA 1KRWA 4ZJPA 2FN9A 3CU5A 1YS6A 4MS4B 3SQNA 1EWKA 3HUUA 3ILHA 4W5NA 4PYRA 1DC8A 1SXGA 3CHYA 4KK3A 3OQNA 4NCBA 2RGYA 2IDMA 4M88A 5IUJC 2JVJA 1OXBB 2R48A 4O5AA 3H75A 3ROTA 1S8NA 3LUAA 1CHNA 1EFAA 1DBWA 3N75A 3Q7RA 4E7OA 5FBKA 3T38A 3RVSA 1W25A 3MM4A 2PL9A 2RJOA 1DP4A 4HNSA 4FB4A 4G0OA 2VK2A 2WRZA 1TVMA 4LE1A 5EWMA 2HQBA 3JVIA 5JNTA 4L85A 3EQZA 2FQYA 4MRMB 1DZ3A 5EWJA 3UKJA 4WT7A 3O2QB 2J48A 2WMYA 4MLCA 2HPHA 1VPWA 2NUBA 2HJ9A 3N0XA 1ISRA 3TO5A 4OLBA 3CKMA 4JOQA 4GPAA 3F73A 4B09A 5EWLB 4Y9TA 5I4CA 1NATA 3K9CA 1Y1LA 4UHJA 5IBQA 1SRRA 3VNAA 1NXPA 3FDFA 3OMWA 3HM9A 5C5CA 5CNKA 5E3JA 3CZ5A 4RK6A 2P4UA 2RJNA 1YMVA 4EGSA 3KLNA 5TPWB 5IEBA 4D74A 4JP1A 2QV0A 1JH9A 5JNRA 1NXOA 4XFKA 1ZY2A 4IMIB 2QW1A 3QELA 2ZWMA 2WWVD 3QELB 1RZRD 1SD5A 5FWYA 4MS3B 2NZUG 3KLOA 2PJUA 5IX8A 4NQRA 3EDCA 5ABPA 3N8IA 4RWEA 2N9UA 1GLGA 2H0AA 5FWXB 1L5ZA 1P6QA 2YHBA 3BILA 1CYEA 5TPZA 2LIVA 3N0RA 1QMPA 5EWLA 1NXXA 2MSWA 1MAVA 2ID7A 2CD7A 3DZDA 2JCGA 1YVUA 1ZDMA 3H5VA 1YIOA 4MS3A 1EWVA 1F4VA 1EAYA 3DBIA 3MQ4A 3KSMA 4G86A 5KI6A 3FGZA 1D1PA 3H1GA 5FBHA 5TQJA 3QEKA 5FWXA 5F64A 5BRAA 1DRJA 4RY9A 1RNLA 1DBPA 2PLNA 4JB2A 2FN8A 4G0PA 5TQ0A 2R4QA 4G0XA 4PICA 2L17A 2ZAYA 3I5AA 3H5IA 3LKBA 4MQFA 1I3CA 3QLVC 1ZITA 1M5UA 2NT4A 2WJAA 4RK1A 4XLTA 4IILA 3T95A 1DC7A 2FQWA 4YRZA 1JF8A 4E7PA 2XDYA 2HQRA 1CEYA 2FXIA 2OENG 1W9HA 3UK0A 4EYOA 4YR7A 3F7NA 4YS6A 3LFTA 3VNBA 3QEMA 3BRQA 1ZHHA 2MYNA 1VRVA 4XARA 4KREA 5HQJA 4G0QA 1BDHA 1PHRA 4TLMB 2QR3A 5B3JA 3CS3A 3I09A 3KYJB 3O75A 3QLUA 2L2QA 3O1HB 3ILYA 3NHZA 3SAJA 4Q7EA 2WB4A 4Z9AA 2GI4A 4XXHA 2PKXA 4ZMRA 4EYKA 1JYEA 1BAPA 1K66A 3NNNA 3O21A 1D1QA 3MMNA 2GWRA 2PUGA 4MS1B 3E3MA 2MYTA 3HK2A 1NXTA 3OM1A 3HVRA 4MLDA 5TQ0B 5JS2A 2A9PA 4UHKA 1YMUA 1ZGGA 1AB6A 4Z4CA 3H5WA 2F8SA 1XWWA 3T6KA 3RVRA 1PNTA 3QK7A 2MSLA 2CWDA 3C3MA 4LZLA 1ZGZA 3DGEC 2TMYA 1C4WA 2JVIA 2NZVG 3LUKA 1EWTA 1C0EA 1FQWA 5KC9A 2NT3A 1YTUA 1DCKA 1USIA 1FFWA 4JAVC 4RXUA 3KHTA 3KYIB 4MR9A 1ABEA 1H9CA 4D6XA 4PEVA 2JB9A 2X7XA 1Z13A 1P2FA 3GBPA 4F06A 3G1WA 3BBLA 4TMYA 3HDGA 2AYXA 4W5QA 4JB0A 3JPYA 4N41A 1ZN2A 2V0NA 3HCWA 5DGCA 1PUXA 1YK0A 4KZKA 1LBHA 3HSYA 1NXVA 4ZPJA 3H5LA 4EVQA 2PUCA 2M1ZA 4LE0A 2E4UA 3K4HA 1SXIA 5JNVA 4H60A 3FFTA 3LUCA 1PEYA 1WETA 4N03A 3HO1A 1BDJA 1NXSA 5KQLA 4EUKA 3CRNA 2JBAB 4EY3A 4RDCA 1QP4A 3EGCA 1RZRA 3OO0A 4WZZA 3H6GA 1UDRA 3HXMA 3R0JA 4HNRA 3CG0A 5CNIA 2LUOA 4ML3A 1F51E 5HM6A 1ZVVA 3KTOA 1ABFA 1XHEA 2QZJA 3JS5A 1JL3A 4Z4IA 1MVOA 3RQIA 3TMYA 6ABPA 2IKSA 2A9OA 3MA0A 4G97A 1JFVA 3KG2A 3FFXA 5IUKC 3URMA 5KQMA 4Z4FA 4PZ0A 4G0ZA 4EYQA 1Z12A 1USKA 4NICA 2PUEA 2IYNA 5EWJB 5DKFA 3I42A 1JWLA 4KK4A 4IRXA 2R25B 2JRLA 4ETMA 9ABPA 3H1EA 3O1JC 3QX9A 2FMHA 4MS1A 4RXMA 3CFYA 4HNQA 3O74A 4L4UA 1Z15A 1Z2DA 5T7BA 1TMYA 5FWYB 1NTRA
chains in the Genus database with same CATH superfamily
4G5RA 2ZRAA 4FQ5A 1XCBA 5HZHA 5MDHA 3QQPA 5JCJA 4R68A 4M9QA 2WJWA 3CVOA 3RIMA 2BUBA 4RCZA 2V7EA 3NR2A 1B0AA 5CJJA 2BGJA 1C1HA 1MKYA 1OV4A 2XLCA 4UUQA 4NBRA 1DNPA 1ZNZA 2YINC 4B84A 1KOFA 3DMTC 5BYKA 2VDKB 4Z0HO 5BSGA 4J1NA 4BTVA 3C8UA 2TS1A 1IHXA 5FEUA 4WW0A 4LTNA 4OUKX 1TMKA 3R9IA 4YT2A 2VK1A 4E4RA 1QHHB 4V3BA 3ZY3A 3WNCA 1IN1A 5EJFA 4DYHA 3TKLA 4BC0A 3KPWA 4J43A 3PPYA 2TSYB 1DIGA 1JA0A 1GR1A 4DLPA 1D07A 3G8YA 1U4SA 3HI6A 4UUBA 4B9AA 3HJFA 1BTOA 5ER9A 3GRUA 3P1JA 4FFMA 4GOND 3TNFA 3S40A 3JZDA 3DL7A 4ZOAA 4MUIA 5DMHA 3PT9A 3RT1A 4A15A 3LI2A 2RIRA 1VE9A 2XUPA 3PD1A 1U0OC 2RI1A 1XDSA 3T3HA 1GDDA 1L4KA 4OLFA 5FX2A 3RG2A 2O6HA 5CDTA 3UMMA 2FN3A 4LK3A 4ZZ1A 3EPJA 2BAGA 3AR3A 3IUBA 4G5FA 1U6IA 3I6ZA 5CD1A 3WGIA 2AWNA 1R4NB 5IULC 2JD2A 3KJXA 3HEBA 1ADJA 1BMTA 4DLNA 3ELDA 1G5PA 1B8VA 4II3A 3ZIUA 3M9XA 2UZ4A 1UEXC 1JRLA 4X85A 4IG4A 2HWKA 1K2WA 3VR5A 1WULS 4BVGA 1E6KA 3IRVA 2VYNA 4GECA 3WO1A 1DIOB 3FTNA 3KYCA 3VU3A 2LWIA 2BGLA 4JBGA 3EX7C 4LGMA 4R16A 3UOWA 2B8WA 1LV8A 2P1RA 4PYOA 3O2JA 4K3VA 3UTCA 2VT3A 3WRVA 4E6PA 1CT9A 4IWXA 5IDWA 5LFAA 1I3LA 4Y2VA 1E3IA 1MDFA 1YB4A 2O2EA 4BNIA 3EA5A 4KFTA 2RCNA 3KPJA 1IK4A 4MR7B 2X3UA 4PG5A 4TKMA 5LWHA 2FFAA 4LSWA 2Y76A 2C5FA 1O58A 3TEJA 1ESNA 1WXGA 1H5UA 3EYAA 1U4NA 2VP6A 4NXNB 3N7UA 3PDWA 3FDZA 1J21A 2AN5A 4OFXA 5DV9A 4X0EA 3WY9A 4CL0A 3ONDA 3PA8A 1BRMA 4KW7A 1PYOA 1Y81A 4QJBA 1I3NA 4D6PA 5LPNA 3G7UA 2REXB 3I6MA 3TLCA 3FHJA 2UZ0A 4Y2HA 1NW9B 4FZRA 1E6LA 1R4NA 4D9BA 4EUFA 3V1NA 2QX8A 4RWZA 2Q07A 1SQ0A 2IY7A 4BCCA 3PENA 5K6TA 4HFNA 1SUIA 2YFKA 3AFNA 5BURA 3RRYA 4QRHA 2O2XA 4FMPA 1PD0A 1BN6A 3KQLA 5JS7A 3FOAA 3DCJA 1CW2B 4A6PA 3IUNA 5CPFA 6PFKA 1T5TA 1RWOA 2RONA 4B6QA 3M6VA 1J0BA 4WLUA 3B1VA 1K27A 3IIKA 1E3TA 2P5TB 2ZI4A 4OJKA 5FR2A 3IMFA 3EA4A 2ISCA 2O3JA 1LWNA 3AY3A 5E2BA 1RMYA 2PH7A 1LS6A 1WEKA 2HUNA 4WKGA 4DVJA 5DHPA 1QP8A 3IL2A 1FFEA 3QENA 3CTPA 5ED4A 1LFDB 2ZRGA 4EB8A 3G2PA 1GRNA 1C9KA 5TY0A 3SSMA 5TS3A 3KJHA 3DLAA 3O9VA 3T5PA 1QCDA 1WWKA 1FPMA 3F6CA 5ETJA 3B9PA 1QX3A 1VPTA 4TLLB 2RAFA 2VJMB 2Z6VA 3QPBA 5DB4A 5G1OA 4JMPA 1V8DA 2QG4A 1BFUA 2EXXA 3IT3A 4UTOA 1KOLA 1NW4A 2QN7A 4OHZA 2QN6A 3I6BA 4DHWA 1WNTA 4D3YA 1Z5GA 3WYBA 1RABA 5JBIA 1YTLA 3IUQA 1FRVA 5AW0A 4EDFA 3NP9A 1I01A 2Y71A 4E07A 4TSFD 3AEZA 1OLUB 4Z54A 3KCNA 4WI1A 1PQUA 2RGCA 1R00A 4OPMA 3ZS9A 1RJEA 4B6EA 1NVDA 2ERCA 1GPJA 4TMFA 4OREX 1I0LA 5GADl 1O4VA 4UDXX 2WIBA 3KOYA 1EFDN 2OCPA 1H69A 1ADYA 1O95D 1KDRA 2R8XA 2VLIA 1EDDA 2B36A 2V03A 2XWJI 4M1SA 1OY1A 4U2KA 5B57C 1CUZA 4XD7D 3LO8A 1Z4NA 3UT6A 5KYXA 2RDMA 1OE0A 3QA9A 2DFTA 2JH8A 1W73A 5IT4A 3PIIA 3B48A 4MVWA 3QFHA 4NCNA 3TD9A 2R8BA 3I1YA 1USGA 1UT5A 4OUDB 2I3GA 4MULA 4XDYA 5DT2A 5KYWA 3Q41A 4Q1DA 3MBKA 1UBKS 2R86A 1MIOB 4EJSA 4GX5A 8ABPA 3IEIA 4N1AA 3VV2A 4BFLA 5DXFA 1U1EA 2DBVO 4OU5A 4PINA 4AMBA 5DNYB 4LE2A 5BN5B 1JSXA 2J08A 2WKQA 3KZMA 4LBWA 4OHFA 4O4JA 3CW8X 1Z35A 3EIUA 1R9MA 3P32A 5KAMA 4S1OA 1Y5RA 4OB6A 3VJMA 5IF3A 5JARA 2PUDA 1WPRA 3DL2A 3U9SA 5KYWB 4R0VA 4TM7A 3SIWA 4LXHA 1H9BA 3EB9A 1NXWA 1P3DA 3G1UA 2NWQA 3O1IC 3Q9UA 4Q3KA 1ULZA 4MQLA 1A50B 4WJZA 3TZEA 4DDHA 3K6SB 3T7RA 3N39C 3LSYA 4LBZA 4W9RA 3UV6A 4B6JA 1QGED 5KOHA 4RL6A 5IXSA 1FNDA 3G13A 4E5DA 4XSGA 5AK0A 2RGXA 1R0KA 3HY6A 2HRRA 3D7MA 4LKRA 4NG5A 2XWBF 2QT1A 1O97D 3A58B 4I50A 2ATVA 3C1OA 1CERA 1K08A 3BHMA 4TMZA 3WYAA 4ASUA 3M1LA 4KU4A 5A2QA 5CFLA 2ZB2A 4GSLA 5AJVB 1JALA 1H2FA 3ANSA 4G84A 4PCVA 4AJ1A 3THXB 3Q2IA 4PBRA 1IONA 4G5XA 4IGKA 1ZJJA 3CPSA 4JA2A 5AQ1A 2NTVA 1JHOA 4K9KA 5IW8A 1U04A 3REFA 3WDMA 4L4ZA 2EKBA 1K7YA 1U2QA 4TRMA 4B76A 3HBNA 2F1RA 3GGDA 5BSKA 2GZRA 5DCYA 3P9YA 1Z26A 1DC3A 2JI6A 1SEVA 1IN7A 5C4GB 4AJKA 1IXSB 2FWMX 2X86A 5B64A 2EFCB 1ORWA 1FRZA 4O8CA 4C78A 2PSSA 1EU1A 1TDJA 4IMPA 4A3SA 5A4DA 2A86A 1IXRC 2RGAA 3OFJA 3PE4A 2H7YA 4YC7A 3CU5A 3AG6A 2I7XA 4PY2A 1TXGA 2XMSA 5JAQA 4DIFA 4EG6A 2HFKA 1FBNA 4KUHA 4LY3A 4RH3A 2AI2A 2PO5A 4ZARA 2YR0A 3RYTC 4GM4A 4CCWA 4K0KB 1OPXA 3CLRD 3DYBA 3P26A 1B23P 4AWAA 2WTXA 2NZJA 3TL3A 4BDSA 4F45A 4M88A 3GUUA 2O0JA 4X90A 4ZOLF 1UBJS 1II0A 3H75A 3U1TA 1DVRA 4MW1A 2D0OB 1S8NA 3T52A 5CJ2A 3W0LB 3UMCA 2R6JA 1U7ZA 3VKFA 3DBOB 4Y9RA 1EDBA 4G41A 4PW0A 4MHTA 1N6NA 3N2GB 3P97A 1W25A 4K1XA 4D3DA 1W0JD 1XVVA 1HV8A 2AN1A 2PL9A 1NZDA 3GJ0A 4QVKA 3WWPA 2BM9A 2XQVA 4DR3B 2WRZA 4PAMA 2I9KA 5JNTA 4DR5B 3E3NA 1T4DA 1N5KA 1GNLA 1GRCA 1S4QA 2YDYA 3HL4A 4X3CA 2KM1A 2C04A 2J3LA 4XFJA 4GWKA 5F23A 1QK3A 1VZ2A 3LDUA 2WIAA 3W6OA 4BQOA 1QV9A 2ZRDA 3ORHA 4ZTBA 1YS9A 3TLMA 3ZBTA 5I4KA 5IC6A 3M9LA 5AW9A 3SK0A 1S6YA 4UOQA 4KKVA 5GY7A 3S0JA 3RVBA 4LWZA 2GYWA 5AW6A 2ZUDA 4RVGA 4R98A 3PNSA 4ZVLA 2X2FA 1X94A 4HH3C 3TLKA 1WMDA 3U9LA 5C5CA 3E9DA 1JDBB 2BGUA 2CYCA 2P4UA 4J0DA 2PLWA 3R3YA 1CQIA 1N6PA 2WSBA 4HRVA 1VRWA 3ZKWA 3TXYA 2I7TA 2Q3CA 3ZI7A 2HU2A 4C7JA 3ZE2B 1V8ZA 2GXQA 3CJRA 2QI9F 2P77A 4RDHA 4X5OA 4YASA 1M6HA 2CVFA 3AETA 4Y8VA 4BNFA 3GJYA 4UAGA 3STXA 3A2KA 3ROZA 2GILA 3DMFA 2GM5A 1K5HA 2DHCA 2XIQA 1P7PA 3DZIA 2GJKA 4FEYA 4HWKA 5LYJB 3DMDA 4E94A 4Z1OA 3DE6X 4DWJA 1WHTA 3KV3O 1XJ0A 4DIDA 1A9XA 4F4HA 2CKDA 1Y3IA 1JKIA 1YIOA 3EAQA 3WOHA 4ZHQB 4QM7A 3LCVB 4PU0A 2JLZA 1IEXA 3IS3A 1FL9A 3GNSA 5ICGA 2Z1DA 3TQSA 2O07A 3H1GA 2G80A 4QUIA 3W90A 2OCDA 3TQHA 3TYXA 5DEIA 3DWGA 5AJTA 2ZBEA 4LY0A 5JALA 3A1TA 4WIAA 4HNAB 5K4HA 5TF0A 2NZWA 4RESA 1OLXA 2VRCA 2PX0A 2Z2KA 3EZFA 3PC8A 4MRVA 1EUCB 1R6BX 4P86A 1O94A 3CH4B 2O2CA 3S8EA 4MJ3A 3RNOA 1F8UA 1OJ7A 2CMDA 2H29A 4P92A 5J59A 3OCYA 1ZYUA 3DVQX 2CUTA 1UBHS 1OTYA 3KPUA 4PGMA 3VPHA 3JALA 3FYHA 3E7WA 2FR0A 4DNPA 3AHJA 3H6KA 4Z0TA 3VVMA 4O5OA 3OM8A 1N1EA 4DJDC 4O4JB 1TYDE 3ZDRA 1LK7A 3HU5A 2ZFUA 4EW3A 2W58A 2CL0X 3TQFA 1VJDA 3CWZA 1ZBDA 4OAPA 2I91A 5IU6A 2C96A 2BRUC 1DELA 4L8VA 1UKAA 5EHNA 1TADA 1BE8A 1B7GO 5ITZB 3SJAA 3EPRA 4RC9A 5EEGA 3OY7A 2XCTB 5B3JA 4PTZA 5LB2A 3GCZA 3QLUA 5CB4A 2ADFA 4HLCA 2GARA 1WVIA 2XF2A 3F6YA 2ZYSA 4Q7EA 3RSCA 4Z9AA 2N75A 1JHPA 5IAOA 5L45A 3ER8A 4TMXA 2ZUUA 2E2WA 3L1IA 1E3QA 1NP6A 5LQUA 1D1QA 1HLFA 5A7HA 2GWRA 3PC8C 3FUWA 4M8IA 1A72A 1M6VB 2E48A 4Y6RA 1LJ8A 2EJWA 3TCNA 2Y8EA 4HAZA 4I4TB 3BGSA 1L5HA 2WA1A 2V7QA 3A1EA 3DE7X 2BMAA 1OW3B 3B1XA 3CEPB 1GZ5A 2JFZA 3GGSA 3H2KA 3LSTA 8MHTA 1JDUA 4M89A 5LZ8A 3T1NA 3OIFA 1PNTA 2R68A 4L1KA 3NH6A 4Q4HA 5BN4A 2QTVA 3PNOA 4U7TB 3ET4A 2R44A 3HBFA 5DULA 3WJ1A 1H3EA 4X97A 4K87A 3NVMB 3OZXA 1DCKA 3STUA 3WQSB 4XM1A 4JAVC 2R4TA 5CHEA 4F97A 1H6CA 1VL6A 2G1UA 3BCUA 3OPYI 2IY9A 1L1RA 1FNSA 4FD2A 4J9VA 3TTXA 5HJ5A 3QVJA 1U31A 4MB2A 4A0RA 4D6XA 1FC0A 4G0VA 4XJVA 2G9QA 3TB4A 3DPIA 5D87A 1E2IA 4DV1B 2B2CA 4EHLA 5BUQA 2F7SA 5E1BA 2CZQA 1QF7A 3Q9NA 2ZETA 3W3AA 3TSOA 4Q7JB 3LQYA 4GI7A 4UASA 5PGMA 3KUXA 3SKVA 3R7WB 1WETA 2HXGA 4P7FA 1QK4A 1SKAA 5KJ1A 2AGVA 3C41J 1L5HB 4I4TA 3PC2A 4BBAA 4IX1A 2FZKA 4QJ5A 3AVUA 4EUKA 5MF6A 3ACCA 1QU3A 4U63A 3CRNA 4UZEA 4K2HA 5I7AA 3F8WA 3ENNA 4L4YA 3D7LA 3SIXA 3L1KA 3K73O 1SK9A 3SR4A 3SFZA 1J5XA 3NPAA 2NV0A 2FF7A 1OXTA 2IU4A 3HLKA 4CMCA 1XYVA 2PGAA 1XB2A 2A0FA 1U0EA 3C3PA 2JHPA 3HJGA 3K6JA 4FZVA 4HLUA 4HLNA 3W06A 4M1TA 3PQ6A 3WL7A 4Z4IA 1MVOA 3GIWA 1I7QB 2X0RA 1NV8A 1WD7A 2P90A 4OOFA 2GCEA 4KH0A 3E9ZA 5DI3A 2XKAA 4QEZA 4PZ0A 3E7PA 3A6KA 4LYYA 1JZQA 1R6DA 2V6BA 1G3UA 1RPTA 3SHWA 5A3VA 2HU8A 3NONA 3ZLUA 3Q0EA 3I5YA 1JHQA 1YQDA 3H18A 4JX9A 5H82A 4F2HA 2TRSB 3VZRA 2R25B 1IM2A 1DXHA 1BE1A 2FUNB 2QP4A 1WCXA 1E5DA 2V6GA 3CTMA 3EIQA 3L7MA 3NHPA 4H7PA 3PDIB 4YFVA 4YAGA 5JNLA 1PR9A 2Z04A 3PGA1 1US8B 4DC0A 1E99A 4ZI3A 3PT5A 3PC4A 4HGNA 3BH7A 4I4TF 1EXNA 1W46A 2GN1A 2QXUA 1E2LA 4F6LA 1KJWA 4X54A 1NVFA 1JHUA 3JWEA 3ZUPA 1XMPA 4BO1A 2P65A 5I5EA 3BTVA 3RFCA 1XTUA 4CKBA 4OKSA 1W8DA 4RXTA 1Q1NA 2AX3A 2FZ5A 3CLSD 3KKQA 3LOPA 1A88A 3MUOA 4Q1EA 3D64A 3PXXA 1RQXA 1K7EB 2V96A 3O91A 2PLAA 1XCOA 1OIXA 2WF9A 3QKIA 4O0MA 4Y0NA 3Q3HA 5EIBC 1O1YA 2X23A 1EP1B 4K9NA 3SIRA 3SS9X 3WLAA 4QOJA 4GAEA 4LA4A 2E4ZA 3Q98A 4REOA 2W4IA 1Z2EA 2JEOA 4DDTA 3E23A 4KE9A 3P9RA 4EGCB 5C81A 4QGGA 3I8SA 1XOIA 3H4IA 4ZTZB 5A0TA 1AB5A 4B40A 3KB6A 1A04A 1F0NA 2WSLA 4YECA 1XRRA 5ANRB 3PWTA 2FWPA 4OM8A 1I0ZA 3WWEA 2RH9B 1C8LA 2XSZD 3PDJA 2WD9A 4V0NA 2V7WA 3S2SA 3WP1B 1NFQA 1ZIOA 3MSCA 5IVHA 4CM3A 4EMTA 2PQ2A 2C94A 2I4TA 3PHIA 4KX5A 1VHQA 4M1MA 3SZMA 3LF2A 1WUJS 4YBZA 3UMFA 3B53X 1JE0A 3G7SA 3BWYA 5F51A 3UK1A 3AG5A 2NUTB 3NAZA 1TC1A 4RS3A 3M4XA 1RE0A 1TRHA 4BKOA 4DCTA 3CUSA 1W36D 4F86A 1XU9A 4YCBA 2W5UA 2IEBA 3ZZ0A 5BP7A 4LF6B 2XQGA 2ZKIA 3OLYA 3F2VA 4ZCMA 1XK6A 2OT3B 2EARA 3LWZA 4P3KA 2DUMA 3IHLA 4ADSG 3BE8A 2CFCA 2QJRA 1DHTA 1MH9A 4PHCA 4YO8A 4OXYA 4N3CA 2JLWA 1ZC3A 2UXBB 3P2MA 4E15A 1E5QA 2C42A 4LYHA 4I6JA 3WL4A 3UOAB 4R5HA 2NN3C 2WFLB 1CUYA 2VPTA 1K5DA 2FVYA 2XCUA 3CLSC 3E4DA 2H2AA 5JSZA 2YWHA 2JIDA 3D2AA 2CHUA 4PC3A 2G8NA 2Q0SA 2X13A 2FE4A 4M0CA 5YASA 3I0MA 1QG4A 4FFOA 1RC1A 4JX8A 4QT4A 4S05A 2HWXA 5EOVA 3Q2KA 2ZIFA 2RHJA 1EHCA 3JATB 4AP9A 1JFRA 2AE1A 4CDGA 1UWKA 1DV1A 4EELA 2AXEA 5I4BA 3ZK8A 4HH0A 5JNSA 1G20E 1EG2A 3N28A 2FHSA 2CL6X 2QF7A 4DCOA 5CK4A 2Q41A 2IWHA 3X1ZA 4OLAA 1NV9A 4XQEA 2HWYA 4DLSA 2X8WA 1G291 3JQGB 1ZNYA 1LK5A 1VSVA 1LKZA 2NYRA 4NAHA 4X94A 1SOUA 1NC1A 4WBNA 3TJMA 5NLLA 3GMTA 2DQYA 1QPZA 1GAWA 1E0AA 3KJFA 1W9MA 5KZMB 2OZVA 5LU9A 2PUAA 5BWMA 3MG9A 5GOTA 3LY7A 4BUJA 3RYIA 5B1HA 4P82A 3MHPA 1H8ED 4DIMA 1ZM3A 5JFOA 1UDBA 4JELA 1ECFA 1BQ3A 2O7RA 5FOQA 2TMGA 1KZ7B 1U3CA 2QD3A 2HF9A 1UPFA 3QUQA 5IN5A 3HHPA 4RVSA 3W8NA 3PG5A 3ZE9A 1XQ1A 4CKYA 1IJBA 3GCGA 5ES4B 2XHZA 4YMSA 5DX8A 4ZEWA 4KHZA 1UBUS 4ZAWA 2JAOA 2O7QA 2WWRA 5J4KA 2XGMA 4BQFA 2BJHA 5JYBA 4HCJA 4KLNA 1CF4A 2QYOA 1XX6A 1KF0A 1PGPA 4HRYA 4FFSA 1UK7A 1VPLA 3NIGB 4UUPA 2A3RA 5TMBA 1VJGA 3ONEA 1Z73A 5BSTA 3PUWA 4DB4A 2P5UA 3CRVA 1SKQA 1PX2A 2VYCA 3HUTA 3KJIA 3LCCA 3ZBPA 5TVGA 4CKCA 2ECFA 3ZGOA 2XTNA 4BJ1A 5K3CA 3ZHVA 3W2IA 4M7RA 1BD3A 3BZUA 2R60A 1ZISA 2IC5A 2ORIA 3PR3A 3RSSA 1N2SA 2BKUA 3KT0A 1DCFA 3L6CA 1IHPA 4RQAA 5DGXA 3T12A 4JDUA 3RRXA 1IRIA 4RADA 1ZIDA 5HOEA 4GRDA 4QHSA 3VFDA 1ZOSA 2AF4C 1CY1A 2PZMA 4UTZA 5C5DA 2QTWB 3DO5A 4YMUA 1K4MA 2J5KA 3FNQA 1EFHA 2IPMA 3NXSA 4LK2A 4N47A 4DCPA 3PP8A 5JUWA 2AXPA 2W93A 1I51A 4WX2B 3H5TA 2AFHB 1R10A 3BMNA 4U7GA 2QX4A 1QB7A 4URHA 5EP2A 2RB5A 1T91A 3X1WA 4CMKA 4YAKA 4AY6A 2B4YA 2ZTSA 3HKBB 3GJ3A 2QRNA 4M8NE 4PCUA 4WCVA 4Z9BA 2YCBA 5BN5A 3AXSA 2FW6A 4N4AA 4G25A 1SNYA 4G1UC 1QTRA 4ZU3A 4OQPA 1XNGA 1RMQA 2QUAA 3D81A 1K2VN 5EJ6A 3D2BA 3PUVA 5ITSA 1M0SA 1JLKA 1U7WA 1YA6A 1PEDA 2WOJA 4ENVA 2JIZD 3K9WA 4EMBA 4KKXB 3D4IA 3Q3IA 1TAGA 5ALQA 4H3KB 3TAUA 2QSYA 1F7VA 1CY7A 1R0ZA 2I6SA 3MRXA 4YWJA 3M6AA 3RAJA 1PCXA 3RJZA 4AYXA 4B6PA 4AT1A 4D43A 2WYWA 2XB9A 4PLHA 3PCRB 3URKA 1JLLA 2QSJA 1JVSA 1DDGA 1SULA 3GAAA 5DHFA 1FFYA 4YLYA 1EFRD 4HAUA 3T61A 1L8QA 3UJ8A 5ERGB 5FEMA 1J56A 2O48X 1PO7A 4EKDA 3GAFA 5JTUA 3ZHQA 1XMOB 3ZWCA 3N53A 3EVBA 2AV6A 3AUYA 1HG0A 3F67A 1NQOA 3JRNA 2OVBA 1EVLA 3AEQA 3L4JA 5ICEA 5A4FS 4LFCB 3GO4A 4EO9A 1QBGA 2FZEA 4DPKA 4B8WA 1ISSA 1SG6A 1UP6A 5HRCA 2BSQA 3RK4A 5AH0A 4GFDA 3GV0A 1WSBA 3MJDA 1E7SA 2GHTA 3E27A 5ALEA 3RTEA 3DT9A 3UF0A 5ENVA 2I8CA 2JLQA 3ZU6A 2YJGA 4B3BA 3VR6A 3THSA 2YWFA 2LBPA 4LIPD 2QQ5A 4JBXA 4DJEC 1LDYA 4C87A 4QTXA 3HK2A 1Z47A 3PB3A 5TQ2B 4ARUA 4E2WA 3IKMB 4PHTA 1S3FA 3EZ6A 3EH1A 3NJ4A 4UUMA 2QVLA 4URZR 2NU9B 3K31A 3PZBA 4AW9A 1BCRB 2WUDA 3K9HA 4RTPA 2DB3A 4FSXA 2C5GA 4NE2A 2YY6A 1P44A 1K63A 3CONA 1EFKA 4OG2A 2W2TA 1HE4A 1U3VA 1QH1B 3G49A 4MP3A 4JL5A 4PLWA 5EMMA 5G0VA 1AKWA 5CYOA 3MQFA 1U8AA 2XUAA 3IA2A 1Y4SA 2BHLA 4NBWA 2XBUA 2X5XA 2OO7A 2C8JA 3G2OA 4JYPA 3WGGA 4R3UC 2H51A 4MRNA 2PE5A 1JQKA 2G76A 2NO5A 4EECA 3GOHA 1A5ZA 4CBVA 2FTKE 3BRSA 3IOYA 2EZ4A 1JECA 1XBTA 2XD9A 1PR0A 2AKYA 1KRWA 5IFLA 1Q22A 1WHSB 4KXNA 2HA6A 4ICIA 4BIIA 1Z38A 3R23A 4S2EA 3UV3A 1B3RA 1AK2A 1D04A 1GG5A 4B82A 1LNZA 4XCQA 4XWKA 5H70A 1K8XB 1U9IC 1U2EA 3AKYA 1JR2A 1ODJA 1W0JA 4JJGA 4NJMB 3ZV6A 3O8OA 1EQAA 4MEBA 1C4KA 3HDQA 4O5AA 5F33A 4DMUB 3MCAA 4B4OA 1DJOA 4F5ZA 4W1RA 2C83A 5CVTA 4DARA 5A9SA 3QE3A 4PO9A 3N75A 3GMIA 4LS3A 3NG1A 4CM1A 2VDVE 4E7OA 3T38A 5JEDA 2CL7X 1JSCA 3DDHA 2J5RA 3A1SA 3FYUA 3KHKA 1M2HA 3OWXA 5G02A 5SY6A 1ID1A 1VL0A 2IPXA 4WACA 3TBKA 3PTLA 4HQRA 1OSNA 4RVNA 2F3SA 2WJIA 2EWVA 5G41A 3ZW7A 1EE1A 1CNMA 3CLRC 4YRDA 3ZIDA 1VPWA 2FUKA 2AMFA 2ZJOA 4IHKA 4KYUA 2BKAA 2H85A 3X0DA 1FUIA 3O0DA 3KR1A 2Q5HA 4BN0A 1L5FA 4D3ZA 1PS9A 3EN0A 3UFXA 1G18A 4OGKA 4BEJA 2QQ0A 4D5EA 3VNAA 4Z1MA 2BEUA 3CZ5A 1JBKA 4Q4JB 2AMYA 1YMVA 2AG6A 1PJLA 2JFGA 2O8DB 1XPJA 3E84A 2G04A 3JD3A 3S1SA 1OYYA 2FA9A 2HIGA 1UMKA 2ZJ4A 1U7HA 2WWVD 1W7AA 1IN8A 1GTRA 5CA1B 3N9IA 4P5DA 5I7RA 5K0CA 4KWEA 3B20A 3CISA 1RVV1 1R5JA 2I87A 1QRRA 2XLBA 1CWUA 3HGTA 4MUAA 2M6SA 4CIAA 4X65B 2FFQA 1FU8A 3PXAA 1OGJA 2JBHA 3A9UA 3IJ5A 4JLAA 4UW9A 2WJPA 4EG8A 2PYIA 2I1VB 2Q99A 1KDPA 2FJUA 2NZ8A 2YHBA 3DR3A 3M6XA 1KK2A 4N3AA 3VNRA 1NXXA 4Q7QA 3Q5DA 5DFAA 5KTMA 3DXZA 4J2HA 2RHWA 2XUJA 3ZS8A 5B7QA 1KS9A 1R66A 2PL3A 1LEHA 4MS3A 3H8SA 4XI9A 2PS3A 4URFA 4F3KA 3NRJA 2BFOA 3CSDA 1HTTA 4MCIA 4MUMA 5LQMA 5JQWA 3LL7A 4EW1A 4JEIA 1KETA 2NP7A 1PWYE 3EWSA 1UJ6A 4QE3A 1T6YA 3EDQA 4RY9A 1WB9A 4LV5B 2QUZA 1VKOA 2POQX 3L4KA 2QS9A 2IP4A 4KSYA 3PXDA 4TYWA 4EATA 3ZLJA 1VHWA 3F2IA 1SY7A 3NDPA 2EGHA 1CX9B 1UZNA 3EQ9A 4G0XA 4XJSA 2Q7XA 4ND3A 3I5AA 2ZAYA 5FTWA 5E1MA 3L5OA 3LBHA 1EE2A 3EEQA 4D92A 4L15A 1QQTA 3ELYA 3CIFA 4TXJA 3ZK7A 3F9CA 3HA2A 1I7PA 1DHRA 3DT6A 4YEDA 1DI0A 4EPTA 2OE2A 5CH5A 4BS9A 3QZUA 2LD4A 4R1OA 5F5XA 1V37A 2XYPA 4GIBA 1RQPA 1KH2A 2Q4OA 1JP7A 2P75A 4KREA 3RSQA 5AVZA 2QTMA 3QOYA 4PLYA 3GK3A 5KPJA 2O8BA 2QROA 3VR2A 2Q6IA 3GLQA 3IYLW 3HH8A 1WZUA 3SAJA 3TLAA 5JPCA 3PE6A 3PHGA 4EY4A 2I4IA 3B6IA 3IR7A 3ZHYA 3CF2A 1AZSC 3V1KA 1TCVA 3KQQA 5J2UF 2MSDB 3WICA 5HCUA 1FOEB 5HR5A 1JPVA 3CRZA 3HR4A 2QKYA 2G83A 2B2XA 3ZX5A 1T3TA 5DYTA 2VSOA 1UJ4A 1C0IA 3KDSE 4L4XA 3KTAB 2HHAA 3OZRA 4MLDA 1VLLA 3AB7A 2OV1A 4PQFA 1H0SA 5JS2A 5IH7A 4LF5B 3GWZA 2OPHA 1XQYA 1K98A 3K0KA 2XGJA 5FUMA 4LUCA 4NZ9A 2ZIUB 3TG8A 2V6MA 1T9CA 1Q1ZA 2CKMA 3A6HA 3G2QA 2WEKA 2ZIEA 3EPLA 1KEEB 4BLWA 2DLCX 1QHSA 4TL9A 1BYUA 1G60A 4KR7A 1KAOA 3RC9A 1V5IA 5BSEA 4HVAA 1YTUA 3L4SO 1K88A 4FNGA 2P8JA 3FB4A 5LYJA 1TUBA 1L4LA 3ZYCA 3KU1A 2OWDA 4M37A 4YQEA 4B4UA 5HYVA 1LW7A 2J85A 3L0OA 3D6TB 2KPOA 2YBEA 3T5TA 1E0KA 3BFJA 5CDUA 2JHCA 4PYMA 1RJ9B 1T9GS 2AWOA 4DDVA 4JB0A 2JD0A 5L4SA 4MUGA 4KTTE 3WFJA 2GTPA 3D3NA 4ZPJA 1RM0A 2XUKA 4Y6SA 5DBOA 4IGIA 1RYHA 2KI5A 3GXOA 4R1LA 2WWFA 3B12A 2HT1A 1ULUA 3ZTWA 2J1LA 2QB5A 3FVWA 3LUCA 4HS9A 5JQGF 3GLKA 3I61A 4KWTA 2GKSA 1IVNA 3QG1A 1K4YA 3RJTA 4RDXA 3TW6A 3WB9A 3GFPA 1WZCA 1G19A 3DZCA 4QUDA 2OC9A 2FX2A 3K9GA 5E9JA 4AF8A 5JBQA 4NCHA 1G8SA 3K0EA 3R7SA 5MFZA 1RKVA 4A6DA 3OE1A 4CF6A 3IKTA 5EJAA 3MWEA 5AM1A 3B2EA 3AF5A 5C8DA 2FW7A 3T54A 4B33A 3LTNC 2EQAA 1PF7E 5HM6A 1QQ7A 1KFCB 4LJ9A 2X5NA 4KC0A 4MH0R 2MWMA 6ABPA 3O4HA 1A8IA 2FZWA 4QXRA 2K87A 1TEZA 4AZVA 5JAHA 4ND4A 2BSAA 3HXTA 3ZJVA 4UAJA 3KZCA 3VMMA 4ROTA 1C14A 2O8FB 3ICOA 1WMFA 2XF8A 2BM8A 2C00A 5LXTB 5HP4A 1JWLA 4KK4A 4L72A 2CY0A 4DMRA 4QPDA 4WY5A 4UMDA 1UJNA 1EGQA 1MFZA 2VT6A 5HFNA 3T0GA 1Y4DE 3EWNA 1CEXA 1N8KA 1VIMA 2XA2A 5K51A 1N33B 3OCWA 2XB2A 4Y1RA 3UGTA 2P62A 1S2MA 3NYQA 4L8FA 1N9ZA 3ENKA 3VHLB 1E1RD 3BDVA 3OEHD 2PUTA 2XCRB 2VF5X 3EQ2A 1L7OA 2YRXA 4FDAA 1Y9DA 1DBQA 4WBXC 3TM5A 1HDYA 4Q5IA 3ITNA 2GERA 2X19A 4YDQA 1XZCA 1Y1PA 3EPPA 2F64A 2XSZA 1T8TA 3M6IA 3Q7TA 5P8WA 1O6GA 4NHEA 5KWJA 4REQA 2P3OA 3FSRA 5CMLA 4RK0A 2ZRIA 3PNVA 3RANA 2XZLA 3GPLA 4YGYA 2R6DA 1TUBB 3ZZTA 1U0LA 1MO2A 1P18A 2X1HA 4EI7A 1QOZA 1SC9A 3ABQB 5D5QA 4LOJA 2F55A 1H4SA 4AY4A 5G3YA 4MW9A 5BYAA 3EMVA 3L4BA 1WBDA 1AKUA 2QVXX 3ZGNA 2BHSA 3JD2A 2V5AA 3SOPA 4QNMA 4AN1A 3RF6A 4ZIRB 1FDUA 1LB1B 5JT1A 5JZBA 3SKXA 3K72B 2ZRKA 5ALZA 1E2EA 2WOOA 3E8SA 4B80A 4XASA 2FQ1A 1MX1A 4FN4A 4DV4B 3HDVA 1FMCA 1JV2B 2YY7A 4KMRA 5EFZA 2UDPA 1UOOA 2B78A 4DA8A 4EYGA 4XCXA 4C7MA 2WU4A 4ZKEA 3SVLA 4XLLA 2VSFA 3U7QB 3ZOZA 1PFGA 4WAUA 5JFGA 4A2PA 2Q7OE 1DLJA 1Y5MA 4JDPA 3H8JA 2XMBA 3A11A 4Q6BA 5DTRA 2JI4A 4TS9A 2B8JA 2CJYA 3AIKA 4QVIA 2XMDA 2DZDA 2W8BA 1UP7A 4C0SA 5BR8B 2AOUA 2KB0A 2NAPA 4IKEA 4E5VA 4PZLA 3JAMA 1U5BA 4GUAA 2PO7A 5IASA 2H06A 2AYZA 2CLKB 3UUGA 1J23A 4KYVA 5JRZA 4I99A 4MI9A 1L3BA 2GEVA 3SXPA 1X38A 5TNXA 5I7OA 5IVKA 5ALWA 1YE5A 3COWA 3TLGA 3BH6A 4GS5A 4J49A 4CG2A 1QLWA 2EFEB 2GFQA 1ZK3A 1G8PA 3JAKA 5WRFA 1YRAA 2J3MA 3NS7A 4MUJA 3TK1A 2O1SA 4LOKA 1ENOA 1UPUA 2XNHA 3A9VA 2C1ZA 1M6NA 3I64A 4JXKA 3P0RA 4EFNA 4UPEA 2PKRA 3A4VA 3OZTA 1JTEA 2B35A 1IDOA 1N8SA 1XF1A 2VIIA 1S3GA 1M8JA 1RIFA 3FF1A 3EOBI 3H2SA 4FCCA 3TZQA 4EJMA 3HXQA 3GJ6A 4NNPA 4FB5A 1G3MA 2ANBA 4X6LA 4TQAA 1IY9A 3H42B 1MNQA 3IHKA 3GVXA 2O54A 2FI1A 2AOXA 2V8OA 3F3YA 4C4TA 4DE5A 5C1PA 3B7GA 3NH9A 2BONA 2B61A 3DYIA 4J2TA 1RP1A 1KWGA 5CB6A 3WBKA 2NQ2C 3MJCA 2Q5CA 1MTZA 4HT3B 3DLBA 2PK3A 3U3RA 3W5IA 3ADDA 4CUJA 2H1LA 4QYWA 5DNDA 5C5IA 3JQAD 1M6EX 2AIRA 4I3FA 4I1PA 3RUPA 2O5CA 3L7KA 1TJ4A 3BMQB 4P33A 1KE2A 3T1VA 4B6SA 5H02A 1U9YA 5EJ4A 4U2CA 5LOVB 3GRFA 1NLYA 3ON5A 1S2IA 4U2GA 3OQ1A 4GSYA 2IRWA 3OP4A 4NOJA 1XTQA 3IAXA 1K6MA 3FN4A 1U2DC 4L8WB 2AR7A 3BRCA 4U2BA 1XWIA 4BO9A 3T7SA 3G6KA 2EHDA 2ZUSA 1RWKA 2BGTA 2HA0A 1NVBA 2V74B 1JBEA 3BRWA 3PR1A 3IAUA 4QGBA 3UO8B 4D56A 5KNLA 3A32A 1WBJB 2L19A 4GPTA 5F3DA 3V4FA 1XNJA 2AG0A 3WK7A 3VZCA 2JATA 1PW7A 2Y99A 4CCSA 4F04A 4FQ8A 1G6HA 2PT9A 4KGZA 1KC1A 1PJ2A 2VJCA 4N5NA 1R9JA 2DSTA 3DAGA 3JWJA 4HFMA 2XB8A 1NKSA 2G08A 3K1ZA 1YHYA 5CEJA 5AHWA 5LBIA 2VUIB 3Q9SA 4C2BA 1XDWA 2Z57A 5J63A 1QG0A 2AA3A 4YRTA 4D26A 4B74A 1SU8A 2VNKA 7ABPA 5KQSA 4JI7B 1LA2A 3LHIA 4LF7B 4O2BA 3W5DA 2CGEA 4HKTA 1GGKA 1M2FA 2CHGA 3DWEX 2HT6A 3QWBA 1ZXLA 2R11A 3LRTA 4QGAA 3GJTA 4LNUA 1IM5A 4LCBA 4R7GA 3H17A 3QI2A 4MNTA 4ITRC 3VBCA 1SBCA 3VKWA 3LG2A 5AQEA 5BY2A 3TZLA 2HA5A 2JIZA 4GI5A 2A7XA 1VDMA 2J9FB 3ISVA 3PKIA 1KI9A 1XVLA 3HV0A 4BNXA 3BGOS 4IJVA 5EERA 3IQZA 1LUAA 4NU8X 4CV1A 5JY6A 3VISA 4PTYA 1CKEA 2P9BA 1L9XA 3AEQB 3R3UA 4IG9A 3UUFA 2P9JA 1RRCA 1LK0A 1U2ZA 2J4FA 5FO0A 4TZ6A 1NR5A 3L1JA 3V1LA 3DMNA 5FUBA 1ZL2A 4AY3A 2DG2A 2G1KA 3IXQA 2IPLA 3Q3EA 4ALNA 4NCAA 2VUSA 4UEJA 3H4TA 3P20A 2ECKA 3NBMA 3A4IA 3IVAA 4RA9A 1E20A 3SU8A 4G01B 4N7JA 4FNAA 1XF9A 2YVQA 2YXEA 5A9TA 1F5SA 3FVVA 4IJKA 4TWJA 3VHQA 1BKDR 1D4FA 3OFND 4HDKB 4O2BF 3TLZA 4G6ZA 2B2NA 4QYMA 3AUSA 3CH6A 3NUGA 2V7TA 1PV4A 1UAGA 1YS1X 3NHBA 3SYTA 4PNEA 5BV1A 2IGBA 2VP4A 3MJSA 2B5OA 5M3BA 3C5EA 4ED9A 1MJ5A 4PFQA 2Q5JA 5C18A 3W8FA 2WABA 4XPIB 1SR8A 2EKQA 2CT8A 3QVUA 3K09C 1N2JA 1O2DA 3F8SA 3G02A 4PVDA 1GUZA 3QU9A 1JFFB 2PGDA 4M9CA 3MB5A 5TQ2A 2OBYA 5JO0A 4WZ6A 1KY4A 1Z88A 1OFGA 1Y6JA 1QK5A 4QEKA 3G2LA 1D0SA 4L73A 3AVWA 1Z8DA 4LV6A 5M7EA 2ZSEA 1SVKA 1QZUA 2B83A 1ZK1A 1WLSA 2HSZA 2CLIB 3FH0A 3M8KA 1G2QA 1QYIA 3PUHA 1E8MA 3I2KA 4I7EA 3UXEA 4Q9NA 1BW9B 1JHVA 1S7GA 2DJ5A 4F3TA 4CQLA 5D2CA 4M9SA 1ZH4A 2CFRA 5HIKA 1H0RA 3AGQA 5E38A 3W1VA 3TIIA 4OHXA 1KEKA 1A5BB 1WQ4A 3FFAA 3HV2A 3BK1A 1VMKA 3M6LA 1GVHA 3N76A 3PK0A 2XOKD 4UM8B 2ZZMA 1WB5A 2BFFB 1YJQA 5C31A 3TQQA 1K8RA 1Q77A 2Q1SA 1B14A 3DXXA 5DH9A 4DLVA 2B7LA 3HJBA 4XGNA 4EOGA 3UHJA 4CQMA 1ZL0A 1YZQA 2XCOA 1LPAB 4C4AA 5KTOA 2NXNA 4BQRA 2CVHA 4YREA 3WV5A 3K32A 3JQ9A 2ZRJA 2UVDA 4G1VA 1ULAA 3ZEAA 5F7OA 2FFRA 2ONKA 1R4MB 3IOEA 3GUZA 2G1JA 4IDQA 1P8AA 1MLDA 2J3HA 3QE9Y 1Z4PX 5F7XA 4ZVQA 3ZDAA 3DV0B 4BASA 2HMVA 3OQHA 1Y4ZA 1JDSA 2R84A 3PGLA 3U9TA 4N0QA 4BFWA 2AMLA 3K4QA 1X14A 4AP6A 1II9A 3WYNA 1XTPA 4IFEA 1AOXA 1Z7EA 4PZZA 4DLKA 1NYLA 2FCRA 3I8OA 1YVRA 3IUSA 4D4KA 1FUUA 1FE8A 5TEWA 4B3HA 2NADA 4JT9A 2H9YA 1QZZA 4D9MA 4UVIA 3D4NA 1T9BA 5DW0A 4O2AB 4D9CA 1GO2A 1L7XA 2PD6A 3QIVA 3R3XA 4M36A 2OYCA 1P2VA 5A9RA 3X2FA 4Q9LA 1CVRA 4K1LA 1YR6A 1F1JA 2G28A 3JQCA 4ZYTA 4CTOA 4CEHB 2M9MA 4M9ZA 2R62A 3DQQA 4IDGA 1XK7A 4E5KA 5KHOC 2RJOA 2A8YA 4HNSA 1T15A 3UJBA 5BVGA 3S4YA 2VI5A 5I8PA 1Q5PA 3UC5A 4TWRA 4I5GA 4MA4A 1Z75A 4F6CA 4EJ0A 3CVUA 1T13A 4C7XA 3LHKA 2XYRA 3K16A 4C6TB 3GVHA 3AUTA 4HI0E 2YBDA 2JFXA 1Y8AA 2C92A 3EZ2A 1CDOA 2CLCX 3M4ZA 3CKMA 4FFBB 3R8XA 3SI7A 2CNDA 3G0OA 3NKFA 4GPAA 2O3TA 3ER6A 3K30A 3K8OE 3TL6A 1HPLA 3LL4A 1SWWA 4K9SA 1CS0B 2NZYA 2YXDA 4WDRA 5BW6B 1Y1LA 2X15A 4K26A 2X42A 5IBQA 3MTAA 1F4PA 3QEBZ 1T9ZA 1OTXA 3FDFA 1PG2A 1DUIA 2EF1A 2PUJA 3B5IA 2GJAA 2IYEA 3OVMA 4W82A 1WQ3A 4C3UA 1AK9A 1Q0HA 1SVMA 2G9UA 4H16A 3KJZA 3UC9A 4OQNA 5A5VA 3AOGA 1AQNA 2AK3A 3T0IA 4AKEA 4EHIA 4QFDA 1J1UA 5JNRA 3N2IA 2J0SA 1YACA 4CR6A 2OILA 1UXHA 2WWWA 5AWFC 1HFWA 4ZCRA 4TLBA 1T5IA 3A04A 2BP7A 4ZRMA 4M22A 3HWRA 1Q57A 4MOWA 4DQLA 4QXOA 3RHZA 4AK9A 1TKBA 3NOOA 5FWDA 4IUBS 3Q4GA 5CB4F 3GG2A 3KWMA 4Z3KA 4UVGA 1JQAA 3UA3A 2E6KA 3F3KA 5DXJA 3GZNB 4D9IA 2HAEA 3Q7EA 3KELA 4LZPA 1ZIPA 2ICAA 3U3ZA 5LUAA 3HKDB 5CFNA 1PJCA 3QVLA 3SPXA 2X8AA 2V4MA 2YW9A 4OY3A 3BJMA 2VRBA 2YIMA 1MCZA 1WDKA 1WKBA 1YB2A 1DLIA 1D1PA 3AUFA 3FGZA 4H7IA 5FL7D 5I8WA 2BD0A 1XDDA 3QNMA 5ALLA 3W6UA 4X92A 2H1WA 4YRMA 1N78A 2ACEA 3OZIA 4RJKA 4NEGA 1YI0A 1UJ5A 4YRJA 2NU9A 4C6TA 1PL8A 1BKYA 1VB5A 2C9ZA 2OAQ1 2FN8A 4UNNA 5DBIA 4G2NA 4E46A 2UUCB 2PX3A 2K7FA 5H8WA 2F17A 2ZSJA 4ZRNA 5BWBA 4FHGA 1EJ0A 2ZI9A 4NBSA 2BEJA 1SIOA 2VNIA 5BYBA 2XNCA 3A36A 1YULA 1K7CA 3FETA 2FQWA 2CNWA 5EZ6B 4OLHA 3D3WB 3L0CA 3RROA 2ZW9A 1NF3A 5E9QA 4HY3A 2VPZA 5FFMA 4ZV4A 1L0BA 3UK0A 3W34A 5JYCA 4DCGA 1WB6A 4G67A 4J07A 4MB0A 1J6UA 2JS7A 1KAEA 2FAXA 3AHCA 3PYMA 2XDQB 3R6LA 4LC0A 4ZA2A 1NM5A 4D4IA 2D74A 4AMYA 1MB9A 2GVNA 3T3NA 5I7VA 4RD6A 3ANTA 4YQYA 5IVIA 2VL7A 3BH0A 3IMGA 3ND5A 2C5BA 3BTUA 4DMHA 4ARCA 5ICMA 1SUWA 1Z33A 2I76A 3H8WA 3IIIA 1YONA 5J2TB 3RSLA 4Y9UA 4CEIB 3IJEB 2GEDA 2G09A 1H23A 1JYEA 3EDRA 3VR5H 3L0SA 2C2HA 5AW1A 3FOEC 4Q1VA 1CVLA 3FCOA 5AIBA 5KNCA 2HJWA 4JOCA 4YI5A 1VCIA 4E03A 3EGDB 1P0CA 3NWPA 4UCQA 3SS7X 1YFLA 2G36A 4UNSA 5F98A 3Q8KA 3ZHCA 4HDMA 4O08A 2H1RA 2KWIA 3DONA 5J2TA 2PMDA 3H9GA 1XWWA 4HN2A 5FORA 5CFPA 2BLLA 2AEEA 2IHKA 2X5JO 1KERA 3MELA 2PH1A 4I36A 1ZU4A 1QLHA 1A4UA 1QF9A 2R751 5JXHA 3DLIA 1XQ9A 4QQFA 1C4WA 2AW3A 4QBGB 2FPOA 1ODFA 2YNMC 3ESCA 4E5MA 3PUKA 5EPUA 1NW5A 1Z3CA 2HC9A 2IP2A 3I4FA 4IJUA 1XKXA 3FCEA 5HS6A 3WK8A 2ZEJA 4L0QA 1EA5A 3FTCA 4MPDA 3ZY5A 1N5LA 4EG1A 2Z5FA 2Q29A 4MARA 1Z6AA 1LLCA 3JD1A 4JIGA 1P6XA 3GB9A 4XGKA 3TR6A 3FY4A 2H59A 4UHHA 4F06A 1P9NA 1BDMA 3R5HA 1VDZA 5CBKA 1SRQA 1GAEO 1A69A 5EIHA 2I2XB 5JIBA 5DGCA 5EC8A 4UTPA 1ZSVA 5IJ9A 1LBHA 2OXCA 3BDIA 4RVCA 4JU9A 1EDOA 2DY1A 1PBNA 1EZ1A 4J0KA 4L07A 3E22A 3TL2A 4DB2A 1E5VA 2VAMA 1U8CB 2I5PO 2IEIA 3IT2A 3NHSA 4H7JA 4HDOB 4MW2A 1KVRA 4TRJA 2G9RA 1CG6A 3KQTA 1P7YA 2C84A 2NSHA 2OG1A 2Y1EA 1XCPA 3FRHA 3LHDA 5CT8A 2X0EA 5C2JB 6AT1A 1PJ8A 2ZREA 3DNMA 4ZT4A 3IOMA 2AG8A 2D1RA 3RGWS 4DRXA 3FNHA 1M7GA 5A3JA 1SUCA 1JYSA 3EGCA 2FZLA 3IR5A 4DGSA 3H6GA 4GKAA 3EQ6A 1TM4E 1AK1A 1GGEA 1ZOLA 3C45A 4KB5A 3RC2A 3L84A 1HUQA 3UB3A 1JL3A 3M5DA 1EK2A 4CTJA 3WZ2A 2GZDA 4PN3A 4YR9A 1E2QA 2Q6VA 3S2YA 4YRGA 2JGAA 1OXMA 3KG2A 5FOWA 3KJEA 3URMA 4C1NA 4FLEA 2WE7A 3BVPA 4DZTA 5REQB 1E1RA 2AOVA 3A6ZA 3OEHA 4LVCA 4UBIA 1Q0SA 3KQSA 4AJHA 1BE6A 3WIOA 4Q9HA 2A4MA 3DKVA 1QVAA 2GDJA 3FGOA 4C0KA 1M76A 4NFSA 1B43A 3ZV5A 1R5BA 9ABPA 5JATA 2RH8A 1ML4A 3L0IB 4IS3A 3T34A 3UAVA 1P1JA 2UV8A 3HY3A 2P1DA 3WSTA 2OL4A 5B3JC 1NTRA 2R7NA 3FPEA 3LNTA 5B6JA 4J1SA 4O0LA 1L8AA 3IEXA 5HTKA 1P45A 1KYQA 5LYJF 1DWPA 1II8A 1MRZA 2XX3A 5K0GA 4R31A 3AEXA 3EJ6A 3K0CC 4P1ZA 5THKA 4M9UA 1JG6A 5EWMB 3RRZA 1EZ4A 1SCQA 3WBFA 4XA8A 4LJRA 1LY1A 1IBRA 1KYYA 1HYQA 3PGMA 4D0NA 5LL6P 5I9TA 1KDYA 4NF2A 4OJQA 1L4FA 1Y9JA 1PZHA 1ZW6A 4M2LA 1XD2A 3PRYA 3WSWA 4BFTA 4NV0A 3DBRA 3U4QB 4BU1A 4XYMA 3U37A 3E1SA 5AM2A 3ID6C 4IZIA 1EBBA 4GLJA 2YMMA 1JHMA 2P7IA 3NTXA 4EQ6B 1QZ3A 1Z37A 1QM5A 3G6WA 3LK7A 1E5LA 1SVUA 1YZLA 3NBKA 2C4VA 4JHLA 4MGEA 5K05A 3CNHA 1B1CA 3DEZA 1VYTA 1RQ7A 1GU1A 4EY7A 4RX1A 4Z53A 4OIMA 3UJ3X 1ZAYA 3OD1A 1HDGO 1HEIA 3F7TA 4NONA 5JADA 1CY2A 4IIGA 4PAWA 3SKYA 4TV9B 1JLSA 4I19A 1O94C 5CDGA 1A9ZA 1XTKA 1EFPA 5H7XA 4P2BA 1N5JA 2Y1LA 5KC8A 5BPFA 3QXJA 3R5SA 5AICA 1YF3A 2NPOA 4GXTA 4W99A 3UJAA 3HJNA 3VYWA 1OAKA 1KMIY 2X4DA 2GNPA 4H4EA 2D5LA 4V2IA 1OB5A 4XJXA 3D02A 2ZIVB 2QL5A 3KKLA 2R1TA 2IHUA 4OSEA 1YRWA 1Z08A 4V2UA 4BMYA 1G8KA 1TOAA 1UINA 3QU7A 4HUTA 1DIHA 1CR4A 4ZOBA 1A5AB 3MPUA 2J0UA 3PVZA 5JSKA 3HACA 4HYTA 3WRYA 4X7RA 1P1BA 1ZOOA 1X7ZB 4PE5B 4KQCA 1HMPA 1R64A 4OI1A 2Y2UA 4TSRA 3KKEA 3EAFA 3DZGA 3TRIA 3KB2A 4MTLA 5MN5A 1ZSNA 1GSAA 1GAXA 4N0MA 1R8JA 1L8XA 2QN3A 5E1DA 1NP7A 2IL1A 5IHPA 1L4NA 1FMFA 4DLXA 1YDEA 1HT1E 2REBA 1T5LA 1U8UA 3CLUD 3HUDA 1KARA 3I6YA 3PDCA 4MINA 4V38A 3BJRA 2CEKA 5HF8A 4U5QA 5JHGB 5D1HA 3EG5A 3VHXA 4BN4A 4OAQA 5C8YB 2QD5A 2Z9BA 3L0PA 3CX6A 2VHJA 4LC9A 4DNXA 3GT4A 4EVRA 2P0AA 3KZOA 4LWPA 1QYWA 1T2FA 4GP7A 2CLHB 1S02A 1E6UA 1RCFA 3KB8A 4ZJYA 3MJEA 4IIXA 4BHTA 2OG2A 1QO7A 3DWIA 1FTQA 2VCEA 2W6ID 4PX9A 1KI8A 3CCBA 4DEVA 3QLJA 3K0BA 2NU6A 4F56A 1T35A 4KVZA 1M8PA 3PR2B 2WZCA 4BLQA 1B2RA 1Q3TA 1JG1A 4Z3DA 4POAA 3BEDA 4XQ0A 1XPOA 2OUKA 2QEQA 3F6PA 2NU7B 2ZS7A 3DTNA 4QXQA 4X62B 2GCGA 1SHJA 1KO1A 1K7SN 1VSQA 1ZM2A 3QVXA 4GGOA 5T67A 1QFMA 2VHWA 2O0HA 2ZT6A 3E3AA 4E2YA 9GPBA 4DV3B 1OA0A 1J90A 3HO8A 1IQ0A 1H8HA 2PL1A 2B94A 3PQ7A 4BNZA 1JVBA 4V39A 1SUFA 4BAUA 4AP5A 3DZJA 3UT5B 1W4AA 3EFOA 1H3NA 4ARZB 2J9FA 2P79A 3K1YA 1Y6ZA 4FHCA 1PGOA 3LH5A 1PSZA 1QIEA 5DM60 5JCJD 3EULA 3DAPA 3HBLA 1DRVA 1FYVA 4NCJA 4YMLA 5B2ZA 1V9CA 2PAFA 5JO9A 5JNWA 1RTKA 4GLBA 2VP2A 2WD8A 3RS9A 3T1HB 3FZQA 1U7UA 2W98A 1UPXA 1AGRA 1H6AA 3I76A 1NSFA 4H7KA 4UC0A 4E12A 1J2TA 3UUWA 2ZVQX 3ZVKA 3LYUA 1V11B 1PDWA 1QHNA 3ZD8A 1TE2A 3V2UA 2FUCA 5AFSA 4MYUA 5ARBA 1V8FA 5JAUA 4CIVA 5K4GA 1AZWA 1C1XA 1POWA 5JU6A 1E79A 3UKOA 3I52A 3IVGA 2NUAB 4HP8A 3ZNPA 1PJZA 2NZ2A 3UYLA 2XZOA 2PRJA 1SUPA 4Q3AA 2GPYA 2XJ4A 3MNFA 1Z62A 5LA6F 1DKUA 2OD2A 4G5HA 3WA6A 3ZXYA 1EGMB 3B2NA 2A1TR 4M76B 3NYRA 4ZCTA 2QMZA 1M2JA 2LDXA 4LRTB 4DBVO 3GDHA 5FTMA 3KNZA 2YVLA 3OFNA 4EUEA 2BN4A 2VHZA 1OX4B 4P7JA 3S8YA 4MIEA 3Q3JB 1S8FA 2X6TA 5FOXA 3SX4A 4CKWB 3EEBA 4QBKA 2OFWA 3PGKA 3U61B 1M1XB 5CA0A 3WRXA 1JEYA 2XXAB 1OWNA 4BRSA 4NK5A 5CGQB 1XZFA 4JVMA 6GPBA 1GYRA 3LQ1A 5DHAA 1ORIA 5F12A 3AR6A 4TS1A 5G53C 1Z7YA 4E5NA 2HY7A 2P9HA 1XP5A 2YTZA 1ZH0A 3BWBA 3L06A 4PANA 4ARBA 4NYIR 4DCVA 2NQ8A 5L9AA 3OM9A 5G0TA 3LYAA 3AVVA 1CNEA 1OXUA 4ZVUA 4M8LA 2QE7A 4GMDA 5IVDA 3QIAA 2PXXA 3TDNA 1C1DB 1C3OB 4YV7A 1PQWA 1QCZA 1KBZA 3G85A 5JSHA 2R6R1 2QRGA 4H9GA 3OZ7A 2UXDB 1GXSB 3MXOA 2X4IA 3O3OB 1FIUA 2Z6AA 5H3HA 2RGWA 4PG8A 5DTEA 5DNAA 1RXIA 2FUG1 3B5EA 4EBFA 4RF4A 1RYDA 3OESA 4IGEA 2BHRA 4PLPA 5I7HA 3E58A 1WXWA 1WV1A 3D7RA 2VCHA 1A0OA 3L8FA 2NP6A 1AZLA 2B5WA 2QVCA 1HDOA 3WLJA 1DJMA 3WIDA 2F9LA 5BNFA 3EPKA 1VGVA 3QW2A 1SQ6A 3DDWA 2OB2A 3K8ZA 6CHYA 4FYVA 3C8HA 3W1WA 4O4HB 4LJ6A 2WPNA 3PGVA 1IIBA 4HL6A 3WK4A 4NEHB 3LXRA 4CLOA 4K28A 3IAM1 4FCTA 1ST2A 5K0EA 4NZPA 3ZVMA 2FOLA 5JJIA 2Q9UA 4GBMA 4XAQA 3ZGYA 4BDTA 2WF5A 5KOYA 1PIWA 2XE4A 4PZYA 5ITVA 3FLEA 1AMUA 1T2UA 1QQAA 5CCEA 1XJWA 3TOVA 1Y1RA 1PTJC 3A10A 1K3TA 1R18A 3HI4A 3IQXA 3LQRA 3NHRA 1VHJA 2GEBA 5C46F 2CVQA 1KR2A 3FVTA 2WICA 4CM8B 2XHEA 1TQ8A 2A5JA 3WQRA 4IDHA 3TUJC 5K8IA 3ZDBA 2Q6LA 1E1CB 4QU9A 2O19A 5DCWA 4XWTA 5E1OA 2WHEA 3HUUA 4BY9E 1NXQA 4ARAA 3JX9A 4KXQA 3ZDQA 1FDVA 3OOSA 2HPZA 3UIEA 4YCCA 1CQIB 1L4UA 1T9DA 3BK7A 3L05A 1ZUNA 3IGFA 3L7YA 3VM6A 5BN3B 2WYHA 3Q7IA 4UTVA 3D7SA 3QHAA 1E9EA 3HZZA 3SSNA 1KKUA 4KIFA 4A2CA 4C07A 3HHEA 1DAHA 2OV4A 4JENA 3RYFB 1HLDA 2VLBA 2C2KA 4N5LA 2A7QA 4D9KA 4JLMA 4Q3BA 3RVSA 4E5PA 2HRBA 4YMWA 4C0XA 5J1SB 3AUXA 4Z0PA 3ST7A 2WK1A 3WJ7A 4ZHQF 3CBGA 1Q95A 4I1VA 3T9CA 5HBGA 1ZR2A 5L8VA 2IXEA 4KDRA 3U3KA 5FUWA 2Q7DA 3U4IA 3W5AA 3TQIA 1YL7A 3HFGA 1FUKA 3W2GA 4DTIA 1IY0A 3ICPA 3V7YA 2SKCA 3K1JA 4TSFA 2P5SA 4OYRA 2FRXA 1WE2A 3E15A 4C3ZA 3K09A 4GM0A 1ISRA 3N0TA 3V32A 3BMXA 3JWPA 3WMEA 5AI8A 2FVXA 5ICSA 3WWZA 1A76A 4ZODA 4A0GA 4MRRA 5I4CA 4AKTA 1GADO 2J33A 2LVBA 2NO6A 4PLCA 2BFWA 3DE4X 3OMWA 2QJFA 2D8MA 3V3TA 3HBJA 3CNQS 4ZRDA 1TCAA 3NBUA 1ZLYA 3COYA 1SC3A 4R2LA 2V9CA 2Q62A 1P2TA 2H1HA 1P72A 1EVZA 4M9RA 4RQUA 2QW1A 3QELA 4XFKA 2QNRA 2PV7A 2I1QA 1G1MA 4L51A 5FA5A 1G6KA 1V9LA 4PXAA 4ERXA 1KI3A 4PZ9A 3PNMA 3PWKA 4XPIA 4OUDA 2JZCA 4EG5A 4DDUA 4OGFA 1FZQA 1MO5A 3RADC 3UT0A 2VWQA 3ROXA 1GLGA 2XV1A 3M83A 5H80A 2V3CC 3DE5X 4B5LA 1W29A 5DI9A 4WSOA 3IIJA 1NVXQ 1MAVA 4XX1A 3SEZA 4MPJA 5BW5A 2FSGA 3DZDA 3RS4A 3RT9A 2VXOA 4D42A 2W7TA 4KQ2A 5EXSA 3FWPA 1QP0A 4FYJA 5AVVA 1W44A 3ZU4A 2HLNA 1NU8A 3IHTA 3AP1A 4TL7A 5IP5A 4QGSA 3ITDA 5JAOA 1N2BA 4O6VA 1S89A 1K8ZB 1SG0A 3HR7A 4Q18A 4BLPA 4YRBA 3DCIA 3DP9A 5KU1A 1M0WA 3TVTA 3PPIA 1OH7A 1P81A 2QRLA 5DEOA 4I1RA 1FXWF 3F47A 1NOJA 5IC4A 4NDAA 3AW8A 3FKSA 1P3JA 1XTIA 3LRPA 3LPNA 4JROA 1LBTA 5AI9A 3M6FA 4H31A 4LHVA 4DR1B 1VMEA 1WZIA 2Q46A 2XAAA 4RF5A 1EUZA 2YYSA 5AVXA 2ONJA 1UKZA 2JDID 3L0DA 4BVLA 4BNDB 4E21A 4L6AA 1G0NA 3AJAA 3T1YB 4AG6A 1M1YB 4EI2A 5AW7A 2W4QA 3ZHOA 4HNUA 5GMOA 3U2QA 2B8EA 4NL4H 2O7SA 2X8BA 2MMCA 5A04A 4YS6A 5LUBA 2ZWVA 3BRQA 4NARA 2E5LB 2WUFA 1OLOA 3ACDA 1AN9A 2ZR0A 4MW4A 3ML1A 4MYCA 4NULA 4WCFB 4A9AA 2FWBA 4D98A 1S1MA 3KE9A 1T9HA 4N5HX 1T1EA 2PU5A 2GRUA 4ZT3A 2DPLA 2FW9A 1SZPA 3VAZA 1YRQA 2AN3A 2C3OA 3C6MA 1MO4A 4JBLA 3TGWA 2QAJA 1UR5A 1YZFA 4PXSA 1UBTS 2BGIA 4GXRA 1UAYA 1QRAA 3EGOA 5F76A 1N8NA 3RRBA 4EYKA 5JQGA 2I7DA 4PM4A 1CY8A 1QS0B 2IF2A 5J3JA 4RHEA 1NVKA 2MYTA 1RWVA 3ESYA 1KI2A 2GBIA 4WESB 3QYAA 3OICA 5CFOA 1SQSA 3ADBA 4F84A 2HHHB 4ZEXA 1YMUA 3G8AA 4HQOA 4BTLA 3KAKA 1YSCA 3E3OA 2VP9A 5FYDA 3OIDA 1UPBA 2GNAA 2JAUA 2JGIA 2QAGA 2WTAA 3C14C 3FYSA 3MCWA 3TCKA 1FDRA 4TROA 3ER9A 2I4NA 4KVGA 4AX8A 1M2VB 2DE0X 1GPNA 2D2IA 3FCAA 2TMYA 3NWJA 3C24A 1WXDA 5J5VA 1YXMA 3W04A 2DPHA 2X2PA 1RXCA 1BEZA 2Z8YA 3VPDA 5HK9A 2WWXA 5DTJA 4BECA 5GZ1A 5LNK1 3FWYA 4BZXA 1MR3F 2Q5FA 3KYIB 4COKA 1MHPA 1SPBS 1PJSA 2OBNA 5DHTA 4C14A 4F0JA 1IBLB 5B7NA 4RD4A 1Z0JA 3BJEA 3TNLA 5KYYA 3UGJA 1DADA 4ZV7A 1QHFA 5JRJA 4WLNA 1KJNA 5HILA 1L7EA 3HCWA 1F4LA 3FUUA 3IAFA 3HMKA 4KIJA 5EPOA 5GGXA 2OGWA 1AKMA 4DPMA 2W6JD 1TJ3A 3SYNA 1KXZA 4OK6A 3ZI0A 3KSDO 4ZVKA 1JDVA 2F2TA 421PA 1XZBA 2ZYHA 3DOJA 3VA7A 1E2HA 4NYMR 4BGVA 4N03A 1BQ4A 3I58A 2VAXA 4HLDA 4KPUB 4RVUA 1C9MA 5DNVA 3UB4A 3D6UA 3WIVA 5JDCC 3GH3A 1MJGM 5KTYA 1MZVA 5IKPA 5LQDA 1XEXA 3V1YA 3O92A 1A2QA 2CV0A 4D8WA 2YOGA 3ES9A 1XRPA 3FPCA 3CX8A 1HSOA 2NTEA 4PYIA 2CZCA 1G9SA 2ZULA 3ZY2A 1YC2A 1ZNXA 4FKBA 4H6WA 4JBNA 2GB4A 3HWSA 2XWPA 1ZVVA 1F51E 1V43A 2EZTA 2OTCA 2XPCA 1XHEA 2ZDHA 3C85A 3KTOA 4HZUA 2QMHA 3SHTA 4A91A 1T8PA 3OZDA 4GLLA 3TMYA 1E5XA 3I23A 4MUKA 4Q01A 3RIXA 3SR0A 4BLVA 5E3HA 1CQZA 5EINA 5M5BA 2UYHA 4UTRA 3FFXA 3FZYA 3DKRA 5HA5A 4K05A 4X24A 5LYYA 2DWUA 3BL8A 4MVJH 3JYOA 2GAAA 5BQ5A 3T9EA 1SQFA 4XIGS 2BI7A 2QD2A 5J2TF 2Y6UA 3A6LA 2EP5A 4NJOA 4Q3EA 5DKFA 3NJ8A 2WAMA 4FINA 3WGZA 3WGOA 4FR2A 4NR0A 4ILEA 1IN4A 1LNSA 3FAKA 4WE3A 1OZHA 1XD8A 2X1LA 3MWDB 1E18A 1Q2UA 4D8TA 2QENA 2ZJAA 1NN5A 1Y3FE 2QR2A 3QJGA 4GG1A 2CXRA 3A14A 3Q12A 1UMCB 3I05A 1SD2A 2Q6OA 2AN9A 1DKLA 1BYIA 4A03A 3G1TA 3I9V1 2B1RA 1CUWA 2Z5GA 4RV5A 5TGZA 1Z8FA 1V25A 1N4DA 4Y6QA 5B36A 3BQNB 2FEXA 2FOIA 4C4SA 3MFYA 4WA7A 2IIQA 2FPWA 1KFBB 3LIPA 1O8BA 2Y6VA 1FVHA 3TSCA 5GONF 3W6ZA 1X7GA 4TTVA 2N1MA 1DJQA 1CUSA 3EGIA 4MV1A 4E3ZA 4KLCA 2LNDA 2VJBA 4I9NA 4DR2B 3NHFA 1LSSA 3LGSA 4RFLA 4U2FA 3HCEA 2F1JA 4WXMA 4CR7A 3J81k 2WWYA 1TFRA 2H1FA 1I4DD 1A7JA 1NNI1 1P8JA 1UQTA 3V00A 4BB6A 5IAAA 1Q7GA 1GVNB 2MT9A 1FK8A 4QG7A 4WLFA 2PS0A 4IUCS 1GUBA 4EGJA 3RVKA 1C3VA 3DOUA 1CXZA 4KLRA 1NMXA 1W1IA 4LAFA 4G3XA 2EP7A 4LDQA 2RHCA 4RZXA 2AFRA 3N2LA 2IZ7A 2ZP1A 4JC0A 2VF8A 2QU7A 1O5OA 3NEPX 2VEOA 2BPOA 4Q03A 3MWDA 4TXLA 1X19A 8AT1A 5IUNC 1V4BA 2G4VA 3LQKA 1ZI8A 4PPYA 4YI3A 1Q3KA 2GBPA 5ICCA 4C2TA 3MT8A 2YJ3A 3RTCA 4LQLA 3SLGA 3TTWA 1ND6A 2UKDA 2DEUA 3I01M 1Z16A 3AEKB 3FSGD 3JQDA 4DY6A 5EIXA 2J6IA 1ZW1A 4BP9A 4MW0A 1M66A 1DTSA 3WKBA 2BFDB 4H77A 3LWBA 1Y5LA 4QQNA 4UU7A 4EF4A 5TE9A 3TIFA 5IS2A 1D6SA 4RPLA 3KXKA 1TGVA 1XLUA 2DBQA 5EQDA 1ZI6A 2FE1A 1XZKA 2Q1TA 3FPJA 2X6QA 3V7FA 3A28A 4WFKA 1JFSA 3QE4A 4KQJA 1NM5C 1C4XA 4NKRA 1CDDA 1BDBA 4TUYA 3HB0A 4JUFA 1XEFA 3UFXB 3A6PC 3IP6A 4OFBA 1E9RA 4QFBA 5JDCA 1JS1X 4OXQA 2ZR8A 4L75A 1IXKA 1YBVA 4MYSA 4P5PA 4PGHA 1Y8QA 2C7OA 4BO8A 4X1IB 3TOZA 4AJLA 5IYZB 4GICA 1ZJWA 5GQSA 1ICIA 3L01A 2PQMA 3W3AD 1BXRB 1JHRA 1SCBA 3IVMA 2JLCA 3LW7A 5D3QA 1PRYA 3NBQA 4A82A 2DX7A 4FR5A 3WB0A 3UHAA 3IEVA 5A6SA 4I9FA 1L7RA 3O95A 3RVNA 4DS3A 1F12A 1IJKA 2PG3A 5B3AA 3OQPA 5LJIA 3VSAA 2AZXA 2W6IA 2FW0A 2J0VA 4G8JA 2I4LA 2YWGA 3OHPA 2YIJA 3QUAA 2VPYA 4EMSA 4ZTUB 4RCVA 4R2IA 3CZQA 2Z9DA 1R3UA 3AB8A 4ZOQI 1VYUA 3GJ5A 3O7MA 1B0UA 1JE1A 2EP8A 3FNBA 4MHSA 1DPFA 2EX4A 5LMUB 1S3SA 3PE3A 5E9WA 4B3XA 5CT9A 3W1EA 1JDTA 1EDZA 2HU5A 4TWAA 2O1XA 4HEQA 4Z2YA 1NVVQ 3TMKA 1T26A 4WNIA 3C3WA 5DF1A 2VDQB 4GL4A 4NX2A 1VI2A 4H7DA 2B8NA 1XXHB 5CFQA 1RI3A 1QPBA 4GWLA 3STYA 3N05A 4J16A 3WLRA 4C03A 4L7VA 1XQWA 3GEBA 3K1TA 1EVIA 1CFZA 5TDHA 3OHSX 4G4SO 5ISMA 4FHFA 4LHSA 1Q1BA 3JARA 4DG5A 4G1FA 1B0ZA 3O2SB 1Q74A 3KKMA 4ND7A 1J9ZA 4BQEA 2D2FA 5JRDS 8OHMA 3UJ6A 1U8TA 1SPXA 3H04A 3BF8A 4BKRA 2YN0A 1IWOA 1T3ZA 1OFTA 1US8A 1YDFA 1T8WA 2QTAA 2OA0A 1F7UA 3LCRA 1GFSA 1EINA 3W9BA 1WO8A 4ER0A 4XYLA 3THWB 3VKGA 2INGX 5F3WB 2QXYA 4G5SA 2QRUA 4IDCA 3R0VA 4JJZA 2F48A 3NGLA 1H1DA 4IDFA 3FZEA 1EFLA 3N8DA 1M10A 4CTNA 1AS2A 4RK7A 4GMHA 1Z4KA 2G6TA 1G98A 2NO1A 1K3UB 7MHTA 3FTQA 1KYZA 4AAYA 3P7MA 4DRYA 3PFGA 3CEAA 4KO1S 2EHJA 3WYCA 1OWMA 2ORED 1O95A 5DW3A 4KH1A 4B0PA 3C7DB 1D4AA 4OMDA 2KSQA 1I3OA 1MJFA 1P2UA 2XE6A 4H3SA 5B3KA 4UU8A 1R9NA 2QJOA 4B47A 1RBQA 5DLQC 1TCBA 4LJSA 2ZKLA 3V33A 5GIOE 1TJPB 4ZMSA 3UAYA 1N5IA 1AU9A 3M6MD 1WKCA 2Y1FA 2RBEA 3IDAA 3T8YA 5IRCD 3HGMA 4L4RA 4NJMA 2DC1A 4WZBE 4RZQA 1L7VC 2N3ZA 1VIVA 1YH3A 2REOA 1N2CB 3STWA 4EX7A 1L7BA 3DBHB 1FVFA 4ZZ0A 3C7TA 5CXXA 3GJ8A 3Q8MA 1STOA 1LRKA 1NBIA 2PBRA 4HQLA 5G3ZA 4EG7A 3T3IA 5LU8A 3GN1A 2Y92A 2QE7D 1UM8A 1LPNA 4WKOA 1IOLA 3H13A 2PVCA 2PR7A 5G1NA 4I6EA 4HDRB 2EW8A 4ZWNA 2FPXA 5TR9A 2V6FA 3IQDB 1DUSA 2RKWA 3N74A 4L8YA 5EE3A 2CXSA 5KOHB 1Q1EA 3H1FA 4NI5A 4B0OA 4BGEA 3HDTA 2ZVDA 3IRUA 3TFQA 1QFXA 1M2KA 5D3MA 1CBUA 1J22A 4WZAE 2WIKA 2C77A 3TBHA 3EBOA 5TSDA 2AH5A 2OHOA 3P9IA 1PL0A 2VHUA 3IPLA 4TQ9A 1ZXBA 4L57A 1IFXA 1H1LA 3P45A 3UCFA 3W6PA 1JIKA 2CJWA 2ONZA 1LQ2A 4H35A 1I80A 1Q6YA 1S0UA 4HQ0A 1YZHA 3B3AA 5IDYA 1A4RA 2Q3JA 2VUTA 3NM4A 4CKEB 4RJ2A 1CUJA 2XRFA 4FX2A 3KVRA 4XWOA 3ODPA 2KX7A 1NA5A 4O4HA 4BU0A 2BEWA 4KE7A 1Z0UA 2JLYA 3BT7A 4Q4CA 3F7MA 1OH6A 3H2YA 1UQUA