3CU5A

Crystal structure of a two component transcriptional regulator arac from clostridium phytofermentans isdg
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
130
structure length
124
Chain Sequence
SLRILIVDDEKLTRDGLIANINWKALSFDQIDQADDGINAIQIALKHPPNVLLTDVRMPRMDGIELVDNILKLYPDCSVIFMSGYSDKEYLRAIRYVEKPIDPSEIMDALKQSIQTVLQHQAQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a two component transcriptional regulator AraC from Clostridium phytofermentans ISDg.
rcsb
source organism Clostridium phytofermentans isdg
molecule tags Transcription regulator
molecule keywords Two component transcriptional regulator, AraC family
total genus 35
structure length 124
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3cu5A00
3Q41A 3NNSA 1JFTA 1NXXA 5TPZA 3RVRA 3MMNA 3LMKA 4D6YA 4KZKA 4MS1A 3DLHA 1USKA 1DC7A 2E4VA 3I42A 2PUBA 4KREA 3H5LA 1SXHA 3T95A 3C3WA 1USIA 4Z4EA 5EWLA 4YWHA 1D4ZA 1KRXA 2IKSA 4Z9AA 3NHMA 3OO0A 2LIVA 4PZ0A 5C5EA 1APBA 4NCBA 4GPAA 3CRNA 5CNMA 3HJFA 3LUGA 2CD7A 3N75A 4JB0A 4RK6A 5B3JA 4KVFA 1W25A 3QLUA 3C3KA 4KV7A 1RXEA 3IPAA 3W9SA 2IOYA 2LPMA 4UHJA 3H5WA 4W5NA 4ETIA 5BRJA 1DBQA 4E7OA 4YV7A 1NTRA 3MQ4A 3H6HA 1JFSA 4W5OA 2PJUA 3ROTA 4KMRA 4MPTA 2NT4A 2RJNA 3LFTA 2JRLA 2FVYA 1QP4A 4MS4B 4H3KB 1Z16A 3HS3A 2V0NA 2IPMA 3RVKA 3JPYA 2WJAA 3TX6A 2RGYA 3Q15C 4F3TA 2JVIA 4JAVC 2R47A 1XHFA 1CHNA 5TQ0B 4EVQA 4RS3A 4LE0A 3RVLA 4IILA 5JNSA 3JS5A 3BREA 2CHFA 2IPLA 4OATA 4Z4HA 5T7BA 4N0QA 3DGFC 4G0QA 4HNQA 4WUTA 4YLEA 3IP9A 1RZRA 4ZPJA 3RVOA 1XHEA 2CWDA 2FEKA 4LZLA 4Z4GA 4D74A 1ZH4A 4M88A 4EVRA 3EGCA 1YK0A 4YO7A 5ABPA 4WT7A 2R25B 3A0RB 3LUCA 3CLKA 4OLBA 5TPWB 2I6FA 3LUKA 1D5WA 2PL9A 4KK4A 1E2BA 4EYGA 3MIZA 1GLGA 1JWLA 1I3CA 3DGEC 3ILHA 4QYMA 4YCSA 1PNTA 2QV0A 4RK5A 4WZZA 5F64A 3BBLA 1VPWA 5DTEA 3UKJA 4IF4A 2FXIA 3H1EA 2FKAA 3ROFA 4Z99A 2E4XA 2LP4Y 4MS4A 4D6XA 1ISSA 4PEVA 4RXMA 5TQJA 2JBAA 1QNLA 3KYIB 3LTEA 4MR8A 1A0OA 5JS1A 2PLNA 3GA5A 3LUAA 4L4UA 2VUHB 2FLWA 5KQMA 3CFYA 4XLTA 3H5VA 1LBHA 4IMJB 5EWJA 1Z18A 3SNKA 2PUAA 1W9HA 2HJ9A 1JX6A 3SM9A 2TMYA 1JDPA 1PUXA 2RJOA 2WRZA 5KC8A 1XWWA 4MR9B 1B00A 4Z4IA 1ZH2A 2HQOA 1QP0A 2JVJA 2R48A 4MRMB 4RZSA 4Y9TA 1JHZA 4E7PA 4F11A 5JNTA 3N0RA 3OLWA 2H0AA 1YK1A 3LKVA 4F12A 1Z25A 4RK1A 2W42A 2QW1A 2MSLA 2MSKA 4G0OA 4O1HA 1E6KA 3GRCA 1Z2DA 5HQJA 5FBHA 1A2OA 1H9CA 1FSPA 5DCLA 3BRQA 3GL9A 2XDYA 3QELA 3P9YA 5EWJB 5BR1A 4YR7A 1LK0A 1LBIA 1F51E 4G97A 3SAJA 3E61A 1YS6A 1PEYA 2L18A 3QK7A 3T8YA 2VUIB 1EWVA 4RXUA 3N8IA 3Q9SA 2QR3A 3H5IA 5KQPA 3HXMA 2PE5A 1BAPA 4MS3A 1JL3A 1GUDA 4RY0A 5TE9A 1A04A 4MGEA 6CHYA 4W5RA 3A10A 2YHBA 4G0MA 4ETNA 1FFWA 4O1IA 1FFGA 1E6MA 1FFSA 4RY8A 4NQRA 4UHKA 3RVJA 4MQFB 2J48A 5GOTA 1EAYA 3GT7A 5TPWA 2FQYA 3RH0A 3EDCA 3F7NA 9ABPA 2BGGA 4B09A 4EVSA 6ABPA 2MSWA 2MYNA 3HK2A 3KHTA 1RXIA 2DRIA 1SXGA 4ML3A 2OENG 2ZWMA 1QQAA 4CBVA 4OLAA 3SG0A 4JB2A 3EQZA 4KPYA 1D1QA 1ZY2A 1RZRD 2WJWA 2AYZA 3MA0A 3TMYA 5BRAA 4Z4FA 1QMPA 1CEYA 4P1ZA 2QU7A 5EWMB 1Z17A 5CNKA 3CZ5A 5FWXB 3HVRA 3A0UA 3FDFA 4LE2A 5D2CA 3I09A 1C4WA 1CYEA 4PICA 2QZJA 3NHZA 4EY3A 5ED4A 2IYNA 1JYFA 1S8NA 2RDMA 1QO0A 1Z13A 2QVGA 5JNRA 1UDRA 1Z15A 3QELB 3IDOA 1DRJA 2A9PA 3FFWA 4H3HB 4PYRA 1EWTA 1DC8A 3OO1A 5DKFA 3QEMB 1VLZA 1TMYA 3RVMA 1U2QA 2NT3A 3CKMA 3EQ2A 1QKKA 4JASB 3SY8A 3S99A 1ZAYA 1GCGA 4RWEA 3EODA 1NXWA 3RVPA 4G0XA 3GWGA 3O1IC 2WB4A 3OMWA 4NV3A 4Z4CA 1PEAA 1ZVVA 4MR7A 4KNYA 2F8SA 2VK2A 4FE7A 2M98A 2A9RA 1SD5A 4IMIB 5JNWA 5KC9A 3TD9A 2QSJA 1OXKB 2NZUG 1M2FA 2PUGA 1DP4A 1AB5A 3BRSA 4F8JA 5EWLB 5JNUA 2FN9A 4XARA 5TQ0A 4ZMRA 3IP5A 1M5TA 4EGSA 2F8TA 4KRFA 4JP1A 4MYRA 4OBBA 2GX6A 2FEWB 3M6MD 1OXBB 2NZVG 2PUDA 3M9XA 3QLVA 1DG9A 1JF8A 3FGZA 5IC5A 4G86A 2HQBA 3E3MA 2PAFA 3O1HB 2GWRA 4TLLB 1NXVA 7ABPA 1NXPA 4Z9BA 4MQEA 3CTPA 4W5TA 4YGXB 1D2AA 3G85A 2MYPA 2P9HA 5C5CA 1NXSA 1F4VA 4F06A 3D8UA 3IP6A 4G0YA 2FMHA 5DGCA 3HUTA 2IPAB 3OQOA 5KI6A 5IEBA 3OMXA 1NXTA 4DQDA 5FBKA 1GCAA 1IIBA 1LJUA 3O2SB 2PKXA 5IEJA 1ZITA 5FWYA 1U8TA 2FMFA 5DLEA 4RK7A 4KK3A 3F6PA 1DBWA 1YMVA 4WXEA 2FTKE 1ZGZA 1QQBA 3UK0A 5HKOA 1VRVA 1YVUA 4PE5B 3OLVA 3DBIA 1JH9A 1EWKA 1JLKA 2AYXA 1DCFA 3KTOA 3N6VA 2WMYA 1ABEA 5I4CA 1NATA 3HUUA 3G1WA 4YP9A 4RKRA 2H3HA 3F73A 5IBQA 2M1ZA 3GBVA 2GKGA 3O75A 2PUCA 1P6UA 1JFVA 2R4QA 4WWHA 3KS9A 5IX8A 1QO0D 4OG2A 2ZAYA 1PNRA 4OTZA 1ISRA 3KLNA 1ZDMA 4EYKA 1ZGGA 3CHYA 3HEBA 4JOQA 2P4UA 3CU5A 1DBPA 1DCKA 2IPNA 3KCNA 3LOPA 5IUKC 1U04A 3URMA 1L5YA 4TLMB 2YHAA 3BILA 3IPCA 3KSMA 3RQIA 1DZ3A 3HSYA 3QLTA 3HZHA 3Q7TA 4P98A 4XASA 1YTUA 2QXYA 1KGSA 4MAAA 1P2FA 3O21A 4XAQA 4ZYLA 1Z2EA 3HDGA 3M9WA 4YRZA 3GYBA 3R0JA 1QPZA 5KQLA 3GBPA 2B1JA 3F6CA 3OLZA 1RPJA 3I45A 3Q7RA 1WETA 4LE1A 4N47A 1MB0A 3FMVA 1U0SY 4KQCA 1FQWA 2PL1A 3RVNA 3SQNA 4LX8A 5CNJA 2FW0A 2Q5CA 3CG0A 4MS1B 2QVCA 4LDZA 2CHEA 1TJYA 4NICA 1EHCA 1T34A 3OLXA 1NXOA 1Z12A 2O20A 2IDMA 3TO5A 4DN6A 3L49A 2E4UA 4HNRA 3NNDA 3C6QA 4Q7EA 1MVOA 4TN5A 4Q6BA 4YS6A 1ZHHA 4TMYA 4N03A 4NCAA 1MB3A 3MM4A 5GQSA 4N41A 4EYOA 4MLDA 5FWYB 5TQ2B 1QP7A 1KMIY 4QPJC 1ABFA 1PHRA 4XFKA 4Z0NA 4QICA 3MF4A 1BDHA 1VKRA 2E4YA 4RXTA 2HSGA 2VYCA 3EAFA 3H75A 1BDIA 3H6GA 1M2EA 2E4WA 2HQRA 1DRKA 5CHYA 3UUGA 1P6QA 2L2QA 3HO1A 4RU1A 3TB6A 3N0WA 1YIOA 2LBPA 2NUBA 4DADA 5KQGA 1MAVA 4MRMA 2E4ZA 4RDCA 3FFXA 3GV0A 1Z26A 2HPHA 3RVQA 5BQ3A 4RKQA 3K9CA 4MR9A 3QLVC 1KRWA 3O74A 3KJXA 2JVKA 4RY9A 1JYEA 1L5ZA 1AB6A 2GBPA 2OQRA 5JNVA 1EFAA 2FSPA 4XXHA 1P8AA 2L17A 3H1GA 3QEKA 3DZDA 4EUKA 4S04A 2JB9A 1DCMA 1ZN2A 2FQXA 2JBAB 2X7XA 4O5AA 2FEPA 3JTEA 4IRXA 1U2PA 3NNNA 5EWMA 5HSGA 5IUJC 5KWSA 4G0PA 1R8JA 4EYQA 3LUJA 3VNBA 4IGAA 3OQNA 2PUFA 1RNLA 1K68A 4RV5A 3EJWA 2A9QA 4W5QA 4LDAA 1LJLA 3LUHA 5CNIA 4FB4A 1SXIA 4MR7B 4LRQA 5HM6A 4KQ9A 2WY2D 3HM9A 2B4AA 5IULC 1BDJA 3OLYA 3NBMA 2PUEA 4S05A 2JK1A 4HNSA 3JPWA 3LKBA 1BVHA 1D1PA 1URPA 3H1FA 1Y1LA 4RK0A 4L85A 3O2QB 4MLCA 4Q6WA 1TVMA 3HV2A 3OM1A 3VNAA 2PMCA 4WXMA 5E3JA 1C0EA 3C3MA 3MYYA 4MQFA 1SRRA 2FN8A 3QEMA 3N53A 3LUDA 1M5UA 3O2JA 4FE4A 5TQ2A 3I5AA 4H60A 2FQWA 1JBEA 3JY6A 1DJMA 3H5TA 2ID7A 1NY5A 3QX9A 2WWVD 3LUFA 4MR8B 3KKEA 3O1JC 2GI4A 1YS7A 3KG2A 3C97A 2MYUA 5FWXA 4RK4A 1JDNA 3HCWA 3A3KA 2JCGA 2ID9A 4KFCA 2LUOA 2MYTA 4HYEA 2FMIA 3DLBA 1USGA 1GUBA 4RSMA 1J56A 1TM2A 3OM0A 5T3YA 5IUNC 5TPZD 4ZMSA 3OQMA 1K66A 1ZESA 3FFTA 3KLOA 4N76A 3CS3A 5JS2A 3JVDA 3KYJB 3JVIA 3K4HA 2FLKA 3D02A 1BA2A 1TLFA 2L19A 3CNBA 4QYWA 4ZJPA 3HDVA 4GNRA 3T6KA 1HEYA 3EULA 4ETMA 2N9UA 2A9OA 1MIHA 4JA2A 3CG4A 3QX8A 3IP7A 3CZCA 4N0PA 3B2NA 2KYRA 5B3JC 8ABPA 3QLUC 3H5OA 3T38A 3RVSA 3N0XA 4G0ZA 1YMUA 2FMKA 5PNTA 4MS3B 4MQEB 3Q7SA 1E6LA 3L6UA 3ILYA
chains in the Genus database with same CATH superfamily
4TZ0A 3CNQS 5U9CA 1F5SA 1KU6A 1AMNA 4L8YA 3K72B 4KC0A 2IEAA 1PBNA 4WY2A 4F0JA 3JQEA 3TD6A 3UA3A 2IZ1A 3VQTA 1SXHA 4OQPA 2REXB 4MDFA 3JYHA 5NLLA 4Z4EA 1D04A 5E7MA 4TSFD 5TGDA 2NGRA 4NMMA 1IB0A 4MV1A 5DXAA 821PA 5BSMA 1XRMA 4JYBA 4DXAA 1SXJD 2ZPUA 3M49A 1G21E 5LQAA 5EQFA 4DR2B 3FDXA 2WG1A 3DEHA 5KHLB 1AK9A 4ZVUA 3AJAA 4IMPA 2X0DA 4KVFA 4C08A 1DOHA 1UDCA 2AVNA 2H1FA 3QLUA 4NEGA 5HA5A 2DQKA 3KD3A 4W1QA 1Q50A 1E3LA 1Z34A 3D7SA 3KDSE 3NDPA 4ND8B 4WNYA 4B7UA 4AJ2A 3MBOA 1N57A 4OMUA 2G1KA 1L9KA 4E7OA 5JASA 4EPWA 3AUYA 4L5IA 2E18A 1G7SA 4KAAA 4KMRA 1NI3A 3SI7A 4AUNA 2IU4A 2JFYA 3DE0X 5H80A 1M6HA 5B7GA 1A7AA 5AFSA 5H02A 3F5MA 1RRMA 3OFSA 2YYAA 2F64A 2FZ5A 3LW7A 1C7JA 4J16C 5AOCA 3PENA 5HCIA 3T1QA 1MJGA 3R0ZA 1A9XB 1MOZA 3RVKA 1LPOA 5JTUA 2WJAA 3M1YA 3UXYA 2FJPA 2IDJA 1XMQB 3OCJA 3AWDA 4AWXA 3JQ7A 3MWDA 3JQCA 4TWZA 1UEXC 2ZYHA 2V3CC 1IXZA 1ECFA 3K8ZA 2XDWA 5EZQA 1G3IA 3EOBI 6GPBA 3N5CA 1JFFB 1TYEB 1O96A 2OFXA 2QN3A 4N0QA 5DMXA 2G5PA 2OQVA 3LQFA 3LECA 3NTUA 3OPYA 3OOSA 3V7WA 1DEOA 4RL4A 1YR9A 4FS3A 4I99A 3T1NA 1P9NA 3NVDA 3WAGA 1KJIA 2RB4A 4MMZB 1MX3A 2JFGA 1QDEA 4EVRA 1AQ6A 1QGED 1TCUA 1PQ4A 5B2ZA 5B2FA 1K6MA 3THSA 1BYIA 3CLKA 5K3AA 1TYZA 3OQ1A 4JCCA 2W43A 5KAMA 1N1MA 4RPCA 3ZE9A 5LU8A 3TR5A 1U98A 1PUIA 1Y6JA 2YMLA 1IOZA 3AVPA 4FUTA 3H11B 4P0PB 2VN8A 3C85A 4Q7LA 3S29A 2JI7A 2Y05A 3U2QA 2DR3A 4C89A 3W05A 1CJVC 2G88A 1JG3A 1BD4A 4EX7A 4QDJA 4TYQA 3P27A 5DGTA 3RS7A 4PHGA 4REQA 4EHDA 5JATA 3ZZTA 2LP4Y 2VUSA 1VPTA 3HU1A 4MS4A 4X6UA 4F72A 2CV2A 3PJRA 1OIWA 2A4MA 5TXGA 5CA0B 4K2HA 1PS9A 2Z6VA 3I92A 3KYIB 4UTRA 1TJNA 4XKJA 1ORWA 5GWXA 2ECQA 2R84A 3NJ4A 3CPEA 5ESRA 6REQB 1PK8A 1LBHA 2OYCA 1CUXA 5I7SA 2Q6OA 1Z18A 2NPOA 2WG0A 4M3NA 3C7DB 3L9XA 3RSZA 3RWMB 2JLYA 3WO1A 3VYRB 2LZ0A 1GYPA 2VAXA 3QPUA 1ZZEA 1LX6A 5CVEA 5DM0A 4YAGA 4ZCMA 1XWWA 5CK4A 4WK0B 2YZNA 3D6NB 4M7OA 4AJ4A 4Y9TA 5LOVB 4BRSA 2BHSA 3I8SA 4E7PA 4GPD1 1YACA 4F11A 4X8MA 3OLWA 4AIIA 4N5IX 4KGXA 1N75A 2C2YA 3HCAA 1Z25A 3OCCA 4G5GA 2HMYB 4IDOA 2QLTA 2BGNA 2V7QA 2YHIB 4OMFG 4DC9A 5IJ9B 5IJZA 5JY1A 1RZ3A 1ISPA 1XDGA 2O2GA 3CEHA 4NCHA 5HRAA 4QDXA 4BFYA 3CINA 4LJRA 1TVKA 1DQRA 1EZZA 3AR5A 5IAEA 2PKRA 4NAHA 4JJ4A 3RTBA 3FYUC 4BVHA 4FI3F 2BHTA 3PPVA 1AN0A 5C1IA 1WDWB 2AJCA 3UC9A 2GD0A 1CQXA 2L18A 1GRVA 4RMGA 3RSFA 4P80A 1U2ZA 2GPAA 2X5KO 3AHHA 3HYRA 4ZCLA 4D3SA 5DIFA 1ZUNA 3FPSA 3I9LA 5KOHB 1U2SA 4B83A 3FHCB 5A5VA 2H16A 1M8GA 1J5PA 1Z6XA 1L5NA 1HNNA 3UAWA 4FMDF 4WLEA 1DCTA 3UWOA 1W0JA 3CLTC 5DHAA 3ND5A 1UBSB 3UB3A 1J2UA 3E5HA 2R8ZA 1G5TA 3URKA 2XOXA 4CG1A 1P1HA 1FRZA 2VKTA 5CVTA 1YBHA 3GT7A 2QORA 3RBXA 5LBIA 4D9NA 4HYYA 2JH9A 1JXAA 1JLMA 2VSXA 3F96A 5JDCA 4LF4B 1M74A 4Z0PA 4AY5A 1XAIA 4RGQA 4HATA 3SYTA 4EVSA 1EP9A 3TF5A 2D8AA 1CS0B 1OI2A 3QVLA 2AN1A 3A6LA 4URWR 5HTOA 2UVQA 3ZGXA 1B8PA 3O8DA 2Q99A 2DBYA 3PHLA 5FAXA 3T12A 3VHXB 2PUHA 2W4MA 2C4WA 3H13A 1D1QA 1BHO1 3BFXA 4R1UA 1QJ4A 3R9KA 2B98A 4D9GA 5IFLA 3CB2A 3QPVA 1XDZA 3JWHA 3OSUA 1F5NA 1W0CA 1I2CA 1JE0A 4XVUA 5FWXB 3EVTA 1NT4A 1M6NA 2VUUA 3L0CA 4L74A 4MDYA 4TWRA 3I09A 1JXOA 4D82A 4EQ6B 1ULTA 4KUEA 4AZ3A 2FKNA 3F1KA 1M8FA 3AESB 4KRXA 4OOFA 3GEIA 5DTIA 2RBGA 4H3HB 3VAZA 3I0ZA 5BNWA 4V0NA 4V0ME 3DT8A 3KTDA 1SB8A 3F6EX 2O6LA 4YT5A 2FW7A 1V5GA 1P5JA 3UXEA 1Z7GA 1ZU4A 2H31A 1XZDA 3IDAA 1WXXA 1W46A 1IEWA 1KI9A 2V4UA 4QX6A 2X9LA 2ACKA 3NC1C 5KNBH 2EIXA 4QQFA 2RGNA 4Y6QA 5AUQA 4ECEA 1LW6E 2HA7A 1U3TA 2WB4A 3OMWA 1T9DA 4KZPA 3DWEX 5FUQA 1WP4A 4DCNA 1PI3A 3MMPA 2J3LA 1PNOA 3LT1A 5IKXA 3NFRA 4B3CA 4WADA 3MB8A 4DQUA 3T9FA 3H86A 1I7SB 5TMPA 1RLJA 2X19A 4YRMA 4E21A 5ALXA 1J97A 1DBVO 1LTKA 2Q8NA 4EZIA 2IDKA 2NPFA 3L2OB 3PF9A 4CKYA 2OAP1 3OZIA 2ZREA 4NK5A 4Y1RA 4DCVA 3LXMA 4UOQA 5EKDA 5JNUA 1NOKA 1XN1A 2HTEA 4BVKA 1L1FA 3WE7A 4BEVA 4DXDA 1PFUA 4JI2B 3IO3A 1HSZA 1NRIA 4NE7A 1GR0A 4GZ5A 4IXMA 5I47A 3LLCA 3UF0A 1OI7A 1XNHA 4TLLB 1W29A 1I1HA 2ZP1A 4W5TA 1P1BA 2CXUA 3PFNA 2XMRA 3CGWA 2XRMA 5B4VA 1ML4A 1NZDA 4G9BA 5C5CA 1L7OA 4C30A 1XMVA 3RS0A 4CIWA 1M76A 3H8VA 3LYLA 4JVSB 5DX1A 1AURA 4CYMA 1JG6A 3JTMA 1T2AA 4WDRA 5C32A 5FF9A 4DQDA 5FBKA 4BLQA 3JD0A 4JI8B 3OZCA 2BRUA 4BGIA 4AI6A 1WSWA 1WF3A 2PKXA 2YYSA 1VHJA 3I9MA 1CC1S 3L8EA 2P3LA 1GKIA 4KTTE 5B30A 3D3EA 1WSBA 2RFLA 3JALA 1DBWA 3OZWA 4O4IF 4Y0AA 1BSVA 5CT5A 5DM2A 2PMKA 1UBOS 4NYIQ 1NPTO 3MYRA 4H7HA 2IE0A 3V3TA 3WA6A 4JP3A 4JBLA 1RM5A 1DCFA 2YY7A 3N6VA 4YUVA 3FUUA 3EPLA 4JKYA 1XA4A 3Q5DA 2Q1SA 3WI7A 5IBPA 2P77A 3SJAA 4L78A 2EDCA 3O75A 4IMRA 1XEFA 2FUG1 3INNA 1Y3HA 2I7XA 3JYPA 3WLHA 1OWPA 5HBRA 5IHXA 4CKBA 2XCRB 1E2DA 4IXDA 3QE9Y 3D64A 1XT6A 4AS1A 3U37A 3TINA 3V46A 2GEBA 1L8AA 4G9EA 4OP1A 2Z6AA 1M1UA 1YU9A 3LSTA 4GRIA 2Y76A 1E3SA 4B6QA 1WBJB 2QAIA 4LC1A 1YL7A 3HBFA 4JGGA 3FTDA 5JXHA 1OA1A 2YHAA 3IPCA 1QGDA 4JT9A 4JV5B 3GT0A 3BWXA 2XYQA 3BYZA 2UXCB 3CLUC 3B9RA 2C2OA 3Q7TA 4TL9A 5I9LA 4HNUA 2ZIFA 4UULA 1VIAA 2C9CA 2OHOA 3PS9A 4CIVA 4UFPA 1O08A 1WMSA 5C31A 2QQ0A 1QH1B 5DASA 1BOOA 3U3XA 4D96A 2QB5A 2RAVA 3BJIC 3KUXA 3R0JA 3RO7A 5LYJF 5F73A 4WEQA 1UJCA 3KU1A 1RPJA 2GHTA 3JQ9C 3R3WA 2H2DA 4MRAA 3BH7A 4F9GA 3DFIA 4KIUA 2PL1A 1KVRA 5EP4A 3SQNA 4H6XA 2GFIA 1UMKA 1ATZA 4LYYA 1A95A 4IRUB 3WOHA 5JZMA 1C9DB 1USWA 2CHEA 2FOXA 3DT6A 3UT6A 5E4TA 4UUPA 1OI4A 4Z7NB 2OOKA 3T15A 1SKQA 3EY4A 5CCBA 4QRHA 3K0SA 2CDCA 3FR7A 3MD9A 1ESNA 1GD1O 1BX0A 5L45A 2XXAB 4FFBA 1DAPA 1WUJS 3CKYA 4UNQA 1YRWA 5HR5A 1D8AA 3ETNA 2DLDA 3V3KA 5TS3A 2QTCA 4M9SA 4EYOA 4H6WA 3ZWQA 1DLIA 4CM7A 2GESA 4FGWA 4ZVRA 1PDWA 1VPVA 2J5BA 5FA6A 4Q3DA 3OJ0A 5IC6A 1G3QA 2TRSB 1K6JA 1K8XB 2EJTA 4JXJA 1B7GO 5JJ5A 1B6TA 2HQRA 1Q0UA 2WIGA 5C1BA 4JBHA 1R74A 4GI5A 1IHUA 3IDFA 2IVFA 3BFKA 1Z5PA 4EEXA 5AM3A 1EFHA 2ZTHA 2E4ZA 1KYVA 2VXYA 3ZLUA 2J3KA 1BRTA 2IZ7A 2J6BA 3DUFA 3H97A 1TJ4A 3SKYA 1E7MA 2RK4A 1VBFA 2H7VA 1KSFX 3IR7A 1P5FA 3TEMA 3TQQA 3OOYA 4NABA 2JAOA 3KWJA 4DNQA 2VPIA 2QPAA 1N7JA 5C80A 4CM9A 1TAHA 1PG5A 2RKOA 3E3AA 3W5CA 4KN9S 4EFMA 4EQ6A 5L51A 5EJ7A 2M2IA 2VK4A 2OHJA 2WNSA 5MN6A 2Q4OA 1Y4ZA 5DLQC 1R0YA 4BNKA 4O4LA 1KJZA 4K0RA 3V4RA 2GO7A 1K68A 1I6LA 1R5JA 2BEVB 4BZZA 3SICE 3QJ5A 3W4KA 4MROA 3T3NA 1SXIA 2AZTA 2IYSA 3IJ5A 1MC4A 4DXHA 1E2NA 1WX1A 1XALA 3DSRA 3GJ8A 2BONA 1K2VN 4S05A 1KO4A 3DONA 3DV2A 4CLEA 4KE7A 5DGHA 5BR7A 1CQJB 3N28A 2ZE7A 4J75A 1URPA 4PYKA 3U81A 4MJLA 1ZK3A 1ZGBA 3S2EA 2WNHA 4FFOA 5L8VA 1GRRA 4WXMA 5JO0A 2DQYA 3IT1A 3MYYA 3S81A 2A84A 2QS9A 3ORSA 1PFVA 1HE8B 3QYJA 3PPXA 3UYKA 4FE4A 1C9YA 4HS9A 4RJLA 2CUKA 1QF6A 3ICWA 1X9IA 3B1JA 1KYWA 1NUQA 3TQFA 1MAWA 3DPSA 3DG9A 3VU9A 4MRPA 4XR4A 4EI8A 3QX9A 1USVA 3FKSD 5CXSA 3NRJA 1TLTA 3WGJA 2GI4A 5CXUA 2BE7A 3AU8A 4UE2A 1YB7A 4E94A 2EX0A 3ZI0A 3GLGA 2GEDA 2NZJA 3PHCA 4OHXA 3M83A 2GBLA 4ZDJA 1VM6A 2QTNA 1UFQA 5F5XA 3PQ7A 1LH0A 1NNI1 1QSGA 2EJBA 3M6WA 4HB0A 1HQCA 4WZAB 4GLLA 3COZA 1TUEA 4N18A 1EKXA 4CTOA 3L0DA 3QE0A 3GLUA 1JAXA 2WA1A 4B4UA 3GIWA 2PGOA 3ORFA 3C1OA 3SJUA 3UM9A 2VS1A 4ER5A 4XVCA 2BE9A 3H2HA 1EXVA 3DMTC 4FD2A 4D2IA 1KPGA 3BXOA 2IIPA 3CS3A 1S8AA 3T5DA 2CT8A 5LBTA 4M6WA 4U7TB 1EGQA 1FMJA 1TLFA 5J4LA 4OHMA 2O8CA 1ZKMA 2YYYA 3JSAA 1E1YA 1IY0A 2JJQA 2N9UA 2E5LB 3NJRA 5EUQB 3GFSA 4XIGS 1TIKA 4G1VA 4AECA 4IS2A 2GHQA 1NLYA 2DB3A 3F1LA 3QLUC 1XEXB 2GZ3A 3FNQA 4H6VA 4IDFA 4J2HA 4TKLA 1BMFD 1JI0A 4G0ZA 4FC7A 4WLNA 5BORA 5E8RA 1Y82A 5EQJB 2CLFB 3NB0A 1NU6A 1OE0A 3L6UA 3ADDA 4WOBA 3L7MA 4UOEA 4HDNB 2H08A 4L6CA 1NVUQ 4CMEC 4KWEA 1C8BA 3CZQA 2F43B 2FPIB 1RYNA 1VJRA 2OB2A 5CYOA 1R6DA 5M3BA 1UOOA 2E4VA 3DLHA 2G5TA 3LK6A 5ALQA 4KBGA 2D59A 4N8EA 3F73A 4KREA 3U13A 3NBYC 4G5QA 4WKBA 5EWLA 5IBCA 3NTOA 2F90A 1IK4A 2IKSA 1NTOA 1R2QA 3AWIA 2AEJA 3NATA 2NUAB 4ENQA 1R18A 1TMKA 2DPGA 3MRSA 4W5JA 1I7NA 4RGYA 3EF0A 5F98A 1Y3BE 1KMQA 3QQPA 3TTVA 4CUZA 3U56A 3A3YA 4OF4A 2X13A 3EEIA 5E6UA 2Q29A 2XAAA 3IERA 3KSRA 3EXFB 3WBJA 2V7BA 3AGQA 1NQTA 2ZIWB 4HWOA 3ELDA 2IU6A 4DV7B 3TLBA 1PJ3A 1ZM4A 4RJIA 1EDZA 3RROA 3OPXA 1DBQA 2PV0A 3MQFA 3H6KA 4C07A 4W5OA 3FYTA 3O90A 2AWNA 1U3CA 5IAOA 3D5QA 3STYA 5BN4A 2P4EA 4LYAA 3UQYS 4ZEXA 4DDTA 4WMLA 3K0CA 4U5QA 1Z7WA 1UAYA 2WT4A 1QB7A 2Q8QA 2WYIA 3H1TA 4DFDA 3M5CA 5EEHA 2RHGB 4TSRA 4AT1A 1NN5A 1NKVA 1G19A 4UXHA 1HKHA 4OGGA 2VDUE 1RBZA 3WHLA 2B5VA 1J5XA 1ENOA 3EUAA 2B2NA 4ND3A 1XQ9A 1E8MA 4AG6A 4P53A 1FDUA 1I36A 1CG6A 1V6CA 2H4JA 3BXGA 4K6OA 4OQDA 3G23A 3AUSA 1XN4A 3DGFC 3OWXA 2AQHA 3ZTWA 4PO3X 4QTZA 3B13B 2NZWA 4O33A 3KUKA 4WUTA 4Y2TA 2XMDA 4YLEA 3CNLA 4B3JA 1U9IA 5EE5B 5IVKA 2XR1A 3ESYA 1SBIA 2VHZA 2WSSA 1NJ5A 1BNCA 2JASA 1XMIA 4GX5A 5SZIA 4CFSA 5FRDA 2OAEA 3FTEA 3NTRA 1Y89A 4J90A 3R44A 4NIMA 2X58A 4TMFA 3EGCA 4U3JA 5HKAA 2XMPA 3ZI7A 3OTOB 2FP4B 3IKJA 4M0EA 4LGCA 1ECJA 4QODA 1RRVA 4NU8X 4IH9A 3I3OA 3HEAA 1NIPA 3HXLA 3F5DA 4I1IA 4ALNA 2B0JA 1CD5A 3O8QB 1VLMA 2IITA 4FYWA 4N7BA 3ZGOA 4DTCA 1KBQA 3ZCVA 2PQMA 2PZJA 4KPUB 1JRLA 4PGGA 1AGRA 3L6DA 4MWDA 4EB3A 5A3JA 1CY2A 4ISCA 5DB4A 3WXMA 3KL2A 1EB9A 1L4YA 1NFRA 4YGYA 4YFVA 5DI3B 1DQPA 1KK1A 1PO7A 3LTEA 4MR8A 3VVMA 4EB0A 4MO9A 1J25A 5B1YA 5F9FA 2WHPB 5AW6A 4P22A 2EFYA 3Q7QA 5JHGB 1VCOA 5AVOA 4H1WA 3LOQA 1XPOA 3P4YA 4JMPA 4MKXA 4YUYA 4B6EA 1X2BA 4GKVA 4OBWA 4PG7A 4Q66C 1JDBC 3GLFE 1IU9A 4MR9B 1BG6A 1TYCA 2PGNA 4H35A 2QBYB 1LDMA 2J9RA 5BSUA 1LX7A 1RC1A 1RHRA 4FKMA 3TLKA 4RMHA 1Q21A 3UOWA 1D6SA 1S96A 1DKQA 2JVJA 4RZSA 3U1VA 3VPCA 1CZNA 4EL5A 2OGSA 5CDHA 5JNTA 4DCMA 1T9GR 4J1NA 4LNUB 1OA0A 1WOYA 2BFMA 2J4CA 4L9SA 1Q12A 2V7TA 3PDIB 3VZDA 3NKFA 5IWCA 1U3FA 1YR7A 3DAPA 2VTBA 1RBMA 2MU1A 4GP7A 4H7PA 2Y0CA 4GYWA 1OFGA 3X43A 1OBCA 1XQVA 3BFJA 5FI0B 1FXWF 1MIOA 2BDUA 4Q21A 2G36A 3KQPA 1H1DA 3GL9A 1JLSA 1SK8A 2WP8J 3OHSX 2ZS9A 4P5PA 3LY5A 1D7AA 1GN8A 2XUJA 2Z8ZA 5FNZA 4B6SA 3BH0A 5M7EA 3KDAA 1H3FA 4TSKA 1UXHA 1NQOA 3E61A 4ZALA 2FEOA 5JIBA 1GL3A 4ODIA 1N0WA 1YQWA 1W47A 2DHEA 3QUQA 3QZUA 4FMBB 1XX6A 2PIDA 2X23A 3M6UA 3PX3A 3TLGA 3B60A 3QOWA 4CW7A 2C0QA 3A3NA 1GQSA 2Q6VA 3LF1A 1ORRA 4GMXA 4LHEA 1CKEA 4ON9A 3RC3A 3S28A 2P2GA 1G64A 1C1XA 2JJ8A 4PAOA 4BKOA 4DB4A 1U9ZA 3L77A 3LHFA 3REGA 3V9AA 1RXYA 3LX6A 4BFLA 1VBMA 1RKQA 1QIDA 1IXKA 3KSDO 1JB9A 3L18A 4RHEA 2V7XA 4DE5A 1V6SA 3IEKA 4F38A 4HUQB 3DV9A 3WNDA 3UHAA 3D4NA 4FYXA 4U6SA 1O8BA 4ENPA 1D03A 4FLEA 2K4MA 1SFRA 4BASA 5JARA 2OMKA 1UF9A 1ULUA 3HJAA 3RUPA 4J16A 4GSYA 3V1NA 4MVJM 2GNAA 1L7VC 1VRCA 2I6GA 3DVLA 5CU7A 2WUEA 3CBGA 4BZXA 5JQGF 1IRXA 4CIDA 4K40A 3DO5A 2H4YA 3P9CA 3I2IA 4R81A 1QQAA 3KWMA 3RT9A 1W19A 4DS3A 2HLDA 1C9KA 1ZY2A 2GPBA 2YIMA 3FN4A 3ZZNA 4X66B 4MYSA 4JWTA 1U6JA 1YB1A 3PYLA 3KZVA 4NS1A 3WWDA 2OZEA 5JADA 5FOXA 2JW5A 4I9HA 4OJNA 3AFGA 3AM1A 3GR6A 2EBHX 3KQWA 1W36D 1A96A 3G0HA 2X5XA 1E1RA 3KIPA 1U7XA 5IAJA 1SC6A 3E0XA 1OYWA 2DWPA 2GEVA 4X71A 5KIAA 2VDOB 4IGEA 3V2UA 3KT8A 2OCYC 4DLKA 5IANA 1F20A 1QHGA 2TECE 2Q7XA 4P2BA 4ZKEA 4ZTZB 2ORED 2CB9A 2XUHA 3AB7A 4JEUA 4CV3A 2CCKA 1I5EA 2J33A 1NVEA 2BCJQ 3AHCA 2GAOA 2OCIA 4J49A 3UW3A 3ZCUA 2JGAA 1GZUA 2WJZB 1D2GA 1M1NB 1GGJA 1QKKA 2IYYA 3IRVA 1N5KA 5DM70 4RCYA 2IHUA 4FSDA 4J7UA 4KN8A 3ZGVA 4S35A 1WD5A 4QJ5A 5JAHA 2K6GA 3AOGA 4LZAA 1D2HA 1C81A 2NNLD 1JPNA 3QI2A 2UDPA 2COKA 1P5RA 1LSUA 1Y48E 3ICOA 4KOEC 3RUFA 4CE6A 1FS6A 1V16B 4J0QA 5U4XA 2QGFA 2V4MA 3S5UA 2PDAA 4CEJB 1M0WA 1DWUA 2CCJA 2ZAIA 3IBGA 1KL7A 4IX1A 3VZRA 1TKAA 2QJOA 5IZCA 2P6PA 4HN2A 1Q19A 1YCHA 3EFOA 4II7A 4D9CA 5G3ZA 3WFIA 3DYIA 1U0NA 4PN3A 4DLAA 4BUJA 1DFGA 1M34A 3EG9A 3VC1A 5IK2D 3V7YA 1RMTA 2PM8A 2D2XA 5TQ0A 1YDFA 4IKPA 3B70A 1ZI8A 2ZPAA 4RETA 3HBLA 4MUAA 3U31A 4OQNA 4NMHA 4PHCA 4MYRA 4F93B 2QD5A 1FL9A 3HXQA 4G4JA 2VWHA 4BO5A 2FE4A 4YAKA 2WICA 3DE2X 3KAPA 1NRJB 2BW0A 2H6EA 4O2BA 1GARA 2H1CA 1ACJA 5DTMA 1ZA2A 3L8GA 4X9XA 1N2EA 1YQQA 1ZXBA 4YCMA 1CZHA 3B1YA 1D2AA 1O95A 3CM0A 3IOYA 1MNAA 4JC4A 1TQDA 1VSBA 4LHXA 3HVHA 3ZQUA 1FVHA 4BO6A 4JXZA 4HPWA 1C30B 4A5SA 1RJ9B 3HJTA 3QPBA 2QIOA 4FSXA 2PR2A 3GGGA 3DQQA 1FX0B 5CDYA 3WLIA 1HFWA 4FEGA 5AM5A 3H1PA 2AXPA 6NULA 5KU7A 1W4AA 2AI1A 4XJSA 4IEFB 4UEQA 4ZI7F 2CNWD 2IZ0A 2QYSA 1AGYA 3EH2A 3GW8A 2F8MA 3GDFA 3HA5A 2X5OA 4CM9D 2B9VA 2XWBF 1RDFA 1XEWX 4KQ6A 3H2GA 4DUYB 1G4HA 3I05A 4MZXA 2WAAA 4I4IA 2PN1A 2X7HA 4OEHA 5C9ZA 3SZLA 2VJMB 4PYMA 3E9DA 1QIJA 5KTMA 2VYVA 2Z8YA 4M0UA 3VYTB 2FZLA 2VP0A 5DF1A 3GBVA 4K6CA 4QDTA 3GUHA 4K9LA 2PS9A 2WZBA 1I0ZA 1E66A 1IXYA 2GASA 5CH5A 1QGZA 2HLHA 4CMBA 3SQDA 2V9PA 4CQLB 5CIYA 5CB4F 1DTSA 3FUWA 2ZUBA 1TF5A 1TCAA 3W8DA 1M0SA 1N1GA 2CLCX 1VJDA 5FBRB 2P4UA 4F5DA 3TDNA 4CCWA 2ZIZA 5EP2A 1ORDA 4RFSA 3KCNA 2Y67A 1E1CB 2JFWA 2ZBDA 3H18A 1K75A 4MNTA 4BB0A 5HX7A 3RODA 1C50A 3HN7A 3A9RA 1B42A 2DLCX 1SA0B 3NAMA 3QLTA 2HK6A 1YCFA 2YBEA 3R6TA 4F4HA 5G0UA 4ND5A 1PJ4A 1V8FA 4E0BA 5LOVF 1UKAA 2IPXA 2WM8A 1KGSA 4ZCPA 4TN1A 5IARA 2O1WA 2JD1A 5FPTA 1PQPA 2UZ1B 4NK4A 3D3JA 4YRZA 1QTIA 3AO0B 5FYDA 1RFGE 2IEIA 3SC3A 4M9XA 3L0SA 2X2EA 3ABZA 3E5NA 4X1YA 1DT3A 1JDUA 2FPRA 1T36B 2GB4A 3LBNA 4ZQEA 5E38A 2HR1A 4KO3S 3FBTA 3LKZA 2F1JA 5JCJD 2QLJA 2FW0A 2NSYA 1M0EA 1K1EA 1N8KA 1IN8A 1Z5OA 1Q7EA 3IQXA 1W59A 4CR7A 4TTJA 3AFHA 1T34A 3NHBA 5AO9A 2ZYSA 3DHEA 3ELYA 2QP9X 3ILSA 3Q6MA 1CQZA 3A2LA 2I4RA 4TL6A 4UBOA 1KI7A 5FPPA 3M4ZA 1RVV1 3D31A 3O8LA 4TM8A 4EEKA 4PQYA 1TW2A 4RD4A 1G20E 2QX6A 5D5HA 3BD8A 2KSQA 3IVXA 3O03A 1D7OA 2BFFA 4N03A 4YJGB 1DC3A 4D9BA 1XJCA 3N2LA 5BY2A 1BE6A 4HKTA 3MCUA 1JHUA 1KJWA 1LKZA 2XZDA 2R9VA 1ABFA 1NVMB 1PKXA 3BL5A 5BRJA 3RAJA 4NYIR 1CX9B 4OMDA 1IZYA 3UJPA 5I7HA 4ZI5A 1SHTX 3AR8A 3D6HA 3W5HA 4H31A 1M2EA 1KI6A 5K0LA 1WPGA 4KLZA 3CZPA 1NPYA 2JHFA 3L5OA 4GBJA 3TLYA 5L4SA 5MF6A 2L2QA 3WLTA 4DADA 1KZ7B 2FWIA 2BSAA 4TSFA 1YRQA 1XD2B 3IRUA 3LDHA 2HHLA 1W5EA 3P5SA 4M0CA 5ESDA 2PV7A 2G3YA 2PMDA 2H1VA 1QGYA 4ZU1X 4F1JA 1YUNA 1NYQA 4CV0A 1VYTA 2V55B 1FYFA 2PPVA 2RGAA 3ZOZA 2CNDA 3TWOA 3ABSB 1US8A 3SJBA 3N0TA 4KITB 2G72A 3ITKA 2IUUA 4XH9B 1CUEA 1Y8AA 2QTZA 1SZJG 1XZFA 2VP9A 3DZDA 2WPNA 3EZ2A 4H1HA 5JHHB 3B5EA 5IDYA 3GLQA 1Y6QA 4ZRDA 5J9FA 5C51B 1SXPA 1M2GA 2NU7A 2Q46A 2JLRA 3GLGB 2DPMA 4IAOA 5EE3A 1DADA 2IYXA 3EF1A 3JQBC 1T9BA 2AA3A 4IRXA 3T3IA 3ZWWA 3LCUA 1ZD5A 3ND8A 1R8JA 3K20A 3ZBUA 1EVJA 1PZHA 1Z74A 3PWTA 4NBVA 4QNMA 3SHOA 2ZBEA 2Y66A 3RIGA 3UQZA 3UWPA 3W3AD 3CUYA 2W6IA 4RCZA 4WOCA 1IN5A 3TLJA 2HADA 1ZNZA 4DV6B 5EN4A 1I32A 2IYWA 4ABTA 3WGLA 1AQJA 4IH4A 3IMGA 4L73A 3GLHA 4BAGA 4S1VA 4IIJF 3SYMA 4IIJA 1V8BA 1U28C 1N2CA 4R41A 5BR4A 3MS4A 3SD7A 2C8LA 4ZI7A 1WXIA 1RI4A 3M5WA 2ID4A 4L75A 1NUAA 3UC5A 1SRRA 3QEMA 4MV3A 3X2SA 3HUEA 3LUDA 3MT0A 4DR7B 4COOA 1QAMA 3VO2A 1ADCA 2MMCA 2B7LA 4LWZA 4H27A 1U02A 3MRVA 5F9MA 4TTIA 4ZIRB 3C4VA 2OHXA 3GVHA 1U11A 1D1TA 3SBXA 4CQLA 1X1CA 2R1TB 3ZC3A 2FW1A 1CZUA 2IYRA 1RJEA 3Q40A 3PGVA 4G63A 4B75A 4H16A 1WA5A 4J4TA 5FFFA 4EJSB 5JXIA 3WGYA 4B8YA 1W1WA 4O8ZA 2PG3A 5IAGA 1A76A 2VHTA 3TLEA 1Z2PX 5LP6B 1PR2A 3U1TA 2HCRA 1RI2A 3EPPA 3H0CA 2DZDA 2UZIR 2AMVA 1RACA 1D4AA 4BX9A 5I6DA 2DKNA 1MTZA 2IGTA 4GZLA 1FUIA 3FFTA 3JZFA 4YAFA 1VMKA 2A58A 2W6JA 2OC4A 3L7DA 3K4HA 3NORA 4L0MA 3W8EA 2LGJA 3CNBA 1RAHA 5C7IO 3C5HA 4B2IA 3NYIA 1IQUA 1KMCA 1QVAA 3AR2A 2A9OA 1EDDA 3W6UA 3WAKA 3KQVA 4JA2A 1QIEA 1X1RA 1CDZA 2ZRPA 3N59A 3PG5A 3R3JA 3GQBB 3M70A 4ER6A 2V6GA 3QX3A 3T38A 3U4CA 5ALWA 2EW8A 1DMRA 1FRQA 4KQHA 4XUCA 4OI1A 5HQ3B 3MZ0A 2I29A 2I4NA 2ZJ3A 3WJ2A 3Q8LA 1PJQA 3EMKA 4MITA 1K3FA 3BXHA 3Q41A 4EG6A 4QUEA 2E89A 2O2JA 4G0VA 2EXXA 2PCJA 4GYJA 3U5TA 3G82C 3FWHA 2YHUA 2G4VA 1YB2A 3TQSA 2Q3BA 1DQZA 3BF7A 1Y4AE 1TRHA 2WLSA 3AUUA 4GC5A 4UUQA 1ZGAA 3FNEA 5CVVA 5FTNA 5GY7A 1AXEA 1F1JA 2BHRA 1OXUA 4YWHA 3FMFA 3R4CA 5KTOA 3FRIA 3PBKA 2Z98A 4MW4A 4WKPA 1K5DA 3GFVA 3AG5A 2XKBA 5JPIA 2FOLA 1FMLA 1APBA 1T4GA 1U7OA 3RUCA 3AZQA 4NCBA 3JWEA 4DBLC 1H69A 2PT7A 5CVDA 3KE8A 1XQWA 1W0JD 2BIFA 3DVAB 5F1YA 2CD7A 4XW2A 1JA9A 2QEQA 2WAXA 3GJQA 3ZDBA 1EG7A 1PWXA 2I67A 3G2PA 3UWDA 3A1CA 4BTVA 4LY6A 4W1RA 4Q3EA 3OLCX 5JRJA 5EHQA 5TS2A 1PWHA 5K8IA 2XCIA 5ALKA 1SBHA 2GZMA 3RR2A 2ZJ1A 2X1HA 3QWAA 3MQ4A 5FA5A 1XVVA 4CIYA 3WLEA 4EZBA 1DQYA 3KUDA 4I0WB 2AXNA 2RJNA 3O26A 4MVYA 1D2NA 4DKXA 5JWOA 5HILA 3BCRA 5G3YA 1TZBA 5EIXA 3WKEA 3R41A 2HAEA 3EDMA 3G49A 3RK4A 3UVEA 6Q21A 2QKYA 3A9TA 1Z2NX 2CN1A 3MJ4A 2HF9A 4UHCA 5JSFA 2HWWA 1RM0A 3CW2A 1P0PA 2DQZA 1P7PA 3A6HA 3QBTA 1V7ZA 1YZNA 2A67A 4PWYA 4QJ4A 5COQA 1MV8A 4ZK2A 3LW8A 4AQDA 5K0JA 2GYVA 1FTSA 1BCRB 4HVLA 4Z1OA 3MPOA 3WXBA 3VH1A 2J0UA 2QRZA 1Q77A 3Q3JB 5CJ2A 3PC8A 3KR1A 3MTQA 2IPLA 4OATA 1ODJA 2ZSUA 1XK6A 2R96A 3PXEA 4LY0A 3WFZA 1KEPA 3RRJA 3S3TA 2J41A 4JI0B 4P3XA 3AI3A 4DPMA 3QVGB 1XVLA 5FUYA 1PQUA 1M2VA 1MX5A 3I5UA 5DHSA 3H3JA 2VHUA 4DGSA 4P84A 4Q00A 1MJHA 1OFHA 1RD4A 3VR6D 4DRXB 2RI0A 4AC9A 3A0RB 2FH5B 4YRFA 2IV3A 1W581 3CVYA 1ADYA 3WK4A 4D7AA 4DSZA 3CLRD 3SE0A 1S4MA 2EBUA 4KK4A 1E2BA 1MX1A 1MGOA 3HE3A 5AM2A 1SBZA 3ASUA 3D6MA 2WEKA 2YUTA 2DQ4A 3PEFA 3HPQA 4DJEC 1H2RS 5BSKA 3BZWA 1X3SA 1SVMA 3D3NA 4QUGA 3ER9A 1PJ8A 1CQIB 2ZTLA 3I83A 5EIBC 2ZB4A 3DAFA 2R4UA 1AGPA 4ZD6A 5JYBA 5ALEA 5LQJA 1AGNA 1CUBA 4TV9A 4RD6A 4RXMA 3OLQA 4Y9SA 3NHKA 3HGMA 3PGKA 5KQMA 4DIOA 3KO8A 1Q91A 4X61A 3P9XA 3O3CA 4C0BA 3K3PA 3KXPA 4QFCA 3H2JA 4GKBA 3NETA 3DDZX 1PV2A 5TF0A 4E4TA 5JCZA 1U8EA 2DT8A 3MJHA 4MW9A 2HQOA 4PS0A 1A9YA 4DIFA 5DYTA 1JNXX 2PZFA 3H3FA 1XZKA 5IF3A 3RYIA 4WVLA 1Y7LA 3GRKA 4MYHA 4LJ5A 2YJGA 4P36A 4ZDKA 1QHHA 2Q62A 4CV1A 4QU0A 3CONA 1LGYA 5DV9A 2PGXA 4KFRA 4QA9A 1YB4A 2O7SA 2BGUA 4HX5A 3SZGA 1TUBB 2ZS7A 3E18A 1ZNWA 1GSIA 2W6QA 4PPFA 1J8QA 4MGKR 3UUEA 8OHMA 4E1BA 1EBFA 5BR1A 1QHYA 4DA4A 2A4KA 1LK0A 2HU2A 3HMKA 2FPPB 4H0FA 1YQXA 1PEYA 8ADHA 2COEA 3IAS6 3Q9UA 3SFTA 2WU8A 3LPLA 4M1SA 2PZAA 2PS3A 3I6QA 5JAUA 1JV2B 3JRWA 5BSTA 1XRSB 1ZRMA 2FZGA 5TMBA 1OKKA 4OXNA 3GRPA 3OWHA 1C3LA 1NLFA 2BEKA 4JEIA 4G0UA 1DL5A 4PYIA 4TL8A 2BMAA 4DDVA 1T6NA 5FUWA 3EPHA 4RY8A 2YNMD 4MINA 2DBVO 2GJKA 4PANA 1CF4A 2RD2A 3U4IA 2OGZA 2VLIA 5I4KA 4NYJQ 2GD1O 4FZJA 4JNCA 4RVCA 3VKGA 5ALDA 4CEIA 1JSRA 1XBTA 3VFDA 3T06B 1E2MA 4G07A 4EY8A 5AW4A 1U2DA 1H2WA 2VDMB 2OD9A 3DL2A 2NSHA 4GYYA 4URUR 5CUQA 1YZLA 4Z2AA 5E4JA 3OSZA 1H2EA 1WR8A 2DRIA 2VF7A 4UD2A 2JCYA 4J9UE 4TZ6A 1CWUA 2XWSA 5K0ZA 1Y6FA 2GEFA 2QMYA 3SX0A 2C83A 4W4TA 2Q2WA 3KVRA 5LJIA 1G1MA 1LB1B 1V26A 1JKIA 2VP6A 1UZLA 3EQZA 5B53A 4A2CA 4KDFA 5JSUA 4CM4B 4MCJA 4P4NA 1E3DA 2ETVA 1Q0HA 3M4XA 1ISFA 3L7YA 1TJ5A 5EWMB 2K7FA 5MGBA 1ZM9A 1T2DA 1VHWA 3A2NA 4CLRA 3FX2A 1NMSA 3AR6A 4YALA 5KWEA 2JC3A 3EA0A 4CCYA 5DNYB 2Q4TA 5C8DA 1JP7A 1JYFA 4MHTA 3OESA 3KZOA 5A9TA 1N2IA 4ZMBA 1Z13A 2NW6A 2CDBA 1D6MA 3GN1A 1GNLA 3IMFA 1JIJA 1TTHA 2NYVA 1DC8A 1AKQA 3QPCA 1VLZA 5E3IA 1TU3A 3IMEA 1KI2A 3NHUA 1MB2A 4LCEA 1Z4NA 1CJSA 1H66A 2HK7A 3SDBA 3IO5A 1BS1A 1VB3A 1N32B 4B7AA 3B1XA 1UADA 3IIJA 5IKPA 1MH1A 2HMTA 4M49A 1CVIA 3H0EA 4OI4A 1NBOA 4Q12A 1G5QA 1A8IA 1M0TA 1OHHA 3QWHA 2ZT5A 3OZ7A 2VAWA 2P1DA 2JFPA 2I03A 2OCGA 2XE6A 3C48A 3MSXA 3RD5A 3ZI4A 5L53A 3Q12A 1KEUA 2M98A 2WFMA 3WL3A 2YS6A 4ENVA 3KU4A 4M1KA 6AT1A 2CLEB 2OCXA 1SU6A 2O8EA 4Y6SA 1P74A 3WMGA 4RJJA 4CMJA 3RTGA 2QN9A 3IQWA 5E4FA 5EWLB 5LQCA 5K0NA 4AQYB 5L4LA 2WU3A 3THWA 4B3IA 2I4MA 4S12A 4IV0A 4CU2A 1SG0A 2IYAA 4HQLA 4NJMA 1KEWA 2OBNA 3E03A 4CXMA 1DELA 3SC6A 1M1YE 3KSUA 3I6IA 4C6TA 4W7SA 4AJHA 4PTLA 2VTVA 4HHEA 1N7IA 3HA7A 2C9YA 4Z86A 2J32A 2FOIA 1QVWA 1ISJA 1QQ7A 3HDQA 4G0YA 2WD9A 1CY0A 4O5OA 2FMHA 2IQ5A 3L07A 1CVLA 3GLRA 3GUUA 4Y7DA 2IPAB 5GJCA 2FETA 3BCUA 2PNJA 2JFVA 2PSSA 1Y3DE 3GP5A 4R40A 5CLQA 3IULA 1AVTA 4N4AA 4UFOA 3QF7A 1AH2A 1N9KA 3IYLW 3P2IA 3OTIA 1BDBA 4GL4A 2VJAA 4HLCA 1LD3A 1U8TA 1G3MA 1X8KA 4QXMA 2HCJB 3A6PC 3AQIA 2GD2A 1G8HA 3KE9A 5DHFA 3WMWA 2LTAA 4MUXA 4HYTA 1TECE 3IIIA 3UAYA 4GZ6A 4WZAA 2ALJA 1V35A 1XXHE 1KZGB 3D2BA 3F78A 3LC7O 2CMHA 3K6RA 4HWSA 2ARKA 5HK9A 2YWDA 2ZU6A 5PGMA 1Z7BA 2X8JB 4MUBA 4B82A 4GZ3A 5FH9A 2YRFA 4N6GA 2F4VB 1ZH6A 4BNDB 3WJ1A 1GEEA 4Y6RA 3FHLA 2IYZA 1EP2B 1OGJA 1Q2XA 2W2LD 3GI1A 5KYUB 5JCPA 4BZQA 3M2TA 2ICAA 2HRRA 1E59A 1E2JA 3LCJA 2DU8A 4OQYA 5ED0A 2JG3A 2IPNA 3QV1A 1IY8A 1I2MA 4H17A 2AVDA 2P3OA 4R83A 1PX2A 5ARCA 3RQIA 3SQMA 4LYEA 2X8BA 3I5XA 4DR4B 3IE0A 3TOZA 2XMQA 2CV1A 1Q20A 2BBSA 2ZBVA 3AF3A 1FTNA 3KXDA 5E7JA 2R87A 5ADHA 1I30A 3GF4A 3AF1A 3MWLA 5ALRA 1JJAA 3V8QA 2PA3A 1E3MA 5JMOA 4B3GA 1Y9DA 3Q7RA 3IQGX 4MA4A 4E4RA 3CEMA 2Z0MA 4HAUA 4IWXA 3P9IA 2ZSDA 2HUPA 3FMVA 1CUZA 4KQCA 2HA5A 1FQWA 3ZQJA 2Z6QA 3UZUA 1CT9A 2Q21A 2V7EA 4RPGA 1CUJA 3KAKA 4WKNA 3DE1X 3U39A 5JV5A 3TKLA 3AY0A 3FE2A 4KQ2A 1ANKA 2NPIA 3RTDA 2CK3D 3HUFA 3TK1A 2OA0A 3QU9A 5JWRA 3MCVA 3N2GA 2ZZMA 4US2R 4DN6A 1NM5C 3AIMA 4IXTA 3ZHVA 3OX1A 2VRCD 2YY5A 1PWZA 1L5VA 4YHHB 5EL0A 4LDRA 5JI3E 2XZLA 3DEYX 4RKFA 3RVDA 3NDJA 5KS2A 4DUGD 1ADJA 4KLCA 4O3FA 4W5WA 2TYSB 1GM5A 4MJ3A 1QTNA 2WJGA 3VJLA 4ZAXA 3VPXA 1KA9H 1UK6A 1F38A 3FOEC 4A8TA 2W2VA 3H9JA 4TS3A 5AP9A 1BDHA 1VKRA 5DGDA 4RXTA 3IUQA 4PLGA 3OIWA 3RTAA 4HDMA 1J99A 2E6UX 4QU9A 4GIBA 4REOA 3BRWA 4U2DA 5GJVC 4CGYA 5KVCA 4BQEA 2PYDA 2Q0HA 4CZ2A 5TPZA 3ILXA 4D4MA 2H63A 2WP0A 5AK6A 3WJAA 4F6LA 4NH4A 4WI1A 2O1SA 4Z7JA 2GN6A 1V4BA 1X7HA 4K6GA 1UMDA 4MP3A 2Q7OE 2HH9A 3VTFA 1L5ZA 3OQIA 3KKPA 5JXWA 1D07A 1V1RA 4I5EA 3R7WB 1JT9A 2FQQA 1WZNA 2PKQP 4J0FA 3WIBA 2GHRA 2C98A 1VP9A 2QDKA 1VECA 1T9CA 3OPVA 4O5AA 3HH8A 4PSKA 3UMVA 3ZVLA 4FDVA 1LTQA 5LL6P 1U8ZA 4B7CA 1K63A 1X38A 1C7ZA 1OZAA 2X0JA 2ZI6A 3IPYA 4HCJA 4DG5A 1IPFA 4COKA 4ZAYA 1X1AA 1XZPA 4B4VA 4LF7B 2RHBA 2YIDA 1LDNA 4QBKA 1DC6A 3VSCA 4YJHA 1NONA 1JU9A 1EIWA 3DKPA 2ZJ0A 3GK3A 1Z45A 3G02A 3KJZA 4GYKA 4WOJA 1LJLA 1NY6A 1QR2A 2W6OA 4X8OA 3SQLA 1CP3A 3T1TA 1UPFA 4LRQA 3F7TA 1KEEB 3WRXC 1W44A 3I9NA 1G9SA 2BMVA 2UV8A 3UJHA 4HDAA 2DUJA 5ILQA 3FOZA 1LSJA 4Q4LA 4QFBA 3QWBA 4MUMA 3USZA 4MARA 4GXRA 2JANA 5KCZA 2QT0A 1Y80A 1F17A 1M10A 3PA8A 3DE7X 4Q9HA 2FA9A 4ZREA 2I7VA 3JYNA 4BMPB 1PG2A 2FN8A 4PTYA 3D4LA 3SGLA 4ALLA 4DCUA 2AYYA 4ZEMA 3BFVA 2V6FA 3OCYA 1GPNA 2BM0A 4LF5B 3SQOA 1ZINA 3H5TA 121PA 2F1KA 1CUWA 3GLVA 5EY5B 1W8DA 5TT1A 1XRPA 5BN3A 3X1MA 4A0QA 2WE8A 4RK4A 2JLQA 5EJMA 3UHPA 1MEJA 2XZPA 3UOGA 5AVYA 5LMZA 4KHPB 1H6CA 5IXJA 4YJ2B 1L4KA 4C4TA 4DA9A 1LFDB 5BNFA 1EA7A 4RD0A 2OESA 3T7TA 1AO0A 2OTCA 2SHKA 4QL3A 4JLDA 4PAMA 4LI3X 5FX2A 3KB8A 3M1AA 1C7IA 1VIVA 3HN6A 5ER9A 1XWIA 1TM2A 2FZ4A 3ACBA 3BG5A 1H4SA 3MGAA 5AK5A 5K05A 3NOVA 3K2BA 3FCUB 2JIZD 4RAQA 1RYHA 1YTLA 4KNWA 3QKSB 4AUEA 3RUIA 3IE1A 1VDMA 2XY4A 2ESRA 3AUJB 4Q1VA 2G77B 1HM5A 1AKTA 4Q37A 5D3KA 2C9MA 4IOLA 1DKLA 1MIHA 1BQEA 5I9SA 3CH5A 3NHPA 2OFOA 1BHJA 1ZN7A 3CNNA 2JK0A 3KP1A 4X6YA 2AMLA 3ST7A 1UBKS 2GDJA 1QAOA 3H2BA 4Y9UA 2XADA 3AB3A 3D59A 4RBNA 1NP6A 4RAOA 1UDWA 3O8OB 2PWZA 1BD3A 1QGAA 2VPWA 3QEJA 1GTMA 4UUMA 2BFAA 5A4KA 3BT7A 1WULS 1XNJA 5CW2A 3ROKA 5AHKA 1EFRD 5ALIA 1I33A 2EP5A 2ODWA 3R9XA 3BKWA 1YZ3A 3AZPA 3JQAA 3TRIA 5FUMA 2C7RA 3ZHXA 1F2VA 3JRNA 3UMJA 3A4YA 3DTVA 3REOA 3EFBA 3VVBA 1ADBA 1IYZA 2YWHA 1BFUA 1C4XA 1FY2A 3NAGA 1CF2O 3BTOA 3F0TA 5JH7A 2VHEA 1KFEB 4I1RA 3WB1A 2NU9B 1ZOPA 3HZRA 4N7JA 4ZHSA 2ZVQX 2QUHA 2X14A 4ZICA 3K2IA 3PNLA 1KJ8A 2PX6A 2GEKA 2YXLA 4GUDA 3HJFA 3E58A 1EI9A 1LY1A 2ODBA 2QN7A 2KB0A 4EM6A 4HGRA 1NPDA 4P3OA 3PIIA 4C0KA 2CFSA 1E1LA 1SQ0A 2WSLA 4IIUA 4PX2A 3Q6IA 3NWBA 4BLUA 4FCWA 4WXPA 2LPMA 3VGPA 4W5NA 4OUKX 2A3RA 4W6QA 5D01A 4IV5A 5EFOA 1KDOA 2EFGA 1U3VA 2JF0A 4OAOA 3I72A 2NIPA 3SYNA 3TZLA 3WY9A 1IH8A 4EW3A 3WGIA 1NW9B 2GPJA 2PWBA 4QYXA 3KJNA 4ND7A 3ZCRA 1Y1TA 5DM4A 1YKSA 3SXJA 1GGEA 4JLMA 2B9EA 2WABA 3ZKWB 2VP2A 2IYTA 4W82A 1E8DA 1A8UA 4JT8A 1I9GA 5G1NA 3Q15C 4Q1FA 4OXXA 1YH3A 3Q1KA 4UC0A 4WBNB 5I5EA 4AZVA 3LA8A 4X90A 4WECA 4RMIA 3UN1A 4A0RA 1J42A 3JQFA 2B3DA 3OT1B 4LC9A 3B6EA 2WYUA 3A2MA 1LWOA 2AZDA 2OSBA 3AEUB 4EHLA 4EI7A 2HXSA 4D9MA 3L43A 4D25A 2O2EA 2EQBA 2YZ7A 1H5QA 4WN9A 1X13A 5BUZA 2D00A 2HMAA 2WTMA 5AJZA 3RVOA 3SIXA 1W5FA 3AU9A 4IYJA 2NZ8A 3NGMA 4JCOA 1ZH4A 2UYYA 3UBTA 1ZGJA 2DUUA 3LG2A 2BLLA 1OR8A 2QD3A 4QAJA 4A9AA 1F2UB 1X7DA 1E6EA 3LQ4A 3AETB 2VP4A 5E6RA 2MSNA 4HDSA 3MS7A 4Z53A 1NLMA 2AZ4A 1TM3E 5IZ4A 4PTZA 4KQXA 4ZRMA 4UXIA 1JTEA 5K8CA 1K88A 1N9GB 4TT3D 4GR5A 3BIXA 5DSZA 1SOUA 5F33A 4OH1A 3D8HA 1Q7CA 3FVTA 4HVCA 1LC3A 4IF4A 3L01A 4IHAA 2QRGA 4GNKA 4O4HF 4AXBA 1DDIA 2A6PA 5TVGA 3V97A 4X1KB 2GGSA 3ZUPA 2IOFA 4FN4A 5TQJA 3ZHUA 2H65A 4DJDC 5KDDA 1KEKA 3GLFB 1QRTA 2BCEA 4OQZA 1X1QA 1ZJZA 2WTAA 4WA8A 5C4MA 5CB8A 3EC2A 2E21A 3R8CA 1I7DA 3Q11A 1W34A 1NIJA 3QW4B 3BMXA 3U3RA 5KJ6A 5J2UF 2C3UA 2B5OA 4DNFA 3DMFA 3HM2A 3W5DA 3PXUA 4N01A 2IHTA 4YBRA 5C7OO 5HWSA 3O8NA 1EHYA 3GT4A 3HJBA 5EPOA 1CR6A 1GG5A 2G04A 3PR1A 2M6KA 2HGZA 2Q5OA 4PONA 4L8LA 3HCPA 4HAOA 4J2TA 4CTMA 4QPZA 3VI3B 3FMGA 2BFWA 1PJTA 3B8EA 1Y1PA 5EJEA 1HE5A 3OG9A 3OJWA 4AFNA 2QMZA 3A1EA 3HBMA 3VR2D 1ZD2P 1A27A 5DT2A 3CRRA 1EG2A 4U7JA 1JEYB 1ZLYA 2OAGA 2FHSA 3LRPA 3SLRA 1FQOA 4OVKA 4YR7A 4R9RA 1F8YA 1DO2A 1A2BA 4PZAA 2AD5A 3RS9A 1PGNA 4EEZA 3Q85A 3I62A 3KZXA 2FN4A 5HFAA 1OREA 3TQCA 2CVZA 5IT0A 1EWVA 3ZGYA 1SCDA 4ND1A 1MZPA 1XZMA 3QFRA 1H0HA 1R0BA 3C15C 5KQPA 5CAEB 1E1RD 4L5CA 3HXMA 3R5JA 5AW8A 4REQB 3ZW9A 5I7RA 4OXYA 5FO1A 2NAPA 4D41A 5SY4A 1GG2A 1RWMA 2RHDA 5ALOA 5KJCA 1XVUA 2P4HX 4RM2A 6CHYA 5CFLA 3K05A 3K16A 3OM9A 3I2FA 3PXBA 2FPWA 4BFSA 2YMQA 3HA3A 5FNVF 4FEAA 1PLJA 3AXSA 3UYLA 1K7EB 1KI3A 3AKEA 4NLLA 2W2MA 4WZBB 2QQ5A 4ZWNA 3HP4A 4P38A 1ARZA 3LQYA 1RC8A 5CFOA 2HJHA 4B09A 3KFXA 4MI3A 3UBMA 4E12A 1UBCA 3LPAA 5WRFA 3OUUA 3UB4A 3D43A 2ZYUX 3A9VA 1IAQA 3LZCA 3ONEA 4NU5A 4ZVPA 3BGVA 2AG8A 1IWPB 1R9MA 1S7CA 1VKZA 5GJWC 2O52A 1EX1A 1CEQA 4G5SA 4EA7A 5FIUA 1JGTA 4A10A 1FZTA 1Z29A 1OY1A 2WWTA 3LNTA 4UCFA 5JE8A 1CRLA 2QTTA 2B4TO 1YR8A 1J0BA 4KYUA 3T7IA 4C0LA 4D9JA 2QL9A 1UP7A 1ZOLA 1I2DA 2OD7A 3HVRA 3TZCA 1I3NA 1XLUA 4R2HA 2FUKA 4DV1B 1Z0KA 2IH2A 2CFCA 5ER6A 1NE7A 1UPUA 2BGWA 1A9XA 2OP0A 4CDMA 3HYLA 2AUNA 2BJVA 3VTKA 4UJ3A 3WL5A 2GZRA 4EB6B 4Z3DA 5L7TA 3PZBA 1GU0A 3OO1A 2Q5LA 1KBOA 3MAJA 3QNWA 4J4BA 4JI7B 2NYAA 4OB8A 2W93A 1DIAA 4CMIA 4DIMA 4PLFA 3BB1A 4E88A 1RM4A 1SZDA 2M1XA 1VE9A 5JOQA 1NBHA 1B23P 2AFIE 1VHTA 1DXQA 3VJKA 4AUMA 2AL7A 2ENUA 4WBXC 1MT3A 2XECA 1O6CA 4KNYA 2FQ1A 3QSGA 3V00A 1D0SA 1KY3A 4I1YA 1K0FA 2EVWX 3CH6A 3FR8A 1RQRA 1FU7A 1WXWA 4EFKA 5B4UA 5HRCA 2UZ3A 5KC9A 5K51A 2HRZA 5T8KA 1E3EA 1LLDA 5FCDA 3A6KA 3QF4B 2R8XA 2PPLA 2HDOA 5FAKA 4P54A 4B3TB 3GEBA 5FOSA 3IIMA 2YWFA 3RW9A 1GNTA 1OH6A 1I9CA 2CXPA 4UPVA 1M2OA 5BOSB 3FAZA 1ZG3A 2JIRA 1OW3B 4F6RA 5HKKD 4GDFA 5LDGA 3AJ9A 1SJ9A 1CULC 3QKIA 3FB1A 4JS0A 4P0TA 5DRTA 5ILGA 1DKNA 1PR5A 2BELA 1IRIA 2NQ8A 4QJBA 1IBKB 2Q5JA 4G0NA 3NFYA 1VGQA 3FYUA 4L27A 3DOOA 3IODA 3O4HA 3K0KA 1J2EA 1B8NA 4HPXB 4MEAA 1NVXQ 3VZBA 4CN9A 2MWMA 3V8VA 2OAQ1 1BJTA 2B6NA 1MPTA 2XGMA 3MT8A 3QFFA 1P7YA 1SUBA 2QHXA 3UHJA 4LWPA 4ZN6A 1BU8A 1SBCA 2R8BA 1P1JA 3ELWA 3NQ41 4PVDA 2REQB 3LSYA 4IX9A 2BGJA 1K5HA 1G20B 1H1TA 1SELA 1UM8A 2P78A 1JIIA 3CE9A 1IDN1 1NULA 3H9CA 3QV2A 5HW0A 5JECA 2VQDA 1IBCA 1V1MA 2I8CA 3AVOA 1CW2B 4JR0A 2GN4A 4RKWA 3BQMB 1LJUA 4V03A 1G2PA 2H48A 3TJMA 4UE3S 4RK7A 3KXIA 3V32A 4OB6A 3B38A 5FBWB 3USES 4HQ6A 3WQQA 1E3WB 4HQFA 1V3UA 2JIMA 1ZMOA 2P7IA 3WP1B 2X0NA 4DCCA 4XYEA 4DNPA 4UQLA 4G1FA 3IEPA 1JXQA 2FRXA 1ABEA 4TQUS 3RYFB 3BSWA 3UXHA 1X70A 1U9CA 4R9NA 1EVZA 4KLRA 1RWNA 5FA8A 1X7XB 1MXFA 5FL7D 4P4LA 3SJCA 3TI9A 3JV7A 2AG1A 1J4AA 2B30A 4NVRA 4PLHA 5TT0A 3EGXA 5FV4A 5KNBD 4P3KA 4ZT2A 2XBMA 1ZMRA 3PKJA 4FGSA 3F90A 4ARUA 4X91A 3ML1A 4OTZA 1LRKA 1Z8NA 4P4SA 3MTJA 1YJ5A 1YQUA 1M7GA 1Z4OA 2C61A 5COBA 4S1WA 3SEQA 3ZHZA 4CMCA 4TLMB 2B34A 3KSMA 3P1JA 3V1LA 4KRYA 2WOOA 1HRDA 3CN9A 3O38A 4Q9AA 3IA2A 1L7XA 5CXQA 3K2QA 4UBJA 2QAJA 3TQTA 5C53B 1MENA 4GQAA 4P58A 2VJDA 2I5PO 1CF9A 1TM5E 3M34A 1KHTA 1P2FA 1HO3A 4JBWA 3M9WA 3BIFA 1VMDA 4KQFA 4RYDA 5CLGA 5M34A 2PU5A 1XQ6A 4I3FA 3S2SA 2YVUA 2DFKB 2DWUA 1BXGA 4L4ZA 1WETA 4GEGA 5GM2A 3EDOA 1ZA1A 3L8FA 5HPYB 2JFUA 3A32A 3UJDA 1KC3A 3EYWA 3EUEA 1GDHA 3U4QB 4U00A 1JQKA 5FEUA 1NI4B 3DMRA 1Y4SA 3ZWDA 3FUCA 4A0HA 1FFXA 4CQMA 3MJFA 5FUXA 4H7EA 4KMOA 3G9XA 4EYEA 1EHCA 3WS7A 3IEVA 3F71A 5E2BA 3RDPA 2EX4A 1CPYA 3RK1A 2EWMA 1ICEA 2I1WA 5EXXA 2E4UA 1HEUA 1PEDA 3DBHA 3WISA 1DIHA 3DDOA 1X7ZB 4Q7EA 1Q0PA 3NBAA 4HLUA 1MVOA 3ABRB 2X4GA 1N3BA 1PF7E 4N7RA 3E35A 5B3LA 4L51A 4FILA 1B93A 5FWYB 3W3AA 4E2WA 5A5EA 5B4TA 4JP8A 2I91A 4PRLA 1CUYA 4V0MA 4DEXA 4B80A 1NG1A 1ORVA 2QY9A 1ZVJA 3TG2A 1PS8A 2PX3A 3NP7A 4HQKA 3EVAA 2JIZA 2VH5R 1QTQA 2AJTA 1EYZA 2QVLA 1GQ2A 1OVMA 2K87A 2X15A 3DWFA 5F35A 3FETA 2HSZA 3D3QA 1WXFA 2C82A 3GEMA 2EBFX 2CJFA 4PFJA 2CJYA 2NVUA 1NJ2A 3GEGA 5THXA 4XWAA 1JEDA 1U0LA 1WMDA 2E9SA 3L7AA 1Z26A 1QRAA 2DKOA 2JFZA 2O0KA 3EA5A 3BAFA 3LBYA 3N8HA 3N8KA 2GCIA 4JYCA 2QP3A 4CL0A 5A4AA 3KJXA 2JVKA 5EZYF 1SHKA 1SVOA 5KVAA 1C9EA 4KVGA 2H2WA 3HKCB 3JQGA 5U4QA 3TEJA 3UUFA 3L8DA 3UWKA 3WB0A 1Q6YA 1Y5NA 4FPXA 4BMYA 3G7NA 2ZJ4A 4JVNA 3PWSA 3DJYA 3DVRX 4ENWA 1UBJS 4NTZA 1K9VF 3GH1A 1UKCA 1XTUA 2IHKA 3K8OE 3KVOA 5DDIP 1A5BB 2IK8A 1NNEA 1UT5A 2W2KA 1U9JA 1UQRA 1YBVA 4CKEB 2N1MA 2KWIA 1FNMA 1TIPA 5D00A 3WRXA 2OLEA 2PKYX 4JBYA 1BKDR 4RGBA 3IAXA 3EJWA 4C6SA 3BHMA 1TTTA 3AEYA 1RWQA 1DHTA 2CJWA 4ATNA 3JD1A 5IKMA 4G5XA 3C14C 4NZZA 2GZHA 2BT4A 1HF3A 2HF2A 1NI5A 3NM4A 4B5KA 4BKRA 1NF3A 2B92A 2GAJA 3JPWA 2ZSFA 3U16A 1AF4A 4MCIA 5J47A 1TIBA 2AFIA 2GKSA 3OQOA 2IHYA 2WWRA 2EYUA 4LOAA 1QX4A 5IN5A 3NKLA 3A06A 4LRYA 3FCAA 3P97A 3WGVA 4MQFA 3FIJA 4QSHA 1TYAE 4ND4A 1U7HA 1RMYA 1G16A 4UDNA 4EJSC 1R8SA 3GHYA 5CTJA 1X9GA 3WYEA 2JEYA 3ZU3A 4C4XA 2H00A 2BFOA 5AICA 4HRAA 3DMGA 2PGAA 3LUFA 3LT0A 1P3DA 3MAAC 3UMMA 4DUZB 1E5TA 4XWYA 1DTWB 3CCBA 3L9WA 1GYQA 1D6NA 2Q2QA 3W2FA 5ELLA 3G89A 1RRCA 3A3PA 1SCBA 1C3OA 1G2IA 1H2FA 2NO5A 3R5XA 1Z06A 2QLBA 4JR1A 1QK4A 3OQBA 3UMYA 4AMBA 2PCLA 5KYYA 1HDRA 2JCGA 1I5RA 4FGJA 1UAAA 2XQVA 1W85B 5LYJA 3BMCA 4MVJH 1PT9A 3MB5A 4MWSA 4WKCA 4DZTA 3PUVA 2ZJ2A 1BDMA 2DH6A 3R0VA 1S8OA 1F3OA 2Z5FA 3TZHA 1BS2A 2F9MA 3OJXA 3LRTA 5CEJA 3SHQA 5T64A 3QTBA 1SKUA 3CRW1 2G07A 3IH5A 4J0DA 1BA2A 2JKZA 3BSSA 2QTVA 4KEAA 1KQPA 4QHYA 4QYWA 1L4HA 4Q34A 3ORYA 5DISB 2WU4A 2DHDA 2I65A 1COZA 2OHGA 2AKAB 1EAMA 2N1BA 3QBVA 4R31A 3SWWA 3MXOA 2FU5C 1Z8DA 2VJNA 1U0BB 2EW2A 3QX8A 1IFXA 3IP7A 2CDAA 2R2AA 4LZPA 3TIFA 3F7MA 3TNDA 4JJ8A 5AJUA 5IH3A 3S68A 4MK4A 1P60A 3WWCA 2WJHA 4PBTA 4MS3B 1JIQA 2D0IA 5BNIA 2YXNA 3LL7A 4YP9A 2QN2A 4LZOA 3HO8A 3CRZA 4TRRA 4BZPA 1H2AS 1X74A 1Z5WA 2YV5A 1FRVA 2H9IA 3FPEA 3LS2A 4PY2A 2J09A 1T8WA 1PWEA 4BX8A 2GO1A 4KP7A 5ICFA 3E82A 5DHPA 4QGBA 1E3JA 1OCEA 3OKAA 4I5DA 4MS1A 4NF2A 4TM7A 4YJ3A 4BBJA 4F2DA 2R66A 2JCBA 3G3EA 4NONA 2W11A 3GRAA 4PAGA 4TZKA 1M1ZA 1XNGA 2RARA 3M4NA 5EG5A 1GV0A 4I2NA 1GA6A 4MMYB 3R7NA 1G8JA 1XZ8A 2ZJFA 4XIJA 2X3YA 2E1RA 3KWFA 3TVDA 3MD0A 4HLNA 1NHGA 3DLAA 5AHRA 3IB6A 5C5EA 3R1IA 5ISMA 4EB8A 4BFWA 4M1ZA 3PX7A 3RB8A 4DMGA 2IUTA 2QENA 5KNDA 2XIJA 3HMQA 2J5KA 5B3JA 2BGKA 4A27A 3QU5A 4ZCIA 5JD4A 5K3FB 5HJ7A 2AW3A 3VRHA 4ITRC 1YD7A 2XGJA 1V5FA 2E2WA 3SK0A 1KIMA 1E79A 4LMBA 2YXDA 4M6WB 2NXCA 2XMGA 2XT6A 4R2MA 4ZGWA 2PFKA 3PSAA 1M7BA 4RY2A 5ARBA 3DB2A 1BX3A 3DKRA 4LV8B 4F5ZA 4MPTA 3W4JA 4MWCA 2NXJA 4YQYA 2VQSA 1IDOA 2D4AA 2A1UB 4GLFA 2Z2JA 3E8XA 4JLBA 4YP7A 4RS4A 1D4FA 4IRMA 2FGJA 4ENSA 3H9EO 3ZW8A 3UFBA 3QI7A 5HIJA 3EXEA 3P2EA 5BMVF 3ZY6A 5AI6A 1G6Q1 1V96A 1CUAA 4XJVA 3W2IA 5AVVA 1Q1NA 3CJQA 1YXMA 2JVIA 4YT2A 2CJXA 4F3TA 2XCQA 3RKRA 1NZFA 2C8JA 3D3WB 4BDSA 1CRPA 3H4MA 5IABA 3DMTA 4AD8A 3ZHQA 5K6TA 5LP1A 1QGUA 4HDRA 1E7SA 2I71A 3T61A 4Q4CA 4G2TA 4G0QA 7GPBA 5CT4A 3RG8A 4C0HA 5KYNA 2ZBUA 1Q7GA 2BR3A 4B6JA 3DBLA 3ZWMA 1O57A 3D0KA 1Z07A 3CX6A 3IP9A 3M4JA 1J09A 2G8NA 4EHFA 1JKMA 2QR5A 1EM8A 8LDHA 4O2AB 1Z36A 1R4MA 2EJUA 2YZ2A 2VDJA 3G8DA 3GJXC 3KVNA 4GOKA 3OURA 4MW1A 3SX2A 2ON6A 4OLBA 3LJKA 4WT7A 2NADA 3TL6A 4BXOA 5B55A 2W2PA 4AL4A 2V7GA 4A8JA 2Z2YA 3RJTA 4BY9E 4B5LA 4DT1A 1QGUB 2EF0A 3II6X 4HDRB 2FWBA 4V24A 3RE1A 4C0AC 1JWLA 4CQNA 2FDRA 3CLSC 4P9NA 3S70A 4RK5A 1FS4A 1UKZA 4Y8VA 1WEHA 2GF9A 2WKWA 1L1RA 2YZGA 1OLUB 3OJLA 3RSCA 4BL5A 2CC2A 1W4BA 2JZOA 4ZZ3A 4BJ6A 1KTIA 1SR8A 1XMSA 2ZTUA 1XCLA 3UV3A 2IY7A 3V2GA 2NTYC 3TGPA 4D57A 2WLTA 1X86B 3UY4A 4LIPD 4LTDA 2BI4A 3CLTD 4RZ2A 4G0WA 3IPXA 1VE3A 3MCTA 3LFHA 2QNBA 3LP6A 2VUHB 5IKEA 3IBFA 1UP6A 4ZT6A 1QVRA 1JPJA 1JG7A 2J3JA 1Z88A 4IWNA 1FYEA 2VA8A 3COVA 1QV7A 2A35A 4KO2S 3QQ5A 3INTA 3F3KA 2C99A 4DARA 3I76A 1PYDA 1B00A 4FJ1A 1S2MA 4KYIB 3C16C 3H9GA 4QDUA 3RS5A 4UOZA 2A57A 2BKLA 3SXUB 2A1TR 4GXTA 3B3AA 1CUHA 3GDGA 2VNJA 2WFAA 1VMIA 5TGZA 3GOHA 2DHCA 1KY2A 2H2AA 3KDPA 4I6JA 2B4RO 1XTTA 4MV6A 4PRKA 5T4HA 3TTTA 2JHGA 5JC8A 2BSQA 1HTTA 1VI6A 3GRCA 5FBVB 2RHJA 5IT5A 2XQIA 2SKEA 5A9RA 2QMEA 1JR4A 3ZV6A 3STVA 4HWKA 4CM5A 2Q4RA 2ONKA 4BPBA 2Q07A 4GRDA 4QUAA 1P19A 3OFJA 3A6DA 3E3NA 4O4HA 4YJ3B 4EMTA 1JHRA 1PE0A 4K87A 3OFND 5DLPA 5K8LA 2PLAA 2DT5A 4NENB 3F2VA 2GM9A 1UMBB 2HA0A 3OIYA 4F8EA 1FVOA 1HTBA 4INPA 2JDIA 3H5IA 3RF6A 1JR6A 1KDRA 4YRRA 1QFJA 1UWKA 4MS3A 4JZYA 5A6SB 3DCNA 1KBZA 1AKVA 3COWA 2HHAA 3FRHA 3G2KA 1B26A 3MCWA 2YHBA 5LYYA 4AZWA 4IDCA 4DQXA 4EMSA 4O4JB 1E6MA 3GA0A 1ZM7A 2C88A 1MD9A 2OV8A 3DEAA 5GOTA 1GGNA 4KV9A 2W0MA 2OCLA 4ZJYA 2P90A 2QMUA 4L50A 4WX2B 1NVVR 3GZ4A 4R7ZA 4GLOA 3PFBA 2BVNA 4GMGA 1BCSB 4EZEA 4OY3A 4IEIA 4YRCA 2KX7A 5A9SA 4TQGA 2H57A 2I6UA 3NHSA 3PGMA 4HNAB 3JD2A 2ATVA 4TV9F 4DWVA 5AW2A 5KREA 4EABA 1M7HA 2ZWMA 4QUHA 3NMUF 4WRRA 1FUYB 1KR2A 1R64A 2A7QA 4X7BA 1RZRD 1X19A 4UPEA 3IJRA 4WJZA 5KSPA 2GM4A 4WN3A 1XZNA 3VHRA 3EG5A 1W0KD 1IHXA 1QG6A 4H4CA 1EFLA 1QMPA 3GX1A 2IS4A 1OYYA 1ZMTA 1GXSB 1XU7A 2C1ZA 2QU7A 2OD2A 3BMOA 2PYZA 3JVUA 3TXYA 3ZWXA 4CN8A 5JXGA 2H4WA 3LHSA 3ZLBA 4AWAA 4CUJA 4HWTA 4B87A 4D4GA 1W36B 4OI0A 4DMRA 1ISGA 4IFBA 2QE7D 4BP9A 3BJEA 4FFRA 3TCNA 3LKDA 4POOA 1XD9A 1OOEA 1XXHB 5IN4A 2DGDA 1C3VA 2OCPA 4HWGA 1YVEI 1ETHA 4PN7A 1PQWA 2QZSA 3RVMA 2NT3A 3H4TA 4MUNA 1FU8A 4RPKA 1ZWKA 4EIWA 3LC1O 1SUIA 5E1BA 5D3MB 2B2XA 2VXBA 1W49A 1NYRA 3V9PA 1NNLA 1WDTA 1Z6QA 3O1IC 1YGYA 1DX9A 1U2TA 4CGZA 4R2IA 1GEGA 1L5LA 3SYRA 5BXYA 3K09C 2PSFA 1QFYA 3L1VA 5H5JA 4FGLA 2QLLA 4FUQA 3P0JA 4HRXA 1FA9A 2ZB7A 3Q5GA 1G42A 2AC4A 3D6UA 2BFCB 5DXFA 3FM9A 3GGPA 4LXGA 3L1UA 5FLEX 1XQYA 3IX7A 3RSQA 3UCEA 4AJNA 4XIFA 3GAMA 3AMVA 3FCOA 5CPFA 3B3JA 4HAYA 1EFDN 1Y5LA 1A69A 3G5TA 3UEOA 3DOEA 5E4YA 3SC2A 2RI6A 4MUJA 3O4VA 4NJEA 4QUKA 4DZRA 1LVHA 5CFNA 5EJ4A 1YZKA 1C9JA 1VLLA 4GZMA 2BFDB 2OFWA 3HKCA 2IEYA 2IYLD 3BKXA 4EW6A 1U3GA 3DVSX 4FOPA 2R6AA 4C3UA 3A25A 3RRZA 4C7KA 1H8HD 4HI0E 5JSYA 2ODAA 2CE7A 4HYQA 4UEOA 3VR6A 1T0JB 1RJFA 3H4VA 3U7QA 4BIIA 4AX4A 1GCOA 4DMMA 5E9WA 1RRPA 1YKFA 1O6ZA 1Z7EA 5IEBA 3OMXA 3W5IA 4DBVO 2KBEA 2AR0A 3PNQA 3DR5A 3GBSA 2IY9A 3G2IA 3WYBA 4GPBA 3EGDB 2Q7DA 2EHJA 2G28A 5B58T