3CUCA

Crystal structure of a fic domain containing signaling protein (bt_2513) from bacteroides thetaiotaomicron vpi-5482 at 2.71 a resolution
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
279
structure length
262
Chain Sequence
SNIKQLYSKWKSLQPLKPEDLKRWNDKFKLEFNYNSNHLEGNTLTYGQTKLLLMFGETSGNASLKDYEEMKAHNVGLEMIKQEAQDKERPLTESFIRELNRTILVQDYWKVGEYKSRPNSVLTGEVFSYASPEETPAFMTSLVDWYNLEADKGILTPVELAALLHYRYIRIHPFEDGNGRIARLLVNFVLHRYGYPMIVIHSEDKSNYLNILHQCDVEAGLTPSDGANATLNDILPFVNYLSSCLIRSLTLAIKAAKGESIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Protein of Unknown Function with a Fic Domain (NP_811426.1) from Bacteroides thetaiotaomicron VPI-5482 at 2.71 A resolution
rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
molecule tags Signaling protein
molecule keywords Protein of unknown function with a Fic domain
total genus 90
structure length 262
sequence length 279
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 3cucA00
3CUCA 4U0ZA 4NPSA 3SHGA 2F6SA 3ZCBA 2JK8A 5JFZA 5CKLA 3SE5A 3SN9A 3N3UA 4PY3A 4U0SA 2VZAA 4WGJA 4X2CA 4XI8A 5CGLA 5EU0A 5CMTA 5JJ6A 4U07A 4U0UA 4X2EA 3S6AA 5JFFA 5JJ7A 2G03A 4ITRA 4LU4A 4X2DA 3ZLMA 3ZC7A 3LETA 4M16A 4N67A 4U04A 2VY3A
chains in the Genus database with same CATH superfamily
3CUCA 4U0ZA 4NPSA 3SHGA 2F6SA 2NUDA 3ZCBA 2JK8A 5JFZA 5CKLA 3SE5A 1NH1A 3N3UA 3SN9A 4PY3A 4U0SA 2VZAA 4WGJA 4X2CA 4XI8A 5CGLA 5EU0A 5CMTA 5JJ6A 4U0UA 4U07A 4X2EA 3S6AA 5JFFA 5JJ7A 2G03A 4ITRA 4LU4A 4X2DA 3ZLMA 3ZC7A 3LETA 2NUNA 4M16A 4N67A 4U04A 2VY3A
chains in the Genus database with same CATH topology
3CUCA 4U0ZA 4NPSA 3SHGA 2F6SA 3ZCBA 2JK8A 5JFZA 5CKLA 3SE5A 3SN9A 3N3UA 4PY3A 4U0SA 2VZAA 4WGJA 4X2CA 4XI8A 5CGLA 5EU0A 5CMTA 5JJ6A 4U07A 4U0UA 4X2EA 3S6AA 5JFFA 5JJ7A 2G03A 4ITRA 4LU4A 4X2DA 3ZLMA 3ZC7A 3LETA 4M16A 4N67A 4U04A 2VY3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CUC A;  4U0Z A;  4NPS A;  3SHG A;  2F6S A;  3ZCB A;  2JK8 A;  5JFZ A;  5CKL A;  3SE5 A;  3SN9 A;  3N3U A;  4PY3 A;  4U0S A;  2VZA A;  4WGJ A;  4X2C A;  4XI8 A;  5CGL A;  5EU0 A;  5CMT A;  5JJ6 A;  4U07 A;  4U0U A;  4X2E A;  3S6A A;  5JFF A;  5JJ7 A;  2G03 A;  4ITR A;  4LU4 A;  4X2D A;  3ZLM A;  3ZC7 A;  3LET A;  4M16 A;  4N67 A;  4U04 A;  2VY3 A; 
#chains in the Genus database with same CATH topology
 3CUC A;  4U0Z A;  4NPS A;  3SHG A;  2F6S A;  2NUD A;  3ZCB A;  2JK8 A;  5JFZ A;  5CKL A;  3SE5 A;  1NH1 A;  3N3U A;  3SN9 A;  4PY3 A;  4U0S A;  2VZA A;  4WGJ A;  4X2C A;  4XI8 A;  5CGL A;  5EU0 A;  5CMT A;  5JJ6 A;  4U0U A;  4U07 A;  4X2E A;  3S6A A;  5JFF A;  5JJ7 A;  2G03 A;  4ITR A;  4LU4 A;  4X2D A;  3ZLM A;  3ZC7 A;  3LET A;  2NUN A;  4M16 A;  4N67 A;  4U04 A;  2VY3 A; 
#chains in the Genus database with same CATH homology
 3CUC A;  4U0Z A;  4NPS A;  3SHG A;  2F6S A;  3ZCB A;  2JK8 A;  5JFZ A;  5CKL A;  3SE5 A;  3SN9 A;  3N3U A;  4PY3 A;  4U0S A;  2VZA A;  4WGJ A;  4X2C A;  4XI8 A;  5CGL A;  5EU0 A;  5CMT A;  5JJ6 A;  4U07 A;  4U0U A;  4X2E A;  3S6A A;  5JFF A;  5JJ7 A;  2G03 A;  4ITR A;  4LU4 A;  4X2D A;  3ZLM A;  3ZC7 A;  3LET A;  4M16 A;  4N67 A;  4U04 A;  2VY3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...