3CUEA

Crystal structure of a trapp subassembly activating the rab ypt1p
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
218
structure length
159
Chain Sequence
b'AIETILVINKSGGLIYQRNFTNDEQKLNSNEYLILASTLHGVFAIASQLTPKALIPYIPYVGMDDFFKEPFTNWNKSGLRQLCTDQFTMFIYQTLTGLKFVAISSSVMNLAIQIADNFLRKVYCLYSDYVMKDPSYSMEMPIRSNLFDEKVKKMVENLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transport protein particle 23 kDa subunit
publication title The structural basis for activation of the Rab Ypt1p by the TRAPP membrane-tethering complexes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 32
structure length 159
sequence length 218
chains with identical sequence G, M, S
ec nomenclature
pdb deposition date 2008-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04099 Sybindin Sybindin-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.70 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3cueA01
3CUEC 2J3TD 2J3WA 3PR6A 2ZMVA 1H3QA 3CUEA 2J3TC
chains in the Genus database with same CATH superfamily
1BSGA 5L07A 4QHCA 2Z2LB 3Q81A 3HVFA 1BT5A 1ZG4A 4UQIS 5HX9A 4F94A 3D72A 5GLBA 3ZCZA 1OTEA 2ZBBA 3EQUA 1JTGA 3C4OA 3T4OA 4UHUA 1WE4A 5A92A 3UB8A 4BWIA 4WL9A 2PHYA 2W3FA 4CLCB 3C5AA 3N8SA 2Y4AA 1MC0A 4DE0A 2V20A 4KZ5A 3DWKA 4DXCA 1K56D 2R9XA 5EM1A 3G34A 3LIDA 2QYBA 2ZC3B 2L0WA 3JVVA 2QKPA 1ES5A 4LRYC 1XJ3A 5GHXA 3IF6C 1N9NA 4KZAA 5HPFA 4BQMA 2Y79A 4GN2A 3LR3A 4OH0A 4BJPA 3ZNTA 4B9OA 4OONA 5J3WA 2V1AA 1STZA 5EM0A 1NWZA 3EOIA 4NEED 1HD8A 1XJ4A 2Q9NA 4GKUA 3E2KA 5DJUA 1XGIA 5MC7A 3HBRA 3R4KA 5G4YA 1GSWA 3Q07A 2JKRI 2YKHA 5IU1A 4N92A 3OZHA 1OTAA 4GB7A 1HZOA 4MLLA 4GD8A 5FATA 2Q9MA 1XP4A 2WAFA 3IT9A 3IWOA 2H0YA 4QY5A 3TJZC 1WYCA 2J9OA 5HPIA 3G4PA 2PAVP 4Y0UA 3CG5A 5L09A 4EBPA 4NETA 2XD1A 2JE5A 5EVIC 1YSQA 5DF7A 2OOLA 1I5QA 4B4ZA 1BLCA 4I3JA 4R3JA 1XJ6A 2W1TA 1G6OA 1N9BA 4LLOB 4MBFA 4RX3A 4EESA 4E6WA 3Q82A 2J3TD 3KSFA 5F68A 4HBUA 2WKPA 4JGQA 1PW1A 1BLSA 3DWZA 1UWNX 2HDUA 2OWJA 1PIOA 5HL1A 1KDSA 2WZXA 4HESA 3IX3A 1FILA 4DDYA 3CWFA 2GDNA 2ZQ9A 4PMAA 3A3IA 4L0LA 4S2NA 3B33A 4BLMA 1Y54A 3GSGA 1O07A 3UDXA 4M3KA 3G6OA 3PAEA 5GHYA 4QU3A 2XEPA 1K25A 2Z6DA 4IVKA 2VKSA 1NLYA 1OJ5A 1TS7A 1D06A 4Q0IA 4IUKA 5CGSA 4P6BA 3Q7VB 3UO9A 2R9WA 1RCJA 4S2JA 4CLCD 5AQ7A 1EW0A 1BLHA 3QP6A 4IJGA 4EQ1A 1G6AA 1S1YA 1OTDA 2QWSA 3A3FA 1E3UA 3HL9A 2O0YA 3SOIA 2ZL1A 5GHZA 3LCEA 1S6RA 5DF8A 5CERA 3ITBA 3GQZA 3R7WA 4ETZA 4X1MA 2G2UA 4DE2A 4E3MA 3SS4A 1MKMA 1PFLA 4M4XA 3LEZA 1W8YA 1FSYA 4OQ0A 1T1AA 3CPTB 2RL3A 2M1CA 5FDSA 3IHBA 5AVFA 3LR4A 3VV4A 2VGLS 1XKZA 2ZJ9A 4OPRA 5A90A 2WZZA 1FCNA 1K0KA 1JNUA 2VV7A 1SDNA 2GX5A 3IF6B 5FA7A 3CJMA 1X0OA 1OTIA 5CEDA 4RX2A 3FC7A 4EBLA 3T4TA 3QNCA 3NDGA 5FSRA 1QMFA 3E4QA 4YINA 3E0YA 2B5RA 3BM6A 4B88A 2Y55A 3GTCA 1PNEA 5DKLA 1FIKA 2IA2A 3FPWA 3HUMA 4RVAA 2XDMA 3IS2A 3LIFA 3HREA 3MR0A 4N1HA 4KZ9A 1NY0A 1YT4A 4HP4A 2XK1A 5FEGA 5HDCA 1CK3A 4MMNA 3P7NA 3UNWA 4Y0TA 1VETA 3BY8A 1ONHA 4P85A 3MFDA 1ES2A 4R6LA 1P97A 4UAAA 1IYPA 2R78A 4OKPA 3UMDA 2XF3A 2VJWA 2KOIA 2ZQDA 4Z1WA 4QB8A 4KZBA 1PZOA 4Q0HA 3WS0A 1LI9A 5EVLA 3P01A 3EGXC 2H0TA 4G3VA 4OPZA 3SS3A 3E4OA 1H3QA 2RCXA 3GMWA 3GECA 1O7EA 5KIZA 5DJTA 5AQBA 4NKPA 5AQAA 4N9KA 4C6YA 5F5YA 4XT2A 4HEFA 2XA7M 3QP1A 2VA0A 4LRZE 1K54A 3S7PA 4JF5A 3Q7ZA 3ZFZA 2OSUA 3OPPA 4EV4A 4X69A 3IXHA 1MZUA 1FR1A 3LUQA 4ZTKA 3O88A 4GLQA 3C7UA 4WZ5A 3V3SA 4ZBEA 5FQQA 1CQAA 1SZVA 5EFWA 3S22A 1VETB 1KOUA 2WYXA 4XUZA 1YQSA 3T1SA 1Q2QA 2VGKA 4H6JA 3NOTC 2ZD8A 1YLWA 2ZC4B 4HIAA 2JKFA 1PWGA 3NBLA 4E3LA 1KE3A 4JXSA 3GRJA 4CQHA 5DTKA 5E2EA 3HJIA 2WKEA 3QHYA 1F98A 1K38A 4Y0OA 4PM8A 5EV0A 3ZDJA 3VFHA 3W4QA 3NI9A 5HAQA 4LV1A 2OAP1 2IWBA 4OQGA 3PTEA 2QPNA 3KSHA 4JF6A 4HH2A 2Y91A 4EUZA 3MXQA 1BZAA 3PBRA 4XUXA 3T1QB 2GNXA 4S2OA 3PHYA 5TR7A 1FOFA 2G7UA 4RYEA 1MWRA 3S7OA 3LFVA 4P0MA 3ICYA 1LSXA 3ISGA 5M18A 5DKKA 1K57C 1ZTUA 4X53A 3F1OB 1LSVA 1E3UD 3WRTA 1VEUB 2K2NA 5J7EA 3BECA 3M6BA 3ZNYA 4LGWA 3V5MA 4HNBA 1N4OA 1VB6A 3N8LA 2JKTI 4FOFA 4K91A 5CXWA 4PM7A 3BEBA 3WS1A 1T1CA 1NJ4A 2Y2QA 1SKOA 1ZHHB 3O86A 1W8QA 2ZOHA 4S2PA 3UPNA 4N9LA 3MMHA 4CLCE 3DBAA 1N9LA 4R3BA 5HDSA 4BBUA 1SCWA 5CX7A 3OPRA 4ZAMA 2HJEA 1XX2A 3MZDA 4GDNA 3NOPC 3T12B 3C38A 3LEQA 2H5SA 1P0ZA 3CZDA 4EQIA 5EOEA 1H8MA 3MQQA 4BBVA 2W3DA 3VP2A 3T4QA 2VK3A 3NHQA 1I2WA 4KZ8A 4B4XA 2PYRA 4PPRA 1Z09A 2DMWA 5FQ9A 5HWTA 4WMCA 1TEMA 1FCMA 2ZMFA 2NUPC 1KGEA 4IHQA 4JGOA 5FI6A 3TSGA 3NOUC 1LL8A 2P7JA 1KDWA 4KQQA 3ZGAB 1XXMA 1E25A 3FKWA 1Q2PA 4WBGA 1K55A 4R4RA 1CJFA 3W2ZA 3ZYTA 5A8BA 1H8YA 3VOYA 2V1BA 3DTKA 3F1NB 1MPLA 4X56A 1S0WA 2A49A 3S7NA 2ZQCA 3AGEA 4OPYA 1SKOB 5F69A 2VLGA 4EW7A 1JWVA 1FQGA 2A2LA 3V50A 3UE6A 1LL5A 5HD3A 4HJ4A 3G2YA 2JC7A 3WWXA 2WGWB 4DN0A 2EFXA 1UGUA 3UB7A 4C3QA 5AVEA 4BMWA 2Y8HA 2O9BA 4WZ4A 4EETB 4LV2A 5AJGA 3NC8A 2Y2PA 3V3RA 1D7EA 2HJ9C 3OBFA 2OLUA 5DTTA 4ZJ2A 1IFQA 3VMAA 3A3DA 4O7DA 3LI8A 1ZKJA 3KSGA 4LCLA 2XFTA 2ZM0A 3RH8B 3BFDA 4X68A 1GHPA 4OP5A 1VQQA 2EX8A 5E2FA 1ODVA 2Y2KA 2WK0A 2IWDA 3B3XA 3VSKA 4BL2A 4S2NC 4GS9B 4NXGA 5EOOA 2JKRM 3CUEA 2EXAA 2O99A 4NXFA 1T1BA 3K3DA 4X55A 2Y2OA 2ZLYA 1H0MA 3IXGA 2FZ0A 3IF5A 1MXOA 2JCHA 1D1JA 3BY9A 3HLFA 3C7VA 2DRWA 5EUAA 4ZJ1A 3Q7VA 1KVLA 4E3JA 5CGWA 3VE4A 4Q8IA 2E8JA 1W79A 3PXPA 2OWHA 1W63Q 2ZQ7A 3BLSA 4GD6A 2M7VA 3GVBA 3EQVA 1GHMA 5HFOA 4GHIB 1PYYA 1Y28A 5GLCA 2W3HA 2ZM8A 3I7JA 3IXDA 1EROA 3RJUA 4R70A 5A93A 3H82B 4WEKA 4WLAA 4F3LB 4U0TA 3WS5A 4DXBA 3D4FA 3W8KA 5IHVA 3DW0A 1ACFA 3ZHHA 1L0EA 3C30A 3HLWA 3G2ZA 3T4LA 2I72A 4R38A 1ES4A 4ARZB 4DE3A 3NCKA 1GCEA 4X1LA 1NYMA 3CPTA 5FQJA 3SZTA 3VOLA 3UB5P 1ERQA 3JYIA 4MNRA 5FEFA 4U3TA 4OPQA 4KZ3A 3DAVA 3QP4A 1NRJA 5F83A 1GA9A 1VM1A 3UN7A 4QJGA 3O87A 1F9IA 2W1RA 2XSSA 3IF6A 3S4XA 5E2HA 2D01A 3FKVA 3KYQA 3M2JA 3T4JA 3A3JA 1IKGA 1ESIA 1IYSA 1ZG6A 1F5MA 3OPHA 3U4LP 1TF1A 3N8RA 2ZQ8A 5KSHA 2IWCA 2ACGA 3VP1A 5D3OA 3U2AA 5C5KA 4BD1A 3N7WA 3OCNA 4Y15A 3BYDA 1C3BA 3IXBA 5J8XA 5HW3A 5DFYA 1LHYA 1I2SA 3MBZA 4DDSA 2VV8A 2XA7S 1ERMA 5CTNA 4JXVA 2GJ3A 5DVAA 1BTLA 1L0DA 3TE8A 2GZAA 4N1XA 4EXOA 5FDHA 2LB5A 2QZ6A 3MKFA 2B18A 2V1ZA 3PAGA 4WMCD 2OV5A 5HAPA 1WYBA 2PD8A 1T18A 3O5YA 4XXRA 3RTYA 2Y2NA 3BLMA 1FCOA 3KYZA 4UA9A 4K0WA 4YFMA 3CLOA 4JGRA 3NIAA 3BQ8A 5CHJA 3F1PB 4E6XA 4EEPA 1YLJA 4ZDXA 1XA1A 3ZG9B 3VP0A 2W27A 1T19A 1MWSA 3N6IA 3ULFA 4DF6A 5CGXA 1YLYA 4YWZA 1DP8A 5G4ZA 3T4SA 5HL6A 2L1MA 1W63M 1CEFA 4EEUA 4D2OA 3G32A 1TDLA 1E4DA 2C6WB 3HCYA 1TS0A 2G2WA 3IH8A 3E98A 3OPLA 3W4PA 3OCLA 3T4KA 5KZHA 1K6SA 2XFSA 3SH7A 2KDKA 4K08A 2FFYA 4HI4A 3V67A 3LIAA 2X71A 5F6AA 5DFXA 2KLIA 4NG2A 1WA9A 5EVIB 3IWQA 2EX9A 2VEAA 2PU2A 3G30A 1J3WA 2WKIA 5A91A 2I9VA 5IS1A 2ZMAA 4E3OA 2PBDP 4JXGA 4JLFA 3NY4A 5HSQA 4MDZA 3GDIA 3VP4A 1MWUA 4MBHA 5F1FA 4KG6A 2J3TC 5HAIA 2ZC6B 3IHAA 4DJ3A 1K4EA 4HY8A 4HOIA 3M6HA 5E43A 2Y2LA 1RP5A 4S2LA 1U60A 3IWIA 3TG9A 2E8IA 4FH2A 2VV6A 3VE3A 4YOFA 5HWWA 4FD8A 1CEGA 1YMSA 5FASA 2WKQA 1YPRA 5EECA 1IOUA 2V9AA 2UWXA 2XH9A 3F1OA 1VEUA 4LRXC 4U0XA 5FI2A 2Y59A 2WGVA 3LR0A 3HUOA 1YMXA 1ZC2A 1RGYA 4L9FA 4S2MA 4UA6A 1P9RA 1MBLA 4HHDA 3OC2A 4CLCC 3UDIA 2PBYA 4DMZA 2PDRA 3ZVWA 3JVUA 3EGDC 4JGPA 3IQAA 5TFQA 3QP8A 2DCFA 4X6TA 1TS8A 5FAQA 3M2KA 2JBFA 3S7QA 2OAQ1 4JF4A 1HTZA 4JXWA 2P9VB 3B47A 1W5DA 1DY6A 2XD5A 3MQOA 1LI0A 4WELA 2YKFA 2Q0OA 1BULA 2Y2MA 1JWZA 2XLNA 2QJ5A 2XRNA 3H7WB 4HQAA 1OMEA 2HZ5A 1BYWA 5FQIA 1S4RA 1NZOA 3CAXA 5TBMA 3LIEA 4LFUA 2XGNA 5F1GA 3OOVA 3V39A 2Y2IA 5DTSA 1G28A 4OP8A 3VFFA 3RXWA 2JKTM 2EXBA 2QHKA 4C75A 1LL9A 2HP5A 4EERA 3F1NA 1XGJA 1ONGA 4HH3A 2VZWA 2XROA 5CHMA 4Y5FA 1Z6FA 2H10A 1KE0A 3TW8A 3BJNA 1DJBA 2ZQAA 1NRFA 2A24A 5L10A 5LBRA 1GSVA 4I39A 4PHTA 4B93A 3HUNA 4CPKA 1JWPA 2WGWA 2Y2GA 1TS6A 4Y7PA 4FSFA 5TJJA 3LIBA 4E04A 1GHIA 5L2FA 3FG8A 4OQHA 2D02A 3MSHA 3IX4A 1NZUA 3A3EA 4JPMA 2JKGA 3WS4A 4R0QA 4CJNA 3BFFA 5FAPA 3CITA 4DJ2A 4GS9A 3UE0A 3LY4A 4WYYA 5KSCA 3BFEA 3CUEC 1YAXA 2ZC5B 1PI4A 5TBMB 5FAOA 3QP2A 3AGDA 4P6ZM 1PRQA 1XPBA 1L3LA 3IH9A 3VOZA 2V0WA 4KUOA 1SDEA 1DP6A 1H8ZA 4IEDA 3ZG0A 3LGOA 5U47A 5GLDA 3BW6A 2XR0A 1K57A 1NLZA 4EBNA 4JBFA 4GHIA 2J3WA 1NYYA 1K6RA 3MKEA 4RA7A 2A24B 3H82A 4E3NA 4F3LA 3MFXA 2PR6A 1IEMA 4UEYA 2P04A 4BL3A 2W3GA 2EX6A 5F82A 2DNSA 1VHMA 3G31A 3LICA 4KG5A 4QWOA 2HV1A 5FL3A 3FWLA 3UMEA 2EWWA 5I5LA 3PR6A 5IT5A 4GZBA 4ARZA 5HD5A 5HDDA 1PW8A 2K31A 3ZG8B 3T1RA 1A0KA 1PZPA 2W0NA 2WKRA 3P09A 1OT6A 3RXXA 3ZG5A 5L8MA 5HWVA 3DTMA 1TVFA 4EU0A 2HDSA 1LLBA 4P87A 3PBOA 4GW9A 3UDFA 3UPPA 4R23A 4HBTA 2V8FA 4I38A 2INWA 1YSPA 5CECA 4MBKA 4HJ6A 2EFUA 4OVDA 1YLTA 1Y4OA 5AQ9A 4BENA 1S67L 4ME4A 2ZOIA 3LR5A 4S2KA 1LSWA 4NXEA 4DE1A 4FTXA 4WM9A 4LCMA 5HZHA 2WUQA 3DTEA 3K2NA 3P98A 3IBJA 4R3AA 4FUWA 4GOGA 3A0VA 3O3VA 2Z2MB 2B95A 4O01A 2JN7A 3SH9A 3PYPA 3K3CA 2J9PA 3PBTA 2HDRA 4R1GA 3NULA 4QPRA 3EWKA 3CI6A 4WEJA 4D60A 4GJ4A 1W7FA 4UQIM 4X25A 4E3KA 5FI7A 5EE8A 3VP3A 4GCZA 4KQRA 4OLGA 5DF9A 1S66L 4MEZA 1L2SA 4MN5A 3F1PA 3AGFA 3UY6A 1KGGA 1YKDA 2QMIA 1BUEA 3W4OA 3H9WA 4L9EA 4IBXA 3E2LA 3Q1FA 5JYOA 3ZG7B 2OLVA 4MN6A 1DP9A 1MWTA 2PD7A 4OOMA 4GDBA 4WF0A 1ESUA 2WADA 1V9YA 4IUHA 4NXBA 4KQOA 4ETXA 1KGFA 5CHUA 3HLDA 3MJQA 2FFFB 4O8GA 3TOIA 5GL9A 3HLCA 1KVMA 1DJAA 5EVIA 3UE3A 3PBSA 3OLOA 3HLGA 1L0FA 5CRFA 1G68A 5CEBA 4EUVA 1H5XA 2WAEA 3DTIA 4QD4A 4UA7A 4KZ6A 3SS5A 2W1TB 1TD5A 4ZJ3A 2UV0E 4KENB 4ZRRA 2Z6CA 1BLPA 2FH5A 1P9WA 1KE4A 1L0GA 2B02A 5CTMA 1FSWA 3WS2A 2CMNA 3IBRA 4Y17A 3MXSA 2NUTC 3JPUA 5EPHA 1AXBA 1EWZA 3PBQA 3BRMA 2PYPA 5E2GA 1YM1A 5M19A 3BQAA 1F2KA 1DJCA 2VGJA 4PM5A 2HF6A 4L9GA 3MS6A 1K54C 4HP9A 2BASA 2P74A 3NDEA 4R4SA 4S2IA 1RGZA 4WZ5C 3FZCA 3ZQ5A 3GR2A 2WKHA 1IKIA 3A0SA 1HVBA 4EWFA 4PM9A 3UB6A 1OT9A 4LV0A 3UB9A 4GNUA 2V8CA 4BD0A 1OJGA 3UPOA 4LENA 4KQDA 1K4FA 4HJ3A 2WGIA 2EX2A 5TGFA 4ESPA 5JYPA 3SH8A 3VSLA 2W3EA 2ZL1B 2PRFA 1CF0A 3MZEA 2BG1A 3C8CA 5FQMA 3GV9A 4AFIA 3R7WB 2Y2JA 1SKFA 2P9VA 2LB9A 3LYXA 1JVJA 1IYQA 4YNRA 3B42A 1DRMA 4MCWA 4KUKA 2J8YA 4PKYA 1QMEA 4G3KA 1M40A 3H7WA 1K56A 2X02A 2J7VA 4JKTA 4II7A 1N9OA 5FQKA 5M1AA 4FCFA 3KO6A 2BTFP 2MJ6A 2J80A 3LO7A 3CHWP 4G3WA 1G5UA 4KG2A 2O9CA 3RFBA 1M6KA 3ITAA 2P08A 2HGVA 4Q0JA 1GA0A 3IX8A 1V9ZA 5J4EA 5G18A 4Y2FA 3TRCA 4QY6A 4OQIA 2O9AA 3FYZA 1YLZA 4DRTA 3IS2B 3UE1A 3MZFA 3FV7A 2HPBA 3QP5A 1J9MA 2ZC7A 3EEAA 3HLEA 2EWVA 4IBRA 4OOYA 1XFQA 2VGLM 1XA7A 3KSIA 2JHEA 3D9YA 4Y13A 3CMZA 4P6ZS 2VX8A 3HJKA 3HLBA 2BLSA 5K5BA 3MXRA 4LPZA 1MY8A 3QNBA 5BOHA 3T1XA 3D3OA 1MKIA 4PKYG 4I3IA 1S4SA 1ALQA 2L4RA 4Y3IA 4RQ9A 2C5WB 1HLUP 2EA9A 1UWPX 2HP6A 2V2FF 2PR5A 1YLPA 1OPXA 5HARA 1PI5A 5KMWA 2HP9A 4I5SA 4IVIA 3S1YA 4E3IA 4K0XA 4BBTA 2ZM2A 3G35A 4MN7A 4XT2B 2Y2HA 2V0UA 1K55C 3LY3A 3FPVA 3E4PA 3PBNA 4FH4A 2KX6A 3BFGA 4WUJA 3A0RA 5EVID 1IELA 4I3AA 3WRZA 3ZVTA 4PAUA 3BFCA 1NXYA 1ES3A 1GSXA 3MF0A 3NECA 1PWCA 4LV3A 1EI5A 4OOLA 3N4IA 4O0PA 1CI9A 2CC1A 3EEHA 5EVEA 1TDGA 3MQ0A 1JTDA 4DKIA 2PU4A 2M7UA 1XJ2A 4H6JB 4CLCA 4H8RA 3L7HA 4WN5A 3C4PA 1SHVA 2XQZA 3BWLA 4PM6A 1PWDA 1IYOA 2QJ7A 1LT0A 3C2WA 5GLAA 4NK3A 2H28A 4Z9QA 3SW1A 2PT7A 3L9KA 3KYEA 1OTBA 2A3UA 1S1ZA 3KX0X 2HDQA 1AWIA 5I94A 2AVXA 4A5RA 3LI9A 4KZ4A 4KZ7A 3T50A 3NJAA 2ZMVA 2X01A 1XFNA 4OLDA 4ID4A 2K7SA 1FR6A 1CI8A
chains in the Genus database with same CATH topology
3PBTA 3T4SA 5HL6A 3HJIA 2L1MA 1W63M 4EEUA 1F98A 4QPRA 3EWKA 3HCYA 1TS0A 3CI6A 4UQIS 3E98A 4WEJA 4GJ4A 3D72A 3OCLA 4UQIM 3T4KA 2OAP1 1OTEA 2ZBBA 3EQUA 3KSHA 4GCZA 4HH2A 5DF9A 3T4OA 1S66L 3MXQA 4MN5A 3F1PA 2KDKA 4K08A 3PBRA 4HI4A 1YKDA 3UB8A 3V67A 4BWIA 3LIAA 2GNXA 3PHYA 2PHYA 4WL9A 5F6AA 2W3FA 2G7UA 5DFXA 4CLCB 3H9WA 2KLIA 1WA9A 2VEAA 3S7OA 3LFVA 1MC0A 4L9EA 2I9VA 5IS1A 3ICYA 1LSXA 5DKKA 1ZTUA 3LIDA 4MN6A 2QYBA 3F1OB 1DP9A 5HSQA 1LSVA 4MDZA 2PD7A 4OOMA 2L0WA 2K2NA 4WF0A 3GDIA 5J7EA 3JVVA 1V9YA 2J3TC 2QKPA 4HNBA 4LRYC 1XJ3A 4IUHA 4NXBA 4KQOA 1N9NA 4DJ3A 4ETXA 1VB6A 5HPFA 2JKTI 3MJQA 4FOFA 4O8GA 4HY8A 4HOIA 1T1CA 2Y79A 3UE3A 1ZHHB 3PBSA 3OLOA 3LR3A 4BJPA 2ZOHA 3VE3A 4B9OA 2VV6A 4EUVA 5J3WA 2V1AA 1STZA 4YOFA 3MMHA 1NWZA 4CLCE 3EOIA 4NEED 5HWWA 1XJ4A 3DBAA 1N9LA 5DJUA 2WKQA 5HDSA 4BBUA 5MC7A 2W1TB 3R4KA 5G4YA 5CX7A 1IOUA 1GSWA 2V9AA 1TD5A 2HJEA 3F1OA 2JKRI 2YKHA 5IU1A 4LRXC 3NOPC 4ZRRA 2Z6CA 2FH5A 1P9WA 1OTAA 2B02A 3C38A 3LR0A 1P0ZA 2CMNA 4L9FA 3IBRA 1H8MA 2NUTC 3MQQA 1P9RA 4BBVA 2W3DA 3PBQA 2PYPA 3TJZC 5HPIA 3BQAA 4HHDA 3OC2A 3NHQA 3T4QA 2PYRA 4CLCC 2HF6A 4DMZA 2DMWA 2PDRA 4L9GA 1YSQA 3JVUA 5HWTA 3EGDC 2OOLA 4JGPA 2ZMFA 4I3JA 2NUPC 4HP9A 1XJ6A 4IHQA 1TS8A 2BASA 4JGOA 2W1TA 1G6OA 4LLOB 3NOUC 1LL8A 2P7JA 4EESA 2J3TD 3KSFA 3S7QA 2OAQ1 5F68A 2WKPA 4JGQA 3ZQ5A 3W2ZA 3B47A 3ZYTA 5A8BA 3A0SA 2V1BA 3F1NB 1UWNX 2OWJA 3UB6A 1OT9A 3MQOA 3UB9A 4WELA 2YKFA 3S7NA 3CWFA 1OJGA 2QJ5A 2XRNA 3H7WB 4KQDA 4HQAA 4HJ3A 5F69A 2VLGA 4L0LA 4EW7A 3B33A 1BYWA 2A2LA 1S4RA 3UE6A 5HD3A 3G6OA 3CAXA 2W3EA 5TBMA 3LIEA 4HJ4A 3OOVA 4DN0A 3C8CA 1UGUA 2Z6DA 3UB7A 4AFIA 2VKSA 5AVEA 1NLYA 1G28A 1OJ5A 2Y8HA 1TS7A 4BMWA 2O9BA 3R7WB 4EETB 5AJGA 1D06A 2JKTM 4Q0IA 2LB9A 2QHKA 3LYXA 4IUKA 1D7EA 2HJ9C 3OBFA 4EERA 3F1NA 4YNRA 4HH3A 2VZWA 3B42A 2XROA 1DRMA 1IFQA 4KUKA 4MCWA 4CLCD 3LI8A 3KSGA 1EW0A 4PKYA 4Y5FA 3RH8B 3TW8A 4G3KA 3BJNA 1ODVA 4IJGA 3H7WA 4EQ1A 1S1YA 1OTDA 4II7A 1N9OA 2A24A 2QWSA 4GS9B 4NXGA 2JKRM 3CUEA 5LBRA 3KO6A 2O0YA 2O99A 1GSVA 4I39A 2MJ6A 4PHTA 4B93A 2J80A 4NXFA 1T1BA 3K3DA 1TS6A 4G3WA 4FSFA 5TJJA 3LIBA 4E04A 3R7WA 2FZ0A 4ETZA 3BY9A 2O9CA 3RFBA 2P08A 2HGVA 3FG8A 4Q0JA 1V9ZA 1MKMA 4M4XA 3VE4A 5J4EA 2D02A 4Y2FA 3TRCA 1T1AA 3PXPA 2O9AA 2OWHA 1W63Q 3IS2B 2M1CA 2M7VA 3EQVA 5AVFA 3LR4A 3EEAA 3VV4A 4GHIB 2VGLS 4DJ2A 2EWVA 3CITA 1Y28A 1XFQA 2W3HA 2VGLM 4GS9A 4R70A 3KSIA 3H82B 1JNUA 2VV7A 3CUEC 2JHEA 4WEKA 4WLAA 4F3LB 1YAXA 2GX5A 5TBMB 1X0OA 1OTIA 4P6ZS 3FC7A 4P6ZM 2VX8A 3HJKA 3T4TA 5K5BA 4LPZA 2V0WA 4KUOA 3D3OA 4PKYG 3C30A 3E4QA 4I3IA 3E0YA 1S4SA 1DP6A 3T4LA 2L4RA 4Y3IA 4R38A 4ARZB 5DKLA 2IA2A 4RQ9A 2EA9A 3BW6A 3FPWA 3IS2A 1UWPX 1NLZA 3VOLA 3LIFA 3MR0A 2PR5A 4GHIA 1OPXA 2J3WA 1NRJA 2A24B 4HP4A 3H82A 5HDCA 4MMNA 1F9IA 4F3LA 3P7NA 3MFXA 2W1RA 2XSSA 2PR6A 4I5SA 3BY8A 4UEYA 2D01A 2P04A 3KYQA 4BBTA 2W3GA 4R6LA 1P97A 1VHMA 3LICA 4MN7A 4XT2B 3T4JA 2HV1A 5FL3A 2V0UA 3UMEA 2R78A 1F5MA 2EWWA 3FPVA 5I5LA 3E4PA 3PBNA 3PR6A 5IT5A 4ARZA 1TF1A 3UMDA 2KX6A 5HD5A 5HDDA 2VJWA 5KSHA 2K31A 2KOIA 4Z1WA 4WUJA 3A0RA 4I3AA 3U2AA 5C5KA 4PAUA 2W0NA 2WKRA 4Q0HA 1OT6A 3P01A 3EGXC 1GSXA 3MF0A 5L8MA 5HWVA 3OCNA 4G3VA 4EU0A 4OOLA 4O0PA 3E4OA 3EEHA 5DFYA 1H3QA 3MQ0A 3PBOA 4GW9A 3GECA 5KIZA 4I38A 5DJTA 4NKPA 2M7UA 2VV8A 1XJ2A 2XA7S 4H6JB 2INWA 1YSPA 4CLCA 5F5YA 4XT2A 2XA7M 2VA0A 4HJ6A 4LRZE 4WN5A 3S7PA 2GJ3A 3BWLA 3TE8A 2GZAA 2QJ7A 1LT0A 3C2WA 4EXOA 1MZUA 2LB5A 2H28A 3SW1A 1S67L 2PT7A 4ME4A 2ZOIA 3LUQA 2B18A 3LR5A 4GLQA 1OTBA 1S1ZA 1LSWA 2PD8A 1T18A 3O5YA 4NXEA 3KX0X 3RTYA 3KYZA 3LI9A 3CLOA 4JGRA 5EFWA 3BQ8A 5HZHA 3K2NA 3IBJA 1KOUA 3F1PB 4R3AA 3T50A 4EEPA 3A0VA 3NJAA 4H6JA 2ZMVA 3NOTC 1XFNA 2W27A 1T19A 3ULFA 4HIAA 4YWZA 2K7SA 4O01A 1DP8A 2JN7A 5G4ZA 3PYPA 4CQHA 3K3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CUE C;  2J3T D;  2J3W A;  3PR6 A;  2ZMV A;  1H3Q A;  3CUE A;  2J3T C; 
#chains in the Genus database with same CATH topology
 1BSG A;  5L07 A;  4QHC A;  2Z2L B;  3Q81 A;  3HVF A;  1BT5 A;  1ZG4 A;  4UQI S;  5HX9 A;  4F94 A;  3D72 A;  5GLB A;  3ZCZ A;  1OTE A;  2ZBB A;  3EQU A;  1JTG A;  3C4O A;  3T4O A;  4UHU A;  1WE4 A;  5A92 A;  3UB8 A;  4BWI A;  4WL9 A;  2PHY A;  2W3F A;  4CLC B;  3C5A A;  3N8S A;  2Y4A A;  1MC0 A;  4DE0 A;  2V20 A;  4KZ5 A;  3DWK A;  4DXC A;  1K56 D;  2R9X A;  5EM1 A;  3G34 A;  3LID A;  2QYB A;  2ZC3 B;  2L0W A;  3JVV A;  2QKP A;  1ES5 A;  4LRY C;  1XJ3 A;  5GHX A;  3IF6 C;  1N9N A;  4KZA A;  5HPF A;  4BQM A;  2Y79 A;  4GN2 A;  3LR3 A;  4OH0 A;  4BJP A;  3ZNT A;  4B9O A;  4OON A;  5J3W A;  2V1A A;  1STZ A;  5EM0 A;  1NWZ A;  3EOI A;  4NEE D;  1HD8 A;  1XJ4 A;  2Q9N A;  4GKU A;  3E2K A;  5DJU A;  1XGI A;  5MC7 A;  3HBR A;  3R4K A;  5G4Y A;  1GSW A;  3Q07 A;  2JKR I;  2YKH A;  5IU1 A;  4N92 A;  3OZH A;  1OTA A;  4GB7 A;  1HZO A;  4MLL A;  4GD8 A;  5FAT A;  2Q9M A;  1XP4 A;  2WAF A;  3IT9 A;  3IWO A;  2H0Y A;  4QY5 A;  3TJZ C;  1WYC A;  2J9O A;  5HPI A;  3G4P A;  2PAV P;  4Y0U A;  3CG5 A;  5L09 A;  4EBP A;  4NET A;  2XD1 A;  2JE5 A;  5EVI C;  1YSQ A;  5DF7 A;  2OOL A;  1I5Q A;  4B4Z A;  1BLC A;  4I3J A;  4R3J A;  1XJ6 A;  2W1T A;  1G6O A;  1N9B A;  4LLO B;  4MBF A;  4RX3 A;  4EES A;  4E6W A;  3Q82 A;  2J3T D;  3KSF A;  5F68 A;  4HBU A;  2WKP A;  4JGQ A;  1PW1 A;  1BLS A;  3DWZ A;  1UWN X;  2HDU A;  2OWJ A;  1PIO A;  5HL1 A;  1KDS A;  2WZX A;  4HES A;  3IX3 A;  1FIL A;  4DDY A;  3CWF A;  2GDN A;  2ZQ9 A;  4PMA A;  3A3I A;  4L0L A;  4S2N A;  3B33 A;  4BLM A;  1Y54 A;  3GSG A;  1O07 A;  3UDX A;  4M3K A;  3G6O A;  3PAE A;  5GHY A;  4QU3 A;  2XEP A;  1K25 A;  2Z6D A;  4IVK A;  2VKS A;  1NLY A;  1OJ5 A;  1TS7 A;  1D06 A;  4Q0I A;  4IUK A;  5CGS A;  4P6B A;  3Q7V B;  3UO9 A;  2R9W A;  1RCJ A;  4S2J A;  4CLC D;  5AQ7 A;  1EW0 A;  1BLH A;  3QP6 A;  4IJG A;  4EQ1 A;  1G6A A;  1S1Y A;  1OTD A;  2QWS A;  3A3F A;  1E3U A;  3HL9 A;  2O0Y A;  3SOI A;  2ZL1 A;  5GHZ A;  3LCE A;  1S6R A;  5DF8 A;  5CER A;  3ITB A;  3GQZ A;  3R7W A;  4ETZ A;  4X1M A;  2G2U A;  4DE2 A;  4E3M A;  3SS4 A;  1MKM A;  1PFL A;  4M4X A;  3LEZ A;  1W8Y A;  1FSY A;  4OQ0 A;  1T1A A;  3CPT B;  2RL3 A;  2M1C A;  5FDS A;  3IHB A;  5AVF A;  3LR4 A;  3VV4 A;  2VGL S;  1XKZ A;  2ZJ9 A;  4OPR A;  5A90 A;  2WZZ A;  1FCN A;  1K0K A;  1JNU A;  2VV7 A;  1SDN A;  2GX5 A;  3IF6 B;  5FA7 A;  3CJM A;  1X0O A;  1OTI A;  5CED A;  4RX2 A;  3FC7 A;  4EBL A;  3T4T A;  3QNC A;  3NDG A;  5FSR A;  1QMF A;  3E4Q A;  4YIN A;  3E0Y A;  2B5R A;  3BM6 A;  4B88 A;  2Y55 A;  3GTC A;  1PNE A;  5DKL A;  1FIK A;  2IA2 A;  3FPW A;  3HUM A;  4RVA A;  2XDM A;  3IS2 A;  3LIF A;  3HRE A;  3MR0 A;  4N1H A;  4KZ9 A;  1NY0 A;  1YT4 A;  4HP4 A;  2XK1 A;  5FEG A;  5HDC A;  1CK3 A;  4MMN A;  3P7N A;  3UNW A;  4Y0T A;  1VET A;  3BY8 A;  1ONH A;  4P85 A;  3MFD A;  1ES2 A;  4R6L A;  1P97 A;  4UAA A;  1IYP A;  2R78 A;  4OKP A;  3UMD A;  2XF3 A;  2VJW A;  2KOI A;  2ZQD A;  4Z1W A;  4QB8 A;  4KZB A;  1PZO A;  4Q0H A;  3WS0 A;  1LI9 A;  5EVL A;  3P01 A;  3EGX C;  2H0T A;  4G3V A;  4OPZ A;  3SS3 A;  3E4O A;  1H3Q A;  2RCX A;  3GMW A;  3GEC A;  1O7E A;  5KIZ A;  5DJT A;  5AQB A;  4NKP A;  5AQA A;  4N9K A;  4C6Y A;  5F5Y A;  4XT2 A;  4HEF A;  2XA7 M;  3QP1 A;  2VA0 A;  4LRZ E;  1K54 A;  3S7P A;  4JF5 A;  3Q7Z A;  3ZFZ A;  2OSU A;  3OPP A;  4EV4 A;  4X69 A;  3IXH A;  1MZU A;  1FR1 A;  3LUQ A;  4ZTK A;  3O88 A;  4GLQ A;  3C7U A;  4WZ5 A;  3V3S A;  4ZBE A;  5FQQ A;  1CQA A;  1SZV A;  5EFW A;  3S22 A;  1VET B;  1KOU A;  2WYX A;  4XUZ A;  1YQS A;  3T1S A;  1Q2Q A;  2VGK A;  4H6J A;  3NOT C;  2ZD8 A;  1YLW A;  2ZC4 B;  4HIA A;  2JKF A;  1PWG A;  3NBL A;  4E3L A;  1KE3 A;  4JXS A;  3GRJ A;  4CQH A;  5DTK A;  5E2E A;  3HJI A;  2WKE A;  3QHY A;  1F98 A;  1K38 A;  4Y0O A;  4PM8 A;  5EV0 A;  3ZDJ A;  3VFH A;  3W4Q A;  3NI9 A;  5HAQ A;  4LV1 A;  2OAP 1;  2IWB A;  4OQG A;  3PTE A;  2QPN A;  3KSH A;  4JF6 A;  4HH2 A;  2Y91 A;  4EUZ A;  3MXQ A;  1BZA A;  3PBR A;  4XUX A;  3T1Q B;  2GNX A;  4S2O A;  3PHY A;  5TR7 A;  1FOF A;  2G7U A;  4RYE A;  1MWR A;  3S7O A;  3LFV A;  4P0M A;  3ICY A;  1LSX A;  3ISG A;  5M18 A;  5DKK A;  1K57 C;  1ZTU A;  4X53 A;  3F1O B;  1LSV A;  1E3U D;  3WRT A;  1VEU B;  2K2N A;  5J7E A;  3BEC A;  3M6B A;  3ZNY A;  4LGW A;  3V5M A;  4HNB A;  1N4O A;  1VB6 A;  3N8L A;  2JKT I;  4FOF A;  4K91 A;  5CXW A;  4PM7 A;  3BEB A;  3WS1 A;  1T1C A;  1NJ4 A;  2Y2Q A;  1SKO A;  1ZHH B;  3O86 A;  1W8Q A;  2ZOH A;  4S2P A;  3UPN A;  4N9L A;  3MMH A;  4CLC E;  3DBA A;  1N9L A;  4R3B A;  5HDS A;  4BBU A;  1SCW A;  5CX7 A;  3OPR A;  4ZAM A;  2HJE A;  1XX2 A;  3MZD A;  4GDN A;  3NOP C;  3T12 B;  3C38 A;  3LEQ A;  2H5S A;  1P0Z A;  3CZD A;  4EQI A;  5EOE A;  1H8M A;  3MQQ A;  4BBV A;  2W3D A;  3VP2 A;  3T4Q A;  2VK3 A;  3NHQ A;  1I2W A;  4KZ8 A;  4B4X A;  2PYR A;  4PPR A;  1Z09 A;  2DMW A;  5FQ9 A;  5HWT A;  4WMC A;  1TEM A;  1FCM A;  2ZMF A;  2NUP C;  1KGE A;  4IHQ A;  4JGO A;  5FI6 A;  3TSG A;  3NOU C;  1LL8 A;  2P7J A;  1KDW A;  4KQQ A;  3ZGA B;  1XXM A;  1E25 A;  3FKW A;  1Q2P A;  4WBG A;  1K55 A;  4R4R A;  1CJF A;  3W2Z A;  3ZYT A;  5A8B A;  1H8Y A;  3VOY A;  2V1B A;  3DTK A;  3F1N B;  1MPL A;  4X56 A;  1S0W A;  2A49 A;  3S7N A;  2ZQC A;  3AGE A;  4OPY A;  1SKO B;  5F69 A;  2VLG A;  4EW7 A;  1JWV A;  1FQG A;  2A2L A;  3V50 A;  3UE6 A;  1LL5 A;  5HD3 A;  4HJ4 A;  3G2Y A;  2JC7 A;  3WWX A;  2WGW B;  4DN0 A;  2EFX A;  1UGU A;  3UB7 A;  4C3Q A;  5AVE A;  4BMW A;  2Y8H A;  2O9B A;  4WZ4 A;  4EET B;  4LV2 A;  5AJG A;  3NC8 A;  2Y2P A;  3V3R A;  1D7E A;  2HJ9 C;  3OBF A;  2OLU A;  5DTT A;  4ZJ2 A;  1IFQ A;  3VMA A;  3A3D A;  4O7D A;  3LI8 A;  1ZKJ A;  3KSG A;  4LCL A;  2XFT A;  2ZM0 A;  3RH8 B;  3BFD A;  4X68 A;  1GHP A;  4OP5 A;  1VQQ A;  2EX8 A;  5E2F A;  1ODV A;  2Y2K A;  2WK0 A;  2IWD A;  3B3X A;  3VSK A;  4BL2 A;  4S2N C;  4GS9 B;  4NXG A;  5EOO A;  2JKR M;  3CUE A;  2EXA A;  2O99 A;  4NXF A;  1T1B A;  3K3D A;  4X55 A;  2Y2O A;  2ZLY A;  1H0M A;  3IXG A;  2FZ0 A;  3IF5 A;  1MXO A;  2JCH A;  1D1J A;  3BY9 A;  3HLF A;  3C7V A;  2DRW A;  5EUA A;  4ZJ1 A;  3Q7V A;  1KVL A;  4E3J A;  5CGW A;  3VE4 A;  4Q8I A;  2E8J A;  1W79 A;  3PXP A;  2OWH A;  1W63 Q;  2ZQ7 A;  3BLS A;  4GD6 A;  2M7V A;  3GVB A;  3EQV A;  1GHM A;  5HFO A;  4GHI B;  1PYY A;  1Y28 A;  5GLC A;  2W3H A;  2ZM8 A;  3I7J A;  3IXD A;  1ERO A;  3RJU A;  4R70 A;  5A93 A;  3H82 B;  4WEK A;  4WLA A;  4F3L B;  4U0T A;  3WS5 A;  4DXB A;  3D4F A;  3W8K A;  5IHV A;  3DW0 A;  1ACF A;  3ZHH A;  1L0E A;  3C30 A;  3HLW A;  3G2Z A;  3T4L A;  2I72 A;  4R38 A;  1ES4 A;  4ARZ B;  4DE3 A;  3NCK A;  1GCE A;  4X1L A;  1NYM A;  3CPT A;  5FQJ A;  3SZT A;  3VOL A;  3UB5 P;  1ERQ A;  3JYI A;  4MNR A;  5FEF A;  4U3T A;  4OPQ A;  4KZ3 A;  3DAV A;  3QP4 A;  1NRJ A;  5F83 A;  1GA9 A;  1VM1 A;  3UN7 A;  4QJG A;  3O87 A;  1F9I A;  2W1R A;  2XSS A;  3IF6 A;  3S4X A;  5E2H A;  2D01 A;  3FKV A;  3KYQ A;  3M2J A;  3T4J A;  3A3J A;  1IKG A;  1ESI A;  1IYS A;  1ZG6 A;  1F5M A;  3OPH A;  3U4L P;  1TF1 A;  3N8R A;  2ZQ8 A;  5KSH A;  2IWC A;  2ACG A;  3VP1 A;  5D3O A;  3U2A A;  5C5K A;  4BD1 A;  3N7W A;  3OCN A;  4Y15 A;  3BYD A;  1C3B A;  3IXB A;  5J8X A;  5HW3 A;  5DFY A;  1LHY A;  1I2S A;  3MBZ A;  4DDS A;  2VV8 A;  2XA7 S;  1ERM A;  5CTN A;  4JXV A;  2GJ3 A;  5DVA A;  1BTL A;  1L0D A;  3TE8 A;  2GZA A;  4N1X A;  4EXO A;  5FDH A;  2LB5 A;  2QZ6 A;  3MKF A;  2B18 A;  2V1Z A;  3PAG A;  4WMC D;  2OV5 A;  5HAP A;  1WYB A;  2PD8 A;  1T18 A;  3O5Y A;  4XXR A;  3RTY A;  2Y2N A;  3BLM A;  1FCO A;  3KYZ A;  4UA9 A;  4K0W A;  4YFM A;  3CLO A;  4JGR A;  3NIA A;  3BQ8 A;  5CHJ A;  3F1P B;  4E6X A;  4EEP A;  1YLJ A;  4ZDX A;  1XA1 A;  3ZG9 B;  3VP0 A;  2W27 A;  1T19 A;  1MWS A;  3N6I A;  3ULF A;  4DF6 A;  5CGX A;  1YLY A;  4YWZ A;  1DP8 A;  5G4Z A;  3T4S A;  5HL6 A;  2L1M A;  1W63 M;  1CEF A;  4EEU A;  4D2O A;  3G32 A;  1TDL A;  1E4D A;  2C6W B;  3HCY A;  1TS0 A;  2G2W A;  3IH8 A;  3E98 A;  3OPL A;  3W4P A;  3OCL A;  3T4K A;  5KZH A;  1K6S A;  2XFS A;  3SH7 A;  2KDK A;  4K08 A;  2FFY A;  4HI4 A;  3V67 A;  3LIA A;  2X71 A;  5F6A A;  5DFX A;  2KLI A;  4NG2 A;  1WA9 A;  5EVI B;  3IWQ A;  2EX9 A;  2VEA A;  2PU2 A;  3G30 A;  1J3W A;  2WKI A;  5A91 A;  2I9V A;  5IS1 A;  2ZMA A;  4E3O A;  2PBD P;  4JXG A;  4JLF A;  3NY4 A;  5HSQ A;  4MDZ A;  3GDI A;  3VP4 A;  1MWU A;  4MBH A;  5F1F A;  4KG6 A;  2J3T C;  5HAI A;  2ZC6 B;  3IHA A;  4DJ3 A;  1K4E A;  4HY8 A;  4HOI A;  3M6H A;  5E43 A;  2Y2L A;  1RP5 A;  4S2L A;  1U60 A;  3IWI A;  3TG9 A;  2E8I A;  4FH2 A;  2VV6 A;  3VE3 A;  4YOF A;  5HWW A;  4FD8 A;  1CEG A;  1YMS A;  5FAS A;  2WKQ A;  1YPR A;  5EEC A;  1IOU A;  2V9A A;  2UWX A;  2XH9 A;  3F1O A;  1VEU A;  4LRX C;  4U0X A;  5FI2 A;  2Y59 A;  2WGV A;  3LR0 A;  3HUO A;  1YMX A;  1ZC2 A;  1RGY A;  4L9F A;  4S2M A;  4UA6 A;  1P9R A;  1MBL A;  4HHD A;  3OC2 A;  4CLC C;  3UDI A;  2PBY A;  4DMZ A;  2PDR A;  3ZVW A;  3JVU A;  3EGD C;  4JGP A;  3IQA A;  5TFQ A;  3QP8 A;  2DCF A;  4X6T A;  1TS8 A;  5FAQ A;  3M2K A;  2JBF A;  3S7Q A;  2OAQ 1;  4JF4 A;  1HTZ A;  4JXW A;  2P9V B;  3B47 A;  1W5D A;  1DY6 A;  2XD5 A;  3MQO A;  1LI0 A;  4WEL A;  2YKF A;  2Q0O A;  1BUL A;  2Y2M A;  1JWZ A;  2XLN A;  2QJ5 A;  2XRN A;  3H7W B;  4HQA A;  1OME A;  2HZ5 A;  1BYW A;  5FQI A;  1S4R A;  1NZO A;  3CAX A;  5TBM A;  3LIE A;  4LFU A;  2XGN A;  5F1G A;  3OOV A;  3V39 A;  2Y2I A;  5DTS A;  1G28 A;  4OP8 A;  3VFF A;  3RXW A;  2JKT M;  2EXB A;  2QHK A;  4C75 A;  1LL9 A;  2HP5 A;  4EER A;  3F1N A;  1XGJ A;  1ONG A;  4HH3 A;  2VZW A;  2XRO A;  5CHM A;  4Y5F A;  1Z6F A;  2H10 A;  1KE0 A;  3TW8 A;  3BJN A;  1DJB A;  2ZQA A;  1NRF A;  2A24 A;  5L10 A;  5LBR A;  1GSV A;  4I39 A;  4PHT A;  4B93 A;  3HUN A;  4CPK A;  1JWP A;  2WGW A;  2Y2G A;  1TS6 A;  4Y7P A;  4FSF A;  5TJJ A;  3LIB A;  4E04 A;  1GHI A;  5L2F A;  3FG8 A;  4OQH A;  2D02 A;  3MSH A;  3IX4 A;  1NZU A;  3A3E A;  4JPM A;  2JKG A;  3WS4 A;  4R0Q A;  4CJN A;  3BFF A;  5FAP A;  3CIT A;  4DJ2 A;  4GS9 A;  3UE0 A;  3LY4 A;  4WYY A;  5KSC A;  3BFE A;  3CUE C;  1YAX A;  2ZC5 B;  1PI4 A;  5TBM B;  5FAO A;  3QP2 A;  3AGD A;  4P6Z M;  1PRQ A;  1XPB A;  1L3L A;  3IH9 A;  3VOZ A;  2V0W A;  4KUO A;  1SDE A;  1DP6 A;  1H8Z A;  4IED A;  3ZG0 A;  3LGO A;  5U47 A;  5GLD A;  3BW6 A;  2XR0 A;  1K57 A;  1NLZ A;  4EBN A;  4JBF A;  4GHI A;  2J3W A;  1NYY A;  1K6R A;  3MKE A;  4RA7 A;  2A24 B;  3H82 A;  4E3N A;  4F3L A;  3MFX A;  2PR6 A;  1IEM A;  4UEY A;  2P04 A;  4BL3 A;  2W3G A;  2EX6 A;  5F82 A;  2DNS A;  1VHM A;  3G31 A;  3LIC A;  4KG5 A;  4QWO A;  2HV1 A;  5FL3 A;  3FWL A;  3UME A;  2EWW A;  5I5L A;  3PR6 A;  5IT5 A;  4GZB A;  4ARZ A;  5HD5 A;  5HDD A;  1PW8 A;  2K31 A;  3ZG8 B;  3T1R A;  1A0K A;  1PZP A;  2W0N A;  2WKR A;  3P09 A;  1OT6 A;  3RXX A;  3ZG5 A;  5L8M A;  5HWV A;  3DTM A;  1TVF A;  4EU0 A;  2HDS A;  1LLB A;  4P87 A;  3PBO A;  4GW9 A;  3UDF A;  3UPP A;  4R23 A;  4HBT A;  2V8F A;  4I38 A;  2INW A;  1YSP A;  5CEC A;  4MBK A;  4HJ6 A;  2EFU A;  4OVD A;  1YLT A;  1Y4O A;  5AQ9 A;  4BEN A;  1S67 L;  4ME4 A;  2ZOI A;  3LR5 A;  4S2K A;  1LSW A;  4NXE A;  4DE1 A;  4FTX A;  4WM9 A;  4LCM A;  5HZH A;  2WUQ A;  3DTE A;  3K2N A;  3P98 A;  3IBJ A;  4R3A A;  4FUW A;  4GOG A;  3A0V A;  3O3V A;  2Z2M B;  2B95 A;  4O01 A;  2JN7 A;  3SH9 A;  3PYP A;  3K3C A;  2J9P A;  3PBT A;  2HDR A;  4R1G A;  3NUL A;  4QPR A;  3EWK A;  3CI6 A;  4WEJ A;  4D60 A;  4GJ4 A;  1W7F A;  4UQI M;  4X25 A;  4E3K A;  5FI7 A;  5EE8 A;  3VP3 A;  4GCZ A;  4KQR A;  4OLG A;  5DF9 A;  1S66 L;  4MEZ A;  1L2S A;  4MN5 A;  3F1P A;  3AGF A;  3UY6 A;  1KGG A;  1YKD A;  2QMI A;  1BUE A;  3W4O A;  3H9W A;  4L9E A;  4IBX A;  3E2L A;  3Q1F A;  5JYO A;  3ZG7 B;  2OLV A;  4MN6 A;  1DP9 A;  1MWT A;  2PD7 A;  4OOM A;  4GDB A;  4WF0 A;  1ESU A;  2WAD A;  1V9Y A;  4IUH A;  4NXB A;  4KQO A;  4ETX A;  1KGF A;  5CHU A;  3HLD A;  3MJQ A;  2FFF B;  4O8G A;  3TOI A;  5GL9 A;  3HLC A;  1KVM A;  1DJA A;  5EVI A;  3UE3 A;  3PBS A;  3OLO A;  3HLG A;  1L0F A;  5CRF A;  1G68 A;  5CEB A;  4EUV A;  1H5X A;  2WAE A;  3DTI A;  4QD4 A;  4UA7 A;  4KZ6 A;  3SS5 A;  2W1T B;  1TD5 A;  4ZJ3 A;  2UV0 E;  4KEN B;  4ZRR A;  2Z6C A;  1BLP A;  2FH5 A;  1P9W A;  1KE4 A;  1L0G A;  2B02 A;  5CTM A;  1FSW A;  3WS2 A;  2CMN A;  3IBR A;  4Y17 A;  3MXS A;  2NUT C;  3JPU A;  5EPH A;  1AXB A;  1EWZ A;  3PBQ A;  3BRM A;  2PYP A;  5E2G A;  1YM1 A;  5M19 A;  3BQA A;  1F2K A;  1DJC A;  2VGJ A;  4PM5 A;  2HF6 A;  4L9G A;  3MS6 A;  1K54 C;  4HP9 A;  2BAS A;  2P74 A;  3NDE A;  4R4S A;  4S2I A;  1RGZ A;  4WZ5 C;  3FZC A;  3ZQ5 A;  3GR2 A;  2WKH A;  1IKI A;  3A0S A;  1HVB A;  4EWF A;  4PM9 A;  3UB6 A;  1OT9 A;  4LV0 A;  3UB9 A;  4GNU A;  2V8C A;  4BD0 A;  1OJG A;  3UPO A;  4LEN A;  4KQD A;  1K4F A;  4HJ3 A;  2WGI A;  2EX2 A;  5TGF A;  4ESP A;  5JYP A;  3SH8 A;  3VSL A;  2W3E A;  2ZL1 B;  2PRF A;  1CF0 A;  3MZE A;  2BG1 A;  3C8C A;  5FQM A;  3GV9 A;  4AFI A;  3R7W B;  2Y2J A;  1SKF A;  2P9V A;  2LB9 A;  3LYX A;  1JVJ A;  1IYQ A;  4YNR A;  3B42 A;  1DRM A;  4MCW A;  4KUK A;  2J8Y A;  4PKY A;  1QME A;  4G3K A;  1M40 A;  3H7W A;  1K56 A;  2X02 A;  2J7V A;  4JKT A;  4II7 A;  1N9O A;  5FQK A;  5M1A A;  4FCF A;  3KO6 A;  2BTF P;  2MJ6 A;  2J80 A;  3LO7 A;  3CHW P;  4G3W A;  1G5U A;  4KG2 A;  2O9C A;  3RFB A;  1M6K A;  3ITA A;  2P08 A;  2HGV A;  4Q0J A;  1GA0 A;  3IX8 A;  1V9Z A;  5J4E A;  5G18 A;  4Y2F A;  3TRC A;  4QY6 A;  4OQI A;  2O9A A;  3FYZ A;  1YLZ A;  4DRT A;  3IS2 B;  3UE1 A;  3MZF A;  3FV7 A;  2HPB A;  3QP5 A;  1J9M A;  2ZC7 A;  3EEA A;  3HLE A;  2EWV A;  4IBR A;  4OOY A;  1XFQ A;  2VGL M;  1XA7 A;  3KSI A;  2JHE A;  3D9Y A;  4Y13 A;  3CMZ A;  4P6Z S;  2VX8 A;  3HJK A;  3HLB A;  2BLS A;  5K5B A;  3MXR A;  4LPZ A;  1MY8 A;  3QNB A;  5BOH A;  3T1X A;  3D3O A;  1MKI A;  4PKY G;  4I3I A;  1S4S A;  1ALQ A;  2L4R A;  4Y3I A;  4RQ9 A;  2C5W B;  1HLU P;  2EA9 A;  1UWP X;  2HP6 A;  2V2F F;  2PR5 A;  1YLP A;  1OPX A;  5HAR A;  1PI5 A;  5KMW A;  2HP9 A;  4I5S A;  4IVI A;  3S1Y A;  4E3I A;  4K0X A;  4BBT A;  2ZM2 A;  3G35 A;  4MN7 A;  4XT2 B;  2Y2H A;  2V0U A;  1K55 C;  3LY3 A;  3FPV A;  3E4P A;  3PBN A;  4FH4 A;  2KX6 A;  3BFG A;  4WUJ A;  3A0R A;  5EVI D;  1IEL A;  4I3A A;  3WRZ A;  3ZVT A;  4PAU A;  3BFC A;  1NXY A;  1ES3 A;  1GSX A;  3MF0 A;  3NEC A;  1PWC A;  4LV3 A;  1EI5 A;  4OOL A;  3N4I A;  4O0P A;  1CI9 A;  2CC1 A;  3EEH A;  5EVE A;  1TDG A;  3MQ0 A;  1JTD A;  4DKI A;  2PU4 A;  2M7U A;  1XJ2 A;  4H6J B;  4CLC A;  4H8R A;  3L7H A;  4WN5 A;  3C4P A;  1SHV A;  2XQZ A;  3BWL A;  4PM6 A;  1PWD A;  1IYO A;  2QJ7 A;  1LT0 A;  3C2W A;  5GLA A;  4NK3 A;  2H28 A;  4Z9Q A;  3SW1 A;  2PT7 A;  3L9K A;  3KYE A;  1OTB A;  2A3U A;  1S1Z A;  3KX0 X;  2HDQ A;  1AWI A;  5I94 A;  2AVX A;  4A5R A;  3LI9 A;  4KZ4 A;  4KZ7 A;  3T50 A;  3NJA A;  2ZMV A;  2X01 A;  1XFN A;  4OLD A;  4ID4 A;  2K7S A;  1FR6 A;  1CI8 A; 
#chains in the Genus database with same CATH homology
 3PBT A;  3T4S A;  5HL6 A;  3HJI A;  2L1M A;  1W63 M;  4EEU A;  1F98 A;  4QPR A;  3EWK A;  3HCY A;  1TS0 A;  3CI6 A;  4UQI S;  3E98 A;  4WEJ A;  4GJ4 A;  3D72 A;  3OCL A;  4UQI M;  3T4K A;  2OAP 1;  1OTE A;  2ZBB A;  3EQU A;  3KSH A;  4GCZ A;  4HH2 A;  5DF9 A;  3T4O A;  1S66 L;  3MXQ A;  4MN5 A;  3F1P A;  2KDK A;  4K08 A;  3PBR A;  4HI4 A;  1YKD A;  3UB8 A;  3V67 A;  4BWI A;  3LIA A;  2GNX A;  3PHY A;  2PHY A;  4WL9 A;  5F6A A;  2W3F A;  2G7U A;  5DFX A;  4CLC B;  3H9W A;  2KLI A;  1WA9 A;  2VEA A;  3S7O A;  3LFV A;  1MC0 A;  4L9E A;  2I9V A;  5IS1 A;  3ICY A;  1LSX A;  5DKK A;  1ZTU A;  3LID A;  4MN6 A;  2QYB A;  3F1O B;  1DP9 A;  5HSQ A;  1LSV A;  4MDZ A;  2PD7 A;  4OOM A;  2L0W A;  2K2N A;  4WF0 A;  3GDI A;  5J7E A;  3JVV A;  1V9Y A;  2J3T C;  2QKP A;  4HNB A;  4LRY C;  1XJ3 A;  4IUH A;  4NXB A;  4KQO A;  1N9N A;  4DJ3 A;  4ETX A;  1VB6 A;  5HPF A;  2JKT I;  3MJQ A;  4FOF A;  4O8G A;  4HY8 A;  4HOI A;  1T1C A;  2Y79 A;  3UE3 A;  1ZHH B;  3PBS A;  3OLO A;  3LR3 A;  4BJP A;  2ZOH A;  3VE3 A;  4B9O A;  2VV6 A;  4EUV A;  5J3W A;  2V1A A;  1STZ A;  4YOF A;  3MMH A;  1NWZ A;  4CLC E;  3EOI A;  4NEE D;  5HWW A;  1XJ4 A;  3DBA A;  1N9L A;  5DJU A;  2WKQ A;  5HDS A;  4BBU A;  5MC7 A;  2W1T B;  3R4K A;  5G4Y A;  5CX7 A;  1IOU A;  1GSW A;  2V9A A;  1TD5 A;  2HJE A;  3F1O A;  2JKR I;  2YKH A;  5IU1 A;  4LRX C;  3NOP C;  4ZRR A;  2Z6C A;  2FH5 A;  1P9W A;  1OTA A;  2B02 A;  3C38 A;  3LR0 A;  1P0Z A;  2CMN A;  4L9F A;  3IBR A;  1H8M A;  2NUT C;  3MQQ A;  1P9R A;  4BBV A;  2W3D A;  3PBQ A;  2PYP A;  3TJZ C;  5HPI A;  3BQA A;  4HHD A;  3OC2 A;  3NHQ A;  3T4Q A;  2PYR A;  4CLC C;  2HF6 A;  4DMZ A;  2DMW A;  2PDR A;  4L9G A;  1YSQ A;  3JVU A;  5HWT A;  3EGD C;  2OOL A;  4JGP A;  2ZMF A;  4I3J A;  2NUP C;  4HP9 A;  1XJ6 A;  4IHQ A;  1TS8 A;  2BAS A;  4JGO A;  2W1T A;  1G6O A;  4LLO B;  3NOU C;  1LL8 A;  2P7J A;  4EES A;  2J3T D;  3KSF A;  3S7Q A;  2OAQ 1;  5F68 A;  2WKP A;  4JGQ A;  3ZQ5 A;  3W2Z A;  3B47 A;  3ZYT A;  5A8B A;  3A0S A;  2V1B A;  3F1N B;  1UWN X;  2OWJ A;  3UB6 A;  1OT9 A;  3MQO A;  3UB9 A;  4WEL A;  2YKF A;  3S7N A;  3CWF A;  1OJG A;  2QJ5 A;  2XRN A;  3H7W B;  4KQD A;  4HQA A;  4HJ3 A;  5F69 A;  2VLG A;  4L0L A;  4EW7 A;  3B33 A;  1BYW A;  2A2L A;  1S4R A;  3UE6 A;  5HD3 A;  3G6O A;  3CAX A;  2W3E A;  5TBM A;  3LIE A;  4HJ4 A;  3OOV A;  4DN0 A;  3C8C A;  1UGU A;  2Z6D A;  3UB7 A;  4AFI A;  2VKS A;  5AVE A;  1NLY A;  1G28 A;  1OJ5 A;  2Y8H A;  1TS7 A;  4BMW A;  2O9B A;  3R7W B;  4EET B;  5AJG A;  1D06 A;  2JKT M;  4Q0I A;  2LB9 A;  2QHK A;  3LYX A;  4IUK A;  1D7E A;  2HJ9 C;  3OBF A;  4EER A;  3F1N A;  4YNR A;  4HH3 A;  2VZW A;  3B42 A;  2XRO A;  1DRM A;  1IFQ A;  4KUK A;  4MCW A;  4CLC D;  3LI8 A;  3KSG A;  1EW0 A;  4PKY A;  4Y5F A;  3RH8 B;  3TW8 A;  4G3K A;  3BJN A;  1ODV A;  4IJG A;  3H7W A;  4EQ1 A;  1S1Y A;  1OTD A;  4II7 A;  1N9O A;  2A24 A;  2QWS A;  4GS9 B;  4NXG A;  2JKR M;  3CUE A;  5LBR A;  3KO6 A;  2O0Y A;  2O99 A;  1GSV A;  4I39 A;  2MJ6 A;  4PHT A;  4B93 A;  2J80 A;  4NXF A;  1T1B A;  3K3D A;  1TS6 A;  4G3W A;  4FSF A;  5TJJ A;  3LIB A;  4E04 A;  3R7W A;  2FZ0 A;  4ETZ A;  3BY9 A;  2O9C A;  3RFB A;  2P08 A;  2HGV A;  3FG8 A;  4Q0J A;  1V9Z A;  1MKM A;  4M4X A;  3VE4 A;  5J4E A;  2D02 A;  4Y2F A;  3TRC A;  1T1A A;  3PXP A;  2O9A A;  2OWH A;  1W63 Q;  3IS2 B;  2M1C A;  2M7V A;  3EQV A;  5AVF A;  3LR4 A;  3EEA A;  3VV4 A;  4GHI B;  2VGL S;  4DJ2 A;  2EWV A;  3CIT A;  1Y28 A;  1XFQ A;  2W3H A;  2VGL M;  4GS9 A;  4R70 A;  3KSI A;  3H82 B;  1JNU A;  2VV7 A;  3CUE C;  2JHE A;  4WEK A;  4WLA A;  4F3L B;  1YAX A;  2GX5 A;  5TBM B;  1X0O A;  1OTI A;  4P6Z S;  3FC7 A;  4P6Z M;  2VX8 A;  3HJK A;  3T4T A;  5K5B A;  4LPZ A;  2V0W A;  4KUO A;  3D3O A;  4PKY G;  3C30 A;  3E4Q A;  4I3I A;  3E0Y A;  1S4S A;  1DP6 A;  3T4L A;  2L4R A;  4Y3I A;  4R38 A;  4ARZ B;  5DKL A;  2IA2 A;  4RQ9 A;  2EA9 A;  3BW6 A;  3FPW A;  3IS2 A;  1UWP X;  1NLZ A;  3VOL A;  3LIF A;  3MR0 A;  2PR5 A;  4GHI A;  1OPX A;  2J3W A;  1NRJ A;  2A24 B;  4HP4 A;  3H82 A;  5HDC A;  4MMN A;  1F9I A;  4F3L A;  3P7N A;  3MFX A;  2W1R A;  2XSS A;  2PR6 A;  4I5S A;  3BY8 A;  4UEY A;  2D01 A;  2P04 A;  3KYQ A;  4BBT A;  2W3G A;  4R6L A;  1P97 A;  1VHM A;  3LIC A;  4MN7 A;  4XT2 B;  3T4J A;  2HV1 A;  5FL3 A;  2V0U A;  3UME A;  2R78 A;  1F5M A;  2EWW A;  3FPV A;  5I5L A;  3E4P A;  3PBN A;  3PR6 A;  5IT5 A;  4ARZ A;  1TF1 A;  3UMD A;  2KX6 A;  5HD5 A;  5HDD A;  2VJW A;  5KSH A;  2K31 A;  2KOI A;  4Z1W A;  4WUJ A;  3A0R A;  4I3A A;  3U2A A;  5C5K A;  4PAU A;  2W0N A;  2WKR A;  4Q0H A;  1OT6 A;  3P01 A;  3EGX C;  1GSX A;  3MF0 A;  5L8M A;  5HWV A;  3OCN A;  4G3V A;  4EU0 A;  4OOL A;  4O0P A;  3E4O A;  3EEH A;  5DFY A;  1H3Q A;  3MQ0 A;  3PBO A;  4GW9 A;  3GEC A;  5KIZ A;  4I38 A;  5DJT A;  4NKP A;  2M7U A;  2VV8 A;  1XJ2 A;  2XA7 S;  4H6J B;  2INW A;  1YSP A;  4CLC A;  5F5Y A;  4XT2 A;  2XA7 M;  2VA0 A;  4HJ6 A;  4LRZ E;  4WN5 A;  3S7P A;  2GJ3 A;  3BWL A;  3TE8 A;  2GZA A;  2QJ7 A;  1LT0 A;  3C2W A;  4EXO A;  1MZU A;  2LB5 A;  2H28 A;  3SW1 A;  1S67 L;  2PT7 A;  4ME4 A;  2ZOI A;  3LUQ A;  2B18 A;  3LR5 A;  4GLQ A;  1OTB A;  1S1Z A;  1LSW A;  2PD8 A;  1T18 A;  3O5Y A;  4NXE A;  3KX0 X;  3RTY A;  3KYZ A;  3LI9 A;  3CLO A;  4JGR A;  5EFW A;  3BQ8 A;  5HZH A;  3K2N A;  3IBJ A;  1KOU A;  3F1P B;  4R3A A;  3T50 A;  4EEP A;  3A0V A;  3NJA A;  4H6J A;  2ZMV A;  3NOT C;  1XFN A;  2W27 A;  1T19 A;  3ULF A;  4HIA A;  4YWZ A;  2K7S A;  4O01 A;  1DP8 A;  2JN7 A;  5G4Z A;  3PYP A;  4CQH A;  3K3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...