3CULA

Aminoacyl-trna synthetase ribozyme
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
92
structure length
92
Chain Sequence
TRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of specific tRNA aminoacylation by a small in vitro selected ribozyme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna/rna binding
molecule keywords RNA (92-MER)
total genus 17
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3culA00
2M2BA 2OIHA 2CQGA 3CCVS 1DZ5A 5LSOA 1X4CA 1URNA 3P49B 2I38A 2MKKA 2QA4S 3NS6A 2HVZA 1U1RA 2VONA 4CH0S 2MSTA 3G96A 1WEZA 2CQ3A 1WG4A 1PGZA 2VOPA 2RS2A 1HL6A 5IQQA 2CQ2A 2FC9A 2JX2A 4IO9Q 4J5OA 5H1SV 2X1FA 2MPUA 1K8AT 1SXLA 2U1AA 3U1MA 2JVOA 2M7SA 2CPZA 3S6EA 2CQIA 1M5KC 2JRSA 2MJNA 2RNEA 2KXNB 2M9KA 2MKHA 3CTRA 2CPXA 1M1KT 4F25A 1X4AA 3VAKA 2MZQA 5DDQC 2CQDA 1UP1A 3HI9A 2VODA 1QVGR 2LCWA 2KU7A 3MD3A 2RRBA 2MZJA 5GVQA 4TU9A 3HHNB 5GAEU 4ED5A 2DHXA 3P3DA 1N8RT 2MY7A 4WKRA 2YKAA 2EK1A 2V94A 3CC7S 3I55S 2L08A 4CQ1A 3J7ZT 2M8DB 2Q79A 2CQHA 2HZCA 4YOEA 2DGUA 4ERDA 1NO8A 3FEYB 2N7CA 1FJEB 1VC6A 2CQ1A 1H2TZ 2MB0B 2KI2A 2X1BA 2XS2A 1X4FA 4P6QA 5LJ3Y 2N82B 5D77A 3G8SA 3VAHA 2N3LA 3H2UB 2YWKA 4PKDB 5JVGQ 3JB9k 1U1KA 2G0CA 5ITHA 5GAGU 3UCUP 1P1TA 2J0QD 2DNZA 2ZJPQ 3DLLQ 5LXRA 2MJUA 1U1QA 2KH9A 3EGNA 5DDPC 5DDOC 3R27A 3CCJS 1U1LA 1BY9A 3TP2A 4TLQA 2MXYA 5GADU 2M70A 4W92B 1UW4A 1IQTA 3D2WA 4LMZA 2LXIA 2ZJQQ 4WFBQ 1M5OC 1WTBA 3THTA 1VBZA 5CXTA 2MKSA 2MQMA 1Q7YT 1QM9A 5CYJA 2LA6A 3BO3A 4Y00A 2M0GB 1U6FA 4UQTA 4IOAQ 2KN4A 1X4BA 2RT3A 5GMKa 2ERRA 1N54B 3J7YU 1X0FA 3VAGA 3G71S 1VC5A 2DNOA 2CQ0A 1YWXA 4Y0FA 3CUNA 3CMAS 2DNNA 4C4WA 3THPA 1X5PA 4ZKAA 2M8HA 3IRWP 2MQLA 4W90B 3UCGA 2DNPA 3CMES 2AYMA 1VQ4S 1X4EA 2M4MA 2RVJA 4WFNQ 1U1OA 2RUGA 5LJ5Y 2AD9A 1OO0B 3G8TA 1L3KA 2KG1A 2DNYA 2MSSA 3NNCA 3I56S 2F9DA 1K9MT 2JWNA 4TU8A 2CPJA 3SDEA 1VQOS 3S8SA 1X4DA 1SJRA 1R8HA 1WF0A 1WHVA 2CPFA 2DGXA 2F9JA 4CIOA 1UAWA 2DGVA 2DO4A 2DHAA 3B4MA 2LYVA 1B7FA 1A7GE 2DNLA 1FT8A 1DRZA 1WF2A 3LPYA 2CPIA 2CQ4A 3CF5Q 2OSRA 2DGTA 3CCES 2E5HA 1JJHA 4YUDA 2FPHX 1NU4A 2DK2A 3R1HA 1VQ5S 1WHXA 1X5OA 5IFMA 1P27B 1OWXA 2LKZA 2X1AA 1FJ7A 4QPTA 1YTYA 3UE2A 2OTJS 1UFWA 3V4MA 1U1PA 1KD1T 1AUDA 1M5VC 2MZSA 2PEHA 4F26A 3S01A 2WBRA 4V19X 1G2EA 5HL7Q 4WFAQ 5DETA 2CQPA 3UD4P 2MZTA 1WI8A 5DM7Q 2KYXA 3MD1A 4YB1P 2DHSA 2DNGA 2RU3A 3MUVP 1R8PA 3B4DA 3G4SS 1D9AA 5DDRC 2G4BA 2D9OA 3CCRS 2X1GA 1ZZFA 4QU6A 1HA1A 2MGZB 1A9NB 3G9CA 2XSFA 2MZRA 2A3JA 2KXFA 3EGZA 2ADBA 1VQ6S 2XS7A 1HD0A 2FHOB 2KM8C 2NLWA 5LXYA 2XB2D 1WWHA 2LEAA 1VQLS 1FHTA 4BS2A 4LIRA 2KM8B 3CXCR 3CC2S 1U1MA 4F02A 2SXLA 4C0OC 3CULA 2GHPA 1WF1A 1N88A 2DNHA 3Q2TC 2DGWA 2L9WA 3BO4A 4CH1A 5IM0B 3CCSS 3TYTA 4IOCQ 2O3DA 3MUMP 2G1DA 1YHQS 1OIAA 2CJKA 5GAHU 2DNRA 5CA5A 1K73T 1DBDA 2U2FA 3BS9A 2FC8A 1YITS 3G6ES 3CCUS 3BO2A 1X4GA 1VBYA 1O0PA 4M5DB 3US5A 1VQNS 2VOOA 3IWNC 2MKIA 1WHYA 3VF0B 1KOOA 2KXHA 1U1NA 3NNHA 2DGSA 4Z2XA 3PIOQ 1YJ9S 1VQ8S 2DIUA 1WEXA 3OW2R 2MQNA 3RW6A 2MY8A 1KOHA 2PE8A 3UWTA 2DNMA 5LSLA 2AYGA 2AYBA 2J0SD 4OZ1A 2L41A 5HO4A 1VC0A 2RRAA 3CCQS 2BOPA 1NJIT 3CCLS 1WEYA 2GO9A 3N9UC 2K8GA 3MXHP 2CPDA 2HGNA 2AYEA 2XNQA 2YTCA 2DB1A 1XN9A 3MUTP 3DXBA 4WIIA 3R1LA 1VBXA 2KRRA 5MLCV 2OTLS 2MQPA 2CQCA 1OPIA 2OSQA 3CC4S 2DH9A 2HYIB 2XNRA 1F9FA 3FEXB 2HGLA 2NZ4A 2DGOA 2MMYA 4IUFA 2E5IA 2KRBA 4FXVA 1YIJS 1WELA 1VQKS 3BEGB 5FJ4A 2DO0A 3EX7B 3CD6S 1SJQA 2MQOA 3NMRA 1WI6A 1SJ4P 1YI2S 2DH7A 1FJCA 2DH8A 3NS5A 1U6BA 1D8ZA 2YH1A 4LJMA 3LQVA 1VQMS 2I2YA 1Q81T 1VQ7S 2J76E 3VAFA 4C7QA 4RU2A 3H2VE 2LQ5A 2E44A 3NNAA 3S7RA 1JMTA 4WCEQ 2MZ1A 2D3OR 2CPYA 5IM0A 4UY8T 2CPHA 3Q2SC 1SJ3P 3VAIA 1JJ4A 3SMZA 4TU7A 3SXLA 2KT5A 1Q82T 2K3KA 3VAMA 5BJRA 2DIVA 2DNQA 4OZ0A 1DHMA 3TO8A 2LXUA 2MKJA 2LECA 4PRFA 4QQBA 4FXWA 5EN1A 1S79A 3ZZYA 3MDFA 1CVJA 2N3OA 3L3CA 2MGZA 5JVHQ 2JVRA 1ZH5A 1YJNS 2MHNA 1WG1A 2D9PA 3RW7A 2LEBA 1PO6A 1N52B 2RQ4A 2KFYA 2KG0A 4U67Q 2CQBA 1RK8A 2DHGA 1YJWS 1QVFR 1HD1A 3P6YC 1H6KX 2M88A 1KQSR 2LA4A 1VQPS 2OJ3A 5DM6Q 3VAJA 2FY1A 1FXLA 1H2VZ 4A8XA 3UD3P 3MI7X 1W2BR 2MKCA 2E5GA 2QEXS 1FNXH 3CPWR 3MURP 2YH0A 2MQQA 1WHWA 2RQCA 1M90T 3CCMS 1WG5A 2DITA 1M5PC 3ULHA 1S72S 1X4HA 3UCZP 1JJ2R 2EVZA 2RS8A 3U1LA 2ADCA 2UP1A 1X5TA 2DNKA 2F3JA 2QFJA 2KHCA 3VALA 3SDEB 3ZZZA 2EK6A 2M52A 1SJFA 2HGMA 3PIPQ 4WF9Q 2MYFA 4EGLA 1ZZNA 4QU7A 2E5JA 2ZJRQ 2LMIA 2CPEA 2KVIA 2BZ2A 1FO1A 1KC8T 3K0JA 1Q86T 1VQ9S 1X5SA 3MOJB 5D78A 3P5TL 2XS5A 2DGQA 2B0GA 2DISA 2J8AA 1H2UX 4PR6A 1U2FA 1RKJA
chains in the Genus database with same CATH superfamily
4USMA 2M2BA 4RUCA 1J5OB 3BGFA 4DX5A 4WIQA 2RQMA 2WK4A 1ICEB 4R25A 2OPRB 5LSOA 3JYTA 4Y6IA 3MM7A 3OTCA 4JYAJ 2CJQA 1URNA 2Q1LA 1RCOB 3AB2B 3R7BB 2I38A 3HHDA 3M7VA 1QAJA 1S1XB 5IV4A 2F7VA 3NS6A 4K59A 3TVYA 5DLFA 1S6PB 3QAEA 2NXEA 4DL3A 1XTZA 1U1RA 4WZMA 1JLFB 2ZH4A 3V6JA 3T1HJ 1BXNA 2DD8S 3VGTA 1DTTA 1JLBB 1S6QB 2V8VA 4BLGA 1HNWJ 1FESA 1WEZA 5F8IA 4DV5F 3POTA 2AV5A 4QIWD 3K5LA 4EK2A 5DZ7A 3PFOA 4QPXA 5DQIA 1JXVA 3M8PB 2HNZA 2GMHA 2CVIA 4DQSA 2EXUA 3RU0A 3PFEA 4WBFA 1S1WA 2WRMA 5JXSA 4CT8A 3IRXA 4CZCA 3T41A 3VZIA 3FFIB 2YKPA 4LF9F 1UVMA 3HHLB 2JX2A 4IO9Q 3MEGA 4HYKA 1UVJA 4KPYA 1H7WA 2XMVA 3AD9C 4G1QB 4ED8A 2DYAA 5EX0A 1PYOB 2DRBA 1EQMA 2UVWA 1KVIA 4EBCA 1UCNA 3TEGA 3SSQA 1VK8A 2IAJA 2KZMA 4X4PA 4ZVTB 2R8JA 2GQCA 4PYAA 1MMDA 2FZCB 1UJ5A 4F3MA 2CQIA 3I0SB 1L3TA 2RDIA 2JRSA 4X62F 1VJWA 2F1FA 3MEEA 3G82B 4NYOA 8AT1B 4DPTA 1NPKA 1TL7A 3Q8PB 4FYXB 1X4AA 3A8JA 3J80U 1CJTA 3LTOA 1HWIA 1UP1A 3DCAA 3HI9A 4ZS6A 2PMZD 1UVNA 2VODA 3H5SA 2GZOA 5EDWA 1CJKB 4EBEA 4ECWA 5A2QY 2AX1A 1VRTA 2HWHA 2KU7A 1W26A 2OPSB 3D0HE 3T1YJ 3MCNA 4LVNP 4USHA 2G9OA 4LBPA 2AKWB 2DHXA 2BOAA 1PC5A 1MMNA 3M32A 4USVA 1BQMA 3S1TA 2JHEA 2V94A 2D3O1 1XWLA 4G65A 4WFZA 2PI5A 4WXOA 4CLPA 4F8RA 4RO0A 3I55S 1RDRA 4HR2A 2V2KA 4U8VA 4CQ1A 3L7OA 3MECA 1X8DA 5B0CA 1JLQB 3NLCA 3GJTB 4JUZA 3D54A 3BSOA 4DFPA 1D9DA 4B3SF 3C2PA 4ZVOB 1RABB 4ERDA 3MEKA 1NH7A 3KXDA 3QNWB 2UUTA 5KFLA 1YDLA 1H2TZ 1XBWA 4X64F 4RZRA 3OTBA 3NG8A 1X4FA 4P6QA 5D0EA 4ER8A 3TQEA 2J0WA 4F67A 5D77A 3JB9k 1SKSA 2YWKA 3A1YG 5JVGQ 2FJVA 2RRNA 1U1KA 2GQ2A 4DN0A 3CJKB 4NASA 1GXTA 3QWUA 1P1TA 1RAHB 2ZE2B 1WSVA 1DTQB 4FPRA 3RUBL 5GAHI 2ZJPQ 2Y1JA 2UVRA 4RW4B 2WSCC 5LM7E 3LWLA 4KGMA 3OR2B 3DLLQ 1KNZA 3HO1A 2RDDA 4QZVB 1CEZA 3N6LA 4JI2J 1OYEA 2E29A 2OAUA 3EGNA 4KY3A 1N5YA 4B9MA 2R7WA 2ASLA 4FVMA 2J6TA 3SCIE 3ITHB 1VGYA 1SC1B 3EUNA 4DL7A 3RBEA 3GFZA 1U1LA 4TLQA 1TKXB 1JIHA 2BQ3A 2UUBF 3KLEB 4PXBA 1EETB 5FDLA 3VWSA 1DLOB 4F04B 3SBMA 1NK4A 3D2WA 2HRTA 3C16A 1Q4RA 5DG9A 3NBPA 3PEHA 5JJBA 4WFBQ 2F8HA 4DL0C 1FRKA 4LRDA 4ZCLA 5ETQA 3WIVA 3I5BA 3OD2A 3QPIA 1QY7A 1NLKL 2E7VA 5CXTA 3VR1A 3D0IE 2BACA 5D0HA 4P2XA 3M9MB 2W9AA 4QOTA 1QM9A 4WFYA 5CYJA 1N5TA 2PDAA 2AWZA 1FI4A 3DLGA 1CC7A 3FQKA 3GG0A 3PJXA 3QT6A 4Y00A 3O8WA 4DJBA 2W4CA 3F41A 3SSSA 2CNKB 5KG2A 3FJ2A 1L5UA 2IBKA 2I9SA 3QIPA 1FCAA 3I0RA 2ERRA 2WBMA 1HMVB 3AXKA 2W4DA 1GTEA 5KFEA 4DOZA 1R0AB 1XC9A 1RTIA 2ZHOA 4Y0FA 1HBUB 3IAS9 4XPCA 2DR6A 3KFWX 3RRHA 2W2PP 4ZLPA 2PMWA 2GHWA 4TXSA 2NSBA 4NA3A 3CMES 2D3UA 2IYGA 4TY8B 4KB7A 2I5JA 1FRJA 1QAYA 4OZ5A 1U09A 5E7OB 2DEJA 4A46A 1VQ4S 5C42A 4WFNQ 3HD2A 4LFCF 2RUGA 1I1GA 3QZ7A 4NLSA 5C24B 2NREA 5ADZA 3I56S 3A8EA 2UXCJ 2C2OB 4ANEA 2J0XA 1GH8A 2R7SA 4QIVA 1UETA 2CPJA 4FS2A 1VHFA 4A8SA 1G1XA 1KHVA 2NYHA 4K8RA 4XAKA 4I1TA 3DRXA 3K58A 4OFZA 4ZP9A 4ED6A 1Y5LB 3RBZA 1OPZA 3BH7B 1UAWA 3CGIA 4KHPJ 3K5PA 4ILRA 4DR6F 2VPXB 1TL1B 4IDKA 2HHHJ 2QRRA 2DNLA 4ANDA 2I1RA 3HXMA 4FVCA 5B0BA 1F0XA 2HHSA 2CPIA 1I51B 1LW0B 3US5A 4AD6A 1A0OB 1RAIB 2OSRA 5F8MA 2HNDA 3DN9A 1J5EF 5ETNA 4IRCA 1GK8A 2ZBIA 4ECTA 1NHKL 3IWXA 4YUDA 2FPHX 3B6BA 1NU4A 1VQ5S 3GIKA 3PO5A 1X5OA 3C3LA 2FLPA 3D66A 3TZWA 1SUQB 2HG4A 4HI2A 3C6UB 3CDBA 5KFUA 3BH6B 1EKSA 1FJ7A 4QPTA 3DLHA 4PZVA 4YHHJ 4OLPA 1GEHA 1UFWA 1AUDA 4RBUA 3OJUA 3T5KA 3OV7A 3PR5B 4RW6A 2MZSA 1AB8A 1LOUA 5ETLA 5HL7Q 2RU9A 2V8PA 5KFKA 3AA9A 2CJYB 2CQPA 5KFHA 2MZTA 3UD4P 2G13A 4KGZB 3RB4A 4TQRA 1SC4B 2FVCA 3HJVA 5FLXU 4YB1P 1JXEA 1U26A 2DHSA 2EPIA 4LRCA 1TP7A 5LOQA 2RU3A 3EZ5A 4DV7F 5B0GA 4USTA 5A8WA 4WKYA 2PSZA 3KLIA 2VG7B 3QFWA 3UN3A 2G4BA 4KV8A 4C8NA 3K59A 2H65B 2HVHA 4QU6A 3AOAA 2IRYA 4OI3A 1HA1A 4TN2A 5KFYA 1FKOB 4WJBA 4Q8EA 1VJQA 3GONA 3CJSA 1MU2A 2P9CA 1H72C 2ZDOA 2HHVA 5J1EA 1LWFA 2XHCA 3MMBB 2KM8C 2GC8A 4CT9A 1OSCA 4DR3F 2D3ZA 3OSNA 3LF0A 1QSLA 3W62A 2LEAA 3BDEA 4LRAA 3DLBA 1FHTA 1FFWB 2X1AA 1LFWA 4BS2A 2M3DA 3CC2S 3SV3A 4DFJA 2VUGA 4WYWA 3FUYA 1XR5A 4I68A 1R27B 5HANA 4Z37A 1U1MA 3CULA 1U02A 4UOFA 1QE1A 4F02A 1C0UB 2JEGA 1YBTA 1YKWA 2LEPA 2WVCA 3IG1A 1F5CA 5C5JA 2QIFA 4LF7F 2L9WA 1XNQF 3MCMA 4PCQA 1U45A 4CH1A 3IBCB 1T05B 4IFVB 2FJXA 3CCSS 1K44A 3MUMP 2X7IA 2HBYB 4IR9A 1FTCA 3AD8C 1RHQB 3L09A 1JKHB 4CO1A 4KHMA 2CIMA 3KG4A 4KYZA 1RAAB 2J7UA 2DNRA 1S49A 2FDNA 1NUEA 2YNHA 3BM7A 1K73T 1DBDA 3IP0A 2V4QA 4RPFA 1FFGB 3L95X 1MN7A 1YITS 4FF3A 3QT7A 3T19A 3TZZA 1U25A 2UZAA 5A8RA 3G6ES 4ZMMA 1OJ4A 3UDLA 4DL2A 1X4GA 2XMUA 1LKZA 2CA9A 4M5DB 4WTYA 4DV1J 4ZN3A 1VQNS 3AJ1A 2MKIA 3VF0B 2PMHA 3FCWA 2M5YA 4QCLA 2KXHA 2RUSA 3EZUA 5AXNA 1MW7A 2BE7D 4PG4A 4QYRA 5KFPA 4FBUA 3BBBA 4DZDA 4Z2XA 3PIOQ 5L1JA 1SL1A 4DU8A 1UVLA 3GSIA 4O3NA 4MT1A 3BSCA 5IT9U 3H4BA 4C8KA 3K8VA 2HZVA 3L7UA 3VCDA 2VFVA 4FS1A 4DL5A 2IY5B 2BRKA 1TVRB 2NCKL 2MQNA 3MEDA 3BYPA 3RW6A 2MY8A 4B3OA 3G8QA 3UWTA 2DNMA 4J9RA 2KYZA 5LSLA 1R89A 2ACYA 4HHJA 2AYGA 1U7LA 1YBAA 4OZ1A 4NRTA 4KSEB 1EP4A 2AYBA 4O3RA 2LQBA 5HO4A 2RRAA 2QL7B 4QWEA 1VC0A 4LFBJ 3CCQS 5K5MA 5C25B 5FD1A 1FRHA 1UPMB 2WHOA 3B78A 3CCTA 4ID5B 4JBCA 1EAYC 4M5LA 4JI0F 2VKRA 2PIIA 3CCLS 1S76D 3HT0A 4C3KA 1DFDA 2Z58B 3MXHP 1NMEB 2CPDA 3QLHB 4DUZJ 1TK8A 3HULA 2V68A 2WB1D 3HVTB 3MMCA 4OI1A 2EFGA 5F3ZA 1RCXB 4ZHRA 2CDRB 3AQOA 5B09A 4CLYA 4WIIA 4H4KA 3MUTP 1VBXA 4JI6J 1N32F 2ZVIA 1FE4A 2WSEC 3TW0A 4NLGA 4N41A 2KRRA 1Y9OA 4DSLA 1IKWB 1IR2A 4DSEA 2AGOA 3FRZA 1RTHB 3CC4S 1FRMA 2DH9A 1UZDA 5KFSA 2IC3A 2HBRB 2QA1A 2RQKA 4UZBA 1IKVA 3T1HF 1F9FA 2XNRA 1T9WA 3FEXB 2F63A 2DGOA 4I64A 2Y8YA 2V67A 4IUFA 2KRBA 1SI9A 1XIQA 4H4OB 3Q8UA 5HJXA 4AQYF 4BWJA 3GB0A 4A8FA 2RB7A 4K0KJ 2JZ5A 3M6VA 1M1HA 4OYMA 2CJ9A 1NJZA 3LGHA 5U47A 1KBRA 3Q8QB 4DR1J 1U48A 5FJ4A 2IC3B 3RB0A 2DO0A 3ZTOA 4RW9B 1NM2A 1IKYB 1CJVA 1B99A 2MQOA 1JNZB 4RNHA 3OUYB 1JLGA 3DLJA 3OJSA 4IRKA 4JV5F 4ZVUB 4PWDB 1ZPWX 1SJ4P 4C8ZA 1NSQA 1UVIA 3ISZA 5J2QA 2FB0A 5ETOA 3AA8A 3BQ0A 1GNKA 3ENAA 4HHUA 4MKBA 3D9BA 4J9MA 5HP1A 4GMKA 1PILA 3EE3A 2XG8A 4KGXB 2KTQA 2YKMB 1S77D 3I82A 1S99A 3M1VB 1Q81T 2J76E 4X62J 1PBAA 1YX2A 2FVPA 1RAGB 2LQ5A 1BQNB 1TKZB 3CJ5A 3H2VE 5DRKA 3PW5A 4JI4J 3ETOA 3LAMA 1K47A 2B8PA 5HQLA 4CWBA 2QE5A 2MZ1A 5I42A 2D3OR 1C4CA 1N5SA 1CULB 4J90A 2C2ZB 2CPYA 1NDKA 2E5LF 5K8OA 1RI7A 3MPUB 1PSDA 5IM0A 3QGGA 3Q2SC 3OHBA 4JI7J 1FX2A 5ETTA 5EWEA 2EFQA 3MR3A 3VVUA 3W7BA 2CG4A 2VC0A 2AEJA 4ZJLA 5CD4H 3HHEA 2L9NA 2XMWA 4YFUA 2ATLA 5M2PA 2BQUA 3SMZA 1JJ4A 4DV2J 2XEXA 2HBQB 4HACB 4LF8J 3Q89A 1N33F 2Z2YB 1D9FA 3VAMA 1TK0A 2DIVA 5A0YA 5ETMA 2HQ3A 4V19J 3UNYA 1S9EB 3OFHA 1RSCA 1XK8A 4ZDNA 3HPOA 2PN6A 2Y1LB 2C2KB 2V0NA 3D6HB 1RT3A 4FXWA 1U47A 5EN1A 3MFIA 1X31C 4FP9A 4M5DA 5KG3A 2EFVA 3HDSA 1CVJA 4CO3A 3JSMB 3LGMA 3L3CA 2JNJA 1JLEB 1R6YA 2VZ9A 2MGZA 2VICA 5JVHQ 4DR4F 4CRJA 5B7WA 4EO6A 4O3PA 1HPZA 3K5OA 4GKJJ 1KS2A 4OX8A 3DI6A 3TJ9A 5KFBA 2Z2LA 2DCUB 3RW7A 1FERA 3MMAA 1NJWA 3DRYA 3C15B 2AQ4A 3GR0A 1REGX 1OMSA 2DBBA 3DOLA 3Q23A 1YJWS 1F2HA 1NK5A 2HEKA 1AZSA 1H6KX 2F8EX 3OXLA 3Q22A 5L1LA 4J9SA 1TFYA 2CAJA 3KLHB 3E8OA 1ZAXA 2W8LA 2CJAA 1SH3A 1Q53A 2LA4A 3GE9A 4GO7X 2OJ3A 3A13A 1YBUA 3W5YA 1TKDA 1FXLA 1KLMB 2BW7A 1R8CA 2Z2ZA 4EYIB 1Q1KA 3O1LA 4LBIA 1NJXA 5A6PA 4DV5J 2HIQA 1Y5IB 3QQCD 4I2QB 3A3PB 4Y34A 5A8KA 4MIWA 4CLUA 1FNXH 3IAM9 3CPWR 2N7YA 4HDGA 4J9OA 3N5FA 3ENQA 1VLOA 2ZD1B 2QT7A 3MTKA 4N8OA 1F5BA 1M90T 1FWKA 2L9DA 1RLDA 2IMOA 4Q45A 2HLTA 1S97A 1C4AA 2AMCB 5CYQA 2GNKA 3DDNA 1X4HA 3PRDA 3ULHA 5J1EB 2V4JA 2RS8A 3U1LA 1FKOA 2J7WA 1HNVA 1RAOA 1RTJB 3RBDA 3BV8A 2DNKA 2WVDA 3C14B 4DX6A 3KLIB 5AJ3J 1FKPA 1CQNA 5KG5A 1WUUA 2J9EA 3SDEB 3WX8A 4ECUA 1UKUA 2XMJA 2EK6A 2QL9B 3N0VA 2V6AA 3IFEA 5CH7B 3X3UA 3PW0A 1GFWB 2E1RA 1LW2A 4Q7AA 4CDIA 3DM2B 4YY3F 4OX6A 1ZZNA 1CS4B 5L38A 4A8OA 3MM6A 2RHQB 2E5JA 3A3OB 1XR6A 1F6TA 2LMIA 2R7QA 4OHZA 2ZJRQ 2BANA 1HWKA 5D4OA 1HR0J 2KVIA 2GA7A 4OJ3A 4CTAB 5HROA 1KC8T 2CFXA 4B17A 3D3CJ 2B3TB 1VQ9S 4DUYJ 4CO0A 4Z7CA 3DRRB 3RRGA 2GJFA 1SUQA 4CCHA 3R5GA 1TUGB 3MOJB 3BR9A 5DQHA 3JQJA 2DGQA 2XM3A 2XS5A 1Z2ZA 3D6FB 5G4DA 3KHLA 1TTHB 4OV6A 1H2UX 3M2VA 3NRBA 3I9V9 5KFJA 3FSXA 1NB2A 1GAOA 2MLXA 1WDTA 2HZAA 1KKHA 3LAKA 2ZH3A 3CCVS 4ZN1A 4TYBA 1IKXA 4HKQA 3O2IA 2KDOA 5DQGA 5D6GA 4FYYB 2P5VA 4LFAJ 3P49B 5F8JA 2B4VA 4YEAA 3ZZPA 1BGXT 5KFRA 1WC1A 2PO4A 3FVYA 2MKKA 5E3CA 1NK6A 2DT9A 1PIEA 1Z4UA 5AE3A 2ALZA 4HEA9 2MSTA 4NLTA 1Q78A 2BRLA 5BXIA 1T9XA 2ZBQA 1AYEA 4H4MB 2IFXA 5HJYA 5AXKA 4KE5A 3SIPB 1U4BA 2GVZB 2AHOB 1EHWA 4KHPF 5JMNA 1RUSA 1WG4A 1A6LA 3QWPA 5HROB 2CXEA 2OMOA 5KFWA 2VOPA 3M8YA 2VDHA 4IG0A 5H9FJ 3SYZA 4DF8A 4KR0B 4OJ1A 5C42B 5J1PA 3OVSA 5KFZA 3DM2A 2OEKA 4JI1J 4A8MP 3EGWB 1LW2B 4PG5A 1WKJA 1UJ6A 2BE9B 1CJUB 1PJ6A 4P7VA 5KG0A 1U8SA 3HT3A 2DR7A 2C2EA 1Y0HA 2ZVSA 4BWMA 2CJBA 2E9TA 2X1FA 1CJUA 1P8GA 1SXLA 1VBKA 3U1MA 2JVOA 4O4RA 3R9LA 4MK9A 3TAQA 4RLEA 3PW2A 3S6EA 1YRTA 2AIRB 5K8MA 3KK1B 2UVVA 2QMXA 3CDUA 4N5SA 5HVFA 1NK9A 4B3MF 2R2RA 2MKHA 2XMMA 3QGHA 5HMWA 2DPIA 3KMQA 2CPXA 1M1KT 3AB4B 3NWGA 3BN7A 3HZGA 4F25A 4KRWA 2XSJB 1SIZA 1T8EA 4JI5J 2VF3A 4LBHA 4U7UK 2MZQA 2Q6BA 2BJDA 2HFNA 4Y3CA 2FJAB 5DDQC 5H9EJ 1QTMA 3WC2A 4Y2KA 4PEOA 1SQEA 1FDDA 3W63A 1WTFA 4A4JA 4GKKF 3T5JA 3PKYA 4L73A 4KH0B 2W8KA 1W2BR 4L6V3 5DG8A 3K57A 4LF8F 2LVWA 3H90A 4RKUC 5GVQA 4YS2A 2WVEA 3HHNB 3CJ2A 4YR3A 4DQPA 3P3DA 1T7PA 2MY7A 4D3GA 1EETA 5FDLB 4M63A 1LFPA 3M6UA 2R7RA 2QLFB 4URSA 3T5HA 2R8GA 1KP6A 4OYOA 3CC7S 3D6MB 1JK9B 1D09B 4R8UA 2D74B 3UR0A 4RNOA 4YR2A 3MAHA 3DYAA 3F56A 1Y10A 1HQ2A 2XQCA 2V34A 1JJCB 3TA2A 2ZZNA 3NAHA 2DGUA 2JFKA 1NO8A 2H5EA 2RKIB 4M94A 3AHPA 2N7CA 1FJEB 2MDAA 4L74A 2YBVA 1VC6A 5KFNA 3K5NA 4CTAA 2X1BA 3CW2C 4BCAA 1FRXA 2VPZB 2XMKA 5LJ3Y 3MM6B 4FYVB 4DMZA 2N82B 3DNCA 3H7HB 1Y4ZB 3Q8VA 1TV6A 3G8SA 4M5MA 3H2UB 4MYUA 4DR7J 3CCZA 3M30A 3OLBA 1YJTA 3VGSA 2UUCF 1RT6A 3JTOA 2LQ9A 1HHSA 4LSLA 4C8MA 3RB3A 1Q5VA 1VMBA 3MM5A 3MGJA 5GAGU 3V2UC 4ED3A 2KT2A 4TYAA 5L39A 2MLYA 4PXDA 1NDCA 5KG6A 2J7KA 2NXNA 3WHIA 4CLKA 5LXRA 3NMAA 2KH9A 1NK8A 2AF6A 2PEBA 4WP9A 1HNVB 4M5HA 2ZH2A 4NXNF 2HHUA 3HFKA 5A6WA 1JLQA 3PJWA 1U6ZA 1BLUA 1BY9A 4M5IA 3THVA 3C8YA 3O5TB 1NZAA 6FD1A 2H5JB 1DY3A 2ZD1A 4WK1A 1HQEA 5GADU 1UW4A 2VHGA 3GYGA 5L1IA 3CMQA 4I7FA 1GX6A 1OY9A 2XZTB 4N77A 2HHWA 2HMIA 5IV3A 2ZJQQ 4ED7A 5KT5A 5HAOA 1R8AA 3M9OB 3KNGA 1KVKA 4ZVFA 3THTA 1O5JA 3U7JA 2NZCA 4DZ6A 2AJQA 3IWLA 2LU2A 2BJ1A 2MKYA 2MQMA 4K4XA 4DV0J 1AZSB 1XMOF 2HMIB 2LA6A 3BO3A 4Y28C 4I7FB 2C3UA 5HK4A 3MEEB 3NGKA 1U6FA 2ZWPA 3CDWA 1HQEB 4YQWA 4L72B 2W01A 3PHTA 1N54B 5GMKa 1VI7A 3J7YU 2YKNB 4ECQA 3G71S 3RBXA 4B9NA 1HPZB 1HW8A 2DNOA 2CQ0A 4ZPTR 1YWXA 2F4VF 2R7XA 4OYZA 1SC6A 2LQJA 4LREA 2UXCF 2FZGB 2OGUA 4K7QA 4NYZA 4ZKAA 3IRWP 4DL4A 1FDBA 3RAMA 4DV3F 1RT3B 2YWHA 2OH2A 3HKWA 2OLWA 3CDEA 5KFFA 1S9EA 2FVQA 1S1WB 1VS3A 2QL5B 2RVJA 4M5JA 5D0GA 1MLAA 2KHDA 4JI8F 1U1OA 1S4EA 4ILMA 1ZM4A 1Q7LB 4ECZA 5ETVA 4USWA 2OMLA 2KG1A 1G6BA 2V8DA 5T41A 1TV6B 4QR1A 3MMCB 2B9YA 3CDAA 2BJ7A 2F9DA 2O01C 3CCWA 3M05A 4ZCIA 1K9MT 4DSKA 3BGUA 2VL1A 2A6MA 4TU8A 3LOUA 4HHHA 3KOAA 1X4DA 1K0VA 3TJ8A 2GJIA 2VJVA 4IKAA 1WHVA 3KWMA 2HHQA 5C25A 1FNMA 1WDDA 5M2UA 1CULA 2J6SA 1RBLA 2DGXA 4C3MA 5I42B 2K2PA 3UDCA 2EFPA 2DGVA 1QAIA 4FNHA 5IZHA 1A7GE 5F8HA 2KFZA 2J6UA 1WF2A 3M1VA 1NPPA 3LPYA 3R7SB 3EVOA 1AFJA 4FNIA 3TUJC 3CF5Q 1XQIA 1Q79A 2W9BB 3TUZC 3ICLA 9RUBA 3A3NB 3R1HA 2AW0A 4C8LA 3M8QA 3Q8RB 4UTGA 4CYUB 4NLRA 4FZVA 4CNZA 1G3OA 2EKNA 5IFMA 3LWMA 2JEJA 3OUYA 3HP6A 1FNOA 4KH1B 1IKYA 2R2TA 1YTYA 1T03B 5D4PA 3EDQB 3L9ZA 3V4MA 4OYWA 2BQRA 4BC7A 3NGRA 1KR4A 1U1PA 3W3SA 4B3MJ 1FVQA 2PEHA 2XSJA 3S01A 5A8RB 1N5QA 3TQ1A 2A10A 3BKUA 1B0VA 3PNIA 5DETA 2KL8A 3W8PA 1R0CB 2VASA 2VQEF 4EBDA 2C2DA 3ELHA 2KYXA 5KFGA 2DNGA 2GS8A 3G4SS 1HLWA 1R8PA 4YDDB 4NXMF 1D9AA 2AGPA 1RWXB 1X9MA 3OL8A 2D9OA 4N8NA 1IKWA 3W1YC 1ZZFA 4AE5A 4F0MA 4F36A 1NK7A 2HHXA 2XC9A 3G9CA 3FZ2A 2XSFA 5AE1A 4JV1A 2A3JA 3T1YF 4FF1A 4K50A 3W2WB 3CD0A 2YX7A 2ADBA 4ES1A 5KT7A 1ZPVA 3UDEA 4RNMA 1HI0P 4JI4F 2X3GA 4C3LA 2NLWA 1PG5B 3I32A 5LXYA 1T9YA 1L3UA 3PO4A 4JI7F 4CLWA 1P9QC 1XEZA 2XB2D 3DOKA 1YJUA 3HKZD 3IBWA 1VQLS 4C97A 2O67A 2HFSA 5J2MA 1IQZA 1RLCL 1RT7A 2B43A 5AXLA 4JI3J 1S1VB 2IJRA 2HQGA 1QLNA 2SXLA 2VIHA 1FXDA 3EXYA 2DNHA 3IXQA 1XJWB 2DGWA 2E1AA 3IR7B 4H54A 1LV5A 4FF2A 3I87A 3KG0A 1TUVA 1RADB 3VHQA 4A8WA 3PJ9A 4KO0A 2MTLA 5THWA 3TYTA 5GADI 1V3ZA 3F0NA 1PCAA 2G1DA 3CIMA 3OFGA 1OIAA 4RR5A 4JYAF 3DOMB 4KV8B 2CJKA 5GAHU 4L3KA 1ZAWA 4ECSA 5EGYA 3UVJA 4DV6J 5CA5A 5LT5A 1RA6A 5SUHA 2ILZA 2U2FA 1DQ8A 4AXIA 4K4VA 5LMNF 4KIAA 2XMTA 1TELA 4C2MA 2JL9A 4X4VA 2W9CA 3HCXA 4ZIVA 4B3RJ 4C11A 2G2OA 1ZM9A 4NA2A 4ALZA 5CAAA 1O0PA 1FE0A 4WXWA 5C2CA 4K4YA 2VOOA 3IWNC 1NRKA 3FMBA 4P73A 1UL3A 2A18A 1U0HB 4DWIA 2RKIA 1RJJA 3DMJA 3P5BP 5LL6d 2UXBJ 2VBZA 5D8HB 4QR2A 1FWPA 3AOCA 2DGSA 2WOMA 3F44A 4CLTA 4TNOA 1JQGA 5M2RA 4GC7A 1KFSA 1Q0NA 1VQ8S 1F2GA 2DIUA 4KBIA 3MCSA 4PABA 1WEXA 3VZHA 4BBYA 3NWRA 3I96A 2RIJA 3GZ7A 5F3TA 1REVB 5D15A 3NCPA 4LT6A 1HYSA 3ILIA 1KOHA 2BA9A 2PE8A 3QRRA 2KFNA 2PA8D 1IM4A 2ROEA 3DOMA 3OFEA 2L41A 2HIYA 3MHYA 1Q8LA 1T94A 4FKYA 4DI6A 5KG7A 4KO0B 4L76A 5JUMA 3NL0A 3GFHA 1BMQB 1WEYA 3CD7A 2JSXA 4RWXA 5E3QA 4Q44A 4N7TA 5HI7A 2GO9A 1CG2A 4ENOA 1SQGA 2HGNA 3LP0A 1HHTP 3RB6A 5KFOA 2W7AA 2YTCA 5KOXA 1VRQC 5SZTA 3KYLA 1S1VA 3DXBA 1FTRA 3KG1A 5C24A 3VQSA 2Z2MA 2JOQA 3Q86A 3I4HX 1J27A 4XDDA 4A8KA 1NB7A 2R8KA 2YQ0A 5MLCV 1X9WA 1RHUB 2CNLB 1JXLA 3T6JA 2VG7A 2KB2A 2A0FB 2OSQA 2BUNA 4GVBA 3E51A 1S57A 3ISNC 1F1BB 4M8LA 5KG1A 3TARA 3ILOA 2HHPA 3PRBA 4OX7A 3ZTSA 1Q8IA 4N56A 3RTVA 1RWNB 3NGTA 2VFTA 2R7OA 1RTIB 2MMYA 3OHAA 3HSJA 3G86A 2E5IA 4QR0A 4A8YA 1BC6A 4C0BA 2H48B 1HNXJ 3R6GB 3CD5A 3MM8B 2IA0A 3FBFA 4RW6B 3EZOA 1YRUA 4E8UA 4JP8A 1CSJA 1YQHA 3DI6B 5HVGA 2WZ1A 3Q8SB 1JB0C 3NAIA 3CD6S 1SJQA 4P71A 2W1BA 2IA6A 4B3OB 2HK2A 3TZXA 3C6UA 3NMRA 3EVWA 2JEFA 3HF5A 1ZBTA 1OY8A 3KDNA 2DH7A 5C7PA 4H4MA 4C11B 1TMMA 3NS5A 1C2PA 3R6LB 3D3BJ 5IC4B 3U1NA 2B5JB 2JDJA 3D1OA 1YJ7A 4LJMA 1VQMS 4OHVA 3AXMA 1S0VA 3VAFA 3BYRA 2E44A 4K4TA 1SH2A 3I4PA 5J2PB 3M8SA 4WCEQ 4JI5F 3PV8A 3MF5A 1OY6A 1KVJA 4IO1A 2PD1A 2GAHC 2C3PA 2ROPA 4B3TJ 4UY8T 2P8IA 1SKWA 4P75A 4DFMA 3RG6A 4DQIA 3BR8A 5L9XA 4DV4J 2P6TA 3DRRA 3ZTQA 1SJ3P 1FDNA 3SQOP 2BW2A 4F4KA 3OR2A 1U0SA 2ILYA 4LF6J 3SXLA 1BQNA 1R3NA 1TKZA 2BANB 1RT7B 2KT5A 2IM0A 4LRFA 1NNDA 1L3VA 4J9KA 2DNQA 2OEMA 4A47A 2B51A 4R0EA 1HR0F 4F50A 5C2GA 2LECA 4X2BA 3OTEA 3R5DA 3GV5B 2VBYA 4JI6F 5J2QB 3W2WA 1N34F 1OYDA 3PXGa 3TI0A 4I56A 2CADA 4MFBA 3KLGB 2C28A 2FHJD 3FKBA 2AJ1A 2YX1A 3UW1A 5F9LA 4OJGA 2JVRA 2A1BA 4RW9A 2JC0A 4UOCA 1R0AA 1RU2A 1RTJA 2CUYA 3LANA 2P9EA 3LH2S 3G6VA 4C8YA 2WW4A 2ZWOA 3JSYA 2RQ4A 2VFRA 5CYQB 2KJVA 3MMJA 3K5MA 1H7XA 4H4OA 3PX6A 2CNOB 2E7WA 2ZDPA 4J91A 4EI2A 3C46A 2G2YA 1C1CA 1PJ5A 4PG8A 1HNZF 4LF4J 1RAEB 3P6YC 4FYWB 2H4YB 2FYXA 3PDNA 3W9IA 1RA7A 1M5SA 2H9ZA 3R5AA 2IJFA 2G0JA 1JNRB 2DXEA 3LO3A 5A8KB 4X65F 5KFQA 5DM6Q 3VAJA 1VQPS 1H2VZ 1WC4A 4A8XA 3UD3P 1KRPA 4EZ9A 3FGVA 2QLBB 3DC2A 2IMWP 4CYUA 4MTPA 1NJYA 3SSRA 3AY0A 1KLMA 4WK3A 1NH8A 1URRA 3G6XA 4DSFA 2E5GA 2W7OA 2GW8A 3CO9A 2IRXA 2W9BA 1RYSA 2FIUA 3KTQA 1Q8BA 1S1UB 3HSDA 1CJTB 3HVTA 2RJZA 2YH0A 2QTWA 2HURA 3ZNUA 5EHHA 1TFWA 1B0TA 2QMUB 2RQCA 2XCAA 2C2NA 1TKXA 1U24A 4CM2A 3TUPA 1WG5A 2KKHA 3O44A 3HVAA 1M5PC 3ZZOA 4U7UD 3G82A 3QRQA 3C15A 1S72S 2G2ZA 4O4GA 5HQMA 4MK8A 1N5YB 1V9OA 3QFHA 4AFFA 3H5XA 1WKLA 1EP4B 4MKYA 3JAMY 4Q0BB 2C3OA 2QSFA 4RX6A 2BXJA 3FSIA 3GV8B 1UFLA 2KHCA 1EIYB 1JLEA 3BREA 3FMWA 3VGVA 2AEMA 4QWBA 1S59A 5IT4A 3LP1B 3HJFA 3W2VA 3HHLA 3IR6B 1PKUA 3V5RA 3ENVA 5K20B 3IRXB 4ZPWR 4NMLA 3GWCA 4I6AA 5KFCA 4U7CA 3NY0A 4U96A 1YVFA 3M30B 1FFSB 2BZ2A 2GO8A 2IM1A 3HD1A 6FDRA 3W2VB 2R2UA 3CUNA 1ZTWA 1Q86T 1SB6A 1BWVA 3HSZA 3LP1A 2R7VA 5KOWA 2ZBCA 3N01A 4OIXA 2RDJA 5K9FA 2VFSA 3H5UA 4ETZA 2B0GA 2DISA 2WTFA 2R2SA 4ILLA 1DAXA 2GIQA 2H5IB 1V3SA 2YWWA 4PR6A 1IBMF 4FBTA 2AEFA 1S6PA 1O51A 5HATA 2OIHA 1U2RA 2DTJA 2CYYA 3LGNA 1DZ5A 4DLGA 4O4GB 3GILA 4F4YA 3MPDA 1RBOB 3GFYA 4LIWA 4ELUA 1WC6A 1OSDA 1X4CA 1TQLA 1SC3B 3MPYA 1ZM2A 2DKOB 2LP4A 1YLXA 1VRTB 2JLEA 1XMBA 2OFGX 2V5HG 4KGVB 4CNYA 7FD1A 2HVZA 4P72A 2VONA 3WX4A 5BYRA 5HP1B 4CH0S 3G96A 3EWGA 5HMXA 1F3FA 4IH6A 4O23A 4ZP7A 3E2EA 2Z0GA 2P9GA 2Z56B 2GQQA 3IG1B 2WVBA 5F0UA 2ZNZA 2CQ3A 1SCJB 3MR2A 1QE1B 4DR7F 1UFKA 3OXGA 3PHEA 3MAQA 4DV1F 5KFTA 4DR6J 4QIGA 2IYIA 1GXLA 4MAKA 1BWEA 2AZ3A 3EXCX 3HSGA 3CSKA 1C1CB 4LR8A 3EPIA 2OFHX 2NS1B 4ZITA 1NDLA 4QWCA 4K4UA 3DGVA 4EMDA 1P1LA 1LWFB 1WD6A 4ZVGA 3QJJA 4WPAA 4ZVRB 3W61A 2F8MA 2BABA 4J5OA 4B02A 3KK1A 3ILLA 1ROFA 3ADAC 3M2UB 4DHVA 2MPUA 3LPEA 4G1QA 1K8AT 2U1AA 3T1AA 2APOA 2HS3A 3DGPB 1ZETA 3FFIA 1IVZA 1IBLJ 3GYXB 3KLGA 4LF9J 3MM5B 1S0OA 2CPZA 3NP5A 3H20A 1RT6B 2ZKUA 4LF2A 4LSLB 3UPFA 5A2QU 1UPPA 2M9KA 3CTRA 2OPQB 2YQ3A 3PW7A 4Y2CA 4B9SA 5KFXA 1HNIA 4X66J 4NCAA 3J81j 2VQEJ 1WORA 2DXFA 3FEZA 3POTB 1N36F 3ZO7A 3W64A 3M8RA 2BKNA 4L75A 1FJGF 3H59A 1NSPA 3KUGA 3OQ2A 5T7LB 3A4TA 3D6TB 3LA0A 2VH7A 3QSIA 2ZNYA 4FPIA 2LCWA 4OQJA 4DV4F 4J9UE 1H73A 5F41A 2IVFB 3ENWA 4LF6F 2RRBA 2MZJA 1MWZA 4ID8A 3DYAB 2ZZTA 2R7TA 2Y0BB 4TU9A 2W2OP 5GAEU 4ED5A 2HNDB 1FD8A 2R42A 2FJWA 5KFIA 2Y0SD 1N8RT 1LW0A 4WKRA 2EWHA 1W25A 2YKAA 1TVRA 3HHLD 3KJFB 4NLYA 3CO0P 4YDXA 3V6DB 4X64J 4HLBA 4XTTA 2E9ZA 2FD2A 5AXMA 4GKJF 1CLFA 1TL1A 3WBZA 2H1YA 3KKFA 3TUIC 2FVSA 3RRKA 3M2RA 3IBFB 4LR9A 4WWSA 4JOUA 2DR9A 3FC9A 4YOEA 4ATNA 3FCVA 3VQTA 3PR4A 5DLGA 4PG7A 4HH1A 5IC6B 4ZVSB 3O3LA 1MWQA 2MB0B 1NEEA 2RMLA 3ISND 1NKBA 4WE1B 1RAFB 2FY8A 2Z8QA 4C48A 1HNWF 5DGBA 1NPRA 1H0HB 1VCTA 3FBCA 3VAHA 2N3LA 4OHWA 4B3SJ 2WSFC 1RWMB 3M4XA 2VPWB 1MSWD 2Z4PA 3A8IA 1QUVA 1CQMA 1UEVA 4WYLA 4AUKA 5ITHA 2FVRA 1CS4A 3UCUP 4K5RA 1N0UA 4YB6A 2J0QD 1DJ0A 3IS9A 3D4JA 4TY8A 3BQ2A 2MJUA 5CCLA 2BVZA 2OO4A 1U1QA 1ZTTA 2VD3A 2XYHB 2ZOGA 2CZ9A 3V81B 5AE2A 4GRSA 4GVBB 2WVFA 1FWLA 1S7HA 3CCJS 2EBGA 3GYNA 1HMVA 3TP2A 2D7SA 5EUHA 3B82A 4F3OA 2V2ZA 4YB7A 1IBKF 2V4JB 3QIPB 1I5OB 2M70A 5IT9Y 4PQAA 4YMEA 4IG0B 1IJEB 2IM3A 5B0AA 4JV5J 2ASYA 3QBCA 3H0PA 3PY8A 3FK4A 2B9XA 3D7SB 4OZLA 1X60A 1M5OC 3LP0B 4LF5J 2YWEA 4I2PA 4XIUA 2AT1B 2NYIA 3PYFA 4O3QA 2OEJA 1YRXA 2B6AB 1VBZA 2DEIA 3AQPA 2C3YA 2ZH9A 2QA2A 4X4QA 1Q7YT 2QLXA 3BKTA 3R5BA 2F4VJ 2F4FA 4GKKJ 3WQPA 4FF4A 3DU5A 1PJ7A 3NBPB 4Q8FA 1IN0A 1TMJA 4NLDA 4RUAA 1HIYA 4DS4A 5A8WB 2DRAA 5HLFA 2BKOA 4ZVHA 4LF5F 1IKXB 2M0GB 4ZA1A 4M5NA 1REVA 4UQTA 2W7PA 1Z2LA 1X4BA 2RT3A 1FVSA 2X51A 3N6NA 1N5VA 1RE1B 2BJ9A 3BGLA 3VAGA 4DPXA 3GSDA 4NLQA 3SV4A 4DS5A 2DY9A 3M2VB 1U49A 2VQFJ 5EWGA 3MMAB 3BSAA 1RHRB 4ZPCA 2DNNA 3DMJB 2HQCA 2FGCA 2ZBPA 1X5PA 3HFVA 3NXZA 1NXIA 1U0HA 2M8HA 3KHRA 4B9TA 1IBMJ 4TKTA 4FXDA 4RW4A 2A2DA 2AYMA 4U95A 1DTQA 5GMDA 3CIZA 2XI2A 4U6PA 3JSMA 1EZZB 5LJ5Y 2XYPB 3H98A 3OFFA 3W65A 4MKVA 1RB0A 2DNYA 1KDNA 2GV1A 4NI2A 4LUBA 1RQ0A 4PYDA 8RUCA 2MHEA 4NPOA 2JWNA 4OI2A 4YN3B 1NKEA 1RP5A 4DV3J 2UUAF 3P96A 2YQ1A 3SDEA 3S8SA 2XYGB 1VQOS 4IDKB 1FKPB 1SJRA 1S5ZA 1R8HA 3QAUA 2Z30B 4NLPA 4B08A 3C14A 4EFAC 1NHUA 1WF0A 2BR0A 2BKPA 4UUXA 4MIAA 2F9JA 1ZM3A 2BV3A 2IDLA 2WCXA 4CIOA 4OHYA 2DO4A 3NS7B 3KK3B 1HW9A 3PKMA 5E33A 4WZQA 2ASDA 4AL6A 4ELVA 3KJQB 3TRGA 4QYZJ 4URGA 3DHXA 2GGPB 4F4WA 3HK2A 2IM2A 3ZC4A 5F8LA 2ZHBA 3M32B 2DGTA 1N6QB 3CCES 2QN6B 4I2QA 1RWOB 2O1PA 1BD6A 5J2MB 4GO5X 2RILA 3D5MA 2DK2A 5D3GB 1WHXA 2OP5A 3DOKB 1WJ9A 3BB5A 4K5SA 2RF2B 1B3TA 4HVZA 1CJKA 2NXJA 5CZVA 1X0PA 3OLAA 1LNQA 1RWWB 4CLLA 2HNYB 3DKDA 5K8PA 3PTWA 1HBNB 2Q3PA 3DLKA 4RW8A 3UE2A 2Z57B 2VFUA 4ZLNA 5IS2A 5T14A 1NHVA 4WFXA 1VYAA 2Y3YA 3KLHA 3WZ0A 1JLGB 2DY1A 4FDFA 1WKKA 1XMQJ 2HVDA 3MR7A 1G2EA 2XWYA 4WFAQ 2KZZA 4U9RA 4DF4A 1SH0A 3R5JB 1P6TA 2BJEA 3H8YA 5G0RB 1NZ8A 3UD5A 3OTOJ 2XY5A 3X1LB 3BPDA 3MD1A 1C1BA 2QZ8A 4HI1A 3UN5A 3MUVP 3B4DA 2YWFA 4IRDA 2E1CA 3H5YA 3J7A1 2IRUA 2IAJB 3J80Y 3EM1A 3CCRS 2V9WA 3QJPA 1F9EB 3IR5B 1VOMA 3SFUA 2MGZB 1TL3A 5GMEA 1X9SA 4V19X 1A9NB 2MZRA 2QGFB 2KXFA 4F4XA 4IOBA 2C42A 1VQ6S 2EKYA 3NOGA 2FHOB 5DGAA 1HD1A 3P4UB 2CWKA 3EMTA 1WC3A 1WWHA 3BKFA 1TL4A 3M8QB 3GIIA 1ITPA 1EQ0A 1F60B 5HMZA 4CO2A 2KM8B 2V8GA 4ZLLA 4DSIA 2V2QA 4ZHRB 4HACA 1N32J 2E9RX 3J7AN 4G3IA 4C0OC 3QMQA 3D67A 3LALA 4WU2A 1WF1A 4DU7A 5IWAF 1GQEA 1S48A 3QGIA 1RTDA 1N88A 3Q2TC 2LU1A 4ZPAA 3OVAA 5B0DA 2D41A 2L48A 2OD4A 2PFDA 3NGSA 4RUBA 3ITHA 5IM0B 4ZP8A 3CJ0A 3FNNA 2Y8WA 1I94F 2W2QP 1J2VA 1HARA 1QDUB 5B0FA 4IOCQ 3MCOA 1YHQS 1RT2B 4J9QA 1NDPA 1R31A 4G1PA 4AQYJ 3PRVA 3UFCX 2ZE2A 3EPGA 2HHHF 2HQFA 3JQMA 3KUEA 4W4MA 2V8HA 3BS9A 3T5LA 2J9CA 1T11A 2W24A 4QIEA 1LWEB 4FKXA 2PFFB 3CCUS 1S6UA 1TKTA 1QAXA 5E3RA 3D0GE 2HWTA 4DPYA 1VBYA 5KFDA 1S1TB 3CE8A 1JLAB 1KOOA 2O5DA 4NZ7A 1YJVA 3AH6A 1U1NA 2UUBJ 2CDQA 4ICLA 2QG9B 1PAEX 1MNEA 1R6VA 1TZ0A 3CMAS 3CJ8A 5EX3A 3MM9A 3GPAA 2UVUA 4I4BA 5LMUF 1C0TA 1YJ9S 3W5ZA 3UDVA 1T95A 1D3WA 2BYCA 2RAQA 2YKNA 4RUHA 1GT8A 5GAGI 4BC9A 4K4WA 2C22A 2XLIA 4UY85 4OJHA 3W66A 4R5PB 2YNHB 3C19A 1IKVB 2NXCA 2PGCA 2PT0A 2R4FA 4GVLA 2HKEA 4LR7A 3J7Z5 5F8NA 2J0SD 3FCHA 1TUWA 1JKHA 2FLOA 3OXFA 2OPSA 3QSYB 3PYGA 5D4NA 3SQGB 1OQ6A 3AOBA 2BOPA 4PUOA 3NCQA 2B56A 1NJIT 3FQLA 3OVBA 4IFVA 3J81Y 1N36J 4RL1A 2GVDB 2FGOA 4A48A 2K8GA 3FZBA 2YXLA 2V50A 1DQAA 1S4FA 3DRPB 3HHLC 3N6MA 4AXJA 3KJVA 1KN6A 1SQFA 1RU1A 2DB1A 2XHWA 4NOHA 1EKRA 1N56A 4ID5A 3R1LA 2CNNB 3JAMU 5HMYA 4DQRA 3I0SA 2HAFA 4K0KF 1NBEB 1ZAVA 2MQPA 1HKAA 2CQCA 3LP2A 1QSYA 1F3VA 1T03A 1APSA 4BDPA 1VLYA 4LFCJ 2HYIB 1MU2B 5L9NA 3QT8A 3G6YA 2HVIA 4E98A 2POKA 2NZ4A 3W5XA 4MMOA 4NXNJ 3KLFB 1HI1A 1Y00A 1R8BA 5GAEI 2XULA 1YIJS 4LSNA 3M8ZA 2ZKTA 1Z1ZA 2F65A 4ZP6A 1HNZJ 1VQKS 3R5CA 4QJVA 2JJ4D 2J9DA 1HHQA 2OELA 3MZIA 3M8PA 4DN9A 3EX7B 3MAAA 2XY7A 2CJXB 3N4WA 1E6VA 4ECVA 1WI6A 4DR5J 3HZEA 4OZ3A 1FF2A 1JLBA 1S6QA 3OPKA 1UW9A 1YI2S 3UR3C 3UNGC 3TWZA 1H38A 1U6BA 2ALYB 4C98A 1D8ZA 4F3QA 1D8YA 1E6YA 2V9KA 3K17A 2GFFA 4NCGA 3WIUA 1J5EJ 2RD5C 2V69A 3DXSX 3RGIA 5I3PA 4Q43A 4B9UA 3N5BA 4RU2A 3MM7B 4JI2F 3NGDA 1V6HA 4ED0A 4R8UB 3EYZA 3NNAA 1V3RA 3S7RA 1S9FA 2UU9J 1R7IA 1K1QA 1XR7A 1TL5A 2B4PA 2YNGB 3AFGA 4LQ9A 4J9NA 3PX4A 5KAKA 3DU6A 2WOMB 1VFJA 2VB6A 1JWWA 2I0XA 5AJ3F 1RISA 2HS4A 1T9UA 1T05A 1K0TA 1FXRA 1GMWA 4O44A 1QSSA 2HWIA 1V5VA 3HFZB 4R5PA 1AFIA 1MROA 2NUHA 4OX9J 3KDOA 4X4UA 4GC6A 1S7IA 4DR4J 2MLZA 2E66A 3Q8YA 3NEKA 4USIA 3UN2A 4DR2F 3TANA 2K3KA 2K06A 2EBEA 3MM9B 3TZYA 5CYMA 1Q82T 1M5HA 2JH3A 4EU0A 1YGYA 2MEWA 4AYBD 4UT4A 3TO8A 4F0KA 1HQUB 2LXUA 3P8BB 3ZZTA 5DZ6A 3A8KA 3EDRB 1HWUA 1PBUA 1RGVA 8ATCB 4DDFA 4PRFA 2KVQE 3D1QA 5CD4A 5HQ8A 3ZZYA 1KQGB 2DCLA 4IH5A 4Y2IA 3DFEA 1XNRF 1Q95G 4EZ6A 4DXLA 2UXDJ 4OZJA 3BBFA 4EUVA 1YJNS 2AJFE 1WG1A 4EO8A 4CLFA 2VU5A 2JLGA 3TVZA 2A6OA 2LEBA 5HBMA 1DQ9A 1PO6A 1HBUA 2BM1A 3RR8A 4OI0A 3GU0A 2KFYA 4KFBA 2CQBA 1RK8A 2VJUA 2N4DA 2DHGA 1VQSA 1QVFR 1XNRJ 1MN9A 7AT1B 1KQKA 3I0RB 4RW7B 4QYZK 3BSNA 2M88A 4LF7J 3DDIA 3ILJA 3T9NA 1LK5A 2CZVC 4NLVA 3V6HA 2B7BB 2BJ8A 3ZFVA 1JLCA 4HDHA 2V4RA 2FLNA 2GVZA 1V5IB 3MI7X 3BN4A 1KSPA 2LDYA 4DR5F 1R43A 2EEYA 1LWXA 2HBZB 3OT9A 4HH0A 2MQQA 2C3MA 2IBOA 1WHWA 3QJLA 1BE4A 4ZVQB 4B3RF 4LSZB 3OSPA 3CCMS 3O6QA 4CLSA 2VDIA 1J5OA 3CB4A 3RAXA 3J7YI 2ZH5A 4NZ0A 2AJ4A 1HWJA 1JJ2R 3I9ZA 4DBQA 2EVZA 3KK2B 2R9LA 2IHR1 4V1Ak 5DJBA 1H74A 1PC4A 1TL3B 3PYDA 4KAIA 3GQCA 5KFMA 2ADCA 2ATCB 4CO5A 1AT1B 1PYTA 2F3JA 3IM8A 4Y65A 3EJMA 3TVKA 2HPUA 4X4NA 2E5LJ 4OHXA 2CKWA 3ZNJ1 1PAUB 5BR8J 3HVWA 3VVTA 1H3DA 1C1BB 3ZZZA 4BHQA 2YX4A 4LVOP 2M52A 1MWYA 2VG5B 2FUG9 2RSQA 3PIPQ 1XMOJ 4K4SA 3T6BA 2DXDA 3E01B 5KT2A 5CCMA 1GTHA 4C9DA 2IVMA 3CJKA 3UI3A 3RR7A 4NE9C 2HFUA 1VRUB 3DLKB 2CPEA 2IJNA 1FKAF 5BR8F 4Q5VA 1FO1A 5I4MA 1S9GA 1KTQA 1VDHA 2ABYA 2YNIA 3MPWA 2GIFA 2DR5A 2HFOA 2HQDA 1X5SA 3GJSB 4LFAF 2LFVA 3P5TL 3ZZRA 4O0NA 3MWBA 2BJ3A 3QIDA 5F0WA 4ES2A 1Q16B 3Q24A 4I6WA 4AL5A 1FX4A 4S0MA 1RKJA 4PXEA 4P74A 2CQGA 3NCRA 4JV2A 2VA2A 4J7CA 3GG1A 2NQPA 3GIJA 4IG3A 3T9ZA 2MQ8A 3MECB 5HN0A 4KQZA 3RZAA 3L4BC 3SEOA 3KK3A 1SPBP 2HAIA 2X3DA 2QA4S 2ZFHA 4DX7A 2ZITA 4P52A 3G2XA 1IWAA 2HFZA 2QV6A 2V2VA 4QBUA 4PQUB 1WC5A 3QT5A 3IMQJ 2NXUA 3KUHA 3I5CA 2C2RA 2WONA 3UO0A 2ZH7A 1LEOA 3RYLA 4CI0B 1HYSB 2H51B 3HVRA 3C16B 1PGZA 2HK3A 2DR8A 4C8OA 1SKUB 2QC3A 2D1CA 1DLOA 3HHKA 4KHRA 2RS2A 3SCLE 1TK5A 2QLWA 2UV8A 1B4SA 3T3FA 4IQXA 3AJDA 3E01A 1HBOA 1HL6A 5IQQA 3BZQA 2CQ2A 2FC9A 3DOLB 2FJDB 4G6VB 2ZBRA 5MAOA 2VG5A 3K7RA 3H25A 4KT0C 2XMAA 1I6JA 4FYDA 5CZXA 3KMSA 3AODA 3TAMA 1VR6A 1N0VC 5H1SV 3W60A 4J9LA 2VKZG 2WW8A 5B0EA 2M7SA 4URQU 5DG7A 1S0NA 1KTVA 5L46A 4N76A 1M5KC 5E41A 2MJNA 2RNEA 3JQKA 2KXNB 2BM0A 1XMQF 3QATA 5J2NA 5KTQA 2K7JA 4YY3J 5A0YB 1VIXA 3VAKA 3EICA 2DHHA 2CQDA 2FJEB 2HNZB 1EJ7L 2HVEA 1FD2A 4IFYB 1QVGR 2ZEJA 3WC0A 2I8EA 2B6AA 2ZC4A 4J9VA 1IR0A 4ZOSA 6AT1B 4F4ZA 3MD3A 4K2JA 5D4LA 2DPJA 1QTNB 1JLCB 3ZXWA 2PA3A 4NYPA 1ZA2B 1BUXA 2NSCA 4NEYA 4P2SA 5A76A 4DR2J 1QJHA 2XZWA 1R0BG 2XGQA 2EK1A 2OPPB 2JEIA 4RW7A 4J9PA 1BQMB 1DARA 2L08A 2XWXA 3ZTRA 3J7ZT 1HI8A 3JYTB 4KFBB 4ZK7M 2M8DB 2PI4A 1AW0A 2R7UA 2Q79A 2CQHA 2HZCA 3V81A 2YKMA 5KG4A 3MR5A 2I6WA 4OYXA 3FEYB 4RU9A 1OS5A 5EWFA 1S9GB 1H98A 2CQ1A 4ED4A 3PW4A 2KI2A 1SV5B 3AAWB 3GP9A 2XS2A 3R2CJ 4U8YA 1LXJA 4PWDA 2AU0A 5ETRA 2ACMA 3SCKE 3JTPA 4LF1A 1TL7B 1ACMB 4DCPB 4F7VA 1AROP 1CJVB 3IGVA 2FZKB 5E3PA 2QFIA 4PKDB 4ANCA 2DRDA 1HQUA 1VIOA 5D3GA 3N79A 2XTJP 2G0CA 1FRIA 3QYYA 4QWAA 4ETXA 2IVYA 4WE1A 4D3HA 4X4RA 2B4OA 1NSAA 2DNZA 1HWLA 4PQUA 1VISA 2R8IA 1VHIA 4OI4A 1RHMB 2GX8A 4IR1A 4CLZA 4OLOA 3AD7C 1KWMA 1HNXF 3IM9A 5DDPC 2BE2B 3HM9A 2B8QA 3M2RB 4ZCKA 1RTHA 3CNQP 5KFAA 5DDOC 1FRLA 1RT1B 1UEKA 3R27A 2RH3A 4P9SA 4Q2MA 3TAPA 2PC6A 1QUPA 2MXYA 2J8SA 2YNGA 4W92B 2GHVC 2AX0A 3KHHA 1D0EA 1IQTA 3GR1A 1RWVB 2K1RA 3CVKA 1RT4A 2LXIA 3QO9B 1EB0A 1RACB 3M8WA 5LMUJ 3PEJA 4LMZA 2GIRA 3EVMA 3QLHA 4NCGB 2XLJA 1WTBA 2YWGA 1WOPA 3AJ2A 3PM9A 1RT5B 1E6YB 1FJGJ 4F2RA 5T7LA 4DSJA 1JLFA 4NLWA 2VG6B 3FSYA 2MKSA 4ZVEA 3VTIA 3SCJE 2OUGA 4WP3A 4NLXA 4I0WA 3W9HA 2ZUGA 4O3SA 1SVDA 3MAAB 2ZM6F 3GJQB 4X4SA 2R8HA 3R2DJ 4K4ZA 3HMJG 2Q43A 4NWBA 2OPQA 2OPRA 3FDSA 2NR0A 1IR1A 4DCJB 2ZH8A 3MEDB 4IOAQ 1F9HA 2KN4A 4I69A 4DUZF 5HBMB 1Y5NB 4B3TF 1X0FA 1RTZA 2K3IA 5ETKA 4NXMJ 4LSNB 2Y1IA 1RT1A 2W25A 1O8BA 1Y7PA 1VC5A 1SBRA 3NKYA 5F8GA 5L8RC 2RHSB 2ZM6J 1BQXA 4C4WA 2D69A 3JXOA 3M2UA 4RJVA 3THPA 4CP5A 5FLXY 2MQLA 4ZPDA 2DVIA 3UCGA 5KT3A 4ELTA 2DNPA 4W90B 2O66A 4QW9A 2FLLA 1B64A 1X4EA 2M4MA 2E1PA 3ET6A 1TU0B 1OO0B 2AD9A 4UQGA 3GFXA 1UZHA 4UOHA 1CC8A 3G8TA 1L3KA 2CVEA 4DL6A 1IBLF 4JI3F 2Y1RI 4P7TA 2QX0A 2MSSA 3NNCA 5HVHA 5IWAJ 3K8WA 3WDOA 1KHWA 2FHKA 4MK7A 4M5GA 1OQ3A 2UUCJ 5CABA 5B08A 3SFGA 3L7PA 5LSRA 3ONQA 4ECRA 2ZOFA 2EW9A 2HRYA 4MIBA 5K8NA 3IGNA 4JB8B 1HBMA 3W8GA 4IQMA 2KO1A 2YPYA 3DRSA 2CPFA 2XO6A 4PUOB 1WNEA 2C1EB 3CJRA 2UV8G 4WP8A 4HT5A 3SQGA 1RZMA 4DPWA 4C6AA 3DRSB 4HT7A 2DHAA 3B4MA 2LYVA 1B7FA 1WACA 4ZPVR 1FDAA 2HQIA 1RKIA 2AZ1A 4ZJOA 4DFKA 4RBVA 1FT8A 3QZ8A 3GCWP 1DRZA 2OHDA 5CHCB 4OZ2A 5ETPA 2BDPA 1IM6A 1C0UA 1QD1A 2CQ4A 3HLUA 3FRYA 3MOZA 4A8QA 1LQ9A 2EC2A 2NPIA 1LWCA 1Y3KA 2E5HA 1ULRA 1XERA 3C6TB 1JJHA 4Q0BA 4OYIA 4F0HA 2IPOB 4CH7A 3TA1A 5IT0A 4DPOA 2EFOA 1L3SA 4ICLB 4QW8A 1IWGA 1P27B 1WOOA 3ETMA 1OWXA 2LKZA 4K2XA 1E6VB 3MMBA 4KC5A 3M6XA 4OI6A 4PAAA 1JLAA 2YNFB 3DLEA 1RAJA 1AUSL 1S1TA 3GJRB 3B8HA 4IFYA 4IYQA 4KKOB 5IXUA 1SKRA 2OTJS 1KD1T 1M5VC 3TNVA 2BEFA 2B7CB 2B9WA 2WBRA 4OX9F 2CWXA 3RJMB 4F26A 4PPDA 3J81U 4DV2F 2ZUAA 1KQFB 5KFVA 1TR0A 2IIHA 4AT1B 1WI8A 4DG1A 3UQSA 5DM7Q 4XPEA 2AP6A 4DR3J 5E3AA 2VBXA 3JSBA 4DPUA 1LXNA 5DDRC 1FEHA 1SL0A 3LP2B 2X1GA 4E0DA 4NCBA 3JS9A 2VQFF 2Q6CA 1SIWB 1YG0A 4AL7A 1KONA 3CJ4A 3H40A 4ECXA 1N48A 1N4LA 2L3MA 2H54B 2VG6A 2W2MP 2FQQB 3OR1A 3EGZA 5E0OA 4N47A 2XS7A 1HD0A 3CT9A 3JTNA 1HBOB 4NLUA 2F5GA 3P45B 4DV7J 2P6SA 1S6OA 2B4UA 2BBEA 2XLKA 2HW3A 2NUUG 5I3UB 2BMBA 1D1UA 4PWWA 2OKQA 4LIRA 3CXCR 1S1UA 1FK9A 1RT4B 2YKOA 3BGRB 3DHWC 3NGUA 2LXFA 1G4CA 3QO9A 4M1KA 4W98A 2GHPA 4G1IA 4NX9A 3D28A 4OYBA 4R0JA 4TVAB 4P2MA 4RWWA 1LK7A 3GMGA 2WONB 3BQ1A 4LRBA 1XNQJ 2FTRA 4XDCA 3BO4A 1BHNA 1B70B 5K14A 4X65J 2BE2A 4ITSA 4KPCA 2O3DA 4MH8A 4MYTA 3CJ3A 1P9YA 2OD6A 3N28A 4ZPBA 5D0RA 3K89A 2GCFA 1I3OB 3TX0A 1EARA 3D1HA 3H42A 4OYAA 4XK8C 2W2NP 4OMFG 3SI8A 4RNFA 1SL2A 4OL8A 5G0RA 1WOSA 2FC8A 1F5AA 2UXBF 1IJFB 1B0PA 3BO2A 2YY3A 4O0IA 1VK3A 1CPZA 4MFBB 1IUJA 3TOQA 3ZZUA 1NKCA 1TKTB 2I5JB 2VBWA 3GLJA 2HNYA 2YNIB 3OBIA 4NLOA 1LWEA 1WHYA 2K7KA 9ATCB 5I3QA 2KT3A 1B7YB 1RYRA 1K1SA 4I67A 2QYCA 4YHHF 4UZCA 2RE1A 5LMNJ 3R97A 3NNHA 3BBCA 4NEZA 4XO0A 2CG8A 2VPYB 2WB4A 3HX9A 4UUWA 2XBPA 4ECYA 4ED2A 1YJRA 1Y3JA 4B9LA 1N6QA 5J1NA 2UU9F 4USJC 3F73A 5E5NA 2YKQA 2OPPA 3TR5A 1RT2A 3OW2R 1T02A 1T9TA 3QRPA 5F9NA 3V4IB 1DURA 4C0HA 3DLGB 2NPFA 1S10A 2AJ2A 5AT1B 3GCXP 3BDPA 3KLVA 3OL7A 4DUYF 2AJ0A 4NRUA 4TQSA 1ELOA 3DDKA 2Y9HA 3BPSP 1RTDB 5J2PA 5K14B 2OI2A 2UUWA 5H9EK 4PPZA 4PWUA 4WU3A 3N9UC 1ZYQA 2XNQA 2AYEA 2VA3A 1RWPB 1YZ7A 2YVSA 4Y2MA 3VGUA 2B5JA 4UOGA 5J2NB 1XN9A 3KHGA 1FK9B 3BGRA 3LW5C 4E2FB 1S0MA 2F40A 3TX8A 3GV7B 4X4TA 1I94J 4KTQA 4LQ3A 2XY6A 3I6PA 1UWAA 5I3UA 3KLEA 4JI0J 1CBKA 2OTLS 3BJYA 2QLJB 1M0SA 4X4OA 3MFHA 4HL9A 1OPIA 2LQ8A 1ZOTA 4NA1A 1NCLA 2LLZA 4CM0A 3V4IA 3H4DA 2XZDB 2ASJA 4M95A 3Q83A 2ZC3A 2H4WB 3KJNB 4KGKA 3TAMB 4DUTA 4I6YA 2HGLA 1T0TV 4PXCA 3PG9A 2ZZMA 3CJQA 3MM8A 2EI5A 4OV1A 4FXVA 1PYSB 5IOLA 2XI3A 3I31A 4ZCMA 2QMWA 1ZS6A 3LUYA 1WELA 4DV6F 4EYHB 4PG6A 3FBEA 3BEGB 1FEEA 1GX5A 2EG2A 3R3TA 1HBNA 4RW8B 1RWUA 2V63A 3Q0AA 4JI1F 1X7VA 3B54A 2JFDA 2EFNA 2XGPA 2CRLA 4ZJQA 1NAQA 2QYGA 2RF2A 2E7XA 1UTAA 1FJCA 4KKOA 1S12A 1RXOB 5L1KA 2DH8A 5HSPA 1NSKL 2J9DE 4YP3A 3U27A 2YH1A 1NK0A 5E2QA 3GTYX 2XCPA 3RAQA 4DR1F 4I2PB 4UW2A 4HTJA 3LQVA 4QWDA 4L3NA 2FHMA 2GGPA 3U02A 5CYMB 2ZH1A 4Y2AA 4ZIWA 1SJ1A 2I2YA 1RHKB 3A12A 3PCOB 4J37A 1VQ7S 1LWCB 4C7QA 1T9VA 3IC1A 4RBTA 4IG3B 4DX8H 5RUBA 4X66F 4DLEA 1JMTA 4MKAA 3R7NB 1KEKA 3E3XA 4TLRA 1UA0A 3MPVA 2QSWA 1IBCB 2CPHA 3H2LA 3G87A 4EWTA 7FDRA 4P10A 1WSRA 4JV0A 3MR6A 1N34J 2C2MB 1HBMB 1KFDA 3VAIA 1TAQA 4HTIA 4NI2B 4TU7A 5FIIA 3IS9B 1YSJA 4NZ6A 1VRUA 4DEZA 4X84A 1FA0A 5KT6A 2E1MC 3PACA 5ETSA 2HRUA 4OZ0A 1WC0A 5BJRA 1DHMA 5BYQA 4JI8J 2MKJA 4YR0A 4FN5A 1MMLA 1GXUA 1UMJA 2VC1A 4QQBA 1M1GA 1EX8A 1S79A 3OR1B 3IN5A 2HSEB 3MDFA 4QIFA 2ZHAA 2XO7A 2N3OA 1Y11A 4USUA 5BYSA 4OZNA 5IQ6A 1VQYA 4WTOB 4LF4F 2W9CB 2COLA 4Z7YA 1ZH5A 1GMUA 2A2CA 2G0IA 2MHNA 3TA0A 4DCOB 1KLNA 4KJIA 2EG1A 3M9NB 2D9PA 2GMJA 4TY9A 3IA0A 2FJBB 1N52B 1RBAA 3AT1B 3M6WA 3MTJA 3VV2B 4DG1B 3KK2A 3MEGB 1Q8KA 2KG0A 4U67Q 4MJKA 1YK9A 3UVJB 5HLFB 3PVXA 3KLFA 4OYPA 3KNAA 3OTDA 4M5KA 3NOCA 4NMXA 3V6DA 4ZLJA 2GAGC 2BX6A 1KQSR 3EGVA 1AA1B 1ZA1B 3BGOP 3GIMA 2UXDF 2HS0A 1HFEL 1GMVA 1AXQA 1W7WA 2YNFA 3DLEB 3BF4A 2WAQD 1UEUA 2R3VA 4ED1A 2FY1A 2ROGA 4F4AA 3TJAA 5CQGA 1DTTB 3W9JA 1W2IA 2HFVA 2AGQA 1JX4A 1U8WA 2MKCA 2VV5A 4YB5A 2ZOMA 1IXKA 2CZ4A 3C6TA 3I5AA 4P2FA 1RHJB 2QEXS 1RT5A 3FBBA 2UUAJ 2HHTA 2GJ2A 3MURP 3KJVB 4EEYA 1S1XA 2G1HA 2KJWA 1MG7A 3DRPA 2P2CB 2QJ3A 1IBKJ 3PZPA 1HNIB 2GVDA 2DITA 3CWJA 2K1RB 2N4CA 3TEHB 3OL9A 5DO2A 5KT4A 3UCZP 2JLFA 3PYEA 4F2SA 4ZVPB 2UP1A 2FHJA 4ES3A 1X5TA 3OL6A 2QA4G 4UF4A 3DGPA 4CO4A 2GMLA 4Q2LA 3GIRA 2QFJA 2B9EA 3SZ2A 2IDEA 3VALA 4O3OA 2JC1A 4USKA 3IO1A 1UWBA 1GMWD 2H3EB 2LDIA 3JSRA 1SJFA 2HGMA 3CJTA 3R8YA 3ZZ0A 1G7CB 4WF9Q 3K2YA 4NL5A 1C0TB 2MYFA 1N33J 4EGLA 4QU7A 2J5AA 2YPZA 1TAUA 2W4PA 4H4KC 3ET6B 1T3OA 3C66A 3D68A 1Q5YA 3ZTPA 4B9VA 1RWKB 3QGPA 4IH7A 3CEDA 4DV0F 3K0JA 5H9FK 1UA1A 1U2CA 2ZH6A 4LFBF 1UVKA 2QO3A 1MROB 1T3NA 2EC0A 1UWBB 1YZ6A 2HLUA 5D78A 1O6XA 4RNNA 2DJWA 1SV5A 3PX0A 4O44B 2J8AA 4DQQA 3OTOF 5DS7A 3V6KA 1UJ4A 1U2FA 2Q66A
chains in the Genus database with same CATH topology
4RUCA 2M2BA 1J5OB 3BGFA 5LSOA 2RQMA 2WK4A 4R25A 2OPRB 3JYTA 4Y6IA 3MM7A 3OTCA 2CJQA 1URNA 2Q1LA 3AB2B 2I38A 3HHDA 1QAJA 1S1XB 2F7VA 3NS6A 4K59A 3TVYA 5DLFA 1S6PB 3QAEA 4DL3A 1U1RA 1XTZA 1JLFB 2ZH4A 3V6JA 2DD8S 1DTTA 1JLBB 1S6QB 2V8VA 1FESA 1WEZA 5F8IA 4DV5F 3POTA 2AV5A 4QIWD 3K5LA 5DQIA 3PFOA 4QPXA 3M8PB 2HNZA 2GMHA 2CVIA 4DQSA 3RU0A 3PFEA 1S1WA 2WRMA 5JXSA 4CT8A 3IRXA 4CZCA 3VZIA 4LF9F 3FFIB 2YKPA 3HHLB 2JX2A 4IO9Q 3MEGA 4HYKA 1UVJA 1H7WA 2XMVA 4G1QB 4ED8A 5EX0A 2UVWA 2DRBA 1KVIA 4EBCA 3SSQA 1VK8A 2IAJA 2KZMA 4X4PA 2R8JA 2GQCA 1MMDA 1UJ5A 4F3MA 2CQIA 3I0SB 1L3TA 2RDIA 2JRSA 4X62F 1VJWA 2F1FA 3MEEA 4NYOA 3Q8PB 1X4AA 1HWIA 1UP1A 3DCAA 3HI9A 4ZS6A 2PMZD 1UVNA 2VODA 3H5SA 5EDWA 4EBEA 4ECWA 5A2QY 2AX1A 1VRTA 2HWHA 2KU7A 3D0HE 2OPSB 4LVNP 4USHA 2G9OA 2DHXA 3M32A 1PC5A 1MMNA 3S1TA 1BQMA 2JHEA 2V94A 1XWLA 4WFZA 2PI5A 4WXOA 4F8RA 3I55S 1RDRA 2V2KA 4CQ1A 3L7OA 3MECA 1X8DA 5B0CA 1JLQB 3NLCA 4JUZA 3D54A 3BSOA 4DFPA 1D9DA 4B3SF 3C2PA 4ERDA 3MEKA 1NH7A 2UUTA 5KFLA 1H2TZ 1XBWA 4X64F 4RZRA 3OTBA 3NG8A 1X4FA 4P6QA 2J0WA 4F67A 5D77A 3JB9k 1SKSA 2YWKA 3A1YG 5JVGQ 2FJVA 2RRNA 1U1KA 2GQ2A 4DN0A 3CJKB 1GXTA 3QWUA 1P1TA 2ZE2B 4FPRA 5GAHI 1DTQB 2UVRA 2ZJPQ 2Y1JA 4RW4B 2WSCC 3LWLA 3DLLQ 4KGMA 3OR2B 3HO1A 1KNZA 4QZVB 1CEZA 3N6LA 2E29A 2OAUA 3EGNA 1N5YA 4B9MA 2R7WA 2ASLA 4FVMA 2J6TA 3SCIE 3ITHB 1VGYA 3EUNA 3RBEA 3GFZA 1U1LA 4TLQA 1TKXB 1JIHA 2BQ3A 2UUBF 3KLEB 4PXBA 1EETB 5FDLA 3VWSA 1DLOB 1NK4A 3D2WA 1Q4RA 5DG9A 3NBPA 3PEHA 5JJBA 4WFBQ 2F8HA 4DL0C 1FRKA 4ZCLA 3I5BA 3QPIA 1QY7A 5CXTA 3VR1A 3D0IE 2BACA 3M9MB 2W9AA 4QOTA 1QM9A 4WFYA 5CYJA 1N5TA 2PDAA 2AWZA 3DLGA 3GG0A 1CC7A 3FQKA 3PJXA 4Y00A 4B3OA 3O8WA 4DJBA 2W4CA 3F41A 3SSSA 5KG2A 1L5UA 3FJ2A 2IBKA 2I9SA 3QIPA 1FCAA 3I0RA 2ERRA 2WBMA 1HMVB 2W4DA 1GTEA 5KFEA 4DOZA 1R0AB 1XC9A 1RTIA 2ZHOA 4Y0FA 1HBUB 3IAS9 4XPCA 3KFWX 3RRHA 4ZLPA 2GHWA 4TXSA 2NSBA 4NA3A 3CMES 2D3UA 2IYGA 4TY8B 4KB7A 2I5JA 1FRJA 1QAYA 4OZ5A 1U09A 5E7OB 4A46A 1VQ4S 4LFCF 5C42A 4WFNQ 2RUGA 1I1GA 3QZ7A 4NLSA 5C24B 2NREA 5ADZA 3I56S 3A8EA 2J0XA 1GH8A 2R7SA 4QIVA 1UETA 2CPJA 4FS2A 1VHFA 4A8SA 1KHVA 4XAKA 4I1TA 3DRXA 3K58A 4OFZA 4ZP9A 4ED6A 1Y5LB 1OPZA 1UAWA 3CGIA 3K5PA 4ILRA 4DR6F 2VPXB 1TL1B 4IDKA 2QRRA 2DNLA 2I1RA 3HXMA 4FVCA 5B0BA 1F0XA 2HHSA 2CPIA 1LW0B 1J5EF 2OSRA 5F8MA 2HNDA 3DN9A 4IRCA 4ECTA 2ZBIA 3IWXA 4YUDA 2FPHX 1NU4A 1VQ5S 3GIKA 3PO5A 1X5OA 3C3LA 2FLPA 1SUQB 2HG4A 4HI2A 3C6UB 3CDBA 5KFUA 1FJ7A 4QPTA 3DLHA 4OLPA 1UFWA 1AUDA 4RBUA 3OJUA 3T5KA 3OV7A 3PR5B 4RW6A 2MZSA 1LOUA 5HL7Q 2RU9A 5KFKA 3AA9A 2CQPA 5KFHA 3UD4P 2MZTA 3RB4A 2G13A 4TQRA 2FVCA 4YB1P 1JXEA 1U26A 2DHSA 2EPIA 4DV7F 1TP7A 2RU3A 3EZ5A 5B0GA 5A8WA 4WKYA 2PSZA 3KLIA 2VG7B 2G4BA 2HVHA 4KV8A 4C8NA 3K59A 4WZMA 4QU6A 4OI3A 2IRYA 1HA1A 4TN2A 5KFYA 1FKOB 4WJBA 4Q8EA 1MU2A 2P9CA 2HHVA 2ZDOA 5J1EA 1LWFA 2KM8C 3MMBB 2GC8A 4CT9A 1OSCA 4DR3F 2D3ZA 3OSNA 3LF0A 1QSLA 2LEAA 3BDEA 3DLBA 1FHTA 1LFWA 4BS2A 2M3DA 3CC2S 3SV3A 4DFJA 2VUGA 4WYWA 1XR5A 4I68A 1R27B 4Z37A 1U1MA 4F02A 3CULA 1QE1A 1C0UB 2JEGA 2LEPA 3IG1A 1F5CA 5C5JA 2QIFA 4LF7F 2L9WA 1XNQF 4PCQA 1U45A 4CH1A 1T05B 2FJXA 4IFVB 3CCSS 3MUMP 4IR9A 1FTCA 3L09A 4CO1A 1JKHB 4KHMA 2CIMA 3KG4A 2J7UA 2DNRA 1S49A 2FDNA 2YNHA 3BM7A 1K73T 1DBDA 2V4QA 3L95X 1YITS 4FF3A 3T19A 1U25A 2UZAA 5A8RA 3G6ES 4ZMMA 3UDLA 4DL2A 1X4GA 2XMUA 1LKZA 4M5DB 4WTYA 1VQNS 3AJ1A 2MKIA 3VF0B 2PMHA 2M5YA 4QCLA 2KXHA 3EZUA 5AXNA 1MW7A 4PG4A 4QYRA 5KFPA 4FBUA 4Z2XA 3PIOQ 5L1JA 1SL1A 4O3NA 3BSCA 3H4BA 4C8KA 3K8VA 3VCDA 2VFVA 4FS1A 4DL5A 2BRKA 1TVRB 2MQNA 3MEDA 3RW6A 2MY8A 3G8QA 3UWTA 2DNMA 4J9RA 2KYZA 5LSLA 1R89A 2ACYA 4HHJA 2AYGA 1U7LA 1YBAA 4OZ1A 4NRTA 4KSEB 1EP4A 2AYBA 4O3RA 2LQBA 5HO4A 2RRAA 4QWEA 1VC0A 3CCQS 5K5MA 5C25B 5FD1A 1FRHA 2WHOA 4JI0F 3B78A 3CCTA 4ID5B 4JBCA 3CCLS 4DL7A 2VKRA 2PIIA 1S76D 1DFDA 4C3KA 3MXHP 2CPDA 3QLHB 2WB1D 3HVTB 3MMCA 4OI1A 2EFGA 5F3ZA 4ZHRA 1N32F 3AQOA 5B09A 3MUTP 4WIIA 4H4KA 1VBXA 1FE4A 2WSEC 3TW0A 4NLGA 4N41A 2KRRA 1Y9OA 4DSLA 1IKWB 4DSEA 2AGOA 3FRZA 1RTHB 3CC4S 1FRMA 2DH9A 5KFSA 2IC3A 2RQKA 2QA1A 3T1HF 2XNRA 1IKVA 1F9FA 3FEXB 2DGOA 4I64A 4IUFA 2KRBA 1SI9A 4H4OB 4AQYF 4A8FA 4BWJA 3GB0A 2RB7A 2JZ5A 3M6VA 2CJ9A 1NJZA 3Q8QB 5U47A 5FJ4A 1U48A 2IC3B 3RB0A 2DO0A 4RW9B 1IKYB 2MQOA 1JNZB 4RNHA 3OUYB 1JLGA 3DLJA 3OJSA 4IRKA 4JV5F 4PWDB 1ZPWX 1SJ4P 4C8ZA 1UVIA 3ISZA 5J2QA 2FB0A 3AA8A 3BQ0A 1GNKA 4J9MA 4MKBA 5HP1A 4GMKA 1PILA 2XG8A 2KTQA 2YKMB 1S77D 3I82A 1S99A 3M1VB 1Q81T 2J76E 3H2VE 2LQ5A 1BQNB 1TKZB 3CJ5A 5DRKA 3PW5A 3ETOA 3LAMA 2QE5A 2MZ1A 5I42A 2D3OR 1C4CA 1N5SA 2CPYA 2E5LF 5K8OA 1RI7A 5IM0A 1PSDA 3QGGA 3Q2SC 3OHBA 5EWEA 2EFQA 3MR3A 3W7BA 2CG4A 2VC0A 2BQUA 4YFUA 5CD4H 3HHEA 2L9NA 2XMWA 2ATLA 4JI4F 5M2PA 1JJ4A 3SMZA 2XEXA 1N33F 1D9FA 3VAMA 1TK0A 2DIVA 5A0YA