3CUOA

Crystal structure of the predicted dna-binding transcriptional regulator from e. coli
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
98
structure length
98
Chain Sequence
MTELAQLQASAEQAAALLKAMSHPKRLLILCMLSGSPGTSAGELTRITGLSASATSQHLARMRDEGLIDSQRDAQRILYSIKNEAVNAIIATLKNVYC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the predicted DNA-binding transcriptional regulator from E. coli.
rcsb
source organism Escherichia coli k12
molecule tags Transcription regulator
molecule keywords Uncharacterized HTH-type transcriptional regulator ygaV
total genus 31
structure length 98
sequence length 98
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3cuoA00
1FBUA 2MC3A 4M73A 1TLHB 2P4WA 4EJTA 2IA2A 1CF7B 1HSJA 2QBYB 3GEZA 1FYMA 3ERED 2ZNZA 3V8KA 5E1WA 1P2FA 1F5TA 1J2XA 4WXHA 1S8NA 3L9FA 2A61A 2HYFA 2ZMEB 2P5LC 2UWMA 4L9TA 1DPUA 2FNAA 1IUYA 3HOSA 2NNNA 5LRSA 2P6SA 4Y13A 4EMSA 1LQ1A 3ZMTA 1R1UA 2IVMA 4MGRA 1ZG1A 2JPCA 4EJUA 3FMRA 2RDPA 2FXAA 2Y0MA 1BI1A 1HBXG 2L02A 2RNJA 2K7LA 5HLHA 3GYHX 3M9AA 2O6GE 3HOTA 2HQRA 2OA4A 4A2UA 3MFKA 1WKMA 3J7AO 1ZGJA 4G6DA 3JTGA 4JQFA 2OQGA 1V3FA 4LLGF 4L5JA 4EQQA 1P4XA 2NS0A 1WSUA 3WTTC 2JT1A 3CO7C 1KU9A 2JRTA 3F21A 2NNYA 3DPTA 4BHCA 1GHCA 1FBSA 3TO7A 2K4BA 4RB0A 1QBJA 1XCBA 1K7AA 3HHGA 4G8XA 2MA3A 3HRSA 4I09A 4G6QA 1BI0A 1O7FA 1WWXA 3CJNA 4LJZF 5DCMA 2CSOA 2HTJA 2Q2EA 4I02A 4M9SA 5E17F 4P55A 2XVCA 2F5CA 4Q47A 3G3ZA 1K78B 5AIPA 3H3UA 2O61A 1U6GA 2H6BA 4XSZF 4L9VA 2V1XA 4FT8A 1SAXA 3RYPA 4IRIA 1TQPA 1O3RA 3VEPA 3E5XA 4IJAA 2DPUA 3R4KA 1I6XA 4KIFA 2ACJA 1W7PD 3K1MA 4AVPA 2HFHA 1SFEA 2XIGA 4MTEA 3I59B 3ISPA 2EA2A 4KN4X 3E6BA 5LHIA 3FM3A 5K1YA 3CUOA 4IRGA 1ZN2A 3VOEA 2DW4A 2L01A 3HYIA 2PN6A 5F64A 1ZLKA 5H20A 2PQ8A 2XAJA 1Z6RA 1IXRC 1MD0A 3H3ZA 1FWZA 1BI3A 2EFWA 1LDJA 1T0FA 2Q8KA 1JGSA 3ABTA 4L9JA 2WV0A 1BI2A 1ULYA 2DI3A 3KFWX 2DBBA 2FBKA 1YYVA 3EUHA 1ZYRF 4A5MA 1IN5A 5ILUA 4L9NA 1IN6A 4M6XA 3D5LA 2Z33A 4ENMA 1CF7A 4Q4ZF 1Z1DA 3FMSA 2UZKA 4MNUA 3EETA 1U78A 1U5TA 5DCFA 3WTXC 1PP7U 1YS7A 2JSCA 2JTVA 4EM1A 5TRDA 1A04A 3WTZA 2AS5F 1HKSA 4RAZA 2PI0A 4GGGA 4S05A 2D1HA 1TQMA 4UVAA 1MDMA 1XMKA 2ZBKA 2PG4A 5HOOA 2ISZA 3CTAA 1O3TA 3TO6A 2BEOA 1HQCA 5K5RA 3FHZA 2RV8A 3KLNA 4G94A 1O3SA 1QPMA 4BYYA 2K86A 2FSWA 2VBWA 2HZTA 3KP7A 4NQWA 4OOIA 3C18A 2DFIA 1XGSA 2GA2A 2OZ6A 3TO9A 1FP1D 3T8RA 2IRFG 4M9ZA 5HS9A 3JSOA 2IPQX 5ERIA 3FXRA 4ENKA 3HRTA 2FF4A 1KU7A 2YU3A 3BP8A 5E8GA 3GW2A 2GZWA 3IRRA 1CGPA 4IHSA 4ZYGA 5LHGA 1E17A 2FQ3A 1G6NA 3QP5A 1GVJA 4UUVA 1VTNC 4IVNA 4LD5A 3RYRA 4N9IA 5DUKA 1W4MA 2HDCA 4GO1A 4DNCA 5A2QZ 3PQJA 4HX8A 3RPQA 1IXSB 4R1HA 1T39A 1ONVA 2BE5F 1B1BA 3F8CA 4UNOA 4P96A 4HF2A 2STTA 3LQQA 2Z3YA 3IC7A 5ICFA 3KP2A 4D0PA 1FSEA 5F6FA 3COAC 3F3XA 3BDDA 2KIUA 2COMA 2KIMA 4NB5A 2IJLA 4A6DA 3E6CC 5D5UB 3TOAA 4Z2YA 1BM9A 1W7PA 3IWFA 5FFXA 1RIOH 2KRFA 1BIAA 5CVUA 4B8XA 3QU6A 4I98B 1TW3A 2ESNA 3I58A 5DDGA 1ODDA 4WCGA 1ZG3A 3P9CA 2W57A 2FBIA 1RUNA 5E1XA 1YW8A 5HDKA 5DD4A 1I1GA 3WTSC 4PGGA 2Q0OA 2M45A 2G9WA 3BWGA 4RGSA 4LK0F 2EWNA 5L3GA 1UCRA 1D5VA 1V4RA 3RKYA 1H9TA 1RNLA 1DUXC 5L3BA 2P5KA 3KE2A 1JHFA 1Z05A 2Y48A 5BMZA 3WGGA 1KQ8A 4QLCU 2W84A 3VFZA 4ZZDA 1LDKB 1XSVA 5JI6A 2FBHA 2PLYA 1KQ9A 4KA4A 2A68F 4HLYA 3GX4X 3RPUA 4OINF 1S29A 2Z9OA 4KFCA 3E6MA 1H0MA 3ULQB 3W6JB 5JFRA 2KKOA 1Z6TA 3ZP5A 4MQVA 4RB2C 1PP8F 2VE8A 3QRFF 2QWWA 3N4MA 2WTEA 4LMYA 1FP2A 2ZCWA 4BNCA 3F8NA 4G9YA 2XKPA 4U7DA 1USTA 1LNWA 5JVTA 4YFXF 5FD5A 2L4MA 2O3FA 2M87A 1YW9A 5CJ9A 4ZH4F 3TOBA 4TV7A 1KYZA 3E5QA 4EJWA 1S7OA 4KICA 1P4WA 4MQ9F 2DQLA 2LSOA 3BJAA 3BJOA 2NAZA 2JPBA 5BS6A 2QBYA 3GFJA 4DQ2A 4JBAA 4HF1A 4HYEA 3ZMVA 4PCQA 4YFKF 4ASNA 1KA8A 4RGUA 1UHWA 1PUEE 4JK1X 1WRJA 1W7PB 3IL2A 3U2RA 2VOPA 3DF8A 1QQIA 4ON0A 3HTSB 2EV5A 3BJ6A 1XD7A 2CG4A 4CO8A 5L3DA 1WI9A 3H92A 1SMTA 1MGTA 2HYGD 4HX4A 4I0AA 1MDMB 1LVAA 5EEGA 4I01A 4HLXA 2P5VA 1F9NA 2YX7A 3IRQA 4PDKA 3GFIA 1BBYA 3SZTA 1LDDA 1T6SA 1ZHFA 2YR2A 5ILSA 1BIBA 4KNYA 2LDUA 2QM3A 5LGNA 2FEZA 1DDNA 4U7BA 3HSEA 5TJJA 2P7CB 4BAYA 4WXCA 1KGSA 1YIOA 4O6JA 3NQOA 1SD7A 3TDZC 2P7VB 3LSTA 3E97A 3ML6A 4ESBA 3JW4A 4LGWA 3CUQB 2MD5A 1IZ1A 3IWZA 4KYWA 5HDGA 4CYDA 4CGZA 4HV6A 1XCVA 5JHUA 2DQRA 3KP6A 1ZLJA 1HKQA 3M8EA 3KLOA 1D8JA 2RC4A 4M74A 3QPTA 1X3UA 1FOKA 3E6DA 4YIFA 1G3YA 1SD5A 2RN7A 1REPC 2GXBA 5L3CA 5H6QA 3PFIA 3FM5A 3LA7A 1B9NA 3WE2A 4UXNA 5HLGA 2GAUA 4PZJA 2V9VA 4EM2A 2ISYA 1HKTA 3T0YA 2H6CA 1R00A 5A2QK 3KZYA 1U2WA 4EGYA 2DLLA 3R61A 3O3KA 1Z7UA 2A5YB 2M30A 3R6SA 3WTVC 4HOBA 3ROUA 4EJOA 2DPDA 2BV6A 1ZREA 1T98A 5F1RA 2XASA 1P4AA 2OAZA 1MZBA 2L4AA 4BHBA 1ON1A 2KJCA 4RB3C 3KCCA 2CW0F 3M8FA 2K4JA 2VN2A 4L5IA 2XAQA 2F2EA 3S2WA 4LB5A 5DCMB 3R60A 1U5TB 2EFQA 3LAPA 3FXQA 1GXQA 4XSXF 5FGMA 3DP7A 3V7RA 4U0VA 1G3WA 1FT9A 1IN7A 3RKWA 4CHUA 3L2CA 1J0RA 4MHGA 3GWZA 3ZN1A 3VB2A 2QLZA 3FWEA 2XROA 3LA3A 2O03A 1FX7A 1BOAA 3DXJF 3R0AA 1R1TA 4Q48A 2QVOA 2IT0A 2HR3A 3F8BA 3RI4A 1USSA 3MZYA 4HDUA 2VOOA 5H6RA 2ZJ2A 3DEUA 4HZFA 1K6OA 4LB6B 4G7ZF 4OIPF 4WK8F 5HS8A 2MLKA 1BC8C 5KK1A 4L0ZB 1ZG5A 2R3SA 3CUQC 3EQLF 3WGHA 3REOA 2VT2A 5FB2A 4IPAA 2D1VA 1UB9A 4R8HA 2HKOA 2ETHA 3PQKA 3O2PE 1YQAA 2E7XA 3Q9SA 4NHJA 4PGHA 5D5WB 3MAJA 1KQ0A 4AD9A 3F22A 1W5SA 3FZVA 2FE3A 4MEYF 4KN7X 1OPCA 5LHHA 2V6CA 1R58A 1XSDA 4U88A 4EM0B 5ILVA 1G3SA 2W25A 2CYYA 5FFZA 3TKYA 2QQBA 3WU1B 4HQEA 4F7ZA 4HF0A 2D45A 4HAMA 3HTUA 1O57A 5D8LB 2UXXA 5LEJA 4WX9A 5CVJA 2JZYA 5E1ZB 1U3EM 4XLPF 2YSRA 5HLIA 5KVRA 3RTRA 1OYYA 2EFPA 4A0ZA 2CWEA 2ZKZA 1TBXA 2IA1A 3DV8A 2ADUA 1JE8A 3I54A 4MEXF 1J9IA 3C7JA 2STWA 5K5OA 3K1NA 3HRMA 3QOPA 1C0WA 2YX4A 3F23A 3ZMDA 3EDPA 2WC2A 2VC1A 3CDHA 4HV5A 3M7GA 3T8TA 3FXUA 4WWCA 3WGIA 1YO5C 2A3SA 1RZ4A 1U8RA 2XRNA 4A6EA 2R7FA 3JTHA 1PDNC 2ELHA 2GQQA 5AONA 3MWMA 1DP7P 3P7NA 3F6OA 3F8MA 1OYWA 2E1NA 4HX7A 2LF8A 1R36A 5E18F 3KZZA 3L00A 4ZZLA 1R5HA 2RVCA 4KIGA 3RKXA 2OBPA 3TQNA 1SFXA 3HSRA 4KT5C 2C6YA 3WTYC 4E70A 2FNPA 5FLXZ 3WU0A 2ZFWA 5AIQA 2RQPA 3IKVA 3DKWA 4N9HA 1QO0D 1F4KA 1W5TA 3CO6C 2W85A 2V1DA 2G7UA 1P92A 1ZRCA 3CUQA 5LRRA 2F5FA 4A0XA 5LLQA 1I27A 2E7WA 2E1CA 1LB2A 1DPRA 2KIFA 4LLLA 3HIFA 5L3EA 2VONA 3J81Z 3ZN0A 1IXCA 4OMYA 3SFZA 2BYVE 5J6XA 3EYIA 5IT9Z 1YW7A 3TGNA 5D4RA 5DV5A 2P8TA 1J75A 1TNTA 5ICCA 2DTRA 4LFUA 5D5XB 3KP3A 4EVIA 3LWFA 2EFOA 3U1DA 4GYGA 4P9FA 2A6EF 4BQAA 5J8FA 3BOQA 5ED4A 1T2KA 1I1SA 5LEKA 3I71A 3F8FA 2M8EA 3KP5A 3C1DA 2CFXA 5DUIA 1FYKA 3FF5A 5LGUA 2LKPA 3K9TA 1R22A 3RDIA 2VBZA 1BN5A 1OYIA 1IRGA 4RGXA 3WG9A 4HDVA 4LG0A 2NYXA 2OU2A 2GA1A 1XN7A 3V8JA 4ZYDA 5D6EA 4HW0A 2DK5A 4H0EA 2J5OA 1HW5A 4G7OF 5FD6A 3Q5FA 1HXDA 4S04A 3I64A 1F1ZA 2ESHA 4K2EA 3I53A 4I0BA 1B4AA 1D3YA 2MLGA 3ABUA 2Z5UA 4OIOF 1SD4A 5D4SA 4L0YB 3MEXA 2PBIA 5IT3A 4AIKA 2D2WA 2HGCA 3D0SA 5CYVA 4UHTA 3I59A 2HEOA 3QAHA 2XV4S 4FX0A 3R0JA 1JXSA 3WODF 4GCVA 4XBFA 3O6BB 3QP6A 2LF7A 1IF1A 4IF4A 1FBQA 3JSPA 2QYOA 4KIBA 3BROA 3BY6A 2EV6A 3MCZA 1ZRDA 4P9UA 1ZARA 1S7AA 3V7SA 1LJ9A 2HQNA 2TDXA 1FPQA 3J80K 3GF2A 4EGZA 2FA5A 5JR3A 4U0WA 4OU0A 3ZPLA 1EH7A 3RJPA 2AXLA 4YG2F 1B9MA 1XGNA 1QZZA 1BC7C 3P9KA 2Z99A 3HRUA 2VE9A 3FMQA 1LEAA 3GFLA 2OD5A 2EV0A 1XDSA 1MJBA 4Y17A 2QZ8A 2XAGA 1TNSA 3B73A 3IKTA 2HOEA 4AIJA 2VBXA 1HW1A 5LBQA 3OOPA 5BPIA 1K78A 3ECOA 1B59A 5L3FA 4L18B 4CZZA 1FZPB 2EK5A 1OKRA 4GYIA 1FNNA 3GZ6A 2DT5A 4Y15A 1IW7F 1XSXA 1IRFA 3V7CA 2XHKA 4UV9A 4HBLA 5IT9K 3RIRA 4OIRF 2PMHA 5CLSA 2MH9A 1J59A 1QGPA 3CLOA 4ZYEA 1QZYA 2M5WA 4ESFA 3DFGA 2EJRA 4IHTA 3KETA 1Z9CA 2L3DA 5CVVA 2DAOA 1Q1HA 1Z91A 2B0LA 3GXOA 4RS8A 5E8IA 2XKOA 1MJ9A 1U5TC 3F72A 2PEXA 1K79A 2IW5A 4IXAA 5DEQA 3BPVA 4KUMA 4EV0A 3T1BA 1SMYF 2FOKA 3SQNA 1ZAOA 3WTWC 1YG2A 1P6RA 1TW2A 5D6FA 2EB7A 4M9XA 4ZYHA 4LG0B 3LA2A 4YFNF 4O3MA 2IP2A 4I2OA 2HS5A 3T5XA 5DYMA 2GXGA 1XDUA 2ZO4A 4KDPA 2XGXA 2ZMEA 5CVIA 3ELKA 1FLIA 2PMUA 3M1EA 5HDNA 3K69A 2OQRA 3E3VA 5ICEA 3KEOA 4FHTA 5DD8A 2K02A 1BJAA 3I0TA 2ZXJA 1EV7A 4A12A 3ECHA 2R7DA 3SHFA 2P6TA 5CVRA 1ZGAA 2GWRA 3BZ6A 1OR7A 3SXYA 2DU9A 2ZNYA 3QPHA 4IRHA 3AAFA 2HWVA 2XUBA 1B6AA 2MBFA 3LAJA 4O5VA 3JAMZ 3ZMZA 1R5GA 4XLNF 1ZH5A 4N0BA 2V79A 3N97A 4OIQF 2FU4A 4GXOA 2DK8A 3U9GA 3G73A 4I7HA 4WXDA 3GO5A 2O8XA 5EEHA 2VBYA 4CICA 1XGMA 1SD6A 2X0LA 6PAXA 1G3TA 3KEQA 5ICGA 2IA0A 2PJPA 1IN4A 1S6LA 2FRHA 1FSHA 3K0LA 1OMIA 3DQVC 2YPRA 5E20A 1XGOA 3LQRA 2J5PA 1TTYA 1ON2A 5K5QA 2A07F 3SZPA 2OZUA 4A5NA 2EA4A 2RGVA 2W24A 1STZA 4CXFA 2V1UA 2QQAA 4CDGA 3P9IA 4UVBA 3IHUA 2FMYA 4G7HF 5HVQC 3JAMK 4P5OA 4AWXB 3DPLC 5J8CA 2UXNA 3LFKA 1KYWA 1SFUA 2VXZA 4KMFA 1KU2A 4RGRA 3GVAA 5FO5A 3K1PA 2VT3A 3F6VA 1XB4A 1EH6A 1FC3A 1R7JA 4ENNA 3J81K 3HHHA 4BXUA 4XRFA 1T38A 3E5UA 4RAYA 1L3LA 1RUOA 1G4DA 5FLXK 4RB1A 4AIHA 2RKHA 2QUFA 1RI7A 2FMLA 1S3JA 2K27A 2G7HA 2H94A 4YIIA 3WE3A 1FY7A 3Q9VA 4WF2A 1GXPA 4MTDA 3W6KB 1ZRFA 1O7LA 4Q5SF 4ESJA 2F5EA 5BQTA 1I5ZA 3K2ZA 2NRAC 2VC0A 1IN8A 2H27A 3HSFA 5LGTA 3ZQ7A 4B09A 1YLFA 3HUGA 1J5YA 3I4PA 2O0YA 1NHAA 4EJVA 2EFNA 1LEBA 4M71A 1H9GA 4UVCA 2X4HA 4ENJA 1L0OC 1XMAA 1WQ2A 2CGPA 4QWQA 3TDUC 1AOYA 3WTUC 1R23A 1R1VA 5BPDA 4ETSA 3L7WA 2H09A 1MJAA 1UHMA 2CO5A 1O3QA 3MZHA 3GFMA 2BBYA 4M6YA 4M72A 1AWCA 3C3WA 3GUDA 4FX4A 3ZMUA 5HS7A 1KU3A 2QQ9A 2F5DA 1UFMA 3L09A 1EH8A 2A69F 3KP4A 2PFBA 4R79A 1D8KA 2XAHA 3VODA 1QNTA 3NRVA 3J80Z 1IAWA 4LLNA 2M1BA 3V4GA 2GIVA 4OMZA 3ZMSA 3I5UA 2XAFA 3GLXA 4UV8A 1TQIA 3B02A 5D5VB 2QENA 1E2XA 1YTYA 1YFHA 1FYLA 2HTSA 1MKMA 1HW2A 4KMUX 3NEUA 2Y75A 2WWYA 3MQ0A 2LNBA 1J7KA 1JHHA 3GZ5A 5BOXA 4HA8A 1Y0UA 2HKXA 3QU3A 2KJBA 4A0YA 1HSTA 4LK1F 3EYYA 2L54A 3OV8A 4U0YA 2DO7A 2A6HF 4HQMA 2MH2A 2VODA 3FX3A 5D8KB 3V8LA 4BH9A 1YS6A 2CQKA 3BPXA 4BHPA 2BGCA
chains in the Genus database with same CATH superfamily
1FBUA 3O8GA 3BG9A 1T33A 2MC3A 1FIAA 1WHUA 2JUCA 2R7QA 3ZQHA 2CUJA 1E0EA 4M73A 1TLHB 2X6WA 1LFUP 2P4WA 2VI6A 4EJTA 2IA2A 3A01B 1CF7B 1HSJA 2QBYB 1LE8B 3GEZA 1FYMA 3LSPA 3ERED 2ZNZA 3V8KA 3FXKA 5E1WA 1P2FA 1F5TA 2DXIA 5E3OA 1J2XA 5E3NA 4WXHA 3CC7I 1G59A 1S8NA 1IV6A 3L9FA 1OLTA 2A61A 2BHZA 3MVPA 1APLC 5KAFC 1I6HJ 2HYFA 2ZMEB 2P5LC 1A36A 2UWMA 4L9TA 1DPUA 2FNAA 3CMYA 1IUYA 3HOSA 2NNNA 4B48A 4E4HA 5LRSA 5F08A 2XSDC 2P6SA 4Y13A 1OFCX 1TZLA 4NC8A 3G1LA 4EMSA 5B5EC 1LQ1A 1V54H 1IJWC 2ECBA 3ZMTA 2F4MB 3OL4A 2JJ7A 1R1UA 2IVMA 3QYFA 2XB5A 3PUBA 4MGRA 2WAQN 3FHNA 1ZG1A 2JPCA 4EJUA 3FMRA 5EYRA 2RDPA 2FXAA 4BACA 2GIZA 2Y0MA 1UG2A 1BI1A 1HBXG 2V9KA 5C44J 2L02A 1LUJB 3TBIA 2RNJA 2HVRA 2K7LA 5HLHA 4CCNA 3M9AA 3OYNA 3GYHX 2CQQA 2O6GE 5FKNA 2M8GX 3OYLA 3HOTA 2HQRA 5BNGA 5J4VA 2OA4A 4A2UA 3MFKA 1WKMA 1Y8RB 3SYTA 3J7AO 2DA6A 1OJLA 1JT0A 1ZGJA 3BZCA 2WY7Q 2KPMA 5CKTA 4G6DA 3JTGA 4IHWA 3CJRB 4JQFA 2OQGA 1V3FA 5J1YA 4LLGF 5DM6F 1IRXA 4L5JA 4EQQA 1P4XA 1KZHA 2YU9J 2NS0A 2VKHA 1WSUA 4DZPA 3WTTC 2ECCA 1WJDA 2JT1A 3CO7C 1KU9A 3CF2A 2JRTA 4ZDLA 3F21A 2NVUB 2NNYA 2OTJI 2VPRA 3VSKA 4E7ZA 2K9QA 3DPTA 3O8HA 4D1QA 4BHCA 1GHCA 1U0JA 1FBSA 3ABLH 3TO7A 4OWRB 2K4BA 3E1SA 4RB0A 1QBJA 2ICWG 1XCBA 1K7AA 3HHGA 4G8XA 2MA3A 3EPZA 5EG0B 3HRSA 3MD2A 4I09A 4G6QA 1BI0A 1ZKGA 3FBNB 2CUFA 3BG5A 1O7FA 2NOGA 1WWXA 3VSLA 3CJNA 2K3PA 1D1AA 2Y2ZA 3I3LA 3SEZA 4LJZF 5DCMA 1D1CA 3L1PA 1N77A 1S7EA 2HI3A 5KNLA 2CSOA 2HTJA 1VFCA 2Q2EA 4I02A 4M9SA 5E17F 4P55A 2XVCA 2F5CA 4RLQA 2D5VA 3BR0A 2NS8A 4Q47A 3G3ZA 1XX5A 2W82A 5EDNA 4X0GA 1K78B 5AIPA 1MMGA 3H3UA 2HOSA 2O61A 1U6GA 5HNHA 4RLFA 2H6BA 1X3ZB 4XSZF 1QU3A 4L9VA 3IP4B 3LSHA 5B1AH 4PFOA 2Y31A 1NK3P 2WV1A 3DTKA 3QYEA 2V1XA 4FT8A 4M3DA 5IPAA 3VDXA 1SAXA 2RQQA 1YX3A 2EZKA 3RYPA 4IRIA 1TQPA 2BY0A 1O3RA 3OSFA 2L7ZA 3VEPA 3FXOA 5J1UA 2EQRA 3TP0A 1U9NA 3E5XA 4IJAA 2DPUA 1NG7A 3R4KA 1I6XA 4KIFA 2ACJA 1W7PD 2OUMA 3ZXSA 2XAUA 3K1MA 1WVRA 4AVPA 1IUFA 2HFHA 2LFBA 3BT9A 3JRIA 1SFEA 2O7OA 2XIGA 1WJAA 1JUSA 2EZLA 3ZRGA 4MTEA 3I59B 3ISPA 2EA2A 3J7ZI 4KN4X 3E6BA 5EEAA 5FKOA 5LHIA 2V4JC 1X3WB 3FM3A 5F04A 5K1YA 3CUOA 4IRGA 2IS4A 1ZN2A 3VOEA 2DW4A 1QVUA 2L01A 3HYIA 2PN6A 3HOWJ 5F64A 1ZLKA 2E19A 5H20A 5K7HA 2PQ8A 2XAJA 2DODA 4YRVA 3CCJI 1Z6RA 1IXRC 1MD0A 3H3ZA 3PL8A 4BJTA 1FWZA 1BI3A 3IH4A 3CCSI 2EFWA 1LDJA 4BDYA 2E2IJ 2JVHA 3D5SC 1T0FA 2HQ5A 2Q8KA 3I4NJ 4LITA 1JGSA 2EILH 3ABTA 4L9JA 2R0QC 2WV0A 5IYCJ 2G0EA 1BI2A 1ULYA 2DI3A 3KFWX 1RKTA 2DBBA 5M5XJ 3FXMA 2KISA 2FBKA 4CCOA 2HQAA 2OF7A 3L2RA 2IGOA 3RZDJ 3S16J 1YYVA 1BR2A 1R49A 1B8IA 3CMMA 3EUHA 3ZQFA 1ETYA 1ZYRF 1X1CA 1DGWY 2LLKA 1IN5A 4IQ4A 4A5MA 1Z0XA 3BR5A 4L9NA 5ILUA 2XC7A 1FJLA 1IN6A 4M6XA 5FKKA 3D5LA 3GTMJ 2Z33A 1GT0C 2CV1A 4ENMA 5B66C 1I39A 1CF7A 4Q4ZF 1Z1DA 3EUKL 2UZKA 4MNUA 3EETA 1JKPC 1U78A 3KYLA 1U5TA 5DCFA 3WTXC 5KHDA 1PP7U 1OCTC 4G6TB 1YS7A 2JSCA 3S3MA 1D0XA 2JTVA 4UUTA 4EM1A 1Z77A 4NQWB 2BY2A 4FISA 5TRDA 1A04A 3WTZA 1JT6A 3DKYA 3PSIA 2AS5F 4QSHA 3LNQA 1FOXA 1HKSA 3TW6A 4RAZA 4KISA 2Z16A 2PI0A 1YJNI 4GGGA 3H35A 4S05A 3KIOA 2D1HA 1TQMA 4UB8C 4UVAA 1R4MB 1MDMA 1GV5A 1XMKA 1E3HA 2PG4A 2ZBKA 4BY1J 5HOOA 2ISZA 1MMNA 3CTAA 1O3TA 3TO6A 4B47A 2BEOA 1HQCA 4M3EA 1V5EA 5K5RA 5K7ZA 2L9VA 3FHZA 1WH7A 4BY7J 1VF9A 3DWLE 2RV8A 3KLNA 4G94A 4BE2A 1O3SA 1QPMA 4BYYA 2K86A 1TWCJ 2FSWA 3ZQIA 2VBWA 2HZTA 2NVYJ 4ZYAA 3KP7A 2Y69H 4NQWA 4V2FA 4PJ0C 4OOIA 3C18A 2DFIA 1XGSA 2GA2A 2OZ6A 2X85A 3TO9A 1FP1D 3T8RA 2IRFG 4M9ZA 5HS9A 1I50J 4XOTA 3JSOA 2IPQX 5ERIA 4BEHB 3FXRA 4ENKA 4V19K 3J7YJ 4BUPA 3HRTA 2FF4A 2XPUA 4RAFA 1KU7A 3KYDB 2YU3A 3BP8A 5E8GA 2KDZA 2DMQA 3GW2A 1MMSA 2OCCH 4NC7A 2BHYA 2GZWA 3IRRA 2DFEA 4BE0A 2X51A 2VJ4A 2AQFA 1ACIA 1CGPA 2VL8A 4KITB 9ANTA 4CYCA 4J00A 4IHSA 1ZELA 4JYKA 4ZYGA 5F0CA 3QQAA 4BQQA 5LHGA 1E17A 1CQTA 3CCRI 2FQ3A 3VPRA 5GAGJ 1G6NA 2CMPA 3QPLA 3QP5A 4XLCA 2AO9A 5B3SH 5EF6A 2RREA 3K4LA 2DJIA 1GVJA 1WPKA 2XB0X 1U8BA 2PJRB 1VTNC 4UUVA 1JTYA 4MLOA 4BE1A 2GXAA 1OR7C 4IVNA 3SZGA 3PIPF 1JJ6C 1B72A 4LD5A 3RYRA 1R6RA 4N9IA 5DUKA 3GMEA 2DA2A 3OWTA 2R7ZJ 1W4MA 2YUSA 2X48A 2HDCA 4GO1A 3NARA 4DNCA 5A2QZ 5EGOA 3I56I 3D1NI 1RKWA 3PQJA 3BR2A 2H8RA 4HX8A 4CA0A 3OYHA 3GZNB 3RPQA 4JOMA 1IXSB 1TL8A 4R1HA 3B6AA 5M3MJ 2JVGA 1OCOH 2BW3A 1T39A 1ONVA 2BE5F 3PNVA 1B1BA 3F8CA 1ETOA 1WH5A 3S3NA 5M5WJ 1K61A 4UNOA 4HRIA 4P96A 4HF2A 2STTA 3LQQA 3RQ4A 2Z3YA 3IC7A 5F27A 1WJCA 4FE4A 5ICFA 2LH9A 3KP2A 4D0PA 1FSEA 5F6FA 3COAC 2PMZN 2JK3A 3F3XA 3S8PA 3BDDA 2KIUA 2JSPA 3CCLI 2COMA 2KIMA 2Z2SB 1HDDC 1FOYA 4NB5A 1W36D 2IJLA 1MBFA 2FD5A 2XPWA 3HZJA 4A6DA 3E6CC 1A35A 2OC6A 1ETVA 2VUMJ 2Y30A 4F52A 3MKZA 5F0HA 2FUG2 1Q1VA 2E71A 3TOAA 5D5UB 3W3CA 1QA6A 4Z2YA 1BM9A 3JR9A 3GTJJ 3ZR8X 4IO9F 1W7PA 1R5ID 3IWFA 2ZSHB 5FFXA 1RIOH 2KRFA 1BIAA 5CVUA 4B8XA 3WHBA 1ZQ3P 3JRHA 2HYJA 5LFAA 3QU6A 4I98B 1TW3A 2BXZA 2ESNA 1XTAA 3I58A 4CH7A 3ABMH 3HGYA 4XL9A 5DDGA 5C4XJ 1ODDA 4WCGA 1ZG3A 2WAFA 3H9QA 3P9CA 4XN3A 2HOAA 2W57A 2FBIA 2L9NA 1SEUA 2JMWA 1RUNA 5E1XA 1YW8A 1X1DA 5HDKA 1ITYA 2K9NA 2DYSH 1TWAJ 4A3FJ 4RBOA 1MNMC 2VB6A 5DD4A 1Z7LA 1I1GA 1RC9A 4FE7A 3WTSC 4PGGA 2Q0OA 2M45A 2G9WA 3BWGA 3CP8A 4RGSA 4LK0F 2EWNA 2QA4I 2JA6J 4BKXA 5L3GA 4RDUA 1UCRA 3LSRA 1D5VA 2Y9YA 2QSHX 3L2VA 1V4RA 2X6YA 3RKYA 1H9TA 1RNLA 1HLVA 1DUXC 2JUGA 5L3BA 1ZTRA 2DN0A 2P5KA 3KE2A 1JHFA 1JUPA 1Z05A 2Y48A 4N4OB 4DYQA 5BMZA 1VQ5I 2P0WA 3WGGA 1KQ8A 4XK4A 4QLCU 2W84A 4Y52J 3VFZA 3W6VA 4NUBA 5F1JA 4ZZDA 1LDKB 1XSVA 1R71A 1W36C 5DTDA 2MGQA 3HG9A 5JI6A 2FBHA 3OYAA 2PLYA 4CUGA 2K3FA 1KQ9A 4A3LJ 4KA4A 2A68F 2EZHA 4HLYA 3OYIA 2B7EA 3FKIJ 1OCZH 3GX4X 5M5YJ 3RPUA 4OINF 1S29A 2Z9OA 4D7MA 4KFCA 3E6MA 2K40A 1H0MA 4XONA 3ULQB 3W6JB 5JFRA 2KKOA 1Z6TA 3DEWA 3F0CA 5IP6A 4OAZA 2E35A 3ZP5A 4BGDA 4FETA 4MQVA 5KAIC 2OV7A 4RB2C 1PP8F 2VE8A 3QRFF 2QWWA 3N4MA 2JWTA 5GPCA 3ZOBA 2WB1A 5EGOB 2WTEA 2I8DA 2MFZA 3PSFA 3OY9A 4LMYA 1FP2A 2ZCWA 1GVDA 4BNCA 4ZC3A 3F8NA 4G9YA 1MSEC 2XKPA 3HC7A 4U7DA 1USTA 1LNWA 3GBGA 3I4MJ 1BW6A 4QPOA 5JVTA 4YFXF 5FD5A 2L4MA 3BG3A 3LMMA 5HODA 3DBLB 2EZIA 5J4YA 4AVZA 2O3FA 2KHMA 2M87A 1YW9A 5CJ9A 4ZH4F 3H0DA 3TOBA 1VQ7I 4TV7A 2R7TA 1KYZA 3E5QA 1MH4A 4EJWA 1S7OA 5E79C 2Y0SA 4KICA 1P4WA 3H5NA 4DZJA 2VKVA 4FASD 4MQ9F 2R92J 2DQLA 2LSOA 3BQZA 3BJAA 2LVSA 4S0HB 1PUFA 4M3BA 4CCJA 3BJOA 2NAZA 2JPBA 1DQUA 5BS6A 2QBYA 3GFJA 4DQ2A 4JBAA 4HF1A 4HYEA 3ZMVA 4PCQA 4XN0A 1ETXA 4DBRA 3OR1C 4ASNA 4YFKF 4A3KJ 1KA8A 2GOXB 4RGUA 3OYKA 1N75A 1UHWA 3V42A 4C2UA 1TWGJ 2EIJH 3DKXA 1VQ9I 1PUEE 3VYTB 2E60A 1QHHD 2LR8A 1WRJA 2IGMA 4JK1X 1W7PB 2BY1A 3U2RA 1YE9A 3IL2A 3JRFA 3DF8A 1QQIA 1SANA 3A4CA 4ON0A 2HOTA 3HTSB 3QOEA 4QTRA 2EV5A 3BJ6A 3OYEA 3HEFA 2W4SA 1PVEA 1XD7A 2CG4A 4CO8A 1K4SA 1JGGA 4XKWA 5L3DA 1WI9A 1ZGWA 3H92A 1SMTA 1MGTA 2HYGD 3M8JA 4HX4A 4I0AA 1MDMB 2WA0A 1LVAA 5EEGA 3G1MA 1K78A 4I01A 2R5ZA 4A3CJ 3CD6I 2KRCA 4HLXA 4A3BJ 2P5VA 1F9NA 1OCCH 2AXTC 2YX7A 3IRQA 2Y0SN 4PDKA 3GFIA 3S93A 1BBYA 3SZTA 1LDDA 3QYBA 1T6SA 3GLLA 1ZHFA 2IAIA 4FCYA 1LKXA 1X2MA 2YR2A 5ILSA 4A3GJ 1IRZA 1BIBA 3K4CA 4KNYA 1OCPA 4GRIA 2LDUA 2QM3A 4J19A 5LGNA 2FEZA 1U9OA 3HOXJ 2RAEA 1DDNA 3M4OJ 2VJIA 4U7BA 1S9HA 3HSEA 5TJJA 4XQFA 2P7CB 1A5JA 1TT5B 4BAYA 3LSMA 4WXCA 4I76A 1MIJA 3ZQCA 1KGSA 1YIOA 2OCEA 1WJBA 4O6JA 2LD5A 1F43A 3NQOA 1MMAA 4D9JA 1ZR4A 1Y0NA 3U1KA 4Y7NJ 1SD7A 3TDZC 1YRNB 2P7VB 1QHGA 3LSTA 3E97A 3ML6A 1R4NB 4ESBA 2KLOA 2GLOA 3JRCA 1Y56A 2X6XA 4XRSG 3JW4A 4LGWA 3CUQB 3HJEA 3G4SI 5CQEA 2MD5A 1IZ1A 3IWZA 3W2AA 4KYWA 5HDGA 4CYDA 4CGZA 4HV6A 1XCVA 3SEQA 5JHUA 2DQRA 3AG4H 5IOYA 3LSKA 3KP6A 1ZLJA 2CJJA 1TWHJ 3SJMA 2AQEA 1HKQA 3BG7A 3M8EA 4CZCA 1B8IB 2QKLB 1FMVA 3KLOA 2VIXA 1D8JA 2RC4A 4M74A 3DU5A 3QPTA 2CQ7A 4BQOA 1X3UA 1FOKA 3E6DA 4YIFA 1G3YA 2MSYA 1MMDA 1SD5A 2RN7A 1REPC 5FRMA 4B4CA 2GXBA 5L3CA 4DYRA 5H6QA 1YRNA 2CQXA 2ZJPF 2HVQA 3IUOA 3PFIA 3FM5A 3LA7A 1B9NA 3WE2A 2X1CA 4UXNA 5HLGA 2GAUA 2WBMA 4PZJA 2V9VA 5J1RA 2DA4A 4EM2A 2ISYA 3HM5A 1HKTA 3T0YA 2H6CA 2GM4A 1R00A 5A2QK 1D1BA 4Y3OA 3KZYA 1U2WA 1Y1WJ 4EGYA 1NTCA 2DLLA 4KT6A 3BCAA 3R61A 1W0UA 2NVXJ 3O3KA 1ETWA 1UZCA 1Z7UA 2LKXA 2A5YB 3KEYA 2M30A 3R6SA 2GBYA 3WTVC 4HOBA 3K70C 1Z67A 3ROUA 4EJOA 2R4GA 2DPDA 2BV6A 3CP2A 3OR2C 1ZREA 1T98A 2WY8Q 5F1RA 2XASA 1P4AA 3K4NA 4MIMA 2OAZA 4F55A 1MZBA 2L4AA 4BHBA 5FKLA 1ON1A 2KJCA 2XF6A 3PNYA 4RB3C 2HXOA 3KCCA 2CW0F 3M8FA 2K4JA 2DA5A 1F36A 4JX4A 2VN2A 2ME6A 4L5IA 3S1MJ 2XAQA 1WJEA 4XICA 2F2EA 3S2WA 4BXFA 3K7AJ 4A3JJ 4LB5A 2VJ5A 4B1RA 4XIDA 1SVOA 4ZDOA 5DCMB 3R60A 1U5TB 2EIKH 5EZHA 3HDDA 2EFQA 3LAPA 3BCBA 1VQPI 3EUAA 2KIQA 3FXQA 1GXQA 4CCLA 4PK4A 4XSXF 3RPUD 2HDDA 1YJWI 2F5VA 4XLAA 1NK2P 5DM7F 1PUFB 5FGMA 3DP7A 5EG0A 3M07A 4U0VA 3V7RA 1G3WA 1FT9A 1IN7A 2A5WA 5F0FA 2OPTA 4ANJA 4ZTFA 4C30A 4IKFA 2FJ1A 4XKBA 3RKWA 3C2GA 4CHUA 3L2CA 1D0YA 1J0RA 2X9DA 4MHGA 5GAEJ 3OMYA 3GWZA 3ZN1A 4HNTA 3VB2A 2R7VA 2QLZA 1IV8A 3FWEA 2CW8A 2XROA 3LA3A 2O03A 1FX7A 1BOAA 3DXJF 2DT6A 3PUFA 1R1TA 3R0AA 4Q48A 2QVOA 2IT0A 4BDZA 2HR3A 4IOAF 3F8BA 3RI4A 2CV0A 1USSA 4II2A 2L9RA 1FTZA 3MZYA 1BR4A 2IBDA 4HDUA 2XGDA 2VOOA 5H6RA 2ZJ2A 3DEUA 1DP3A 3LFUA 4IHVA 2DFFA 1M1EB 4HZFA 2XGCA 1G2HA 1K6OA 2JA5J 4LB6B 3OS0A 4G7ZF 2I5UA 4OIPF 1EKEA 1MW7A 3S17J 2X6OA 4P1WA 5HS8A 4WK8F 2MLKA 1BC8C 5KK1A 1W1WE 4L0ZB 1ZG5A 2LKSA 5GAHJ 2EPFA 2R3SA 3CUQC 4BXXJ 3EQLF 3Q0WA 2M3AA 3WGHA 3MMYB 3PJRA 3REOA 5JHFA 3OIOA 2VT2A 4YELA 5GPAA 2XF5A 2IXSA 4HG2A 5FB2A 5JLWA 4PUSA 4MO7A 4MFEA 3H36A 1RRJA 2CH0A 3CCUI 4IPAA 2D1VA 1UB9A 4R8HA 5CPRB 1MBJA 1YHQI 2HKOA 2ETHA 3DBRB 4HNUA 4I6ZA 3PQKA 1YJ9I 1N78A 1VNDA 3AG1H 3O2PE 3H9JA 1YQAA 2E7XA 3BR1A 3Q9SA 4NHJA 4PGHA 3C2BA 3MN2A 5D5WB 3MAJA 1KQ0A 1RPWA 4HSRA 3HPHA 4AD9A 1W5SA 3F22A 5IOZA 4B3AA 1UELB 4DW6A 3FZVA 2FE3A 2KRHA 4MEYF 3FKJA 3JRAA 4KN7X 4E7LA 4ZTJA 1OPCA 5LHHA 2DA7A 4F93B 4XORA 2V6CA 1R58A 1SC7A 1QPIA 1XSDA 4BL0B 3HL2A 2KZGA 4U88A 1DGRM 4EM0B 4XRMA 3CDIA 2HPMA 3BG6A 5ILVA 1G3SA 1VQ4I 2W25A 2CYYA 5FFZA 1AA7A 3TKYA 3HBLA 3AG2H 2QQBA 2NXNB 1HC8A 5IP7J 3WU1B 4UUSB 1SAUA 4HQEA 4F7ZA 4HF0A 2D45A 4HAMA 1E3OC 1WGXA 2XDVA 3HTUA 1O57A 5D8LB 3DPUA 2UXXA 2V26A 3AG3H 2TCTA 2VKEA 5LEJA 4WX9A 4XMYA 4YIRX 5CVJA 3CC4I 2JZYA 5E1ZB 3LSGA 1U3EM 4XLPF 2ZXHA 3PFYA 3CCQI 2YSRA 5HLIA 1JKOC 3GTOJ 2F4IA 3FXLA 5KVRA 3RTRA 3FK7A 3G2BA 3GTKJ 1OYYA 1I3AA 2EFPA 4A0ZA 2CWEA 2ZKZA 1TBXA 2IA1A 2R7SA 3DV8A 2ADUA 2KP6A 2DDAA 1JE8A 1T0FC 4I99C 2PMZA 3BR6A 3CJTB 3I54A 2E1MB 4MEXF 1J9IA 3C7JA 2STWA 5K5OA 3W2WA 3K1NA 4C2MJ 2ZMEC 1R9TJ 3HRMA 3QOPA 3GTLJ 1C0WA 4IX7A 3ZQLA 2YX4A 1VQ6I 3F23A 3ZMDA 3EDPA 2LY1A 2WC2A 2NS7A 1GV2A 2VC1A 3CDHA 2N8GA 4HV5A 3M7GA 2JN6A 3T8TA 3FXUA 4WWCA 2VOPA 3WGIA 3ONQA 4XLFA 4F91B 3A1YA 4N4NB 2A3SA 1RZ4A 2F4OB 3CLQA 1YO5C 2ID3A 1U8RA 1H8AC 2LBFA 1V5GA 2XRNA 3FBIB 4A6EA 4E7SA 4F3QA 2K85A 2R7FA 3JTHA 1PDNC 2BW3B 2ELHA 2GQQA 4NNJA 4A3MJ 4RAGA 5AONA 1Z21A 1O4XA 1B72B 1YI2I 1WFXA 5FKMA 3MWMA 4CCMA 1DP7P 3P7NA 3F6OA 4XR6A 3F8MA 1WZ2A 3MZ8A 1OYWA 4PSXA 5B1BH 3OYJA 2E1NA 4EEFG 2V7FA 2KFDA 2LF8A 4HX7A 3VYRB 1R36A 4A3IJ 1MH3A 3KX2A 3L2UA 4GFBA 5E18F 3KZZA 3L00A 4ZZLA 2O8KA 1R5HA 2RVCA 4KIGA 3RKXA 2OBPA 3DU6A 3TQNA 1SFXA 3HSRA 4KT5C 1JI8A 2HPIA 2FX0A 1AHDP 2CQNA 2C6YA 3HKZA 3WTYC 1XPXA 2ELKA 4E70A 5HNFA 2FNPA 5CQGA 5FLXZ 3WU0A 2ZFWA 5AIQA 4IL6C 2RQPA 1OISA 3IKVA 1WJ5A 2HU9A 3DKWA 4A3EJ 2Q1ZB 4N9HA 1VQ8I 1BL0A 2P81A 1EA3A 1QO0D 1NH3A 5FLMJ 1F4KA 1FTTA 2IGKA 1X1BA 1W5TA 2LC2A 3ZQGA 1BR1A 3GCMA 4B3XA 1EF4A 1LVKA 1BOBA 3WG7H 3CO6C 2W85A 2OTLI 2V1DA 2G7UA 3BQYA 1P92A 2NOJB 4BJ6C 1ZRCA 4HPQA 3LSIA 4A93J 3CUQA 3WHCA 2ZSIB 5LRRA 1ZK8A 3X2QH 1JKRC 2F5FA 4A0XA 2LK2A 5LLQA 1I27A 2E7WA 2E1CA 3BR3A 4LIVA 3CC2I 4C9YA 1LB2A 3OYCA 1DPRA 2IEKA 2KZVA 2KIFA 4LLLA 3HIFA 2NVTJ 5J47A 3AL0B 5L3EA 2F6CA 2VONA 3J81Z 3ZN0A 1IXCA 4OMYA 4XM3A 1SVLA 3SFZA 2BYVE 2IS2A 2JA2A 1KONA 3BTJA 3DTEA 5J6XA 2K9SA 3EYIA 4KJZA 4BHPA 1MBHA 5IT9Z 1YW7A 3TGNA 3L2QA 5DV5A 5D4RA 2P8TA 3PM1A 1J75A 1TNTA 1X1PA 5ICCA 2DTRA 1SFOJ 2M34A 2H1KA 1POGA 4RA2A 4LFUA 1GUUA 5D5XB 4RM2A 2NVQJ 2LTPA 4J01A 3KP3A 4EVIA 3FXJA 3LWFA 2EFOA 3U1DA 4DYCA 4GYGA 4P9FA 2A6EF 4BQAA 3FIWA 5J8FA 3BOQA 1XS9A 5DS9A 3NAUA 5ED4A 1T2KA 1I1SA 2E2JJ 5LEKA 3I71A 3F8FA 4D5CA 2M8EA 2VKDA 3KP5A 2DMTA 1IG7A 1Y1VJ 3AKZA 3C1DA 2CFXA 5DUIA 2XRLA 4II3A 1FYKA 3FF5A 1LFPA 5LGUA 4IHXA 3HGGA 2LKPA 3K9TA 3TMOA 3B6CA 1R22A 2HZDA 3RDIA 2VBZA 1BN5A 1JTXA 1OYIA 2LOOA 1IRGA 2QCOA 4RGXA 5E3LA 3WG9A 2DA3A 4HDVA 4LG0A 2NYXA 2OU2A 1J09A 2GA1A 3DLAA 1ETQA 1XN7A 2DMUA 2EINH 2MABA 4BQNA 3CF5F 1VQNI 1HA8A 3V8JA 4ZYDA 5JVGF 5D6EA 4HW0A 5TGTA 2DK5A 4H0EA 2J5OA 3CCEI 2HXIA 1HW5A 4D7NA 5GTIC 3M3YJ 4G7OF 1NG6A 4FQGA 2W00A 3UR3C 1X58A 2CRGA 3HPGA 5FD6A 3Q5FA 1HXDA 1X2NA 1P9QC 2WAEA 4S04A 3I64A 4AYBA 1F1ZA 3A2KA 2ESHA 1TWFJ 2EH3A 3Q3SA 4K2EA 3I53A 5GTHC 4I0BA 2JA7J 4M3GA 3SDBA 2H8WA 1B4AA 3IAS2 1D3YA 1RETA 3K6GA 3ERMA 2HNHA 1VI0A 2MLGA 3JRGA 3IV5A 2LYCA 2K5CA 3ABUA 2Z5UA 4BS9A 4OIOF 1SD4A 5D4SA 4L0YB 3MEXA 2PBIA 2CV2A 5IT3A 3OYBA 3HOUJ 4AIKA 2D2WA 2HGCA 3D0SA 5CYVA 3JRBA 1WCMJ 3I59A 4UHTA 3QAHA 2R7WA 2HEOA 3PO3J 2BY3A 2XV4S 4FX0A 1YOVB 3R0JA 2QKMB 1JXSA 2L7KA 3WODF 4GCVA 3A0BC 2VLAA 4M6VA 1YITI 2VPLA 4XBFA 3O6BB 3QP6A 2LF7A 4EATA 1IF1A 4IF4A 1FBQA 3JSPA 2QYOA 4KIBA 3LOCA 3BROA 3BY6A 2EV6A 3MCZA 4UB6C 3IAM2 2R5YA 2QSGX 1ZRDA 3PIOF 4P9UA 1ZARA 1S7AA 3V7SA 3TW7A 1LJ9A 3VYUB 1IDYA 2HQNA 2JQ7A 1UHSA 2TDXA 3QODA 1FPQA 4V2GA 3RCOA 3J80K 3GF2A 4EGZA 2FA5A 5JR3A 3S1RJ 1XG1A 4U0WA 3QWLA 4OU0A 3ZPLA 4PJJA 1Y8QB 1EH7A 2CUEA 2XF7A 3BTCA 2LY9A 3RJPA 2AXLA 4IZZA 4PJLA 4YG2F 1B9MA 2PX9A 1XGNA 1VQMI 1QZZA 2OJED 3VWBA 3N05A 2DOAA 1BC7C 3P9KA 2M7BA 3K4JA 2Z99A 3HRUA 3GTQJ 2V1NA 2VE9A 3FMQA 1LEAA 3GFLA 2R7UA 2OD5A 2EV0A 3CESA 1XDSA 2K9LA 2QGUA 2IS6A 2VQGA 1MJBA 1FOWA 3M1CA 4Y17A 2QZ8A 2XAGA 1A31A 3OS1A 1TNSA 3B73A 3IKTA 2HOEA 2VJJA 1IGNA 2M0MA 4AIJA 2VBXA 2YS9A 4AYBN 1HW1A 3I9V2 5LBQA 5IYDJ 3OOPA 3DLLF 5BPIA 1K83J 2DJNA 2DOFA 4G12A 4BBRJ 3A01A 3ECOA 1B59A 1LFBA 5L3FA 3IH2A 4L18B 4CZZA 1WI3A 2VQHA 1FZPB 2EK5A 3TP3A 1OKRA 2Q2EB 4GYIA 1FNNA 3S14J 3GZ6A 4C3IJ 2DT5A 3GTGJ 2X1EA 4Y15A 2FQ4A 1IW7F 1XSXA 2BXYA 2R7XA 2XPVA 3K4MA 4PFPA 1IRFA 2CS3A 2V9PA 3V7CA 1WJFA 3ESWB 3AFHA 2XHKA 3E7LA 1RESA 4AC0A 4UV9A 4HBLA 5IT9K 3RIRA 3WU2C 1A6IA 4XNFA 4OIRF 2PMHA 5CLSA 2MH9A 3CMAI 1J59A 1QGPA 3CLOA 2E5NA 4ZYEA 1QZYA 1XMXA 2M5WA 4ESFA 3DFGA 2EJRA 3HOZJ 4B43A 4IHTA 3JCUC 1VQLI 3KETA 1Z9CA 2L3DA 2KT0A 5CVVA 3K4BA 2DAOA 1Q1HA 2W7NA 1Z91A 5IYBJ 2B0LA 3GXOA 1SFKA 1HCRA 2DDBA 4RS8A 5E8IA 2XKOA 1MJ9A 4GDFA 1SVMA 1U5TC 3F72A 4CCKA 4XRSA 2PEXA 1K79A 1JJ8C 2IW5A 4AM3A 4IXAA 1Y39A 3DBHB 2A6TA 5DEQA 2QF7A 3BPVA 4PJMA 4KUMA 2CW7A 4EV0A 3T1BA 1SMYF 2FOKA 3SQNA 1ZAOA 3CCYA 3WTWC 3OSGA 1VQOI 1YG2A 5FROA 4W97A 1EJ9A 1P6RA 2R7RA 1AU7A 2LRDA 1TW2A 5D6FA 2EB7A 3CCMI 4M9XA 4LIUA 2M0CA 1A6QA 4ZYHA 2LBFB 5IP9J 4LG0B 3K70D 3ZQQA 3LA2A 4XOPA 2GOMA 4YFNF 4O3MA 2IP2A 2ZJQF 1H89C 1TP4A 3LSJA 4I2OA 2HS5A 3U21A 4BEHA 3T5XA 5DYMA 2GXGA 2DCEA 1XDUA 2ZO4A 4KDPA 2XGXA 2ZMEA 4RM3A 5CVIA 3A0HC 3ELKA 1FLIA 2PMUA 3DCFA 4BBSJ 2MG4A 1BW5A 1JUMA 3OS2A 3M1EA 5HDNA 3FISA 4IQJA 3K69A 1BA5A 2L2OA 2OQRA 3E3VA 4A3DJ 3I55I 5ICEA 3KEOA 3HB9A 1I3QJ 4FHTA 2BVMA 5DD8A 2K02A 2QEXI 1BJAA 3I0TA 4HEA2 2CFOA 2DOEA 5GP9A 2ZXJA 1EV7A 2M4KA 4JP0A 4E6KG 4A12A 1AKHB 3ECHA 4CYCB 1UG0A 5E3MA 2R7DA 3HXLA 3SHFA 4E7HA 2R5ZB 3BZKA 2P6TA 5CVRA 3H5RA 1FEXA 1T56A 3BTLA 2DTZA 3OYGA 3G1OA 2F48A 1ZGAA 2GWRA 4PJNA 3BZ6A 3L2WA 1OR7A 3CCVI 1QVTA 3SXYA 2DU9A 2ZNYA 3QPHA 4JX5A 4IRHA 1XC5A 3AAFA 1E3PA 2HWVA 2XUBA 1B6AA 3G6EI 3PNTA 2B9SA 2MBFA 3LAJA 4O5VA 3JAMZ 3ZMZA 1R5GA 4DBQA 4XLNF 3D5RC 1VQKI 1ZH5A 1DU6A 4N0BA 2EBIA 2V79A 2W48A 4FTHA 3N97A 1FIPA 2E1OA 2MC4A 4AU7A 4OIQF 1AKHA 2V6EA 2FU4A 4GXOA 2DK8A 1V55H 4I7HA 3U9GA 3G73A 4WXDA 1T08B 1QRYA 5HLTA 3F9KA 2BZTA 2M7AA 3GO5A 2O8XA 5EEHA 3CZ6A 2VBYA 4CICA 4C3JJ 1XGMA 1SD6A 3A03A 2LREA 2X0LA 1HDPA 6PAXA 1G3TA 1G8XA 4UY8I 3ASOH 3EUHC 3KEQA 4H4KC 4Y4RA 2O5RA 3H5AA 5ICGA 3RZOJ 2IA0A 3FK6A 2PJPA 1MNEA 2KDOA 3DTIA 3CMEI 1HF0A 1IN4A 3K10A 2I10A 4LOCA 1S6LA 2FRHA 3HOYJ 2ELJA 1X1AA 2ZXIA 3S1QJ 1IDZA 1T95A 1S5LC 2VXDA 2ZFUA 4ABZA 1FSHA 3K0LA 5C4JJ 1OMIA 3DQVC 2YPRA 5E20A 1XGOA 3LQRA 2J5PA 4IEJA 1TTYA 1ON2A 5FJ8J 5K5QA 5EJCA 2A07F 3SZPA 2DYRH 3NWSA 2OZUA 2ME0A 3FDYA 4A5NA 2EA4A 2RGVA 2W24A 1STZA 5K7FA 4CXFA 2ZC2A 1ERDA 2V1UA 3S2HJ 2R7OA 2QQAA 1RR8C 4CDGA 3P9IA 4E7KA 2LMDA 4UVBA 3IHUA 1UMQA 2FMYA 4G7HF 3S3OA 5HVQC 3JAMK 5IY5H 1N25A 2QQ8A 2DMPA 2L7FP 4P5OA 3OYMA 1P7JA 4A69C 4AWXB 3MKYB 3W2VA 3DPLC 1PJRA 5J8CA 2UXNA 3LFKA 1KYWA 2A05A 1SFUA 1P7IA 2VXZA 5KCMA 4KMFA 1KU2A 4RGRA 3GVAA 5FO5A 3HOVJ 4YEJA 3QPSA 3JRDA 3JREA 3AL0C 3K1PA 1X4OA 2LY2A 3PO2J 2VT3A 1V5FA 3F6VA 1XB4A 1EH6A 1FC3A 1Y6IA 1IO2A 1DU0A 4ZJZA 1LPQA 1R7JA 4ENNA 2M2EA 4C3HJ 2VASA 3BTIA 3HHHA 3J81K 1QZEA 4BXUA 4XRFA 1T38A 2E5ZA 4U87A 2CU7A 3E5UA 4RAYA 1L3LA 3HUGB 1RUOA 4X6AJ 2DT7B 1FMWA 1ENHA 1YIJI 2B63J 3UNGC 4XLHA 1K6YA 5FRNA 4IHYA 2KQRA 1G4DA 5FLXK 4RB1A 2L9SA 1MSFC 2ZXWH 4UUSA 4AIHA 2RKHA 4AIDA 2Z1DA 1MBGA 3Q0VA 2EIMH 2LG4A 2QUFA 3OIQA 1RI7A 3H9GA 2FMLA 2CUZA 1S3JA 2K27A 2HVSA 3RSNA 2G7HA 2H94A 4YIIA 4DOZA 1D0ZA 3WE3A 1FY7A 3G71I 1ETKA 2VQLA 2RNGA 3Q9VA 4WF2A 2E34A 1UAAA 4RMNA 3K4KA 4X1EA 1GXPA 4BJ5C 4MTDA 1D5YA 3CDLA 3W6KB 1TC3C 3KPHA 1ZRFA 3MKLA 1O7LA 4Q5SF 1W5CC 3H0GJ 2BVLA 2UUZA 1IC8A 4ESJA 2F5EA 2M4GA 2ZJRF 3KZIC 5BQTA 1I5ZA 3K2ZA 2NRAC 1ZR2A 4ZDPA 2DFHA 2MW8A 1JKQC 5FLVA 2VC0A 1IN8A 2H27A 3HSFA 5LGTA 3Q0UA 4CSWA 3ZQ7A 5TISC 4B09A 1YLFA 1X19A 2KMUA 2WADA 3HUGA 3P5JA 4XKVA 1J5YA 2JA8J 2R5YB 4DIQA 2ID6A 3I4PA 1ORKA 2O0YA 3S32A 1NHAA 2JRMA 2MD0A 4EJVA 3ZCOA 2EFNA 3ABKH 1LEBA 3CJQB 2TRTA 3H3VK 2FOWA 2DA1A 3IH3A 4M71A 1H9GA 5JLXA 1GDTA 4UVCA 2X4HA 4ENJA 4C2TA 1L0OC 1XMAA 2UV1A 4L5EA 1WQ2A 2CGPA 3J7AY 4W1UA 4QWQA 2H1LA 3DEEA 3TDUC 1GLNA 1Z3YA 2R93J 1AOYA 2L0KA 4QPQA 3SFIA 5H2FC 1MBEA 3WTUC 1R23A 3OOUA 1R1VA 4HNVA 3SDGA 4ETSA 5BPDA 3L7WA 2H09A 1MJAA 1MNDA 4OAYA 2LP0A 1UHMA 2HDWA 3OYFA 3NWTA 1OCRH 2CO5A 2KL4A 3RKQA 1T8IA 4XLEA 1O3QA 3MZHA 2QSFX 1X4PA 2PJRA 3GFMA 2O9LA 2XSJC 4PSWA 2BOLA 2BBYA 4M6YA 4M72A 1AWCA 2DMNA 3C3WA 3GUDA 4FX4A 4DGWB 3ZMUA 5HS7A 1KU3A 2X1DA 2QQ9A 2F5DA 1UFMA 3VYSB 3L09A 1EH8A 2A69F 5J3LA 3S15J 3KP4A 2PFBA 4R79A 1D8KA 2XAHA 3VODA 5C3EJ 1QNTA 3NRVA 3J80Z 3MKWB 1IAWA 2IS1A 4LLNA 3C2HA 4BU2A 2M1BA 4B44A 3V4GA 2L7MP 5LD2C 2GIVA 1UJ8A 2E36A 4OMZA 3ZMSA 5EZGA 1OQYA 2K9MA 3OIPA 1S72I 4M3FA 4MFDA 3OL3A 1TT0A 4Y33A 4D5FA 2IGNA 3I5UA 2XAFA 3RQIA 3GLXA 4UV8A 3A02A 3K2AA 4Z6YA 1TQIA 1Z3XA 1VZ0A 3B02A 5J40A 1MBKA 2AHQA 3LL7A 3S2DJ 4ITVA 5D5VB 2VQCA 4XKCA 2WAQA 4LG3A 4NC6A 4E7IA 2QENA 1E2XA 3TL4X 2MYSA 2W1OA 1YTYA 2E2HJ 1YFHA 1K4TA 1FYLA 2HTSA 4QIWN 4AUXA 2COBA 1MKMA 2M9HA 4KMUX 1HW2A 1YX5A 3NEUA 1PYVA 2Y75A 4E7JA 1LE8A 4F92B 2WWYA 2ZB9A 3BC8A 3TEDA 1W0TA 3S1NJ 3H1CA 2LNBA 3MQ0A 1RR7A 2L5QA 4JX6A 1J7KA 1JHHA 3GZ5A 5BOXA 3GTPJ 4HA8A 4NDLA 1Y0UA 1BJZA 2HKXA 3QU3A 2KJBA 4A0YA 1HSTA 4HSTA 3BLYA 3ZGKA 4LK1F 3EYYA 2L54A 5M3FJ 3HKZN 3UKGA 4IOCF 3OV8A 1HOMA 2Y9ZA 4DJAA 4U0YA 2E1MC 2DO7A 2A6HF 4HQMA 2WB1N 2MH2A 2XGEA 3CQZJ 4NBQA 2VODA 3KYCB 3FX3A 5D8KB 3OYDA 3V8LA 1H88C 3ASNH 1YS6A 2CQKA 4BH9A 3BPXA 5GADJ 3E0JB 3FMSA 2BGCA
chains in the Genus database with same CATH topology
1FBUA 2MC3A 4M73A 1TLHB 2P4WA 4EJTA 2IA2A 1CF7B 1HSJA 2QBYB 3GEZA 1FYMA 3ERED 2ZNZA 3V8KA 5E1WA 1P2FA 1F5TA 1J2XA 4WXHA 1S8NA 3L9FA 2A61A 2HYFA 2ZMEB 2P5LC 2UWMA 4L9TA 1DPUA 2FNAA 1IUYA 3HOSA 2NNNA 5LRSA 2P6SA 4Y13A 4EMSA 1LQ1A 3ZMTA 1R1UA 2IVMA 4MGRA 1ZG1A 2JPCA 4EJUA 3FMRA 2RDPA 2FXAA 2Y0MA 1BI1A 1HBXG 2L02A 2RNJA 2K7LA 5HLHA 3GYHX 3M9AA 2O6GE 3HOTA 2HQRA 2OA4A 4A2UA 3MFKA 1WKMA 3J7AO 1ZGJA 4G6DA 3JTGA 4JQFA 2OQGA 1V3FA 4LLGF 4L5JA 4EQQA 1P4XA 2NS0A 1WSUA 3WTTC 2JT1A 3CO7C 1KU9A 2JRTA 3F21A 2NNYA 3DPTA 4BHCA 1GHCA 1FBSA 3TO7A 2K4BA 4RB0A 1QBJA 1XCBA 1K7AA 3HHGA 4G8XA 2MA3A 3HRSA 4I09A 4G6QA 1BI0A 1O7FA 1WWXA 3CJNA 4LJZF 5DCMA 2CSOA 2HTJA 2Q2EA 4I02A 4M9SA 5E17F 4P55A 2XVCA 2F5CA 4Q47A 3G3ZA 1K78B 5AIPA 3H3UA 2O61A 1U6GA 2H6BA 4XSZF 4L9VA 2V1XA 4FT8A 1SAXA 3RYPA 4IRIA 1TQPA 1O3RA 3VEPA 3E5XA 4IJAA 2DPUA 3R4KA 1I6XA 4KIFA 2ACJA 1W7PD 3K1MA 4AVPA 2HFHA 1SFEA 2XIGA 4MTEA 3I59B 3ISPA 2EA2A 4KN4X 3E6BA 5LHIA 3FM3A 5K1YA 3CUOA 4IRGA 1ZN2A 3VOEA 2DW4A 2L01A 3HYIA 2PN6A 5F64A 1ZLKA 5H20A 2PQ8A 2XAJA 1Z6RA 1IXRC 1MD0A 3H3ZA 1FWZA 1BI3A 2EFWA 1LDJA 1T0FA 2Q8KA 1JGSA 3ABTA 4L9JA 2WV0A 1BI2A 1ULYA 2DI3A 3KFWX 2DBBA 2FBKA 1YYVA 3EUHA 1ZYRF 4A5MA 1IN5A 5ILUA 4L9NA 1IN6A 4M6XA 3D5LA 2Z33A 4ENMA 1CF7A 4Q4ZF 1Z1DA 3FMSA 2UZKA 4MNUA 3EETA 1U78A 1U5TA 5DCFA 3WTXC 1PP7U 1YS7A 2JSCA 2JTVA 4EM1A 5TRDA 1A04A 3WTZA 2AS5F 1HKSA 4RAZA 2PI0A 4GGGA 4S05A 2D1HA 1TQMA 4UVAA 1MDMA 1XMKA 2ZBKA 2PG4A 5HOOA 2ISZA 3CTAA 1O3TA 3TO6A 2BEOA 1HQCA 5K5RA 3FHZA 2RV8A 3KLNA 4G94A 1O3SA 1QPMA 4BYYA 2K86A 2FSWA 2VBWA 2HZTA 3KP7A 4NQWA 4OOIA 3C18A 2DFIA 1XGSA 2GA2A 2OZ6A 3TO9A 1FP1D 3T8RA 2IRFG 4M9ZA 5HS9A 3JSOA 2IPQX 5ERIA 3FXRA 4ENKA 3HRTA 2FF4A 1KU7A 2YU3A 3BP8A 5E8GA 3GW2A 2GZWA 3IRRA 1CGPA 4IHSA 4ZYGA 5LHGA 1E17A 2FQ3A 1G6NA 3QP5A 1GVJA 4UUVA 1VTNC 4IVNA 4LD5A 3RYRA 4N9IA 5DUKA 1W4MA 2HDCA 4GO1A 4DNCA 5A2QZ 3PQJA 4HX8A 3RPQA 1IXSB 4R1HA 1T39A 1ONVA 2BE5F 1B1BA 3F8CA 4UNOA 4P96A 4HF2A 2STTA 3LQQA 2Z3YA 3IC7A 5ICFA 3KP2A 4D0PA 1FSEA 5F6FA 3COAC 3F3XA 3BDDA 2KIUA 2COMA 2KIMA 4NB5A 2IJLA 4A6DA 3E6CC 5D5UB 3TOAA 4Z2YA 1BM9A 1W7PA 3IWFA 5FFXA 1RIOH 2KRFA 1BIAA 5CVUA 4B8XA 3QU6A 4I98B 1TW3A 2ESNA 3I58A 5DDGA 1ODDA 4WCGA 1ZG3A 3P9CA 2W57A 2FBIA 1RUNA 5E1XA 1YW8A 5HDKA 5DD4A 1I1GA 3WTSC 4PGGA 2Q0OA 2M45A 2G9WA 3BWGA 4RGSA 4LK0F 2EWNA 5L3GA 1UCRA 1D5VA 1V4RA 3RKYA 1H9TA 1RNLA 1DUXC 5L3BA 2P5KA 3KE2A 1JHFA 1Z05A 2Y48A 5BMZA 3WGGA 1KQ8A 4QLCU 2W84A 3VFZA 4ZZDA 1LDKB 1XSVA 5JI6A 2FBHA 2PLYA 1KQ9A 4KA4A 2A68F 4HLYA 3GX4X 3RPUA 4OINF 1S29A 2Z9OA 4KFCA 3E6MA 1H0MA 3ULQB 3W6JB 5JFRA 2KKOA 1Z6TA 3ZP5A 4MQVA 4RB2C 1PP8F 2VE8A 3QRFF 2QWWA 3N4MA 2WTEA 4LMYA 1FP2A 2ZCWA 4BNCA 3F8NA 4G9YA 2XKPA 4U7DA 1USTA 1LNWA 5JVTA 4YFXF 5FD5A 2L4MA 2O3FA 2M87A 1YW9A 5CJ9A 4ZH4F 3TOBA 4TV7A 1KYZA 3E5QA 4EJWA 1S7OA 4KICA 1P4WA 4MQ9F 2DQLA 2LSOA 3BJAA 3BJOA 2NAZA 2JPBA 5BS6A 2QBYA 3GFJA 4DQ2A 4JBAA 4HF1A 4HYEA 3ZMVA 4PCQA 4YFKF 4ASNA 1KA8A 4RGUA 1UHWA 1PUEE 4JK1X 1WRJA 1W7PB 3IL2A 3U2RA 2VOPA 3DF8A 1QQIA 4ON0A 3HTSB 2EV5A 3BJ6A 1XD7A 2CG4A 4CO8A 5L3DA 1WI9A 3H92A 1SMTA 1MGTA 2HYGD 4HX4A 4I0AA 1MDMB 1LVAA 5EEGA 4I01A 4HLXA 2P5VA 1F9NA 2YX7A 3IRQA 4PDKA 3GFIA 1BBYA 3SZTA 1LDDA 1T6SA 1ZHFA 2YR2A 5ILSA 1BIBA 4KNYA 2LDUA 2QM3A 5LGNA 2FEZA 1DDNA 4U7BA 3HSEA 5TJJA 2P7CB 4BAYA 4WXCA 1KGSA 1YIOA 4O6JA 3NQOA 1SD7A 3TDZC 2P7VB 3LSTA 3E97A 3ML6A 4ESBA 3JW4A 4LGWA 3CUQB 2MD5A 1IZ1A 3IWZA 4KYWA 5HDGA 4CYDA 4CGZA 4HV6A 1XCVA 5JHUA 2DQRA 3KP6A 1ZLJA 1HKQA 3M8EA 3KLOA 1D8JA 2RC4A 4M74A 3QPTA 1X3UA 1FOKA 3E6DA 4YIFA 1G3YA 1SD5A 2RN7A 1REPC 2GXBA 5L3CA 5H6QA 3PFIA 3FM5A 3LA7A 1B9NA 3WE2A 4UXNA 5HLGA 2GAUA 4PZJA 2V9VA 4EM2A 2ISYA 1HKTA 3T0YA 2H6CA 1R00A 5A2QK 3KZYA 1U2WA 4EGYA 2DLLA 3R61A 3O3KA 1Z7UA 2A5YB 2M30A 3R6SA 3WTVC 4HOBA 3ROUA 4EJOA 2DPDA 2BV6A 1ZREA 1T98A 5F1RA 2XASA 1P4AA 2OAZA 1MZBA 2L4AA 4BHBA 1ON1A 2KJCA 4RB3C 3KCCA 2CW0F 3M8FA 2K4JA 2VN2A 4L5IA 2XAQA 2F2EA 3S2WA 4LB5A 5DCMB 3R60A 1U5TB 2EFQA 3LAPA 3FXQA 1GXQA 4XSXF 5FGMA 3DP7A 3V7RA 4U0VA 1G3WA 1FT9A 1IN7A 3RKWA 4CHUA 3L2CA 1J0RA 4MHGA 3GWZA 3ZN1A 3VB2A 2QLZA 3FWEA 2XROA 3LA3A 2O03A 1FX7A 1BOAA 3DXJF 3R0AA 1R1TA 4Q48A 2QVOA 2IT0A 2HR3A 3F8BA 3RI4A 1USSA 3MZYA 4HDUA 2VOOA 5H6RA 2ZJ2A 3DEUA 4HZFA 1K6OA 4LB6B 4G7ZF 4OIPF 4WK8F 5HS8A 2MLKA 1BC8C 5KK1A 4L0ZB 1ZG5A 2R3SA 3CUQC 3EQLF 3WGHA 3REOA 2VT2A 5FB2A 4IPAA 2D1VA 1UB9A 4R8HA 2HKOA 2ETHA 3PQKA 3O2PE 1YQAA 2E7XA 3Q9SA 4NHJA 4PGHA 5D5WB 3MAJA 1KQ0A 4AD9A 3F22A 1W5SA 3FZVA 2FE3A 4MEYF 4KN7X 1OPCA 5LHHA 2V6CA 1R58A 1XSDA 4U88A 4EM0B 5ILVA 1G3SA 2W25A 2CYYA 5FFZA 3TKYA 2QQBA 3WU1B 4HQEA 4F7ZA 4HF0A 2D45A 4HAMA 3HTUA 1O57A 5D8LB 2UXXA 5LEJA 4WX9A 5CVJA 2JZYA 5E1ZB 1U3EM 4XLPF 2YSRA 5HLIA 5KVRA 3RTRA 1OYYA 2EFPA 4A0ZA 2CWEA 2ZKZA 1TBXA 2IA1A 3DV8A 2ADUA 1JE8A 3I54A 4MEXF 1J9IA 3C7JA 2STWA 5K5OA 3K1NA 3HRMA 3QOPA 1C0WA 2YX4A 3F23A 3ZMDA 3EDPA 2WC2A 2VC1A 3CDHA 4HV5A 3M7GA 3T8TA 3FXUA 4WWCA 3WGIA 1YO5C 2A3SA 1RZ4A 1U8RA 2XRNA 4A6EA 2R7FA 3JTHA 1PDNC 2ELHA 2GQQA 5AONA 3MWMA 1DP7P 3P7NA 3F6OA 3F8MA 1OYWA 2E1NA 4HX7A 2LF8A 1R36A 5E18F 3KZZA 3L00A 4ZZLA 1R5HA 2RVCA 4KIGA 3RKXA 2OBPA 3TQNA 1SFXA 3HSRA 4KT5C 2C6YA 3WTYC 4E70A 2FNPA 5FLXZ 3WU0A 2ZFWA 5AIQA 2RQPA 3IKVA 3DKWA 4N9HA 1QO0D 1F4KA 1W5TA 3CO6C 2W85A 2V1DA 2G7UA 1P92A 1ZRCA 3CUQA 5LRRA 2F5FA 4A0XA 5LLQA 1I27A 2E7WA 2E1CA 1LB2A 1DPRA 2KIFA 4LLLA 3HIFA 5L3EA 2VONA 3J81Z 3ZN0A 1IXCA 4OMYA 3SFZA 2BYVE 5J6XA 3EYIA 5IT9Z 1YW7A 3TGNA 5D4RA 5DV5A 2P8TA 1J75A 1TNTA 5ICCA 2DTRA 4LFUA 5D5XB 3KP3A 4EVIA 3LWFA 2EFOA 3U1DA 4GYGA 4P9FA 2A6EF 4BQAA 5J8FA 3BOQA 5ED4A 1T2KA 1I1SA 5LEKA 3I71A 3F8FA 2M8EA 3KP5A 3C1DA 2CFXA 5DUIA 1FYKA 3FF5A 5LGUA 2LKPA 3K9TA 1R22A 3RDIA 2VBZA 1BN5A 1OYIA 1IRGA 4RGXA 3WG9A 4HDVA 4LG0A 2NYXA 2OU2A 2GA1A 1XN7A 3V8JA 4ZYDA 5D6EA 4HW0A 2DK5A 4H0EA 2J5OA 1HW5A 4G7OF 5FD6A 3Q5FA 1HXDA 4S04A 3I64A 1F1ZA 2ESHA 4K2EA 3I53A 4I0BA 1B4AA 1D3YA 2MLGA 3ABUA 2Z5UA 4OIOF 1SD4A 5D4SA 4L0YB 3MEXA 2PBIA 5IT3A 4AIKA 2D2WA 2HGCA 3D0SA 5CYVA 4UHTA 3I59A 2HEOA 3QAHA 2XV4S 4FX0A 3R0JA 1JXSA 3WODF 4GCVA 4XBFA 3O6BB 3QP6A 2LF7A 1IF1A 4IF4A 1FBQA 3JSPA 2QYOA 4KIBA 3BROA 3BY6A 2EV6A 3MCZA 1ZRDA 4P9UA 1ZARA 1S7AA 3V7SA 1LJ9A 2HQNA 2TDXA 1FPQA 3J80K 3GF2A 4EGZA 2FA5A 5JR3A 4U0WA 4OU0A 3ZPLA 1EH7A 3RJPA 2AXLA 4YG2F 1B9MA 1XGNA 1QZZA 1BC7C 3P9KA 2Z99A 3HRUA 2VE9A 3FMQA 1LEAA 3GFLA 2OD5A 2EV0A 1XDSA 1MJBA 4Y17A 2QZ8A 2XAGA 1TNSA 3B73A 3IKTA 2HOEA 4AIJA 2VBXA 1HW1A 5LBQA 3OOPA 5BPIA 1K78A 3ECOA 1B59A 5L3FA 4L18B 4CZZA 1FZPB 2EK5A 1OKRA 4GYIA 1FNNA 3GZ6A 2DT5A 4Y15A 1IW7F 1XSXA 1IRFA 3V7CA 2XHKA 4UV9A 4HBLA 5IT9K 3RIRA 4OIRF 2PMHA 5CLSA 2MH9A 1J59A 1QGPA 3CLOA 4ZYEA 1QZYA 2M5WA 4ESFA 3DFGA 2EJRA 4IHTA 3KETA 1Z9CA 2L3DA 5CVVA 2DAOA 1Q1HA 1Z91A 2B0LA 3GXOA 4RS8A 5E8IA 2XKOA 1MJ9A 1U5TC 3F72A 2PEXA 1K79A 2IW5A 4IXAA 5DEQA 3BPVA 4KUMA 4EV0A 3T1BA 1SMYF 2FOKA 3SQNA 1ZAOA 3WTWC 1YG2A 1P6RA 1TW2A 5D6FA 2EB7A 4M9XA 4ZYHA 4LG0B 3LA2A 4YFNF 4O3MA 2IP2A 4I2OA 2HS5A 3T5XA 5DYMA 2GXGA 1XDUA 2ZO4A 4KDPA 2XGXA 2ZMEA 5CVIA 3ELKA 1FLIA 2PMUA 3M1EA 5HDNA 3K69A 2OQRA 3E3VA 5ICEA 3KEOA 4FHTA 5DD8A 2K02A 1BJAA 3I0TA 2ZXJA 1EV7A 4A12A 3ECHA 2R7DA 3SHFA 2P6TA 5CVRA 1ZGAA 2GWRA 3BZ6A 1OR7A 3SXYA 2DU9A 2ZNYA 3QPHA 4IRHA 3AAFA 2HWVA 2XUBA 1B6AA 2MBFA 3LAJA 4O5VA 3JAMZ 3ZMZA 1R5GA 4XLNF 1ZH5A 4N0BA 2V79A 3N97A 4OIQF 2FU4A 4GXOA 2DK8A 3U9GA 3G73A 4I7HA 4WXDA 3GO5A 2O8XA 5EEHA 2VBYA 4CICA 1XGMA 1SD6A 2X0LA 6PAXA 1G3TA 3KEQA 5ICGA 2IA0A 2PJPA 1IN4A 1S6LA 2FRHA 1FSHA 3K0LA 1OMIA 3DQVC 2YPRA 5E20A 1XGOA 3LQRA 2J5PA 1TTYA 1ON2A 5K5QA 2A07F 3SZPA 2OZUA 4A5NA 2EA4A 2RGVA 2W24A 1STZA 4CXFA 2V1UA 2QQAA 4CDGA 3P9IA 4UVBA 3IHUA 2FMYA 4G7HF 5HVQC 3JAMK 4P5OA 4AWXB 3DPLC 5J8CA 2UXNA 3LFKA 1KYWA 1SFUA 2VXZA 4KMFA 1KU2A 4RGRA 3GVAA 5FO5A 3K1PA 2VT3A 3F6VA 1XB4A 1EH6A 1FC3A 1R7JA 4ENNA 3J81K 3HHHA 4BXUA 4XRFA 1T38A 3E5UA 4RAYA 1L3LA 1RUOA 1G4DA 5FLXK 4RB1A 4AIHA 2RKHA 2QUFA 1RI7A 2FMLA 1S3JA 2K27A 2G7HA 2H94A 4YIIA 3WE3A 1FY7A 3Q9VA 4WF2A 1GXPA 4MTDA 3W6KB 1ZRFA 1O7LA 4Q5SF 4ESJA 2F5EA 5BQTA 1I5ZA 3K2ZA 2NRAC 2VC0A 1IN8A 2H27A 3HSFA 5LGTA 3ZQ7A 4B09A 1YLFA 3HUGA 1J5YA 3I4PA 2O0YA 1NHAA 4EJVA 2EFNA 1LEBA 4M71A 1H9GA 4UVCA 2X4HA 4ENJA 1L0OC 1XMAA 1WQ2A 2CGPA 4QWQA 3TDUC 1AOYA 3WTUC 1R23A 1R1VA 5BPDA 4ETSA 3L7WA 2H09A 1MJAA 1UHMA 2CO5A 1O3QA 3MZHA 3GFMA 2BBYA 4M6YA 4M72A 1AWCA 3C3WA 3GUDA 4FX4A 3ZMUA 5HS7A 1KU3A 2QQ9A 2F5DA 1UFMA 3L09A 1EH8A 2A69F 3KP4A 2PFBA 4R79A 1D8KA 2XAHA 3VODA 1QNTA 3NRVA 3J80Z 1IAWA 4LLNA 2M1BA 3V4GA 2GIVA 4OMZA 3ZMSA 3I5UA 2XAFA 3GLXA 4UV8A 1TQIA 3B02A 5D5VB 2QENA 1E2XA 1YTYA 1YFHA 1FYLA 2HTSA 1MKMA 1HW2A 4KMUX 3NEUA 2Y75A 2WWYA 3MQ0A 2LNBA 1J7KA 1JHHA 3GZ5A 5BOXA 4HA8A 1Y0UA 2HKXA 3QU3A 2KJBA 4A0YA 1HSTA 4LK1F 3EYYA 2L54A 3OV8A 4U0YA 2DO7A 2A6HF 4HQMA 2MH2A 2VODA 3FX3A 5D8KB 3V8LA 4BH9A 1YS6A 2CQKA 3BPXA 4BHPA 2BGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FBU A;  2MC3 A;  4M73 A;  1TLH B;  2P4W A;  4EJT A;  2IA2 A;  1CF7 B;  1HSJ A;  2QBY B;  3GEZ A;  1FYM A;  3ERE D;  2ZNZ A;  3V8K A;  5E1W A;  1P2F A;  1F5T A;  1J2X A;  4WXH A;  1S8N A;  3L9F A;  2A61 A;  2HYF A;  2ZME B;  2P5L C;  2UWM A;  4L9T A;  1DPU A;  2FNA A;  1IUY A;  3HOS A;  2NNN A;  5LRS A;  2P6S A;  4Y13 A;  4EMS A;  1LQ1 A;  3ZMT A;  1R1U A;  2IVM A;  4MGR A;  1ZG1 A;  2JPC A;  4EJU A;  3FMR A;  2RDP A;  2FXA A;  2Y0M A;  1BI1 A;  1HBX G;  2L02 A;  2RNJ A;  2K7L A;  5HLH A;  3GYH X;  3M9A A;  2O6G E;  3HOT A;  2HQR A;  2OA4 A;  4A2U A;  3MFK A;  1WKM A;  3J7A O;  1ZGJ A;  4G6D A;  3JTG A;  4JQF A;  2OQG A;  1V3F A;  4LLG F;  4L5J A;  4EQQ A;  1P4X A;  2NS0 A;  1WSU A;  3WTT C;  2JT1 A;  3CO7 C;  1KU9 A;  2JRT A;  3F21 A;  2NNY A;  3DPT A;  4BHC A;  1GHC A;  1FBS A;  3TO7 A;  2K4B A;  4RB0 A;  1QBJ A;  1XCB A;  1K7A A;  3HHG A;  4G8X A;  2MA3 A;  3HRS A;  4I09 A;  4G6Q A;  1BI0 A;  1O7F A;  1WWX A;  3CJN A;  4LJZ F;  5DCM A;  2CSO A;  2HTJ A;  2Q2E A;  4I02 A;  4M9S A;  5E17 F;  4P55 A;  2XVC A;  2F5C A;  4Q47 A;  3G3Z A;  1K78 B;  5AIP A;  3H3U A;  2O61 A;  1U6G A;  2H6B A;  4XSZ F;  4L9V A;  2V1X A;  4FT8 A;  1SAX A;  3RYP A;  4IRI A;  1TQP A;  1O3R A;  3VEP A;  3E5X A;  4IJA A;  2DPU A;  3R4K A;  1I6X A;  4KIF A;  2ACJ A;  1W7P D;  3K1M A;  4AVP A;  2HFH A;  1SFE A;  2XIG A;  4MTE A;  3I59 B;  3ISP A;  2EA2 A;  4KN4 X;  3E6B A;  5LHI A;  3FM3 A;  5K1Y A;  3CUO A;  4IRG A;  1ZN2 A;  3VOE A;  2DW4 A;  2L01 A;  3HYI A;  2PN6 A;  5F64 A;  1ZLK A;  5H20 A;  2PQ8 A;  2XAJ A;  1Z6R A;  1IXR C;  1MD0 A;  3H3Z A;  1FWZ A;  1BI3 A;  2EFW A;  1LDJ A;  1T0F A;  2Q8K A;  1JGS A;  3ABT A;  4L9J A;  2WV0 A;  1BI2 A;  1ULY A;  2DI3 A;  3KFW X;  2DBB A;  2FBK A;  1YYV A;  3EUH A;  1ZYR F;  4A5M A;  1IN5 A;  5ILU A;  4L9N A;  1IN6 A;  4M6X A;  3D5L A;  2Z33 A;  4ENM A;  1CF7 A;  4Q4Z F;  1Z1D A;  3FMS A;  2UZK A;  4MNU A;  3EET A;  1U78 A;  1U5T A;  5DCF A;  3WTX C;  1PP7 U;  1YS7 A;  2JSC A;  2JTV A;  4EM1 A;  5TRD A;  1A04 A;  3WTZ A;  2AS5 F;  1HKS A;  4RAZ A;  2PI0 A;  4GGG A;  4S05 A;  2D1H A;  1TQM A;  4UVA A;  1MDM A;  1XMK A;  2ZBK A;  2PG4 A;  5HOO A;  2ISZ A;  3CTA A;  1O3T A;  3TO6 A;  2BEO A;  1HQC A;  5K5R A;  3FHZ A;  2RV8 A;  3KLN A;  4G94 A;  1O3S A;  1QPM A;  4BYY A;  2K86 A;  2FSW A;  2VBW A;  2HZT A;  3KP7 A;  4NQW A;  4OOI A;  3C18 A;  2DFI A;  1XGS A;  2GA2 A;  2OZ6 A;  3TO9 A;  1FP1 D;  3T8R A;  2IRF G;  4M9Z A;  5HS9 A;  3JSO A;  2IPQ X;  5ERI A;  3FXR A;  4ENK A;  3HRT A;  2FF4 A;  1KU7 A;  2YU3 A;  3BP8 A;  5E8G A;  3GW2 A;  2GZW A;  3IRR A;  1CGP A;  4IHS A;  4ZYG A;  5LHG A;  1E17 A;  2FQ3 A;  1G6N A;  3QP5 A;  1GVJ A;  4UUV A;  1VTN C;  4IVN A;  4LD5 A;  3RYR A;  4N9I A;  5DUK A;  1W4M A;  2HDC A;  4GO1 A;  4DNC A;  5A2Q Z;  3PQJ A;  4HX8 A;  3RPQ A;  1IXS B;  4R1H A;  1T39 A;  1ONV A;  2BE5 F;  1B1B A;  3F8C A;  4UNO A;  4P96 A;  4HF2 A;  2STT A;  3LQQ A;  2Z3Y A;  3IC7 A;  5ICF A;  3KP2 A;  4D0P A;  1FSE A;  5F6F A;  3COA C;  3F3X A;  3BDD A;  2KIU A;  2COM A;  2KIM A;  4NB5 A;  2IJL A;  4A6D A;  3E6C C;  5D5U B;  3TOA A;  4Z2Y A;  1BM9 A;  1W7P A;  3IWF A;  5FFX A;  1RIO H;  2KRF A;  1BIA A;  5CVU A;  4B8X A;  3QU6 A;  4I98 B;  1TW3 A;  2ESN A;  3I58 A;  5DDG A;  1ODD A;  4WCG A;  1ZG3 A;  3P9C A;  2W57 A;  2FBI A;  1RUN A;  5E1X A;  1YW8 A;  5HDK A;  5DD4 A;  1I1G A;  3WTS C;  4PGG A;  2Q0O A;  2M45 A;  2G9W A;  3BWG A;  4RGS A;  4LK0 F;  2EWN A;  5L3G A;  1UCR A;  1D5V A;  1V4R A;  3RKY A;  1H9T A;  1RNL A;  1DUX C;  5L3B A;  2P5K A;  3KE2 A;  1JHF A;  1Z05 A;  2Y48 A;  5BMZ A;  3WGG A;  1KQ8 A;  4QLC U;  2W84 A;  3VFZ A;  4ZZD A;  1LDK B;  1XSV A;  5JI6 A;  2FBH A;  2PLY A;  1KQ9 A;  4KA4 A;  2A68 F;  4HLY A;  3GX4 X;  3RPU A;  4OIN F;  1S29 A;  2Z9O A;  4KFC A;  3E6M A;  1H0M A;  3ULQ B;  3W6J B;  5JFR A;  2KKO A;  1Z6T A;  3ZP5 A;  4MQV A;  4RB2 C;  1PP8 F;  2VE8 A;  3QRF F;  2QWW A;  3N4M A;  2WTE A;  4LMY A;  1FP2 A;  2ZCW A;  4BNC A;  3F8N A;  4G9Y A;  2XKP A;  4U7D A;  1UST A;  1LNW A;  5JVT A;  4YFX F;  5FD5 A;  2L4M A;  2O3F A;  2M87 A;  1YW9 A;  5CJ9 A;  4ZH4 F;  3TOB A;  4TV7 A;  1KYZ A;  3E5Q A;  4EJW A;  1S7O A;  4KIC A;  1P4W A;  4MQ9 F;  2DQL A;  2LSO A;  3BJA A;  3BJO A;  2NAZ A;  2JPB A;  5BS6 A;  2QBY A;  3GFJ A;  4DQ2 A;  4JBA A;  4HF1 A;  4HYE A;  3ZMV A;  4PCQ A;  4YFK F;  4ASN A;  1KA8 A;  4RGU A;  1UHW A;  1PUE E;  4JK1 X;  1WRJ A;  1W7P B;  3IL2 A;  3U2R A;  2VOP A;  3DF8 A;  1QQI A;  4ON0 A;  3HTS B;  2EV5 A;  3BJ6 A;  1XD7 A;  2CG4 A;  4CO8 A;  5L3D A;  1WI9 A;  3H92 A;  1SMT A;  1MGT A;  2HYG D;  4HX4 A;  4I0A A;  1MDM B;  1LVA A;  5EEG A;  4I01 A;  4HLX A;  2P5V A;  1F9N A;  2YX7 A;  3IRQ A;  4PDK A;  3GFI A;  1BBY A;  3SZT A;  1LDD A;  1T6S A;  1ZHF A;  2YR2 A;  5ILS A;  1BIB A;  4KNY A;  2LDU A;  2QM3 A;  5LGN A;  2FEZ A;  1DDN A;  4U7B A;  3HSE A;  5TJJ A;  2P7C B;  4BAY A;  4WXC A;  1KGS A;  1YIO A;  4O6J A;  3NQO A;  1SD7 A;  3TDZ C;  2P7V B;  3LST A;  3E97 A;  3ML6 A;  4ESB A;  3JW4 A;  4LGW A;  3CUQ B;  2MD5 A;  1IZ1 A;  3IWZ A;  4KYW A;  5HDG A;  4CYD A;  4CGZ A;  4HV6 A;  1XCV A;  5JHU A;  2DQR A;  3KP6 A;  1ZLJ A;  1HKQ A;  3M8E A;  3KLO A;  1D8J A;  2RC4 A;  4M74 A;  3QPT A;  1X3U A;  1FOK A;  3E6D A;  4YIF A;  1G3Y A;  1SD5 A;  2RN7 A;  1REP C;  2GXB A;  5L3C A;  5H6Q A;  3PFI A;  3FM5 A;  3LA7 A;  1B9N A;  3WE2 A;  4UXN A;  5HLG A;  2GAU A;  4PZJ A;  2V9V A;  4EM2 A;  2ISY A;  1HKT A;  3T0Y A;  2H6C A;  1R00 A;  5A2Q K;  3KZY A;  1U2W A;  4EGY A;  2DLL A;  3R61 A;  3O3K A;  1Z7U A;  2A5Y B;  2M30 A;  3R6S A;  3WTV C;  4HOB A;  3ROU A;  4EJO A;  2DPD A;  2BV6 A;  1ZRE A;  1T98 A;  5F1R A;  2XAS A;  1P4A A;  2OAZ A;  1MZB A;  2L4A A;  4BHB A;  1ON1 A;  2KJC A;  4RB3 C;  3KCC A;  2CW0 F;  3M8F A;  2K4J A;  2VN2 A;  4L5I A;  2XAQ A;  2F2E A;  3S2W A;  4LB5 A;  5DCM B;  3R60 A;  1U5T B;  2EFQ A;  3LAP A;  3FXQ A;  1GXQ A;  4XSX F;  5FGM A;  3DP7 A;  3V7R A;  4U0V A;  1G3W A;  1FT9 A;  1IN7 A;  3RKW A;  4CHU A;  3L2C A;  1J0R A;  4MHG A;  3GWZ A;  3ZN1 A;  3VB2 A;  2QLZ A;  3FWE A;  2XRO A;  3LA3 A;  2O03 A;  1FX7 A;  1BOA A;  3DXJ F;  3R0A A;  1R1T A;  4Q48 A;  2QVO A;  2IT0 A;  2HR3 A;  3F8B A;  3RI4 A;  1USS A;  3MZY A;  4HDU A;  2VOO A;  5H6R A;  2ZJ2 A;  3DEU A;  4HZF A;  1K6O A;  4LB6 B;  4G7Z F;  4OIP F;  4WK8 F;  5HS8 A;  2MLK A;  1BC8 C;  5KK1 A;  4L0Z B;  1ZG5 A;  2R3S A;  3CUQ C;  3EQL F;  3WGH A;  3REO A;  2VT2 A;  5FB2 A;  4IPA A;  2D1V A;  1UB9 A;  4R8H A;  2HKO A;  2ETH A;  3PQK A;  3O2P E;  1YQA A;  2E7X A;  3Q9S A;  4NHJ A;  4PGH A;  5D5W B;  3MAJ A;  1KQ0 A;  4AD9 A;  3F22 A;  1W5S A;  3FZV A;  2FE3 A;  4MEY F;  4KN7 X;  1OPC A;  5LHH A;  2V6C A;  1R58 A;  1XSD A;  4U88 A;  4EM0 B;  5ILV A;  1G3S A;  2W25 A;  2CYY A;  5FFZ A;  3TKY A;  2QQB A;  3WU1 B;  4HQE A;  4F7Z A;  4HF0 A;  2D45 A;  4HAM A;  3HTU A;  1O57 A;  5D8L B;  2UXX A;  5LEJ A;  4WX9 A;  5CVJ A;  2JZY A;  5E1Z B;  1U3E M;  4XLP F;  2YSR A;  5HLI A;  5KVR A;  3RTR A;  1OYY A;  2EFP A;  4A0Z A;  2CWE A;  2ZKZ A;  1TBX A;  2IA1 A;  3DV8 A;  2ADU A;  1JE8 A;  3I54 A;  4MEX F;  1J9I A;  3C7J A;  2STW A;  5K5O A;  3K1N A;  3HRM A;  3QOP A;  1C0W A;  2YX4 A;  3F23 A;  3ZMD A;  3EDP A;  2WC2 A;  2VC1 A;  3CDH A;  4HV5 A;  3M7G A;  3T8T A;  3FXU A;  4WWC A;  3WGI A;  1YO5 C;  2A3S A;  1RZ4 A;  1U8R A;  2XRN A;  4A6E A;  2R7F A;  3JTH A;  1PDN C;  2ELH A;  2GQQ A;  5AON A;  3MWM A;  1DP7 P;  3P7N A;  3F6O A;  3F8M A;  1OYW A;  2E1N A;  4HX7 A;  2LF8 A;  1R36 A;  5E18 F;  3KZZ A;  3L00 A;  4ZZL A;  1R5H A;  2RVC A;  4KIG A;  3RKX A;  2OBP A;  3TQN A;  1SFX A;  3HSR A;  4KT5 C;  2C6Y A;  3WTY C;  4E70 A;  2FNP A;  5FLX Z;  3WU0 A;  2ZFW A;  5AIQ A;  2RQP A;  3IKV A;  3DKW A;  4N9H A;  1QO0 D;  1F4K A;  1W5T A;  3CO6 C;  2W85 A;  2V1D A;  2G7U A;  1P92 A;  1ZRC A;  3CUQ A;  5LRR A;  2F5F A;  4A0X A;  5LLQ A;  1I27 A;  2E7W A;  2E1C A;  1LB2 A;  1DPR A;  2KIF A;  4LLL A;  3HIF A;  5L3E A;  2VON A;  3J81 Z;  3ZN0 A;  1IXC A;  4OMY A;  3SFZ A;  2BYV E;  5J6X A;  3EYI A;  5IT9 Z;  1YW7 A;  3TGN A;  5D4R A;  5DV5 A;  2P8T A;  1J75 A;  1TNT A;  5ICC A;  2DTR A;  4LFU A;  5D5X B;  3KP3 A;  4EVI A;  3LWF A;  2EFO A;  3U1D A;  4GYG A;  4P9F A;  2A6E F;  4BQA A;  5J8F A;  3BOQ A;  5ED4 A;  1T2K A;  1I1S A;  5LEK A;  3I71 A;  3F8F A;  2M8E A;  3KP5 A;  3C1D A;  2CFX A;  5DUI A;  1FYK A;  3FF5 A;  5LGU A;  2LKP A;  3K9T A;  1R22 A;  3RDI A;  2VBZ A;  1BN5 A;  1OYI A;  1IRG A;  4RGX A;  3WG9 A;  4HDV A;  4LG0 A;  2NYX A;  2OU2 A;  2GA1 A;  1XN7 A;  3V8J A;  4ZYD A;  5D6E A;  4HW0 A;  2DK5 A;  4H0E A;  2J5O A;  1HW5 A;  4G7O F;  5FD6 A;  3Q5F A;  1HXD A;  4S04 A;  3I64 A;  1F1Z A;  2ESH A;  4K2E A;  3I53 A;  4I0B A;  1B4A A;  1D3Y A;  2MLG A;  3ABU A;  2Z5U A;  4OIO F;  1SD4 A;  5D4S A;  4L0Y B;  3MEX A;  2PBI A;  5IT3 A;  4AIK A;  2D2W A;  2HGC A;  3D0S A;  5CYV A;  4UHT A;  3I59 A;  2HEO A;  3QAH A;  2XV4 S;  4FX0 A;  3R0J A;  1JXS A;  3WOD F;  4GCV A;  4XBF A;  3O6B B;  3QP6 A;  2LF7 A;  1IF1 A;  4IF4 A;  1FBQ A;  3JSP A;  2QYO A;  4KIB A;  3BRO A;  3BY6 A;  2EV6 A;  3MCZ A;  1ZRD A;  4P9U A;  1ZAR A;  1S7A A;  3V7S A;  1LJ9 A;  2HQN A;  2TDX A;  1FPQ A;  3J80 K;  3GF2 A;  4EGZ A;  2FA5 A;  5JR3 A;  4U0W A;  4OU0 A;  3ZPL A;  1EH7 A;  3RJP A;  2AXL A;  4YG2 F;  1B9M A;  1XGN A;  1QZZ A;  1BC7 C;  3P9K A;  2Z99 A;  3HRU A;  2VE9 A;  3FMQ A;  1LEA A;  3GFL A;  2OD5 A;  2EV0 A;  1XDS A;  1MJB A;  4Y17 A;  2QZ8 A;  2XAG A;  1TNS A;  3B73 A;  3IKT A;  2HOE A;  4AIJ A;  2VBX A;  1HW1 A;  5LBQ A;  3OOP A;  5BPI A;  1K78 A;  3ECO A;  1B59 A;  5L3F A;  4L18 B;  4CZZ A;  1FZP B;  2EK5 A;  1OKR A;  4GYI A;  1FNN A;  3GZ6 A;  2DT5 A;  4Y15 A;  1IW7 F;  1XSX A;  1IRF A;  3V7C A;  2XHK A;  4UV9 A;  4HBL A;  5IT9 K;  3RIR A;  4OIR F;  2PMH A;  5CLS A;  2MH9 A;  1J59 A;  1QGP A;  3CLO A;  4ZYE A;  1QZY A;  2M5W A;  4ESF A;  3DFG A;  2EJR A;  4IHT A;  3KET A;  1Z9C A;  2L3D A;  5CVV A;  2DAO A;  1Q1H A;  1Z91 A;  2B0L A;  3GXO A;  4RS8 A;  5E8I A;  2XKO A;  1MJ9 A;  1U5T C;  3F72 A;  2PEX A;  1K79 A;  2IW5 A;  4IXA A;  5DEQ A;  3BPV A;  4KUM A;  4EV0 A;  3T1B A;  1SMY F;  2FOK A;  3SQN A;  1ZAO A;  3WTW C;  1YG2 A;  1P6R A;  1TW2 A;  5D6F A;  2EB7 A;  4M9X A;  4ZYH A;  4LG0 B;  3LA2 A;  4YFN F;  4O3M A;  2IP2 A;  4I2O A;  2HS5 A;  3T5X A;  5DYM A;  2GXG A;  1XDU A;  2ZO4 A;  4KDP A;  2XGX A;  2ZME A;  5CVI A;  3ELK A;  1FLI A;  2PMU A;  3M1E A;  5HDN A;  3K69 A;  2OQR A;  3E3V A;  5ICE A;  3KEO A;  4FHT A;  5DD8 A;  2K02 A;  1BJA A;  3I0T A;  2ZXJ A;  1EV7 A;  4A12 A;  3ECH A;  2R7D A;  3SHF A;  2P6T A;  5CVR A;  1ZGA A;  2GWR A;  3BZ6 A;  1OR7 A;  3SXY A;  2DU9 A;  2ZNY A;  3QPH A;  4IRH A;  3AAF A;  2HWV A;  2XUB A;  1B6A A;  2MBF A;  3LAJ A;  4O5V A;  3JAM Z;  3ZMZ A;  1R5G A;  4XLN F;  1ZH5 A;  4N0B A;  2V79 A;  3N97 A;  4OIQ F;  2FU4 A;  4GXO A;  2DK8 A;  3U9G A;  3G73 A;  4I7H A;  4WXD A;  3GO5 A;  2O8X A;  5EEH A;  2VBY A;  4CIC A;  1XGM A;  1SD6 A;  2X0L A;  6PAX A;  1G3T A;  3KEQ A;  5ICG A;  2IA0 A;  2PJP A;  1IN4 A;  1S6L A;  2FRH A;  1FSH A;  3K0L A;  1OMI A;  3DQV C;  2YPR A;  5E20 A;  1XGO A;  3LQR A;  2J5P A;  1TTY A;  1ON2 A;  5K5Q A;  2A07 F;  3SZP A;  2OZU A;  4A5N A;  2EA4 A;  2RGV A;  2W24 A;  1STZ A;  4CXF A;  2V1U A;  2QQA A;  4CDG A;  3P9I A;  4UVB A;  3IHU A;  2FMY A;  4G7H F;  5HVQ C;  3JAM K;  4P5O A;  4AWX B;  3DPL C;  5J8C A;  2UXN A;  3LFK A;  1KYW A;  1SFU A;  2VXZ A;  4KMF A;  1KU2 A;  4RGR A;  3GVA A;  5FO5 A;  3K1P A;  2VT3 A;  3F6V A;  1XB4 A;  1EH6 A;  1FC3 A;  1R7J A;  4ENN A;  3J81 K;  3HHH A;  4BXU A;  4XRF A;  1T38 A;  3E5U A;  4RAY A;  1L3L A;  1RUO A;  1G4D A;  5FLX K;  4RB1 A;  4AIH A;  2RKH A;  2QUF A;  1RI7 A;  2FML A;  1S3J A;  2K27 A;  2G7H A;  2H94 A;  4YII A;  3WE3 A;  1FY7 A;  3Q9V A;  4WF2 A;  1GXP A;  4MTD A;  3W6K B;  1ZRF A;  1O7L A;  4Q5S F;  4ESJ A;  2F5E A;  5BQT A;  1I5Z A;  3K2Z A;  2NRA C;  2VC0 A;  1IN8 A;  2H27 A;  3HSF A;  5LGT A;  3ZQ7 A;  4B09 A;  1YLF A;  3HUG A;  1J5Y A;  3I4P A;  2O0Y A;  1NHA A;  4EJV A;  2EFN A;  1LEB A;  4M71 A;  1H9G A;  4UVC A;  2X4H A;  4ENJ A;  1L0O C;  1XMA A;  1WQ2 A;  2CGP A;  4QWQ A;  3TDU C;  1AOY A;  3WTU C;  1R23 A;  1R1V A;  5BPD A;  4ETS A;  3L7W A;  2H09 A;  1MJA A;  1UHM A;  2CO5 A;  1O3Q A;  3MZH A;  3GFM A;  2BBY A;  4M6Y A;  4M72 A;  1AWC A;  3C3W A;  3GUD A;  4FX4 A;  3ZMU A;  5HS7 A;  1KU3 A;  2QQ9 A;  2F5D A;  1UFM A;  3L09 A;  1EH8 A;  2A69 F;  3KP4 A;  2PFB A;  4R79 A;  1D8K A;  2XAH A;  3VOD A;  1QNT A;  3NRV A;  3J80 Z;  1IAW A;  4LLN A;  2M1B A;  3V4G A;  2GIV A;  4OMZ A;  3ZMS A;  3I5U A;  2XAF A;  3GLX A;  4UV8 A;  1TQI A;  3B02 A;  5D5V B;  2QEN A;  1E2X A;  1YTY A;  1YFH A;  1FYL A;  2HTS A;  1MKM A;  1HW2 A;  4KMU X;  3NEU A;  2Y75 A;  2WWY A;  3MQ0 A;  2LNB A;  1J7K A;  1JHH A;  3GZ5 A;  5BOX A;  4HA8 A;  1Y0U A;  2HKX A;  3QU3 A;  2KJB A;  4A0Y A;  1HST A;  4LK1 F;  3EYY A;  2L54 A;  3OV8 A;  4U0Y A;  2DO7 A;  2A6H F;  4HQM A;  2MH2 A;  2VOD A;  3FX3 A;  5D8K B;  3V8L A;  4BH9 A;  1YS6 A;  2CQK A;  3BPX A;  4BHP A;  2BGC A; 
#chains in the Genus database with same CATH topology
 1FBU A;  3O8G A;  3BG9 A;  1T33 A;  2MC3 A;  1FIA A;  1WHU A;  2JUC A;  2R7Q A;  3ZQH A;  2CUJ A;  1E0E A;  4M73 A;  1TLH B;  2X6W A;  1LFU P;  2P4W A;  2VI6 A;  4EJT A;  2IA2 A;  3A01 B;  1CF7 B;  1HSJ A;  2QBY B;  1LE8 B;  3GEZ A;  1FYM A;  3LSP A;  3ERE D;  2ZNZ A;  3V8K A;  3FXK A;  5E1W A;  1P2F A;  1F5T A;  2DXI A;  5E3O A;  1J2X A;  5E3N A;  4WXH A;  3CC7 I;  1G59 A;  1S8N A;  1IV6 A;  3L9F A;  1OLT A;  2A61 A;  2BHZ A;  3MVP A;  1APL C;  5KAF C;  1I6H J;  2HYF A;  2ZME B;  2P5L C;  1A36 A;  2UWM A;  4L9T A;  1DPU A;  2FNA A;  3CMY A;  1IUY A;  3HOS A;  2NNN A;  4B48 A;  4E4H A;  5LRS A;  5F08 A;  2XSD C;  2P6S A;  4Y13 A;  1OFC X;  1TZL A;  4NC8 A;  3G1L A;  4EMS A;  5B5E C;  1LQ1 A;  1V54 H;  1IJW C;  2ECB A;  3ZMT A;  2F4M B;  3OL4 A;  2JJ7 A;  1R1U A;  2IVM A;  3QYF A;  2XB5 A;  3PUB A;  4MGR A;  2WAQ N;  3FHN A;  1ZG1 A;  2JPC A;  4EJU A;  3FMR A;  5EYR A;  2RDP A;  2FXA A;  4BAC A;  2GIZ A;  2Y0M A;  1UG2 A;  1BI1 A;  1HBX G;  2V9K A;  5C44 J;  2L02 A;  1LUJ B;  3TBI A;  2RNJ A;  2HVR A;  2K7L A;  5HLH A;  4CCN A;  3M9A A;  3OYN A;  3GYH X;  2CQQ A;  2O6G E;  5FKN A;  2M8G X;  3OYL A;  3HOT A;  2HQR A;  5BNG A;  5J4V A;  2OA4 A;  4A2U A;  3MFK A;  1WKM A;  1Y8R B;  3SYT A;  3J7A O;  2DA6 A;  1OJL A;  1JT0 A;  1ZGJ A;  3BZC A;  2WY7 Q;  2KPM A;  5CKT A;  4G6D A;  3JTG A;  4IHW A;  3CJR B;  4JQF A;  2OQG A;  1V3F A;  5J1Y A;  4LLG F;  5DM6 F;  1IRX A;  4L5J A;  4EQQ A;  1P4X A;  1KZH A;  2YU9 J;  2NS0 A;  2VKH A;  1WSU A;  4DZP A;  3WTT C;  2ECC A;  1WJD A;  2JT1 A;  3CO7 C;  1KU9 A;  3CF2 A;  2JRT A;  4ZDL A;  3F21 A;  2NVU B;  2NNY A;  2OTJ I;  2VPR A;  3VSK A;  4E7Z A;  2K9Q A;  3DPT A;  3O8H A;  4D1Q A;  4BHC A;  1GHC A;  1U0J A;  1FBS A;  3ABL H;  3TO7 A;  4OWR B;  2K4B A;  3E1S A;  4RB0 A;  1QBJ A;  2ICW G;  1XCB A;  1K7A A;  3HHG A;  4G8X A;  2MA3 A;  3EPZ A;  5EG0 B;  3HRS A;  3MD2 A;  4I09 A;  4G6Q A;  1BI0 A;  1ZKG A;  3FBN B;  2CUF A;  3BG5 A;  1O7F A;  2NOG A;  1WWX A;  3VSL A;  3CJN A;  2K3P A;  1D1A A;  2Y2Z A;  3I3L A;  3SEZ A;  4LJZ F;  5DCM A;  1D1C A;  3L1P A;  1N77 A;  1S7E A;  2HI3 A;  5KNL A;  2CSO A;  2HTJ A;  1VFC A;  2Q2E A;  4I02 A;  4M9S A;  5E17 F;  4P55 A;  2XVC A;  2F5C A;  4RLQ A;  2D5V A;  3BR0 A;  2NS8 A;  4Q47 A;  3G3Z A;  1XX5 A;  2W82 A;  5EDN A;  4X0G A;  1K78 B;  5AIP A;  1MMG A;  3H3U A;  2HOS A;  2O61 A;  1U6G A;  5HNH A;  4RLF A;  2H6B A;  1X3Z B;  4XSZ F;  1QU3 A;  4L9V A;  3IP4 B;  3LSH A;  5B1A H;  4PFO A;  2Y31 A;  1NK3 P;  2WV1 A;  3DTK A;  3QYE A;  2V1X A;  4FT8 A;  4M3D A;  5IPA A;  3VDX A;  1SAX A;  2RQQ A;  1YX3 A;  2EZK A;  3RYP A;  4IRI A;  1TQP A;  2BY0 A;  1O3R A;  3OSF A;  2L7Z A;  3VEP A;  3FXO A;  5J1U A;  2EQR A;  3TP0 A;  1U9N A;  3E5X A;  4IJA A;  2DPU A;  1NG7 A;  3R4K A;  1I6X A;  4KIF A;  2ACJ A;  1W7P D;  2OUM A;  3ZXS A;  2XAU A;  3K1M A;  1WVR A;  4AVP A;  1IUF A;  2HFH A;  2LFB A;  3BT9 A;  3JRI A;  1SFE A;  2O7O A;  2XIG A;  1WJA A;  1JUS A;  2EZL A;  3ZRG A;  4MTE A;  3I59 B;  3ISP A;  2EA2 A;  3J7Z I;  4KN4 X;  3E6B A;  5EEA A;  5FKO A;  5LHI A;  2V4J C;  1X3W B;  3FM3 A;  5F04 A;  5K1Y A;  3CUO A;  4IRG A;  2IS4 A;  1ZN2 A;  3VOE A;  2DW4 A;  1QVU A;  2L01 A;  3HYI A;  2PN6 A;  3HOW J;  5F64 A;  1ZLK A;  2E19 A;  5H20 A;  5K7H A;  2PQ8 A;  2XAJ A;  2DOD A;  4YRV A;  3CCJ I;  1Z6R A;  1IXR C;  1MD0 A;  3H3Z A;  3PL8 A;  4BJT A;  1FWZ A;  1BI3 A;  3IH4 A;  3CCS I;  2EFW A;  1LDJ A;  4BDY A;  2E2I J;  2JVH A;  3D5S C;  1T0F A;  2HQ5 A;  2Q8K A;  3I4N J;  4LIT A;  1JGS A;  2EIL H;  3ABT A;  4L9J A;  2R0Q C;  2WV0 A;  5IYC J;  2G0E A;  1BI2 A;  1ULY A;  2DI3 A;  3KFW X;  1RKT A;  2DBB A;  5M5X J;  3FXM A;  2KIS A;  2FBK A;  4CCO A;  2HQA A;  2OF7 A;  3L2R A;  2IGO A;  3RZD J;  3S16 J;  1YYV A;  1BR2 A;  1R49 A;  1B8I A;  3CMM A;  3EUH A;  3ZQF A;  1ETY A;  1ZYR F;  1X1C A;  1DGW Y;  2LLK A;  1IN5 A;  4IQ4 A;  4A5M A;  1Z0X A;  3BR5 A;  4L9N A;  5ILU A;  2XC7 A;  1FJL A;  1IN6 A;  4M6X A;  5FKK A;  3D5L A;  3GTM J;  2Z33 A;  1GT0 C;  2CV1 A;  4ENM A;  5B66 C;  1I39 A;  1CF7 A;  4Q4Z F;  1Z1D A;  3EUK L;  2UZK A;  4MNU A;  3EET A;  1JKP C;  1U78 A;  3KYL A;  1U5T A;  5DCF A;  3WTX C;  5KHD A;  1PP7 U;  1OCT C;  4G6T B;  1YS7 A;  2JSC A;  3S3M A;  1D0X A;  2JTV A;  4UUT A;  4EM1 A;  1Z77 A;  4NQW B;  2BY2 A;  4FIS A;  5TRD A;  1A04 A;  3WTZ A;  1JT6 A;  3DKY A;  3PSI A;  2AS5 F;  4QSH A;  3LNQ A;  1FOX A;  1HKS A;  3TW6 A;  4RAZ A;  4KIS A;  2Z16 A;  2PI0 A;  1YJN I;  4GGG A;  3H35 A;  4S05 A;  3KIO A;  2D1H A;  1TQM A;  4UB8 C;  4UVA A;  1R4M B;  1MDM A;  1GV5 A;  1XMK A;  1E3H A;  2PG4 A;  2ZBK A;  4BY1 J;  5HOO A;  2ISZ A;  1MMN A;  3CTA A;  1O3T A;  3TO6 A;  4B47 A;  2BEO A;  1HQC A;  4M3E A;  1V5E A;  5K5R A;  5K7Z A;  2L9V A;  3FHZ A;  1WH7 A;  4BY7 J;  1VF9 A;  3DWL E;  2RV8 A;  3KLN A;  4G94 A;  4BE2 A;  1O3S A;  1QPM A;  4BYY A;  2K86 A;  1TWC J;  2FSW A;  3ZQI A;  2VBW A;  2HZT A;  2NVY J;  4ZYA A;  3KP7 A;  2Y69 H;  4NQW A;  4V2F A;  4PJ0 C;  4OOI A;  3C18 A;  2DFI A;  1XGS A;  2GA2 A;  2OZ6 A;  2X85 A;  3TO9 A;  1FP1 D;  3T8R A;  2IRF G;  4M9Z A;  5HS9 A;  1I50 J;  4XOT A;  3JSO A;  2IPQ X;  5ERI A;  4BEH B;  3FXR A;  4ENK A;  4V19 K;  3J7Y J;  4BUP A;  3HRT A;  2FF4 A;  2XPU A;  4RAF A;  1KU7 A;  3KYD B;  2YU3 A;  3BP8 A;  5E8G A;  2KDZ A;  2DMQ A;  3GW2 A;  1MMS A;  2OCC H;  4NC7 A;  2BHY A;  2GZW A;  3IRR A;  2DFE A;  4BE0 A;  2X51 A;  2VJ4 A;  2AQF A;  1ACI A;  1CGP A;  2VL8 A;  4KIT B;  9ANT A;  4CYC A;  4J00 A;  4IHS A;  1ZEL A;  4JYK A;  4ZYG A;  5F0C A;  3QQA A;  4BQQ A;  5LHG A;  1E17 A;  1CQT A;  3CCR I;  2FQ3 A;  3VPR A;  5GAG J;  1G6N A;  2CMP A;  3QPL A;  3QP5 A;  4XLC A;  2AO9 A;  5B3S H;  5EF6 A;  2RRE A;  3K4L A;  2DJI A;  1GVJ A;  1WPK A;  2XB0 X;  1U8B A;  2PJR B;  1VTN C;  4UUV A;  1JTY A;  4MLO A;  4BE1 A;  2GXA A;  1OR7 C;  4IVN A;  3SZG A;  3PIP F;  1JJ6 C;  1B72 A;  4LD5 A;  3RYR A;  1R6R A;  4N9I A;  5DUK A;  3GME A;  2DA2 A;  3OWT A;  2R7Z J;  1W4M A;  2YUS A;  2X48 A;  2HDC A;  4GO1 A;  3NAR A;  4DNC A;  5A2Q Z;  5EGO A;  3I56 I;  3D1N I;  1RKW A;  3PQJ A;  3BR2 A;  2H8R A;  4HX8 A;  4CA0 A;  3OYH A;  3GZN B;  3RPQ A;  4JOM A;  1IXS B;  1TL8 A;  4R1H A;  3B6A A;  5M3M J;  2JVG A;  1OCO H;  2BW3 A;  1T39 A;  1ONV A;  2BE5 F;  3PNV A;  1B1B A;  3F8C A;  1ETO A;  1WH5 A;  3S3N A;  5M5W J;  1K61 A;  4UNO A;  4HRI A;  4P96 A;  4HF2 A;  2STT A;  3LQQ A;  3RQ4 A;  2Z3Y A;  3IC7 A;  5F27 A;  1WJC A;  4FE4 A;  5ICF A;  2LH9 A;  3KP2 A;  4D0P A;  1FSE A;  5F6F A;  3COA C;  2PMZ N;  2JK3 A;  3F3X A;  3S8P A;  3BDD A;  2KIU A;  2JSP A;  3CCL I;  2COM A;  2KIM A;  2Z2S B;  1HDD C;  1FOY A;  4NB5 A;  1W36 D;  2IJL A;  1MBF A;  2FD5 A;  2XPW A;  3HZJ A;  4A6D A;  3E6C C;  1A35 A;  2OC6 A;  1ETV A;  2VUM J;  2Y30 A;  4F52 A;  3MKZ A;  5F0H A;  2FUG 2;  1Q1V A;  2E71 A;  3TOA A;  5D5U B;  3W3C A;  1QA6 A;  4Z2Y A;  1BM9 A;  3JR9 A;  3GTJ J;  3ZR8 X;  4IO9 F;  1W7P A;  1R5I D;  3IWF A;  2ZSH B;  5FFX A;  1RIO H;  2KRF A;  1BIA A;  5CVU A;  4B8X A;  3WHB A;  1ZQ3 P;  3JRH A;  2HYJ A;  5LFA A;  3QU6 A;  4I98 B;  1TW3 A;  2BXZ A;  2ESN A;  1XTA A;  3I58 A;  4CH7 A;  3ABM H;  3HGY A;  4XL9 A;  5DDG A;  5C4X J;  1ODD A;  4WCG A;  1ZG3 A;  2WAF A;  3H9Q A;  3P9C A;  4XN3 A;  2HOA A;  2W57 A;  2FBI A;  2L9N A;  1SEU A;  2JMW A;  1RUN A;  5E1X A;  1YW8 A;  1X1D A;  5HDK A;  1ITY A;  2K9N A;  2DYS H;  1TWA J;  4A3F J;  4RBO A;  1MNM C;  2VB6 A;  5DD4 A;  1Z7L A;  1I1G A;  1RC9 A;  4FE7 A;  3WTS C;  4PGG A;  2Q0O A;  2M45 A;  2G9W A;  3BWG A;  3CP8 A;  4RGS A;  4LK0 F;  2EWN A;  2QA4 I;  2JA6 J;  4BKX A;  5L3G A;  4RDU A;  1UCR A;  3LSR A;  1D5V A;  2Y9Y A;  2QSH X;  3L2V A;  1V4R A;  2X6Y A;  3RKY A;  1H9T A;  1RNL A;  1HLV A;  1DUX C;  2JUG A;  5L3B A;  1ZTR A;  2DN0 A;  2P5K A;  3KE2 A;  1JHF A;  1JUP A;  1Z05 A;  2Y48 A;  4N4O B;  4DYQ A;  5BMZ A;  1VQ5 I;  2P0W A;  3WGG A;  1KQ8 A;  4XK4 A;  4QLC U;  2W84 A;  4Y52 J;  3VFZ A;  3W6V A;  4NUB A;  5F1J A;  4ZZD A;  1LDK B;  1XSV A;  1R71 A;  1W36 C;  5DTD A;  2MGQ A;  3HG9 A;  5JI6 A;  2FBH A;  3OYA A;  2PLY A;  4CUG A;  2K3F A;  1KQ9 A;  4A3L J;  4KA4 A;  2A68 F;  2EZH A;  4HLY A;  3OYI A;  2B7E A;  3FKI J;  1OCZ H;  3GX4 X;  5M5Y J;  3RPU A;  4OIN F;  1S29 A;  2Z9O A;  4D7M A;  4KFC A;  3E6M A;  2K40 A;  1H0M A;  4XON A;  3ULQ B;  3W6J B;  5JFR A;  2KKO A;  1Z6T A;  3DEW A;  3F0C A;  5IP6 A;  4OAZ A;  2E35 A;  3ZP5 A;  4BGD A;  4FET A;  4MQV A;  5KAI C;  2OV7 A;  4RB2 C;  1PP8 F;  2VE8 A;  3QRF F;  2QWW A;  3N4M A;  2JWT A;  5GPC A;  3ZOB A;  2WB1 A;  5EGO B;  2WTE A;  2I8D A;  2MFZ A;  3PSF A;  3OY9 A;  4LMY A;  1FP2 A;  2ZCW A;  1GVD A;  4BNC A;  4ZC3 A;  3F8N A;  4G9Y A;  1MSE C;  2XKP A;  3HC7 A;  4U7D A;  1UST A;  1LNW A;  3GBG A;  3I4M J;  1BW6 A;  4QPO A;  5JVT A;  4YFX F;  5FD5 A;  2L4M A;  3BG3 A;  3LMM A;  5HOD A;  3DBL B;  2EZI A;  5J4Y A;  4AVZ A;  2O3F A;  2KHM A;  2M87 A;  1YW9 A;  5CJ9 A;  4ZH4 F;  3H0D A;  3TOB A;  1VQ7 I;  4TV7 A;  2R7T A;  1KYZ A;  3E5Q A;  1MH4 A;  4EJW A;  1S7O A;  5E79 C;  2Y0S A;  4KIC A;  1P4W A;  3H5N A;  4DZJ A;  2VKV A;  4FAS D;  4MQ9 F;  2R92 J;  2DQL A;  2LSO A;  3BQZ A;  3BJA A;  2LVS A;  4S0H B;  1PUF A;  4M3B A;  4CCJ A;  3BJO A;  2NAZ A;  2JPB A;  1DQU A;  5BS6 A;  2QBY A;  3GFJ A;  4DQ2 A;  4JBA A;  4HF1 A;  4HYE A;  3ZMV A;  4PCQ A;  4XN0 A;  1ETX A;  4DBR A;  3OR1 C;  4ASN A;  4YFK F;  4A3K J;  1KA8 A;  2GOX B;  4RGU A;  3OYK A;  1N75 A;  1UHW A;  3V42 A;  4C2U A;  1TWG J;  2EIJ H;  3DKX A;  1VQ9 I;  1PUE E;  3VYT B;  2E60 A;  1QHH D;  2LR8 A;  1WRJ A;  2IGM A;  4JK1 X;  1W7P B;  2BY1 A;  3U2R A;  1YE9 A;  3IL2 A;  3JRF A;  3DF8 A;  1QQI A;  1SAN A;  3A4C A;  4ON0 A;  2HOT A;  3HTS B;  3QOE A;  4QTR A;  2EV5 A;  3BJ6 A;  3OYE A;  3HEF A;  2W4S A;  1PVE A;  1XD7 A;  2CG4 A;  4CO8 A;  1K4S A;  1JGG A;  4XKW A;  5L3D A;  1WI9 A;  1ZGW A;  3H92 A;  1SMT A;  1MGT A;  2HYG D;  3M8J A;  4HX4 A;  4I0A A;  1MDM B;  2WA0 A;  1LVA A;  5EEG A;  3G1M A;  1K78 A;  4I01 A;  2R5Z A;  4A3C J;  3CD6 I;  2KRC A;  4HLX A;  4A3B J;  2P5V A;  1F9N A;  1OCC H;  2AXT C;  2YX7 A;  3IRQ A;  2Y0S N;  4PDK A;  3GFI A;  3S93 A;  1BBY A;  3SZT A;  1LDD A;  3QYB A;  1T6S A;  3GLL A;  1ZHF A;  2IAI A;  4FCY A;  1LKX A;  1X2M A;  2YR2 A;  5ILS A;  4A3G J;  1IRZ A;  1BIB A;  3K4C A;  4KNY A;  1OCP A;  4GRI A;  2LDU A;  2QM3 A;  4J19 A;  5LGN A;  2FEZ A;  1U9O A;  3HOX J;  2RAE A;  1DDN A;  3M4O J;  2VJI A;  4U7B A;  1S9H A;  3HSE A;  5TJJ A;  4XQF A;  2P7C B;  1A5J A;  1TT5 B;  4BAY A;  3LSM A;  4WXC A;  4I76 A;  1MIJ A;  3ZQC A;  1KGS A;  1YIO A;  2OCE A;  1WJB A;  4O6J A;  2LD5 A;  1F43 A;  3NQO A;  1MMA A;  4D9J A;  1ZR4 A;  1Y0N A;  3U1K A;  4Y7N J;  1SD7 A;  3TDZ C;  1YRN B;  2P7V B;  1QHG A;  3LST A;  3E97 A;  3ML6 A;  1R4N B;  4ESB A;  2KLO A;  2GLO A;  3JRC A;  1Y56 A;  2X6X A;  4XRS G;  3JW4 A;  4LGW A;  3CUQ B;  3HJE A;  3G4S I;  5CQE A;  2MD5 A;  1IZ1 A;  3IWZ A;  3W2A A;  4KYW A;  5HDG A;  4CYD A;  4CGZ A;  4HV6 A;  1XCV A;  3SEQ A;  5JHU A;  2DQR A;  3AG4 H;  5IOY A;  3LSK A;  3KP6 A;  1ZLJ A;  2CJJ A;  1TWH J;  3SJM A;  2AQE A;  1HKQ A;  3BG7 A;  3M8E A;  4CZC A;  1B8I B;  2QKL B;  1FMV A;  3KLO A;  2VIX A;  1D8J A;  2RC4 A;  4M74 A;  3DU5 A;  3QPT A;  2CQ7 A;  4BQO A;  1X3U A;  1FOK A;  3E6D A;  4YIF A;  1G3Y A;  2MSY A;  1MMD A;  1SD5 A;  2RN7 A;  1REP C;  5FRM A;  4B4C A;  2GXB A;  5L3C A;  4DYR A;  5H6Q A;  1YRN A;  2CQX A;  2ZJP F;  2HVQ A;  3IUO A;  3PFI A;  3FM5 A;  3LA7 A;  1B9N A;  3WE2 A;  2X1C A;  4UXN A;  5HLG A;  2GAU A;  2WBM A;  4PZJ A;  2V9V A;  5J1R A;  2DA4 A;  4EM2 A;  2ISY A;  3HM5 A;  1HKT A;  3T0Y A;  2H6C A;  2GM4 A;  1R00 A;  5A2Q K;  1D1B A;  4Y3O A;  3KZY A;  1U2W A;  1Y1W J;  4EGY A;  1NTC A;  2DLL A;  4KT6 A;  3BCA A;  3R61 A;  1W0U A;  2NVX J;  3O3K A;  1ETW A;  1UZC A;  1Z7U A;  2LKX A;  2A5Y B;  3KEY A;  2M30 A;  3R6S A;  2GBY A;  3WTV C;  4HOB A;  3K70 C;  1Z67 A;  3ROU A;  4EJO A;  2R4G A;  2DPD A;  2BV6 A;  3CP2 A;  3OR2 C;  1ZRE A;  1T98 A;  2WY8 Q;  5F1R A;  2XAS A;  1P4A A;  3K4N A;  4MIM A;  2OAZ A;  4F55 A;  1MZB A;  2L4A A;  4BHB A;  5FKL A;  1ON1 A;  2KJC A;  2XF6 A;  3PNY A;  4RB3 C;  2HXO A;  3KCC A;  2CW0 F;  3M8F A;  2K4J A;  2DA5 A;  1F36 A;  4JX4 A;  2VN2 A;  2ME6 A;  4L5I A;  3S1M J;  2XAQ A;  1WJE A;  4XIC A;  2F2E A;  3S2W A;  4BXF A;  3K7A J;  4A3J J;  4LB5 A;  2VJ5 A;  4B1R A;  4XID A;  1SVO A;  4ZDO A;  5DCM B;  3R60 A;  1U5T B;  2EIK H;  5EZH A;  3HDD A;  2EFQ A;  3LAP A;  3BCB A;  1VQP I;  3EUA A;  2KIQ A;  3FXQ A;  1GXQ A;  4CCL A;  4PK4 A;  4XSX F;  3RPU D;  2HDD A;  1YJW I;  2F5V A;  4XLA A;  1NK2 P;  5DM7 F;  1PUF B;  5FGM A;  3DP7 A;  5EG0 A;  3M07 A;  4U0V A;  3V7R A;  1G3W A;  1FT9 A;  1IN7 A;  2A5W A;  5F0F A;  2OPT A;  4ANJ A;  4ZTF A;  4C30 A;  4IKF A;  2FJ1 A;  4XKB A;  3RKW A;  3C2G A;  4CHU A;  3L2C A;  1D0Y A;  1J0R A;  2X9D A;  4MHG A;  5GAE J;  3OMY A;  3GWZ A;  3ZN1 A;  4HNT A;  3VB2 A;  2R7V A;  2QLZ A;  1IV8 A;  3FWE A;  2CW8 A;  2XRO A;  3LA3 A;  2O03 A;  1FX7 A;  1BOA A;  3DXJ F;  2DT6 A;  3PUF A;  1R1T A;  3R0A A;  4Q48 A;  2QVO A;  2IT0 A;  4BDZ A;  2HR3 A;  4IOA F;  3F8B A;  3RI4 A;  2CV0 A;  1USS A;  4II2 A;  2L9R A;  1FTZ A;  3MZY A;  1BR4 A;  2IBD A;  4HDU A;  2XGD A;  2VOO A;  5H6R A;  2ZJ2 A;  3DEU A;  1DP3 A;  3LFU A;  4IHV A;  2DFF A;  1M1E B;  4HZF A;  2XGC A;  1G2H A;  1K6O A;  2JA5 J;  4LB6 B;  3OS0 A;  4G7Z F;  2I5U A;  4OIP F;  1EKE A;  1MW7 A;  3S17 J;  2X6O A;  4P1W A;  5HS8 A;  4WK8 F;  2MLK A;  1BC8 C;  5KK1 A;  1W1W E;  4L0Z B;  1ZG5 A;  2LKS A;  5GAH J;  2EPF A;  2R3S A;  3CUQ C;  4BXX J;  3EQL F;  3Q0W A;  2M3A A;  3WGH A;  3MMY B;  3PJR A;  3REO A;  5JHF A;  3OIO A;  2VT2 A;  4YEL A;  5GPA A;  2XF5 A;  2IXS A;  4HG2 A;  5FB2 A;  5JLW A;  4PUS A;  4MO7 A;  4MFE A;  3H36 A;  1RRJ A;  2CH0 A;  3CCU I;  4IPA A;  2D1V A;  1UB9 A;  4R8H A;  5CPR B;  1MBJ A;  1YHQ I;  2HKO A;  2ETH A;  3DBR B;  4HNU A;  4I6Z A;  3PQK A;  1YJ9 I;  1N78 A;  1VND A;  3AG1 H;  3O2P E;  3H9J A;  1YQA A;  2E7X A;  3BR1 A;  3Q9S A;  4NHJ A;  4PGH A;  3C2B A;  3MN2 A;  5D5W B;  3MAJ A;  1KQ0 A;  1RPW A;  4HSR A;  3HPH A;  4AD9 A;  1W5S A;  3F22 A;  5IOZ A;  4B3A A;  1UEL B;  4DW6 A;  3FZV A;  2FE3 A;  2KRH A;  4MEY F;  3FKJ A;  3JRA A;  4KN7 X;  4E7L A;  4ZTJ A;  1OPC A;  5LHH A;  2DA7 A;  4F93 B;  4XOR A;  2V6C A;  1R58 A;  1SC7 A;  1QPI A;  1XSD A;  4BL0 B;  3HL2 A;  2KZG A;  4U88 A;  1DGR M;  4EM0 B;  4XRM A;  3CDI A;  2HPM A;  3BG6 A;  5ILV A;  1G3S A;  1VQ4 I;  2W25 A;  2CYY A;  5FFZ A;  1AA7 A;  3TKY A;  3HBL A;  3AG2 H;  2QQB A;  2NXN B;  1HC8 A;  5IP7 J;  3WU1 B;  4UUS B;  1SAU A;  4HQE A;  4F7Z A;  4HF0 A;  2D45 A;  4HAM A;  1E3O C;  1WGX A;  2XDV A;  3HTU A;  1O57 A;  5D8L B;  3DPU A;  2UXX A;  2V26 A;  3AG3 H;  2TCT A;  2VKE A;  5LEJ A;  4WX9 A;  4XMY A;  4YIR X;  5CVJ A;  3CC4 I;  2JZY A;  5E1Z B;  3LSG A;  1U3E M;  4XLP F;  2ZXH A;  3PFY A;  3CCQ I;  2YSR A;  5HLI A;  1JKO C;  3GTO J;  2F4I A;  3FXL A;  5KVR A;  3RTR A;  3FK7 A;  3G2B A;  3GTK J;  1OYY A;  1I3A A;  2EFP A;  4A0Z A;  2CWE A;  2ZKZ A;  1TBX A;  2IA1 A;  2R7S A;  3DV8 A;  2ADU A;  2KP6 A;  2DDA A;  1JE8 A;  1T0F C;  4I99 C;  2PMZ A;  3BR6 A;  3CJT B;  3I54 A;  2E1M B;  4MEX F;  1J9I A;  3C7J A;  2STW A;  5K5O A;  3W2W A;  3K1N A;  4C2M J;  2ZME C;  1R9T J;  3HRM A;  3QOP A;  3GTL J;  1C0W A;  4IX7 A;  3ZQL A;  2YX4 A;  1VQ6 I;  3F23 A;  3ZMD A;  3EDP A;  2LY1 A;  2WC2 A;  2NS7 A;  1GV2 A;  2VC1 A;  3CDH A;  2N8G A;  4HV5 A;  3M7G A;  2JN6 A;  3T8T A;  3FXU A;  4WWC A;  2VOP A;  3WGI A;  3ONQ A;  4XLF A;  4F91 B;  3A1Y A;  4N4N B;  2A3S A;  1RZ4 A;  2F4O B;  3CLQ A;  1YO5 C;  2ID3 A;  1U8R A;  1H8A C;  2LBF A;  1V5G A;  2XRN A;  3FBI B;  4A6E A;  4E7S A;  4F3Q A;  2K85 A;  2R7F A;  3JTH A;  1PDN C;  2BW3 B;  2ELH A;  2GQQ A;  4NNJ A;  4A3M J;  4RAG A;  5AON A;  1Z21 A;  1O4X A;  1B72 B;  1YI2 I;  1WFX A;  5FKM A;  3MWM A;  4CCM A;  1DP7 P;  3P7N A;  3F6O A;  4XR6 A;  3F8M A;  1WZ2 A;  3MZ8 A;  1OYW A;  4PSX A;  5B1B H;  3OYJ A;  2E1N A;  4EEF G;  2V7F A;  2KFD A;  2LF8 A;  4HX7 A;  3VYR B;  1R36 A;  4A3I J;  1MH3 A;  3KX2 A;  3L2U A;  4GFB A;  5E18 F;  3KZZ A;  3L00 A;  4ZZL A;  2O8K A;  1R5H A;  2RVC A;  4KIG A;  3RKX A;  2OBP A;  3DU6 A;  3TQN A;  1SFX A;  3HSR A;  4KT5 C;  1JI8 A;  2HPI A;  2FX0 A;  1AHD P;  2CQN A;  2C6Y A;  3HKZ A;  3WTY C;  1XPX A;  2ELK A;  4E70 A;  5HNF A;  2FNP A;  5CQG A;  5FLX Z;  3WU0 A;  2ZFW A;  5AIQ A;  4IL6 C;  2RQP A;  1OIS A;  3IKV A;  1WJ5 A;  2HU9 A;  3DKW A;  4A3E J;  2Q1Z B;  4N9H A;  1VQ8 I;  1BL0 A;  2P81 A;  1EA3 A;  1QO0 D;  1NH3 A;  5FLM J;  1F4K A;  1FTT A;  2IGK A;  1X1B A;  1W5T A;  2LC2 A;  3ZQG A;  1BR1 A;  3GCM A;  4B3X A;  1EF4 A;  1LVK A;  1BOB A;  3WG7 H;  3CO6 C;  2W85 A;  2OTL I;  2V1D A;  2G7U A;  3BQY A;  1P92 A;  2NOJ B;  4BJ6 C;  1ZRC A;  4HPQ A;  3LSI A;  4A93 J;  3CUQ A;  3WHC A;  2ZSI B;  5LRR A;  1ZK8 A;  3X2Q H;  1JKR C;  2F5F A;  4A0X A;  2LK2 A;  5LLQ A;  1I27 A;  2E7W A;  2E1C A;  3BR3 A;  4LIV A;  3CC2 I;  4C9Y A;  1LB2 A;  3OYC A;  1DPR A;  2IEK A;  2KZV A;  2KIF A;  4LLL A;  3HIF A;  2NVT J;  5J47 A;  3AL0 B;  5L3E A;  2F6C A;  2VON A;  3J81 Z;  3ZN0 A;  1IXC A;  4OMY A;  4XM3 A;  1SVL A;  3SFZ A;  2BYV E;  2IS2 A;  2JA2 A;  1KON A;  3BTJ A;  3DTE A;  5J6X A;  2K9S A;  3EYI A;  4KJZ A;  4BHP A;  1MBH A;  5IT9 Z;  1YW7 A;  3TGN A;  3L2Q A;  5DV5 A;  5D4R A;  2P8T A;  3PM1 A;  1J75 A;  1TNT A;  1X1P A;  5ICC A;  2DTR A;  1SFO J;  2M34 A;  2H1K A;  1POG A;  4RA2 A;  4LFU A;  1GUU A;  5D5X B;  4RM2 A;  2NVQ J;  2LTP A;  4J01 A;  3KP3 A;  4EVI A;  3FXJ A;  3LWF A;  2EFO A;  3U1D A;  4DYC A;  4GYG A;  4P9F A;  2A6E F;  4BQA A;  3FIW A;  5J8F A;  3BOQ A;  1XS9 A;  5DS9 A;  3NAU A;  5ED4 A;  1T2K A;  1I1S A;  2E2J J;  5LEK A;  3I71 A;  3F8F A;  4D5C A;  2M8E A;  2VKD A;  3KP5 A;  2DMT A;  1IG7 A;  1Y1V J;  3AKZ A;  3C1D A;  2CFX A;  5DUI A;  2XRL A;  4II3 A;  1FYK A;  3FF5 A;  1LFP A;  5LGU A;  4IHX A;  3HGG A;  2LKP A;  3K9T A;  3TMO A;  3B6C A;  1R22 A;  2HZD A;  3RDI A;  2VBZ A;  1BN5 A;  1JTX A;  1OYI A;  2LOO A;  1IRG A;  2QCO A;  4RGX A;  5E3L A;  3WG9 A;  2DA3 A;  4HDV A;  4LG0 A;  2NYX A;  2OU2 A;  1J09 A;  2GA1 A;  3DLA A;  1ETQ A;  1XN7 A;  2DMU A;  2EIN H;  2MAB A;  4BQN A;  3CF5 F;  1VQN I;  1HA8 A;  3V8J A;  4ZYD A;  5JVG F;  5D6E A;  4HW0 A;  5TGT A;  2DK5 A;  4H0E A;  2J5O A;  3CCE I;  2HXI A;  1HW5 A;  4D7N A;  5GTI C;  3M3Y J;  4G7O F;  1NG6 A;  4FQG A;  2W00 A;  3UR3 C;  1X58 A;  2CRG A;  3HPG A;  5FD6 A;  3Q5F A;  1HXD A;  1X2N A;  1P9Q C;  2WAE A;  4S04 A;  3I64 A;  4AYB A;  1F1Z A;  3A2K A;  2ESH A;  1TWF J;  2EH3 A;  3Q3S A;  4K2E A;  3I53 A;  5GTH C;  4I0B A;  2JA7 J;  4M3G A;  3SDB A;  2H8W A;  1B4A A;  3IAS 2;  1D3Y A;  1RET A;  3K6G A;  3ERM A;  2HNH A;  1VI0 A;  2MLG A;  3JRG A;  3IV5 A;  2LYC A;  2K5C A;  3ABU A;  2Z5U A;  4BS9 A;  4OIO F;  1SD4 A;  5D4S A;  4L0Y B;  3MEX A;  2PBI A;  2CV2 A;  5IT3 A;  3OYB A;  3HOU J;  4AIK A;  2D2W A;  2HGC A;  3D0S A;  5CYV A;  3JRB A;  1WCM J;  3I59 A;  4UHT A;  3QAH A;  2R7W A;  2HEO A;  3PO3 J;  2BY3 A;  2XV4 S;  4FX0 A;  1YOV B;  3R0J A;  2QKM B;  1JXS A;  2L7K A;  3WOD F;  4GCV A;  3A0B C;  2VLA A;  4M6V A;  1YIT I;  2VPL A;  4XBF A;  3O6B B;  3QP6 A;  2LF7 A;  4EAT A;  1IF1 A;  4IF4 A;  1FBQ A;  3JSP A;  2QYO A;  4KIB A;  3LOC A;  3BRO A;  3BY6 A;  2EV6 A;  3MCZ A;  4UB6 C;  3IAM 2;  2R5Y A;  2QSG X;  1ZRD A;  3PIO F;  4P9U A;  1ZAR A;  1S7A A;  3V7S A;  3TW7 A;  1LJ9 A;  3VYU B;  1IDY A;  2HQN A;  2JQ7 A;  1UHS A;  2TDX A;  3QOD A;  1FPQ A;  4V2G A;  3RCO A;  3J80 K;  3GF2 A;  4EGZ A;  2FA5 A;  5JR3 A;  3S1R J;  1XG1 A;  4U0W A;  3QWL A;  4OU0 A;  3ZPL A;  4PJJ A;  1Y8Q B;  1EH7 A;  2CUE A;  2XF7 A;  3BTC A;  2LY9 A;  3RJP A;  2AXL A;  4IZZ A;  4PJL A;  4YG2 F;  1B9M A;  2PX9 A;  1XGN A;  1VQM I;  1QZZ A;  2OJE D;  3VWB A;  3N05 A;  2DOA A;  1BC7 C;  3P9K A;  2M7B A;  3K4J A;  2Z99 A;  3HRU A;  3GTQ J;  2V1N A;  2VE9 A;  3FMQ A;  1LEA A;  3GFL A;  2R7U A;  2OD5 A;  2EV0 A;  3CES A;  1XDS A;  2K9L A;  2QGU A;  2IS6 A;  2VQG A;  1MJB A;  1FOW A;  3M1C A;  4Y17 A;  2QZ8 A;  2XAG A;  1A31 A;  3OS1 A;  1TNS A;  3B73 A;  3IKT A;  2HOE A;  2VJJ A;  1IGN A;  2M0M A;  4AIJ A;  2VBX A;  2YS9 A;  4AYB N;  1HW1 A;  3I9V 2;  5LBQ A;  5IYD J;  3OOP A;  3DLL F;  5BPI A;  1K83 J;  2DJN A;  2DOF A;  4G12 A;  4BBR J;  3A01 A;  3ECO A;  1B59 A;  1LFB A;  5L3F A;  3IH2 A;  4L18 B;  4CZZ A;  1WI3 A;  2VQH A;  1FZP B;  2EK5 A;  3TP3 A;  1OKR A;  2Q2E B;  4GYI A;  1FNN A;  3S14 J;  3GZ6 A;  4C3I J;  2DT5 A;  3GTG J;  2X1E A;  4Y15 A;  2FQ4 A;  1IW7 F;  1XSX A;  2BXY A;  2R7X A;  2XPV A;  3K4M A;  4PFP A;  1IRF A;  2CS3 A;  2V9P A;  3V7C A;  1WJF A;  3ESW B;  3AFH A;  2XHK A;  3E7L A;  1RES A;  4AC0 A;  4UV9 A;  4HBL A;  5IT9 K;  3RIR A;  3WU2 C;  1A6I A;  4XNF A;  4OIR F;  2PMH A;  5CLS A;  2MH9 A;  3CMA I;  1J59 A;  1QGP A;  3CLO A;  2E5N A;  4ZYE A;  1QZY A;  1XMX A;  2M5W A;  4ESF A;  3DFG A;  2EJR A;  3HOZ J;  4B43 A;  4IHT A;  3JCU C;  1VQL I;  3KET A;  1Z9C A;  2L3D A;  2KT0 A;  5CVV A;  3K4B A;  2DAO A;  1Q1H A;  2W7N A;  1Z91 A;  5IYB J;  2B0L A;  3GXO A;  1SFK A;  1HCR A;  2DDB A;  4RS8 A;  5E8I A;  2XKO A;  1MJ9 A;  4GDF A;  1SVM A;  1U5T C;  3F72 A;  4CCK A;  4XRS A;  2PEX A;  1K79 A;  1JJ8 C;  2IW5 A;  4AM3 A;  4IXA A;  1Y39 A;  3DBH B;  2A6T A;  5DEQ A;  2QF7 A;  3BPV A;  4PJM A;  4KUM A;  2CW7 A;  4EV0 A;  3T1B A;  1SMY F;  2FOK A;  3SQN A;  1ZAO A;  3CCY A;  3WTW C;  3OSG A;  1VQO I;  1YG2 A;  5FRO A;  4W97 A;  1EJ9 A;  1P6R A;  2R7R A;  1AU7 A;  2LRD A;  1TW2 A;  5D6F A;  2EB7 A;  3CCM I;  4M9X A;  4LIU A;  2M0C A;  1A6Q A;  4ZYH A;  2LBF B;  5IP9 J;  4LG0 B;  3K70 D;  3ZQQ A;  3LA2 A;  4XOP A;  2GOM A;  4YFN F;  4O3M A;  2IP2 A;  2ZJQ F;  1H89 C;  1TP4 A;  3LSJ A;  4I2O A;  2HS5 A;  3U21 A;  4BEH A;  3T5X A;  5DYM A;  2GXG A;  2DCE A;  1XDU A;  2ZO4 A;  4KDP A;  2XGX A;  2ZME A;  4RM3 A;  5CVI A;  3A0H C;  3ELK A;  1FLI A;  2PMU A;  3DCF A;  4BBS J;  2MG4 A;  1BW5 A;  1JUM A;  3OS2 A;  3M1E A;  5HDN A;  3FIS A;  4IQJ A;  3K69 A;  1BA5 A;  2L2O A;  2OQR A;  3E3V A;  4A3D J;  3I55 I;  5ICE A;  3KEO A;  3HB9 A;  1I3Q J;  4FHT A;  2BVM A;  5DD8 A;  2K02 A;  2QEX I;  1BJA A;  3I0T A;  4HEA 2;  2CFO A;  2DOE A;  5GP9 A;  2ZXJ A;  1EV7 A;  2M4K A;  4JP0 A;  4E6K G;  4A12 A;  1AKH B;  3ECH A;  4CYC B;  1UG0 A;  5E3M A;  2R7D A;  3HXL A;  3SHF A;  4E7H A;  2R5Z B;  3BZK A;  2P6T A;  5CVR A;  3H5R A;  1FEX A;  1T56 A;  3BTL A;  2DTZ A;  3OYG A;  3G1O A;  2F48 A;  1ZGA A;  2GWR A;  4PJN A;  3BZ6 A;  3L2W A;  1OR7 A;  3CCV I;  1QVT A;  3SXY A;  2DU9 A;  2ZNY A;  3QPH A;  4JX5 A;  4IRH A;  1XC5 A;  3AAF A;  1E3P A;  2HWV A;  2XUB A;  1B6A A;  3G6E I;  3PNT A;  2B9S A;  2MBF A;  3LAJ A;  4O5V A;  3JAM Z;  3ZMZ A;  1R5G A;  4DBQ A;  4XLN F;  3D5R C;  1VQK I;  1ZH5 A;  1DU6 A;  4N0B A;  2EBI A;  2V79 A;  2W48 A;  4FTH A;  3N97 A;  1FIP A;  2E1O A;  2MC4 A;  4AU7 A;  4OIQ F;  1AKH A;  2V6E A;  2FU4 A;  4GXO A;  2DK8 A;  1V55 H;  4I7H A;  3U9G A;  3G73 A;  4WXD A;  1T08 B;  1QRY A;  5HLT A;  3F9K A;  2BZT A;  2M7A A;  3GO5 A;  2O8X A;  5EEH A;  3CZ6 A;  2VBY A;  4CIC A;  4C3J J;  1XGM A;  1SD6 A;  3A03 A;  2LRE A;  2X0L A;  1HDP A;  6PAX A;  1G3T A;  1G8X A;  4UY8 I;  3ASO H;  3EUH C;  3KEQ A;  4H4K C;  4Y4R A;  2O5R A;  3H5A A;  5ICG A;  3RZO J;  2IA0 A;  3FK6 A;  2PJP A;  1MNE A;  2KDO A;  3DTI A;  3CME I;  1HF0 A;  1IN4 A;  3K10 A;  2I10 A;  4LOC A;  1S6L A;  2FRH A;  3HOY J;  2ELJ A;  1X1A A;  2ZXI A;  3S1Q J;  1IDZ A;  1T95 A;  1S5L C;  2VXD A;  2ZFU A;  4ABZ A;  1FSH A;  3K0L A;  5C4J J;  1OMI A;  3DQV C;  2YPR A;  5E20 A;  1XGO A;  3LQR A;  2J5P A;  4IEJ A;  1TTY A;  1ON2 A;  5FJ8 J;  5K5Q A;  5EJC A;  2A07 F;  3SZP A;  2DYR H;  3NWS A;  2OZU A;  2ME0 A;  3FDY A;  4A5N A;  2EA4 A;  2RGV A;  2W24 A;  1STZ A;  5K7F A;  4CXF A;  2ZC2 A;  1ERD A;  2V1U A;  3S2H J;  2R7O A;  2QQA A;  1RR8 C;  4CDG A;  3P9I A;  4E7K A;  2LMD A;  4UVB A;  3IHU A;  1UMQ A;  2FMY A;  4G7H F;  3S3O A;  5HVQ C;  3JAM K;  5IY5 H;  1N25 A;  2QQ8 A;  2DMP A;  2L7F P;  4P5O A;  3OYM A;  1P7J A;  4A69 C;  4AWX B;  3MKY B;  3W2V A;  3DPL C;  1PJR A;  5J8C A;  2UXN A;  3LFK A;  1KYW A;  2A05 A;  1SFU A;  1P7I A;  2VXZ A;  5KCM A;  4KMF A;  1KU2 A;  4RGR A;  3GVA A;  5FO5 A;  3HOV J;  4YEJ A;  3QPS A;  3JRD A;  3JRE A;  3AL0 C;  3K1P A;  1X4O A;  2LY2 A;  3PO2 J;  2VT3 A;  1V5F A;  3F6V A;  1XB4 A;  1EH6 A;  1FC3 A;  1Y6I A;  1IO2 A;  1DU0 A;  4ZJZ A;  1LPQ A;  1R7J A;  4ENN A;  2M2E A;  4C3H J;  2VAS A;  3BTI A;  3HHH A;  3J81 K;  1QZE A;  4BXU A;  4XRF A;  1T38 A;  2E5Z A;  4U87 A;  2CU7 A;  3E5U A;  4RAY A;  1L3L A;  3HUG B;  1RUO A;  4X6A J;  2DT7 B;  1FMW A;  1ENH A;  1YIJ I;  2B63 J;  3UNG C;  4XLH A;  1K6Y A;  5FRN A;  4IHY A;  2KQR A;  1G4D A;  5FLX K;  4RB1 A;  2L9S A;  1MSF C;  2ZXW H;  4UUS A;  4AIH A;  2RKH A;  4AID A;  2Z1D A;  1MBG A;  3Q0V A;  2EIM H;  2LG4 A;  2QUF A;  3OIQ A;  1RI7 A;  3H9G A;  2FML A;  2CUZ A;  1S3J A;  2K27 A;  2HVS A;  3RSN A;  2G7H A;  2H94 A;  4YII A;  4DOZ A;  1D0Z A;  3WE3 A;  1FY7 A;  3G71 I;  1ETK A;  2VQL A;  2RNG A;  3Q9V A;  4WF2 A;  2E34 A;  1UAA A;  4RMN A;  3K4K A;  4X1E A;  1GXP A;  4BJ5 C;  4MTD A;  1D5Y A;  3CDL A;  3W6K B;  1TC3 C;  3KPH A;  1ZRF A;  3MKL A;  1O7L A;  4Q5S F;  1W5C C;  3H0G J;  2BVL A;  2UUZ A;  1IC8 A;  4ESJ A;  2F5E A;  2M4G A;  2ZJR F;  3KZI C;  5BQT A;  1I5Z A;  3K2Z A;  2NRA C;  1ZR2 A;  4ZDP A;  2DFH A;  2MW8 A;  1JKQ C;  5FLV A;  2VC0 A;  1IN8 A;  2H27 A;  3HSF A;  5LGT A;  3Q0U A;  4CSW A;  3ZQ7 A;  5TIS C;  4B09 A;  1YLF A;  1X19 A;  2KMU A;  2WAD A;  3HUG A;  3P5J A;  4XKV A;  1J5Y A;  2JA8 J;  2R5Y B;  4DIQ A;  2ID6 A;  3I4P A;  1ORK A;  2O0Y A;  3S32 A;  1NHA A;  2JRM A;  2MD0 A;  4EJV A;  3ZCO A;  2EFN A;  3ABK H;  1LEB A;  3CJQ B;  2TRT A;  3H3V K;  2FOW A;  2DA1 A;  3IH3 A;  4M71 A;  1H9G A;  5JLX A;  1GDT A;  4UVC A;  2X4H A;  4ENJ A;  4C2T A;  1L0O C;  1XMA A;  2UV1 A;  4L5E A;  1WQ2 A;  2CGP A;  3J7A Y;  4W1U A;  4QWQ A;  2H1L A;  3DEE A;  3TDU C;  1GLN A;  1Z3Y A;  2R93 J;  1AOY A;  2L0K A;  4QPQ A;  3SFI A;  5H2F C;  1MBE A;  3WTU C;  1R23 A;  3OOU A;  1R1V A;  4HNV A;  3SDG A;  4ETS A;  5BPD A;  3L7W A;  2H09 A;  1MJA A;  1MND A;  4OAY A;  2LP0 A;  1UHM A;  2HDW A;  3OYF A;  3NWT A;  1OCR H;  2CO5 A;  2KL4 A;  3RKQ A;  1T8I A;  4XLE A;  1O3Q A;  3MZH A;  2QSF X;  1X4P A;  2PJR A;  3GFM A;  2O9L A;  2XSJ C;  4PSW A;  2BOL A;  2BBY A;  4M6Y A;  4M72 A;  1AWC A;  2DMN A;  3C3W A;  3GUD A;  4FX4 A;  4DGW B;  3ZMU A;  5HS7 A;  1KU3 A;  2X1D A;  2QQ9 A;  2F5D A;  1UFM A;  3VYS B;  3L09 A;  1EH8 A;  2A69 F;  5J3L A;  3S15 J;  3KP4 A;  2PFB A;  4R79 A;  1D8K A;  2XAH A;  3VOD A;  5C3E J;  1QNT A;  3NRV A;  3J80 Z;  3MKW B;  1IAW A;  2IS1 A;  4LLN A;  3C2H A;  4BU2 A;  2M1B A;  4B44 A;  3V4G A;  2L7M P;  5LD2 C;  2GIV A;  1UJ8 A;  2E36 A;  4OMZ A;  3ZMS A;  5EZG A;  1OQY A;  2K9M A;  3OIP A;  1S72 I;  4M3F A;  4MFD A;  3OL3 A;  1TT0 A;  4Y33 A;  4D5F A;  2IGN A;  3I5U A;  2XAF A;  3RQI A;  3GLX A;  4UV8 A;  3A02 A;  3K2A A;  4Z6Y A;  1TQI A;  1Z3X A;  1VZ0 A;  3B02 A;  5J40 A;  1MBK A;  2AHQ A;  3LL7 A;  3S2D J;  4ITV A;  5D5V B;  2VQC A;  4XKC A;  2WAQ A;  4LG3 A;  4NC6 A;  4E7I A;  2QEN A;  1E2X A;  3TL4 X;  2MYS A;  2W1O A;  1YTY A;  2E2H J;  1YFH A;  1K4T A;  1FYL A;  2HTS A;  4QIW N;  4AUX A;  2COB A;  1MKM A;  2M9H A;  4KMU X;  1HW2 A;  1YX5 A;  3NEU A;  1PYV A;  2Y75 A;  4E7J A;  1LE8 A;  4F92 B;  2WWY A;  2ZB9 A;  3BC8 A;  3TED A;  1W0T A;  3S1N J;  3H1C A;  2LNB A;  3MQ0 A;  1RR7 A;  2L5Q A;  4JX6 A;  1J7K A;  1JHH A;  3GZ5 A;  5BOX A;  3GTP J;  4HA8 A;  4NDL A;  1Y0U A;  1BJZ A;  2HKX A;  3QU3 A;  2KJB A;  4A0Y A;  1HST A;  4HST A;  3BLY A;  3ZGK A;  4LK1 F;  3EYY A;  2L54 A;  5M3F J;  3HKZ N;  3UKG A;  4IOC F;  3OV8 A;  1HOM A;  2Y9Z A;  4DJA A;  4U0Y A;  2E1M C;  2DO7 A;  2A6H F;  4HQM A;  2WB1 N;  2MH2 A;  2XGE A;  3CQZ J;  4NBQ A;  2VOD A;  3KYC B;  3FX3 A;  5D8K B;  3OYD A;  3V8L A;  1H88 C;  3ASN H;  1YS6 A;  2CQK A;  4BH9 A;  3BPX A;  5GAD J;  3E0J B;  3FMS A;  2BGC A; 
#chains in the Genus database with same CATH homology
 1FBU A;  2MC3 A;  4M73 A;  1TLH B;  2P4W A;  4EJT A;  2IA2 A;  1CF7 B;  1HSJ A;  2QBY B;  3GEZ A;  1FYM A;  3ERE D;  2ZNZ A;  3V8K A;  5E1W A;  1P2F A;  1F5T A;  1J2X A;  4WXH A;  1S8N A;  3L9F A;  2A61 A;  2HYF A;  2ZME B;  2P5L C;  2UWM A;  4L9T A;  1DPU A;  2FNA A;  1IUY A;  3HOS A;  2NNN A;  5LRS A;  2P6S A;  4Y13 A;  4EMS A;  1LQ1 A;  3ZMT A;  1R1U A;  2IVM A;  4MGR A;  1ZG1 A;  2JPC A;  4EJU A;  3FMR A;  2RDP A;  2FXA A;  2Y0M A;  1BI1 A;  1HBX G;  2L02 A;  2RNJ A;  2K7L A;  5HLH A;  3GYH X;  3M9A A;  2O6G E;  3HOT A;  2HQR A;  2OA4 A;  4A2U A;  3MFK A;  1WKM A;  3J7A O;  1ZGJ A;  4G6D A;  3JTG A;  4JQF A;  2OQG A;  1V3F A;  4LLG F;  4L5J A;  4EQQ A;  1P4X A;  2NS0 A;  1WSU A;  3WTT C;  2JT1 A;  3CO7 C;  1KU9 A;  2JRT A;  3F21 A;  2NNY A;  3DPT A;  4BHC A;  1GHC A;  1FBS A;  3TO7 A;  2K4B A;  4RB0 A;  1QBJ A;  1XCB A;  1K7A A;  3HHG A;  4G8X A;  2MA3 A;  3HRS A;  4I09 A;  4G6Q A;  1BI0 A;  1O7F A;  1WWX A;  3CJN A;  4LJZ F;  5DCM A;  2CSO A;  2HTJ A;  2Q2E A;  4I02 A;  4M9S A;  5E17 F;  4P55 A;  2XVC A;  2F5C A;  4Q47 A;  3G3Z A;  1K78 B;  5AIP A;  3H3U A;  2O61 A;  1U6G A;  2H6B A;  4XSZ F;  4L9V A;  2V1X A;  4FT8 A;  1SAX A;  3RYP A;  4IRI A;  1TQP A;  1O3R A;  3VEP A;  3E5X A;  4IJA A;  2DPU A;  3R4K A;  1I6X A;  4KIF A;  2ACJ A;  1W7P D;  3K1M A;  4AVP A;  2HFH A;  1SFE A;  2XIG A;  4MTE A;  3I59 B;  3ISP A;  2EA2 A;  4KN4 X;  3E6B A;  5LHI A;  3FM3 A;  5K1Y A;  3CUO A;  4IRG A;  1ZN2 A;  3VOE A;  2DW4 A;  2L01 A;  3HYI A;  2PN6 A;  5F64 A;  1ZLK A;  5H20 A;  2PQ8 A;  2XAJ A;  1Z6R A;  1IXR C;  1MD0 A;  3H3Z A;  1FWZ A;  1BI3 A;  2EFW A;  1LDJ A;  1T0F A;  2Q8K A;  1JGS A;  3ABT A;  4L9J A;  2WV0 A;  1BI2 A;  1ULY A;  2DI3 A;  3KFW X;  2DBB A;  2FBK A;  1YYV A;  3EUH A;  1ZYR F;  4A5M A;  1IN5 A;  5ILU A;  4L9N A;  1IN6 A;  4M6X A;  3D5L A;  2Z33 A;  4ENM A;  1CF7 A;  4Q4Z F;  1Z1D A;  3FMS A;  2UZK A;  4MNU A;  3EET A;  1U78 A;  1U5T A;  5DCF A;  3WTX C;  1PP7 U;  1YS7 A;  2JSC A;  2JTV A;  4EM1 A;  5TRD A;  1A04 A;  3WTZ A;  2AS5 F;  1HKS A;  4RAZ A;  2PI0 A;  4GGG A;  4S05 A;  2D1H A;  1TQM A;  4UVA A;  1MDM A;  1XMK A;  2ZBK A;  2PG4 A;  5HOO A;  2ISZ A;  3CTA A;  1O3T A;  3TO6 A;  2BEO A;  1HQC A;  5K5R A;  3FHZ A;  2RV8 A;  3KLN A;  4G94 A;  1O3S A;  1QPM A;  4BYY A;  2K86 A;  2FSW A;  2VBW A;  2HZT A;  3KP7 A;  4NQW A;  4OOI A;  3C18 A;  2DFI A;  1XGS A;  2GA2 A;  2OZ6 A;  3TO9 A;  1FP1 D;  3T8R A;  2IRF G;  4M9Z A;  5HS9 A;  3JSO A;  2IPQ X;  5ERI A;  3FXR A;  4ENK A;  3HRT A;  2FF4 A;  1KU7 A;  2YU3 A;  3BP8 A;  5E8G A;  3GW2 A;  2GZW A;  3IRR A;  1CGP A;  4IHS A;  4ZYG A;  5LHG A;  1E17 A;  2FQ3 A;  1G6N A;  3QP5 A;  1GVJ A;  4UUV A;  1VTN C;  4IVN A;  4LD5 A;  3RYR A;  4N9I A;  5DUK A;  1W4M A;  2HDC A;  4GO1 A;  4DNC A;  5A2Q Z;  3PQJ A;  4HX8 A;  3RPQ A;  1IXS B;  4R1H A;  1T39 A;  1ONV A;  2BE5 F;  1B1B A;  3F8C A;  4UNO A;  4P96 A;  4HF2 A;  2STT A;  3LQQ A;  2Z3Y A;  3IC7 A;  5ICF A;  3KP2 A;  4D0P A;  1FSE A;  5F6F A;  3COA C;  3F3X A;  3BDD A;  2KIU A;  2COM A;  2KIM A;  4NB5 A;  2IJL A;  4A6D A;  3E6C C;  5D5U B;  3TOA A;  4Z2Y A;  1BM9 A;  1W7P A;  3IWF A;  5FFX A;  1RIO H;  2KRF A;  1BIA A;  5CVU A;  4B8X A;  3QU6 A;  4I98 B;  1TW3 A;  2ESN A;  3I58 A;  5DDG A;  1ODD A;  4WCG A;  1ZG3 A;  3P9C A;  2W57 A;  2FBI A;  1RUN A;  5E1X A;  1YW8 A;  5HDK A;  5DD4 A;  1I1G A;  3WTS C;  4PGG A;  2Q0O A;  2M45 A;  2G9W A;  3BWG A;  4RGS A;  4LK0 F;  2EWN A;  5L3G A;  1UCR A;  1D5V A;  1V4R A;  3RKY A;  1H9T A;  1RNL A;  1DUX C;  5L3B A;  2P5K A;  3KE2 A;  1JHF A;  1Z05 A;  2Y48 A;  5BMZ A;  3WGG A;  1KQ8 A;  4QLC U;  2W84 A;  3VFZ A;  4ZZD A;  1LDK B;  1XSV A;  5JI6 A;  2FBH A;  2PLY A;  1KQ9 A;  4KA4 A;  2A68 F;  4HLY A;  3GX4 X;  3RPU A;  4OIN F;  1S29 A;  2Z9O A;  4KFC A;  3E6M A;  1H0M A;  3ULQ B;  3W6J B;  5JFR A;  2KKO A;  1Z6T A;  3ZP5 A;  4MQV A;  4RB2 C;  1PP8 F;  2VE8 A;  3QRF F;  2QWW A;  3N4M A;  2WTE A;  4LMY A;  1FP2 A;  2ZCW A;  4BNC A;  3F8N A;  4G9Y A;  2XKP A;  4U7D A;  1UST A;  1LNW A;  5JVT A;  4YFX F;  5FD5 A;  2L4M A;  2O3F A;  2M87 A;  1YW9 A;  5CJ9 A;  4ZH4 F;  3TOB A;  4TV7 A;  1KYZ A;  3E5Q A;  4EJW A;  1S7O A;  4KIC A;  1P4W A;  4MQ9 F;  2DQL A;  2LSO A;  3BJA A;  3BJO A;  2NAZ A;  2JPB A;  5BS6 A;  2QBY A;  3GFJ A;  4DQ2 A;  4JBA A;  4HF1 A;  4HYE A;  3ZMV A;  4PCQ A;  4YFK F;  4ASN A;  1KA8 A;  4RGU A;  1UHW A;  1PUE E;  4JK1 X;  1WRJ A;  1W7P B;  3IL2 A;  3U2R A;  2VOP A;  3DF8 A;  1QQI A;  4ON0 A;  3HTS B;  2EV5 A;  3BJ6 A;  1XD7 A;  2CG4 A;  4CO8 A;  5L3D A;  1WI9 A;  3H92 A;  1SMT A;  1MGT A;  2HYG D;  4HX4 A;  4I0A A;  1MDM B;  1LVA A;  5EEG A;  4I01 A;  4HLX A;  2P5V A;  1F9N A;  2YX7 A;  3IRQ A;  4PDK A;  3GFI A;  1BBY A;  3SZT A;  1LDD A;  1T6S A;  1ZHF A;  2YR2 A;  5ILS A;  1BIB A;  4KNY A;  2LDU A;  2QM3 A;  5LGN A;  2FEZ A;  1DDN A;  4U7B A;  3HSE A;  5TJJ A;  2P7C B;  4BAY A;  4WXC A;  1KGS A;  1YIO A;  4O6J A;  3NQO A;  1SD7 A;  3TDZ C;  2P7V B;  3LST A;  3E97 A;  3ML6 A;  4ESB A;  3JW4 A;  4LGW A;  3CUQ B;  2MD5 A;  1IZ1 A;  3IWZ A;  4KYW A;  5HDG A;  4CYD A;  4CGZ A;  4HV6 A;  1XCV A;  5JHU A;  2DQR A;  3KP6 A;  1ZLJ A;  1HKQ A;  3M8E A;  3KLO A;  1D8J A;  2RC4 A;  4M74 A;  3QPT A;  1X3U A;  1FOK A;  3E6D A;  4YIF A;  1G3Y A;  1SD5 A;  2RN7 A;  1REP C;  2GXB A;  5L3C A;  5H6Q A;  3PFI A;  3FM5 A;  3LA7 A;  1B9N A;  3WE2 A;  4UXN A;  5HLG A;  2GAU A;  4PZJ A;  2V9V A;  4EM2 A;  2ISY A;  1HKT A;  3T0Y A;  2H6C A;  1R00 A;  5A2Q K;  3KZY A;  1U2W A;  4EGY A;  2DLL A;  3R61 A;  3O3K A;  1Z7U A;  2A5Y B;  2M30 A;  3R6S A;  3WTV C;  4HOB A;  3ROU A;  4EJO A;  2DPD A;  2BV6 A;  1ZRE A;  1T98 A;  5F1R A;  2XAS A;  1P4A A;  2OAZ A;  1MZB A;  2L4A A;  4BHB A;  1ON1 A;  2KJC A;  4RB3 C;  3KCC A;  2CW0 F;  3M8F A;  2K4J A;  2VN2 A;  4L5I A;  2XAQ A;  2F2E A;  3S2W A;  4LB5 A;  5DCM B;  3R60 A;  1U5T B;  2EFQ A;  3LAP A;  3FXQ A;  1GXQ A;  4XSX F;  5FGM A;  3DP7 A;  3V7R A;  4U0V A;  1G3W A;  1FT9 A;  1IN7 A;  3RKW A;  4CHU A;  3L2C A;  1J0R A;  4MHG A;  3GWZ A;  3ZN1 A;  3VB2 A;  2QLZ A;  3FWE A;  2XRO A;  3LA3 A;  2O03 A;  1FX7 A;  1BOA A;  3DXJ F;  3R0A A;  1R1T A;  4Q48 A;  2QVO A;  2IT0 A;  2HR3 A;  3F8B A;  3RI4 A;  1USS A;  3MZY A;  4HDU A;  2VOO A;  5H6R A;  2ZJ2 A;  3DEU A;  4HZF A;  1K6O A;  4LB6 B;  4G7Z F;  4OIP F;  4WK8 F;  5HS8 A;  2MLK A;  1BC8 C;  5KK1 A;  4L0Z B;  1ZG5 A;  2R3S A;  3CUQ C;  3EQL F;  3WGH A;  3REO A;  2VT2 A;  5FB2 A;  4IPA A;  2D1V A;  1UB9 A;  4R8H A;  2HKO A;  2ETH A;  3PQK A;  3O2P E;  1YQA A;  2E7X A;  3Q9S A;  4NHJ A;  4PGH A;  5D5W B;  3MAJ A;  1KQ0 A;  4AD9 A;  3F22 A;  1W5S A;  3FZV A;  2FE3 A;  4MEY F;  4KN7 X;  1OPC A;  5LHH A;  2V6C A;  1R58 A;  1XSD A;  4U88 A;  4EM0 B;  5ILV A;  1G3S A;  2W25 A;  2CYY A;  5FFZ A;  3TKY A;  2QQB A;  3WU1 B;  4HQE A;  4F7Z A;  4HF0 A;  2D45 A;  4HAM A;  3HTU A;  1O57 A;  5D8L B;  2UXX A;  5LEJ A;  4WX9 A;  5CVJ A;  2JZY A;  5E1Z B;  1U3E M;  4XLP F;  2YSR A;  5HLI A;  5KVR A;  3RTR A;  1OYY A;  2EFP A;  4A0Z A;  2CWE A;  2ZKZ A;  1TBX A;  2IA1 A;  3DV8 A;  2ADU A;  1JE8 A;  3I54 A;  4MEX F;  1J9I A;  3C7J A;  2STW A;  5K5O A;  3K1N A;  3HRM A;  3QOP A;  1C0W A;  2YX4 A;  3F23 A;  3ZMD A;  3EDP A;  2WC2 A;  2VC1 A;  3CDH A;  4HV5 A;  3M7G A;  3T8T A;  3FXU A;  4WWC A;  3WGI A;  1YO5 C;  2A3S A;  1RZ4 A;  1U8R A;  2XRN A;  4A6E A;  2R7F A;  3JTH A;  1PDN C;  2ELH A;  2GQQ A;  5AON A;  3MWM A;  1DP7 P;  3P7N A;  3F6O A;  3F8M A;  1OYW A;  2E1N A;  4HX7 A;  2LF8 A;  1R36 A;  5E18 F;  3KZZ A;  3L00 A;  4ZZL A;  1R5H A;  2RVC A;  4KIG A;  3RKX A;  2OBP A;  3TQN A;  1SFX A;  3HSR A;  4KT5 C;  2C6Y A;  3WTY C;  4E70 A;  2FNP A;  5FLX Z;  3WU0 A;  2ZFW A;  5AIQ A;  2RQP A;  3IKV A;  3DKW A;  4N9H A;  1QO0 D;  1F4K A;  1W5T A;  3CO6 C;  2W85 A;  2V1D A;  2G7U A;  1P92 A;  1ZRC A;  3CUQ A;  5LRR A;  2F5F A;  4A0X A;  5LLQ A;  1I27 A;  2E7W A;  2E1C A;  1LB2 A;  1DPR A;  2KIF A;  4LLL A;  3HIF A;  5L3E A;  2VON A;  3J81 Z;  3ZN0 A;  1IXC A;  4OMY A;  3SFZ A;  2BYV E;  5J6X A;  3EYI A;  5IT9 Z;  1YW7 A;  3TGN A;  5D4R A;  5DV5 A;  2P8T A;  1J75 A;  1TNT A;  5ICC A;  2DTR A;  4LFU A;  5D5X B;  3KP3 A;  4EVI A;  3LWF A;  2EFO A;  3U1D A;  4GYG A;  4P9F A;  2A6E F;  4BQA A;  5J8F A;  3BOQ A;  5ED4 A;  1T2K A;  1I1S A;  5LEK A;  3I71 A;  3F8F A;  2M8E A;  3KP5 A;  3C1D A;  2CFX A;  5DUI A;  1FYK A;  3FF5 A;  5LGU A;  2LKP A;  3K9T A;  1R22 A;  3RDI A;  2VBZ A;  1BN5 A;  1OYI A;  1IRG A;  4RGX A;  3WG9 A;  4HDV A;  4LG0 A;  2NYX A;  2OU2 A;  2GA1 A;  1XN7 A;  3V8J A;  4ZYD A;  5D6E A;  4HW0 A;  2DK5 A;  4H0E A;  2J5O A;  1HW5 A;  4G7O F;  5FD6 A;  3Q5F A;  1HXD A;  4S04 A;  3I64 A;  1F1Z A;  2ESH A;  4K2E A;  3I53 A;  4I0B A;  1B4A A;  1D3Y A;  2MLG A;  3ABU A;  2Z5U A;  4OIO F;  1SD4 A;  5D4S A;  4L0Y B;  3MEX A;  2PBI A;  5IT3 A;  4AIK A;  2D2W A;  2HGC A;  3D0S A;  5CYV A;  4UHT A;  3I59 A;  2HEO A;  3QAH A;  2XV4 S;  4FX0 A;  3R0J A;  1JXS A;  3WOD F;  4GCV A;  4XBF A;  3O6B B;  3QP6 A;  2LF7 A;  1IF1 A;  4IF4 A;  1FBQ A;  3JSP A;  2QYO A;  4KIB A;  3BRO A;  3BY6 A;  2EV6 A;  3MCZ A;  1ZRD A;  4P9U A;  1ZAR A;  1S7A A;  3V7S A;  1LJ9 A;  2HQN A;  2TDX A;  1FPQ A;  3J80 K;  3GF2 A;  4EGZ A;  2FA5 A;  5JR3 A;  4U0W A;  4OU0 A;  3ZPL A;  1EH7 A;  3RJP A;  2AXL A;  4YG2 F;  1B9M A;  1XGN A;  1QZZ A;  1BC7 C;  3P9K A;  2Z99 A;  3HRU A;  2VE9 A;  3FMQ A;  1LEA A;  3GFL A;  2OD5 A;  2EV0 A;  1XDS A;  1MJB A;  4Y17 A;  2QZ8 A;  2XAG A;  1TNS A;  3B73 A;  3IKT A;  2HOE A;  4AIJ A;  2VBX A;  1HW1 A;  5LBQ A;  3OOP A;  5BPI A;  1K78 A;  3ECO A;  1B59 A;  5L3F A;  4L18 B;  4CZZ A;  1FZP B;  2EK5 A;  1OKR A;  4GYI A;  1FNN A;  3GZ6 A;  2DT5 A;  4Y15 A;  1IW7 F;  1XSX A;  1IRF A;  3V7C A;  2XHK A;  4UV9 A;  4HBL A;  5IT9 K;  3RIR A;  4OIR F;  2PMH A;  5CLS A;  2MH9 A;  1J59 A;  1QGP A;  3CLO A;  4ZYE A;  1QZY A;  2M5W A;  4ESF A;  3DFG A;  2EJR A;  4IHT A;  3KET A;  1Z9C A;  2L3D A;  5CVV A;  2DAO A;  1Q1H A;  1Z91 A;  2B0L A;  3GXO A;  4RS8 A;  5E8I A;  2XKO A;  1MJ9 A;  1U5T C;  3F72 A;  2PEX A;  1K79 A;  2IW5 A;  4IXA A;  5DEQ A;  3BPV A;  4KUM A;  4EV0 A;  3T1B A;  1SMY F;  2FOK A;  3SQN A;  1ZAO A;  3WTW C;  1YG2 A;  1P6R A;  1TW2 A;  5D6F A;  2EB7 A;  4M9X A;  4ZYH A;  4LG0 B;  3LA2 A;  4YFN F;  4O3M A;  2IP2 A;  4I2O A;  2HS5 A;  3T5X A;  5DYM A;  2GXG A;  1XDU A;  2ZO4 A;  4KDP A;  2XGX A;  2ZME A;  5CVI A;  3ELK A;  1FLI A;  2PMU A;  3M1E A;  5HDN A;  3K69 A;  2OQR A;  3E3V A;  5ICE A;  3KEO A;  4FHT A;  5DD8 A;  2K02 A;  1BJA A;  3I0T A;  2ZXJ A;  1EV7 A;  4A12 A;  3ECH A;  2R7D A;  3SHF A;  2P6T A;  5CVR A;  1ZGA A;  2GWR A;  3BZ6 A;  1OR7 A;  3SXY A;  2DU9 A;  2ZNY A;  3QPH A;  4IRH A;  3AAF A;  2HWV A;  2XUB A;  1B6A A;  2MBF A;  3LAJ A;  4O5V A;  3JAM Z;  3ZMZ A;  1R5G A;  4XLN F;  1ZH5 A;  4N0B A;  2V79 A;  3N97 A;  4OIQ F;  2FU4 A;  4GXO A;  2DK8 A;  3U9G A;  3G73 A;  4I7H A;  4WXD A;  3GO5 A;  2O8X A;  5EEH A;  2VBY A;  4CIC A;  1XGM A;  1SD6 A;  2X0L A;  6PAX A;  1G3T A;  3KEQ A;  5ICG A;  2IA0 A;  2PJP A;  1IN4 A;  1S6L A;  2FRH A;  1FSH A;  3K0L A;  1OMI A;  3DQV C;  2YPR A;  5E20 A;  1XGO A;  3LQR A;  2J5P A;  1TTY A;  1ON2 A;  5K5Q A;  2A07 F;  3SZP A;  2OZU A;  4A5N A;  2EA4 A;  2RGV A;  2W24 A;  1STZ A;  4CXF A;  2V1U A;  2QQA A;  4CDG A;  3P9I A;  4UVB A;  3IHU A;  2FMY A;  4G7H F;  5HVQ C;  3JAM K;  4P5O A;  4AWX B;  3DPL C;  5J8C A;  2UXN A;  3LFK A;  1KYW A;  1SFU A;  2VXZ A;  4KMF A;  1KU2 A;  4RGR A;  3GVA A;  5FO5 A;  3K1P A;  2VT3 A;  3F6V A;  1XB4 A;  1EH6 A;  1FC3 A;  1R7J A;  4ENN A;  3J81 K;  3HHH A;  4BXU A;  4XRF A;  1T38 A;  3E5U A;  4RAY A;  1L3L A;  1RUO A;  1G4D A;  5FLX K;  4RB1 A;  4AIH A;  2RKH A;  2QUF A;  1RI7 A;  2FML A;  1S3J A;  2K27 A;  2G7H A;  2H94 A;  4YII A;  3WE3 A;  1FY7 A;  3Q9V A;  4WF2 A;  1GXP A;  4MTD A;  3W6K B;  1ZRF A;  1O7L A;  4Q5S F;  4ESJ A;  2F5E A;  5BQT A;  1I5Z A;  3K2Z A;  2NRA C;  2VC0 A;  1IN8 A;  2H27 A;  3HSF A;  5LGT A;  3ZQ7 A;  4B09 A;  1YLF A;  3HUG A;  1J5Y A;  3I4P A;  2O0Y A;  1NHA A;  4EJV A;  2EFN A;  1LEB A;  4M71 A;  1H9G A;  4UVC A;  2X4H A;  4ENJ A;  1L0O C;  1XMA A;  1WQ2 A;  2CGP A;  4QWQ A;  3TDU C;  1AOY A;  3WTU C;  1R23 A;  1R1V A;  5BPD A;  4ETS A;  3L7W A;  2H09 A;  1MJA A;  1UHM A;  2CO5 A;  1O3Q A;  3MZH A;  3GFM A;  2BBY A;  4M6Y A;  4M72 A;  1AWC A;  3C3W A;  3GUD A;  4FX4 A;  3ZMU A;  5HS7 A;  1KU3 A;  2QQ9 A;  2F5D A;  1UFM A;  3L09 A;  1EH8 A;  2A69 F;  3KP4 A;  2PFB A;  4R79 A;  1D8K A;  2XAH A;  3VOD A;  1QNT A;  3NRV A;  3J80 Z;  1IAW A;  4LLN A;  2M1B A;  3V4G A;  2GIV A;  4OMZ A;  3ZMS A;  3I5U A;  2XAF A;  3GLX A;  4UV8 A;  1TQI A;  3B02 A;  5D5V B;  2QEN A;  1E2X A;  1YTY A;  1YFH A;  1FYL A;  2HTS A;  1MKM A;  1HW2 A;  4KMU X;  3NEU A;  2Y75 A;  2WWY A;  3MQ0 A;  2LNB A;  1J7K A;  1JHH A;  3GZ5 A;  5BOX A;  4HA8 A;  1Y0U A;  2HKX A;  3QU3 A;  2KJB A;  4A0Y A;  1HST A;  4LK1 F;  3EYY A;  2L54 A;  3OV8 A;  4U0Y A;  2DO7 A;  2A6H F;  4HQM A;  2MH2 A;  2VOD A;  3FX3 A;  5D8K B;  3V8L A;  4BH9 A;  1YS6 A;  2CQK A;  3BPX A;  4BHP A;  2BGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...