3CUOA

Crystal structure of the predicted dna-binding transcriptional regulator from e. coli
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
98
structure length
98
Chain Sequence
MTELAQLQASAEQAAALLKAMSHPKRLLILCMLSGSPGTSAGELTRITGLSASATSQHLARMRDEGLIDSQRDAQRILYSIKNEAVNAIIATLKNVYC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized HTH-type transcriptional regulator ygaV
publication title The crystal structure of the predicted DNA-binding transcriptional regulator from E. coli.
rcsb
source organism Escherichia coli k12
molecule tags Transcription regulator
total genus 31
structure length 98
sequence length 98
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3cuoA00
2EFWA 3WU1B 4XLPF 2OQRA 3Q5FA 2WC2A 4KNYA 1UHMA 4XRFA 2HYFA 1XMAA 1G3SA 4UVAA 5LGUA 1KA8A 1Z7UA 3FHZA 4M6YA 3GFIA 2P7VB 1HSTA 3H92A 5D5VB 3GO5A 3WTVC 4RB0A 4I0AA 2MH2A 3GLXA 2Z33A 5ILUA 2FF4A 2WWYA 1ZYRF 3M7GA 5H6RA 3LSTA 3KCCA 5LLQA 1CF7B 2OZ6A 3K1NA 4MTEA 4XBFA 4ZYGA 2ZJ2A 4RAZA 3ZPLA 4DQ2A 3K1MA 2L4MA 3TO6A 1CGPA 3ECOA 3VODA 1XCBA 4U0VA 1F5TA 1JXSA 2KKOA 1XDUA 3CUQB 2QENA 4L9VA 1PP8F 4L9JA 2O3FA 2IW5A 3C3WA 1DDNA 2JPCA 4ESBA 2VT2A 3LAPA 2AS5F 3EQLF 4IPAA 4N9IA 5LHGA 3R60A 3CO7C 5AIQA 4AWXB 2A6HF 1MJ9A 5F64A 3GYHX 1ZGJA 1G3WA 2O6GE 2K27A 2KIUA 4RGXA 1JGSA 1ZRFA 3VOEA 5FB2A 4WK8F 3E6MA 2ZFWA 2DAOA 5L3FA 4IRGA 3C18A 1MJAA 2HKXA 4IXAA 1WRJA 1B9NA 1MD0A 2TDXA 5AONA 3J81K 4P55A 2DQLA 4NHJA 2IP2A 2HZTA 1LDDA 3JW4A 4HQEA 4CZZA 1CF7A 1Y0UA 2W24A 2H27A 2BV6A 3ABUA 2RDPA 2O8XA 1B9MA 1TW2A 4GO1A 1IF1A 4BXUA 2L4AA 3SHFA 2OQGA 3KE2A 4HDUA 4D0PA 4LLGF 3BPVA 3CUQA 1XDSA 3KP6A 1OMIA 2HQNA 3HTUA 4OIPF 1L3LA 4UVCA 4FT8A 3RTRA 4HF1A 1Z05A 3I54A 2Y48A 4OMYA 1DPUA 2O61A 3DP7A 1YTYA 4GYGA 3QPTA 1MDMB 1YQAA 2PBIA 2AXLA 4MHGA 2XUBA 1ZHFA 1K79A 3KP7A 4HAMA 3CLOA 3BJ6A 4KICA 1R00A 1FOKA 3OOPA 3P9IA 1E2XA 2BGCA 1XGMA 1S7AA 4BAYA 3I53A 5F6FA 5LGNA 4YIIA 1XGOA 2LNBA 2IPQX 3IKTA 1G3YA 2RN7A 5HS9A 6PAXA 4OMZA 4WCGA 4CYDA 2A68F 2KJBA 2MBFA 3L9FA 2DK8A 2X0LA 3NEUA 2QQBA 1J7KA 1QQIA 4KN7X 5LHHA 4EMSA 4A0YA 3IHUA 2XIGA 3DPTA 1O3RA 3F22A 1LEAA 1YS6A 4YIFA 3IL2A 4RB1A 4RGSA 2V1XA 3WGIA 3DQVC 2F5FA 2FMLA 1LVAA 2EFQA 3V8LA 1BIAA 2XGXA 3BDDA 4GGGA 5DEQA 1MGTA 1TW3A 1FLIA 2PMHA 3MWMA 5K5RA 5D5WB 2CG4A 1OKRA 3G3ZA 1U8RA 3HHGA 1T0FA 2IVMA 1MDMA 3LQQA 5D4RA 2HS5A 2L01A 4Q48A 1AOYA 2VE8A 3F72A 2MC3A 2IA2A 2STWA 3P9KA 4ESFA 1TQPA 1GHCA 2NRAC 1D8KA 3BY6A 3WTSC 4TV7A 4HV5A 1FP2A 2QWWA 4QLCU 1OYWA 2C6YA 1GXPA 2HTSA 2EA2A 4B8XA 3I71A 4XSZF 4R8HA 2VBXA 4EM1A 3ZMVA 1S29A 2P8TA 5J8FA 2OAZA 4HX4A 2BEOA 2D1VA 1BC7C 4EVIA 5JHUA 2XAQA 1Z91A 2P5LC 3GX4X 4ETSA 4RB3C 1I6XA 4MEXF 2NS0A 1R5HA 2Q8KA 4RGUA 2ESNA 3WE3A 5ICFA 3ZP5A 4CDGA 5ICEA 1UHWA 3PQKA 5JR3A 2NYXA 2V79A 1OPCA 1F4KA 4MEYF 1IUYA 4BHCA 2WTEA 1P92A 3C7JA 2OA4A 3PFIA 1I5ZA 1KU9A 2DI3A 1UFMA 3FXQA 3I58A 3WGHA 3F8NA 2CGPA 2A6EF 4PGGA 4L18B 3GEZA 3SZPA 2QBYA 1SMTA 3T1BA 3ML6A 2PMUA 2DBBA 4YFNF 4ZYEA 2ZCWA 1J0RA 1LDJA 4Y13A 4ZZDA 3EUHA 2RQPA 2DT5A 5L3DA 1MKMA 1P4AA 2D45A 1YIOA 5J8CA 1XN7A 4EJOA 1BIBA 4DNCA 4BQAA 2P5VA 3K1PA 2JRTA 2NNNA 2QUFA 3B02A 1QZZA 4LGWA 5E1WA 1O7FA 4JQFA 2ZBKA 1KQ0A 2L54A 3P9CA 4G6QA 2K4BA 3WTUC 2V9VA 1KU2A 4U0WA 2R7FA 2FNAA 3BP8A 4M71A 2KIMA 1U5TA 1SD5A 4B09A 3L09A 4YFXF 3H3ZA 1B6AA 2JSCA 5ED4A 4PDKA 1S3JA 4ESJA 3F8BA 1O7LA 1D5VA 3CO6C 4AIJA 3F23A 2FBHA 2YSRA 3HUGA 3BOQA 1FBSA 2UXXA 2M1BA 5FLXZ 4M72A 3OV8A 4EQQA 2ISZA 4EM0B 5ILVA 1U5TC 1IN5A 5FFZA 4EGZA 2M30A 2A5YB 1IW7F 4ASNA 4A12A 3O6BB 2OBPA 1ZG3A 5TRDA 1Z9CA 2RVCA 1LDKB 4AIHA 3HIFA 3FM5A 3Q9SA 3K0LA 4UUVA 3B73A 2CW0F 2ETHA 2J5OA 5CVJA 2Y75A 4EJWA 2HYGD 4UV9A 4MQVA 1SFEA 4E70A 1J75A 3HTSB 1BOAA 3F8MA 3L2CA 4IRHA 1FPQA 4L9NA 3RKXA 1Z1DA 1DP7P 1BI0A 1JE8A 1ZGAA 2VT3A 3RJPA 3F8FA 2M5WA 3KLNA 3BROA 3T8TA 1YYVA 3E5UA 3V7CA 4HYEA 1PUEE 1I1SA 2IA1A 4EM2A 2H09A 3L7WA 1HSJA 4UNOA 3ULQB 1FT9A 4HBLA 3KFWX 2DQRA 1IN4A 5E17F 1Z6TA 5DYMA 2E1CA 1BM9A 4LJZF 1SD7A 1EV7A 1YW7A 3EDPA 3EETA 1HKSA 2FXAA 4LK1F 5J6XA 1W7PD 1ZG5A 4MQ9F 3LA7A 2O03A 4MNUA 5CVRA 1ZH5A 2UWMA 2GIVA 1K7AA 3BZ6A 1YW9A 3I59B 4WF2A 1XSXA 3FZVA 2IRFG 2ZNZA 4HQMA 1A04A 5BMZA 1YG2A 4BH9A 2VODA 3TKYA 2EFNA 4YG2F 1YO5C 1KQ8A 4P9UA 2G7UA 3J7AO 1QGPA 2M87A 2F5CA 4PZJA 1SFUA 4HV6A 1VTNC 3N97A 4BHBA 1IXCA 5LHIA 2EWNA 1RUOA 3TQNA 2VE9A 1G4DA 3P7NA 4P96A 2ISYA 2HKOA 2FSWA 1TNSA 4RB2C 3E5QA 1WQ2A 3MEXA 1YLFA 3E6BA 1YFHA 3TDUC 5KVRA 2YU3A 2XKOA 3R0JA 4WX9A 3R0AA 4UV8A 2LSOA 5HLIA 3TDZC 3QRFF 3V7SA 4Q5SF 3R4KA 3FMRA 1FC3A 3HOTA 3W6JB 2RV8A 3FWEA 3ZMZA 5DUIA 1QNTA 2XKPA 3WTYC 1F1ZA 3GFLA 1W7PB 2DW4A 4Y17A 2BE5F 2MA3A 4BHPA 1EH8A 4R1HA 1ULYA 4XLNF 3U1DA 3CUQC 3QP5A 5L3CA 3I59A 3LWFA 5CVUA 3DV8A 3J81Z 3ROUA 4L5IA 4CICA 3HSRA 3KP3A 5FO5A 3N4MA 4KMFA 2NAZA 4KYWA 2DPDA 3JAMZ 4KMUX 3DFGA 3R61A 3IKVA 1FBQA 3V8JA 1I1GA 2VBYA 1PDNC 1S7OA 2FBKA 3I4PA 1HW1A 1XGSA 2Z5UA 2NNYA 1O3QA 1R1UA 5DD8A 3QP6A 4O3MA 3DPLC 4G7ZF 3IWFA 1KU7A 2GAUA 3NRVA 3KP2A 1J59A 3DEUA 2LF8A 1FYLA 3K9TA 2G9WA 2XRNA 4S04A 4CHUA 5ERIA 3F8CA 4I98B 3GZ6A 5KK1A 4EJUA 1HKQA 5JFRA 4G8XA 4A2UA 4FX4A 4A0ZA 4KUMA 1RZ4A 2HGCA 5DDGA 2ZNYA 4F7ZA 2E7XA 1U78A 1IRFA 1QZYA 2OD5A 2MLGA 2RKHA 1G3TA 5ICGA 3HYIA 5BPDA 3SFZA 1LB2A 1D3YA 3E3VA 3ISPA 2V1UA 5CVIA 5FD6A 5LEKA 1BI1A 1HXDA 1IRGA 2P4WA 1NHAA 5FD5A 4Y15A 3KP4A 4OU0A 2F2EA 2HWVA 3NQOA 2ADUA 5IT9Z 2KRFA 2JPBA 1R58A 4OIOF 2FMYA 2PLYA 1XSVA 3GWZA 4BNCA 2COMA 4WXHA 3E6DA 2O0YA 2VC0A 2PJPA 3EYIA 4G9YA 2FA5A 4U7BA 5D5XB 1KGSA 1IN6A 1ON1A 4I0BA 5DD4A 2GA1A 1P2FA 2CSOA 1AWCA 2VONA 3QAHA 5L3EA 5L3GA 4KIGA 1KQ9A 4HDVA 4I02A 1HW2A 4IRIA 1GXQA 3M9AA 3ECHA 4LLNA 4QWQA 2HR3A 4G6DA 1YS7A 2OZUA 2QLZA 3BJAA 3GZ5A 4M6XA 5FFXA 1L0OC 2P5KA 1STZA 4U7DA 1HW5A 4ZH4F 4UVBA 2EJRA 4L5JA 2HDCA 4IHTA 5LRRA 3KZYA 5A2QZ 3WTXC 1R23A 5E1XA 1P4WA 1IXRC 2GA2A 2G7HA 1UB9A 3WG9A 5CLSA 4AD9A 1BI2A 4KT5C 5CJ9A 2LDUA 5FLXK 3O2PE 1TTYA 2J5PA 5E8IA 2XV4S 5TJJA 4N9HA 3SQNA 3ABTA 2CQKA 1BC8C 1H9GA 1ZG1A 2R3SA 4ENKA 3TGNA 2HQRA 3I64A 5D8KB 2VBWA 2GXBA 4ZZLA 2PEXA 1FY7A 4A0XA 5D6FA 3VB2A 1R5GA 2MD5A 1OYIA 2LKPA 3IWZA 4ENNA 1O3TA 2IJLA 4M9ZA 2F5DA 4AVPA 4L0ZB 4P9FA 3E97A 2QQ9A 2ZMEB 4NB5A 3PQJA 1ODDA 4MGRA 2V1DA 1XCVA 1FZPB 2PQ8A 1B59A 5ICCA 1FP1D 2RGVA 4EGYA 4JK1X 2ESHA 2P6TA 3J80Z 1JHHA 1ON2A 5DUKA 4A5MA 5D8LB 4FHTA 2EB7A 5E8GA 1REPC 4ENJA 4AIKA 2OU2A 1MZBA 3WE2A 1HQCA 5HLGA 4HX8A 1Q1HA 4HF2A 3FMSA 1EH7A 1OR7A 4I2OA 5LEJA 1GVJA 3IRQA 2ELHA 3TO7A 3DXJF 2EFPA 2EK5A 1SMYF 2DO7A 1J2XA 3HRTA 4WWCA 3GF2A 3SZTA 2XAGA 2PG4A 3MAJA 3TOBA 3QPHA 5CYVA 3F6VA 5FGMA 1FWZA 1EH6A 3E5XA 3ELKA 1B4AA 3KEOA 5EEHA 3IRRA 1O3SA 2HFHA 1S8NA 1FBUA 2GXGA 4GCVA 1T39A 3COAC 5DCMB 4S05A 2VN2A 5HOOA 2ZMEA 3R6SA 1QO0D 1R22A 2D1HA 5HDNA 3MZYA 2X4HA 3HRMA 2H94A 5H20A 2H6CA 3LFKA 4ON0A 2RC4A 2D2WA 2DFIA 4EV0A 4O6JA 1SAXA 3MFKA 2FOKA 1JHFA 3MZHA 1C0WA 3BJOA 3F21A 2FU4A 4P5OA 4OINF 1T6SA 2W85A 3REOA 3U2RA 5E1ZB 1KYWA 1ZN2A 2YX4A 2GWRA 3GFJA 2H6BA 1ZREA 2A3SA 1RUNA 3M8EA 2EV0A 4OOIA 4MTDA 1R36A 3WU0A 4CGZA 1D8JA 4Q4ZF 1BJAA 5LBQA 1WI9A 4EJVA 2EV5A 3KLOA 4M74A 2EV6A 1XB4A 1W5SA 2PFBA 4R79A 1TLHB 2HEOA 2VOPA 4H0EA 2K7LA 4HW0A 3D0SA 2Z3YA 4CXFA 2K02A 1E17A 3JSPA 3FM3A 2P6SA 1XSDA 1UCRA 2DU9A 3V4GA 1RI7A 1P6RA 5D4SA 3WTZA 3CTAA 5DCMA 1P4XA 1TNTA 3I0TA 2DPUA 5H6QA 3CJNA 3V7RA 2PN6A 3JAMK 1ZRCA 5L3BA 1FSEA 2MLKA 1V4RA 3K69A 4G7HF 3ZQ7A 1BI3A 4HLYA 1SFXA 1USTA 4ENMA 5AIPA 1TBXA 4HF0A 2IT0A 1J9IA 1RNLA 3FMQA 2VOOA 2FEZA 3GVAA 2XAHA 1LEBA 4KA4A 2R7DA 3GW2A 1YW8A 4HOBA 4A6EA 4LFUA 4OIRF 4RGRA 3LA2A 2VXZA 2Q0OA 2QM3A 2BBYA 3C1DA 4LG0B 4N0BA 1F9NA 3ERED 5D6EA 2JT1A 1FYMA 3H3UA 2GZWA 4GYIA 1WKMA 1IN7A 4K2EA 2FE3A 5BS6A 1XD7A 1TQIA 3IC7A 1LQ1A 2YX7A 4O5VA 4KFCA 2W57A 4KN4X 4HLXA 2LF7A 3ZMUA 1IZ1A 2A61A 2VBZA 1U2WA 2YR2A 5ILSA 3RKWA 4L0YB 4EJTA 3TOAA 3QOPA 2ZKZA 3K2ZA 1R7JA 1FSHA 3FXRA 4IVNA 1WSUA 5LGTA 3RIRA 1OYYA 2IA0A 1DPRA 2WV0A 4UXNA 1QPMA 3AAFA 1LJ9A 3RI4A 1DUXC 2FNPA 3QU3A 3LAJA 2DK5A 2ZO4A 2JTVA 3DF8A 1U3EM 2FBIA 3VEPA 1T98A 3KZZA 2QZ8A 2K4JA 4HA8A 5IT3A 5IT9K 3GFMA 4U88A 3KEQA 4IJAA 2FRHA 2RNJA 4JBAA 5E18F 3V8KA 5DCFA 3G73A 4IHSA 2ACJA 2PI0A 1W7PA 4LLLA 1T38A 3ZMSA 1ZARA 4A5NA 4LMYA 4LG0A 2V6CA 1TQMA 3T0YA 1USSA 1HKTA 2XVCA 2DTRA 1R1VA 2L3DA 2XAJA 3U9GA 4LB5A 4HZFA 3KETA 5CVVA 3WGGA 1R1TA 2A07F 3T5XA 1HBXG 1RIOH 3EYYA 3M8FA 2QBYB 1H9TA 1BN5A 1I27A 2XAFA 4PCQA 1S6LA 3TO9A 4WXDA 4YFKF 1IN8A 1G6NA 5D5UB 3DKWA 4NQWA 5EEGA 3KP5A 3RDIA 3HRSA 5HDKA 1FX7A 5BOXA 3Q9VA 5HS7A 2EFOA 3LQRA 3T8RA 3WTTC 4LK0F 4LB6B 2FQ3A 3RPQA 3I5UA 5A2QK 1KU3A 2Y0MA 3D5LA 1IXSB 3HOSA 3S2WA 3VFZA 4HX7A 2YPRA 5DV5A 3ZMTA 4G7OF 2XHKA 3M1EA 4UHTA 1U6GA 2M45A 2E7WA 2UXNA 3L00A 2GQQA 4ZYDA 4CO8A 4ZYHA 3RYPA 1ONVA 2E1NA 2KIFA 1Z6RA 1MJBA 4BYYA 3ZN0A 1XGNA 3E6CC 2CWEA 3SXYA 3LA3A 4RAYA 1ZAOA 2EA4A 2W25A 1K78B 2CO5A 4WXCA 1U5TB 3GUDA 1ZLKA 5HDGA 2MH9A 4Z2YA 4LD5A 1X3UA 2Q2EA 1W5TA 1LNWA 1QBJA 2Z99A 3HSEA 3F6OA 2CFXA 1PP7U 5JI6A 1H0MA 2QQAA 3O3KA 4A6DA 1IAWA 3FF5A 3JTHA 3MCZA 1FNNA 3RKYA 4KDPA 3FXUA 4I7HA 5HVQC 5K5QA 2XROA 2K86A 4I09A 2CYYA 3FX3A 4I01A 1SD6A 3JSOA 3J80K 5LRSA 4GXOA 4XSXF 2M8EA 2BYVE 4M9SA 2L02A 2B0LA 5F1RA 4G94A 1J5YA 1ZRDA 3ZN1A 3HHHA 4FX0A 3HRUA 3JTGA 1BBYA 2QVOA 3HSFA 3GXOA 4KIFA 3QU6A 3CUOA 1V3FA 3BPXA 2UZKA 5JVTA 5HS8A 1WWXA 2HOEA 1B1BA 1K78A 2VC1A 1FYKA 1W4MA 3MQ0A 3WTWC 5HLHA 2QYOA 4Q47A 3F3XA 4KIBA 2W84A 4RS8A 4IF4A 4U0YA 1XMKA 2DLLA 5K1YA 4L9TA 1O57A 5K5OA 4M73A 3RYRA 2JZYA 3WODF 1SD4A 5E20A 1K6OA 4OIQF 4M9XA 3ZMDA 1ZLJA 2A69F 3BWGA 2HTJA 2Z9OA 2STTA 1T2KA 2ZXJA 5BPIA 3W6KB 1KYZA 2F5EA 3CDHA 3RPUA 2P7CB 4PGHA 2XASA 2KJCA 5BQTA
chains in the Genus database with same CATH superfamily
2EFWA 3WU1B 2ME6A 3OY9A 4XLPF 2OQRA 1JKPC 3Q5FA 1G8XA 2WC2A 3RSNA 4KNYA 2DA3A 1UHMA 1E3OC 1Y6IA 4XRFA 2HYFA 1RPWA 1G3SA 1XMAA 4UVAA 5LGUA 3JREA 4BY1J 3EUAA 3HOVJ 5JHFA 1KA8A 1Z7UA 3FHZA 1VQPI 1OR7C 2ZSIB 4M6YA 4JOMA 1XX5A 3GFIA 2WB1N 2IGOA 2WAQN 4YEJA 2P7VB 3GTLJ 1HSTA 3DBRB 1MMAA 3H92A 4NDLA 5D5VB 3GO5A 3WTVC 2ZJPF 2VJ4A 4RB0A 2QA4I 4I0AA 5FJ8J 3BCAA 1U8BA 2MH2A 1ETKA 3GLXA 4PSWA 3DBLB 2FF4A 5ILUA 3LL7A 3SDBA 2WWYA 2Z33A 1ZYRF 3M7GA 5J1UA 2GLOA 4XN0A 4CSWA 5H6RA 3LSTA 3KCCA 5LLQA 1CF7B 2OZ6A 1W1WE 3K1NA 2ID3A 4MTEA 4XBFA 4ZYGA 2ZJ2A 4RAZA 3ZPLA 3A01A 1LFBA 3RQ4A 2CW7A 3OYMA 4DQ2A 3W2VA 4CCMA 3K1MA 2L4MA 3TO6A 5CQGA 4Y52J 5CKTA 4II2A 3HOXJ 1CGPA 3ECOA 3VODA 1XCBA 4U0VA 1F5TA 1JXSA 2KKOA 3K10A 1DQUA 5J4VA 3BR5A 2VQLA 1EKEA 1ETVA 1XDUA 3CUQB 2QENA 4L9VA 1PP8F 3S1NJ 4L9JA 2EZHA 5EJCA 2O3FA 2ZMEC 4AVZA 2IW5A 3E7LA 3C3WA 1DDNA 2JPCA 3HOYJ 1WZ2A 4ESBA 2VT2A 5B1AH 4AIDA 3LAPA 4KITB 2AS5F 4W97A 3EQLF 3LMMA 3S3OA 2F48A 2FD5A 3E1SA 1UHSA 3S93A 1X1AA 1JKQC 1IUFA 4IPAA 1HDPA 1WH5A 4N9IA 4HSTA 5LHGA 5F08A 3R60A 1ETQA 3CO7C 1YRNA 5AIQA 4AWXB 2A6HF 9ANTA 1MJ9A 3L2VA 4QTRA 5F64A 3GYHX 3UR3C 3CCEI 1ZGJA 1G3WA 2O6GE 2K27A 4DIQA 3OYJA 4PJMA 2M34A 1IV8A 1A36A 1WVRA 4B43A 2KIUA 2Y30A 4RGXA 4V2GA 1JGSA 1MW7A 1Y8QB 1ZRFA 4XK4A 3VOEA 5GAEJ 5FB2A 4WK8F 3E6MA 2ZFWA 2DAOA 5L3FA 1VQLI 4IRGA 3C18A 1MJAA 2HKXA 4IXAA 1WRJA 1B9NA 1MD0A 2TDXA 5AONA 3J81K 4P55A 2DQLA 2DOAA 3QQAA 4XKVA 2IP2A 2RQQA 4NHJA 4D5CA 4CYCB 2HZTA 3X2QH 1LDDA 3MVPA 3HM5A 3JW4A 5F04A 4F3QA 2YUSA 4HQEA 4CZZA 1CF7A 3OYEA 1QHGA 1Y0UA 1W36C 2W24A 2L9SA 5EYRA 2H27A 1E3HA 3GTGJ 2BV6A 3ABUA 3G1OA 2O7OA 1ZR4A 4DZJA 2RDPA 2WY7Q 2IAIA 2O8XA 4I6ZA 1ORKA 1I3QJ 1B9MA 1TW2A 2I8DA 4GO1A 1IF1A 4BXUA 2L4AA 4CCNA 3G4SI 3SHFA 1MBJA 2OQGA 2MABA 4AM3A 3KE2A 4HDUA 3IH4A 4D0PA 4LLGF 3J7AY 2XF5A 3BPVA 3CUQA 3BTJA 1XDSA 3OYFA 3KP6A 2P0WA 1OMIA 2HQNA 5GAHJ 5E79C 2E2HJ 1MBGA 3DU5A 3HTUA 4IEJA 4OIPF 3H9GA 1L3LA 2BVLA 4ITVA 4UVCA 1MH4A 4FT8A 1S7EA 3RTRA 4HF1A 1Z05A 3I54A 1TT5B 3UKGA 2BXZA 2Y48A 4BXXJ 4OMYA 2DMUA 3WHBA 1DPUA 2O61A 3CCVI 2HVRA 3DP7A 1AHDP 2P81A 1YTYA 1YHQI 4GYGA 5K7ZA 2LY2A 3PUBA 3QPTA 1EF4A 3HOZJ 1MDMB 1VQ9I 1YQAA 3HXLA 2PBIA 2AXLA 3PUFA 2R5YA 1WI3A 4MHGA 5LFAA 2XUBA 1ZHFA 3CQZJ 1K79A 1ETXA 2LLKA 3OS1A 3KP7A 1GV2A 1XC5A 4HAMA 3CLOA 2F6CA 3BJ6A 4KICA 2OC6A 3BQYA 1R00A 5E3OA 1FOKA 2HU9A 2W4SA 4XIDA 1JJ8C 3OOPA 3P9IA 1E2XA 3H0DA 4A3MJ 2BGCA 1FOWA 1XGMA 2A05A 1FMVA 4CCLA 1S7AA 2DDBA 3I53A 5F6FA 4BAYA 5LGNA 1O4XA 3H5NA 1XGOA 2LNBA 4YIIA 4A3LJ 2IPQX 1TWFJ 3IKTA 1G3YA 1ZELA 2RN7A 2IS6A 5HS9A 1B8IB 1NH3A 6PAXA 4OMZA 4WCGA 2DYRH 4E7LA 4CYDA 2A68F 2KJBA 1DP3A 3OYBA 2EIJH 2MBFA 4DBRA 4CYCA 4LIUA 1WJBA 3L9FA 2DK8A 2X0LA 3NEUA 2QQBA 1Z0XA 3CC7I 5EEAA 1J7KA 1QQIA 4KN7X 5HNHA 2MFZA 5LHHA 3K4CA 1IC8A 4EMSA 4A0YA 1I3AA 1OJLA 2PJRB 1BA5A 3IHUA 2XIGA 4IOAF 3DPTA 1O3RA 3LSRA 2K85A 3F22A 1LEAA 1YS6A 4YIFA 3IL2A 2GIZA 2NVTJ 3OR2C 2IS1A 4RB1A 1APLC 4RGSA 2V1XA 4LG3A 3WGIA 2JWTA 3DQVC 2GM4A 2F5FA 1ZGWA 2FMLA 2LYCA 1LVAA 2EFQA 2ID6A 5IYCJ 3V8LA 1BIAA 2XGXA 3BDDA 4GGGA 5M3FJ 1ZKGA 1JI8A 4G12A 5DEQA 2FQ4A 1MGTA 1TW3A 1FLIA 2PMHA 1AA7A 2R7RA 3MWMA 3S3NA 4HNUA 2PMZA 5IOZA 5K5RA 3VYUB 5D5WB 2CG4A 4MFEA 1OKRA 1FJLA 4A3CJ 3G3ZA 1U8RA 4C9YA 3HHGA 1T0FA 2IVMA 5EG0B 1MDMA 3CLQA 4D5FA 3LQQA 4ZDLA 4DZPA 5D4RA 2R7XA 2HS5A 2L01A 1XPXA 4Q48A 1LUJB 2GXAA 1AOYA 2VE8A 2IEKA 2R5ZB 2CUZA 3HGYA 3F72A 3L2RA 2MC3A 2IA2A 2STWA 3P9KA 1Y0NA 2V26A 4HEA2 1VFCA 3TL4X 1MNDA 1TQPA 4ESFA 1GHCA 2NRAC 1D8KA 5GPAA 2F4MB 3BY6A 2NVQJ 3WTSC 4TV7A 4BE2A 4HV5A 1FP2A 2HI3A 2QWWA 3I55I 3AL0C 4QLCU 5B5EC 1OYWA 2M0MA 2C6YA 1GXPA 2MGQA 2HTSA 2EA2A 2LG4A 3QPSA 4P1WA 1YJWI 4BACA 4B8XA 1GT0C 2ECBA 3I71A 1JT6A 4XSZF 4ZDPA 4R8HA 4B4CA 2X6XA 5C3EJ 2VBXA 2ZSHB 1X2NA 4EM1A 3ZMVA 1S29A 3FXLA 4PFOA 1JGGA 3S32A 3ABKH 2LC2A 2ZC2A 2P8TA 5J8FA 2BOLA 2OAZA 2OPTA 2BEOA 3KPHA 4HX4A 3DLLF 2D1VA 3HJEA 2NVYJ 1UMQA 3C2HA 4EVIA 1BC7C 5JHUA 4AUXA 2PJRA 2XAQA 3LNQA 3PJRA 1Z91A 2P5LC 3GX4X 4YRVA 4ETSA 2XC7A 1HDDC 3LFUA 4FETA 4RB3C 3OSFA 2EILH 1RR8C 4RM2A 2VKHA 2NXNB 1I6XA 2XGEA 2E1MC 3IH2A 2NS0A 4MEXF 1R5HA 2Q8KA 4RGUA 3TP0A 5C44J 2EH3A 2ESNA 3WE3A 5ICFA 2HVSA 3ZP5A 3GZNB 4CDGA 2XPUA 5ICEA 1UHWA 3PQKA 5JR3A 2NYXA 2V79A 1OPCA 1IDYA 2NVXJ 4QIWN 2HXOA 1F4KA 4MEYF 1IUYA 3ZQIA 4BHCA 2WTEA 4RM3A 1Y1WJ 3H36A 1FEXA 3CCRI 2M7BA 1QU3A 3DU6A 2JK3A 4QSHA 4RDUA 5CPRB 5EDNA 2R7QA 1P92A 5EG0A 3JRBA 3C7JA 2OA4A 3PFIA 1VQNI 4I99C 3MKWB 1I5ZA 3S1MJ 1KU9A 3BC8A 1I6HJ 3TW7A 3GTQJ 3PFYA 3HUGB 1YITI 4B3XA 2VPRA 4FQGA 2TCTA 1BL0A 3BR2A 2FUG2 3G1LA 4BJTA 2DI3A 1UFMA 5DM6F 3FXQA 4YELA 3I58A 4A93J 1WH7A 3FIWA 2M8GX 3ONQA 3F8NA 3WGHA 3LSPA 2CGPA 2A6EF 4PGGA 3FK6A 4L18B 2JRMA 3GEZA 3K70D 3SZPA 3GBGA 3QYBA 2QBYA 1SMTA 3OIQA 4U87A 2LP0A 2K5CA 3T1BA 2VUMJ 1VQ4I 3BG3A 4Y3OA 1LPQA 2QQ8A 3ML6A 2PMUA 3H0GJ 2DBBA 5IOYA 4YFNF 4ZYEA 2ZCWA 1S72I 1J0RA 1LDJA 4Y13A 4ZZDA 3EUHA 2RQPA 2LREA 4OAYA 2DT5A 5L3DA 3DKXA 2K9SA 1MKMA 3PSFA 1P4AA 2D45A 1YIOA 5IPAA 5J8CA 1XN7A 4EJOA 1BIBA 4AYBA 4B44A 4DNCA 5IP9J 4BQAA 3S8PA 3OYHA 3ZRGA 2P5VA 5J47A 3K1PA 2JRTA 2NNNA 3IP4B 1B72B 2QUFA 3B02A 2DJIA 1QZZA 4LGWA 5E1WA 2YS9A 1O7FA 2R92J 4JQFA 2ZBKA 1D0XA 1KQ0A 2IGMA 2L54A 3P9CA 5J1RA 3BTLA 2MD0A 1IV6A 2VASA 4G6QA 2K4BA 3WTUC 2V9VA 3BG9A 1KU2A 4U0WA 2R7FA 3I4MJ 2FNAA 3BP8A 4M71A 2KIMA 5FRNA 4BU2A 1U5TA 3AKZA 2VJJA 1SD5A 2M4GA 4B09A 3L09A 2BHZA 3EUHC 1FIAA 3C2BA 4YFXF 3H3ZA 1B6AA 2XSJC 3BCBA 2JSCA 2WBMA 5ED4A 3ZOBA 3PNYA 1X1CA 4PDKA 2KIQA 4ZYAA 1S3JA 1A5JA 5FLMJ 4UUSB 1X3WB 3H9QA 4ESJA 3FHNA 3F8BA 2GOXB 1MBEA 1O7LA 1D5VA 3CO6C 1V54H 1GUUA 4AIJA 3F23A 2FBHA 2YSRA 4N4NB 2DFEA 2KZGA 3HUGA 3BOQA 1FBSA 3CZ6A 2UXXA 4HG2A 2M1BA 2X1EA 3V42A 5FLXZ 4M72A 2Y0SN 3OV8A 3SJMA 4EQQA 2ISZA 3CCYA 5FKMA 3GTJJ 2LVSA 4EM0B 5ILVA 2E35A 3DTIA 3E0JB 1U5TC 4ANJA 2JMWA 4CH7A 1IN5A 5FFZA 4ZTJA 2NOJB 4EGZA 2M30A 5GP9A 5KAIC 2A5YB 1IW7F 2X1DA 4ASNA 2OCEA 2DMTA 1VNDA 2BW3B 3CMEI 2W7NA 4NUBA 1HCRA 1ZK8A 4A12A 1BW5A 3BLYA 1Z77A 2CQ7A 3HB9A 1VQ5I 2ME0A 3K4JA 3H35A 4PK4A 3O6BB 2OBPA 1ZG3A 2EZLA 4M3DA 3SDGA 5TRDA 1Z9CA 5FLVA 1FTTA 2RVCA 1LDKB 4AIHA 3HIFA 1FOYA 3FM5A 3G1MA 3Q9SA 1B72A 2KDOA 3K0LA 4UUVA 1P9QC 3B73A 2EPFA 2CW0F 1TWAJ 2ETHA 4RAGA 3S2HJ 1N78A 2J5OA 5CVJA 3JRAA 2Y75A 4EJWA 2HYGD 4UV9A 4MQVA 1OCOH 3GTKJ 1SFEA 3ASNH 4E70A 1J75A 3HTSB 1BOAA 2R7VA 3KZIC 3F8MA 1OCZH 3L2CA 3VYSB 3DWLE 4IRHA 3BZKA 4GDFA 4FE7A 3RQIA 1FPQA 1BR4A 4L9NA 3RKXA 3UNGC 1Z1DA 1DP7P 3PO3J 1BI0A 2BZTA 4E6KG 1ZGAA 1JE8A 2VQGA 1K4SA 2VT3A 3RJPA 4BKXA 3F8FA 2M5WA 5JLXA 4FCYA 2I5UA 2Y0SA 3KLNA 5IYDJ 3BROA 1VQ6I 5DS9A 3T8TA 4CCKA 1YYVA 2K9NA 4XRSA 3A02A 1Z7LA 1R9TJ 3E5UA 3SEZA 1VF9A 3V7CA 1YI2I 2E34A 4HYEA 4C3IJ 1PUEE 2IA1A 4EM2A 2H09A 1I1SA 3L7WA 1HSJA 1SFOJ 1RKWA 2HPMA 4UNOA 3ULQB 1FT9A 4HBLA 3KFWX 2DQRA 1IN4A 5E17F 1BR1A 1Z6TA 5DYMA 2E1CA 3BR6A 1AKHB 4BS9A 4XR6A 3ZQHA 1BM9A 2O8KA 4B48A 3SYTA 2BY0A 2QSHX 4LJZF 2Y31A 1SD7A 2L0KA 4IHVA 1EV7A 1YW7A 3EDPA 2CJJA 2ZFUA 2DA7A 3LSKA 3L2WA 2VQHA 4EEFG 1P7IA 2BW3A 3EETA 1HKSA 2XF7A 3KEYA 2V7FA 4YIRX 2FXAA 5IP7J 3DPUA 1TL8A 4BE1A 4LK1F 2LY9A 5J6XA 1W7PD 1ZG5A 1A6QA 4MIMA 3KYLA 4MQ9F 2XGCA 2F4IA 3LA7A 1GDTA 2O03A 2DFFA 2L7ZA 4MNUA 3TW6A 5CVRA 2L5QA 4BBRJ 1ZH5A 2UWMA 1OCTC 3H9JA 2GIVA 1ETWA 1K7AA 2OCCH 1EJ9A 2O9LA 3BZ6A 1YW9A 1NTCA 1MBKA 3I59B 4WF2A 5IY5H 1XSXA 1SVLA 1YIJI 3FZVA 2IRFG 2ZNZA 4HQMA 5HNFA 2UUZA 3RCOA 1A04A 1U0JA 5BMZA 1YG2A 2EQRA 3I56I 4BH9A 2XPVA 3VWBA 2EIMH 2VODA 3ESWB 3K70C 1ACIA 3TKYA 2EFNA 3K4BA 4YG2F 2QEXI 1YO5C 1KQ8A 4P9UA 2G7UA 3J7AO 5HODA 1D0YA 2CV1A 1QGPA 2M87A 2KZVA 2F5CA 2XRLA 1NG6A 4PZJA 1SFUA 4HV6A 1VTNC 3N97A 3NARA 4BHBA 1IXCA 5LHIA 2EWNA 1OCRH 1RUOA 4MFDA 3TQNA 3QYFA 2HXIA 2KRHA 4I76A 5FRMA 2VE9A 1G4DA 3P7NA 4P96A 4IHWA 2ISYA 2Y9YA 2HKOA 4KISA 1IGNA 2FSWA 2KHMA 2H1KA 3CCJI 5J3LA 1WGXA 1TNSA 4RB2C 3E5QA 1HC8A 3RZDJ 1WQ2A 3MEXA 1YLFA 3A0BC 3QPLA 3RZOJ 3E6BA 3JCUC 4XMYA 1YFHA 1ZTRA 1BOBA 4A3DJ 3TDUC 1RRJA 5KVRA 3LSMA 3CD6I 2E36A 4PSXA 2YU3A 2XKOA 3EUKL 3R0JA 4WX9A 2R7SA 3R0AA 4UV8A 2LSOA 4IL6C 2QSFX 3OR1C 5HLIA 3TDZC 4DBQA 2FX0A 3V7SA 3QRFF 4Q5SF 3R4KA 3FMRA 1X4OA 1FC3A 3HOTA 3W6JB 3OYKA 2RV8A 2O5RA 1V5GA 1YOVB 3OYLA 3FWEA 3ZMZA 2DT7B 5DUIA 1QNTA 1POGA 3CP8A 5TISC 4CCOA 2XKPA 3WTYC 1F1ZA 4FASD 1R4MB 1UG2A 2V9PA 4DGWB 1Z3XA 4BBSJ 4W1UA 2NS7A 3GFLA 1D1BA 1MIJA 2VL8A 2COBA 5E3LA 1DU0A 1W7PB 1F36A 3BG7A 2DW4A 4Y17A 5M5XJ 2BE5F 2MA3A 4BHPA 1EH8A 1MSFC 4R1HA 1SANA 1GLNA 1ULYA 4J19A 2PMZN 4XLNF 2R7TA 3U1DA 3CUQC 1UELB 3QP5A 5L3CA 2CV2A 3I59A 3I9V2 3LWFA 5CVUA 3S2DJ 3DV8A 4BQQA 3ROUA 4L5IA 3J81Z 4CICA 3HSRA 3KP3A 5FO5A 3N4MA 4KMFA 3OYAA 2NAZA 3DBHB 3K2AA 4KYWA 2DPDA 1OLTA 2Y2ZA 3JAMZ 5LD2C 4KMUX 3DFGA 3AG3H 3CCLI 3R61A 2QF7A 1NG7A 3IKVA 1LFUP 1Q1VA 1SEUA 1FBQA 1IG7A 3V8JA 1I1GA 2VBYA 3AFHA 2N8GA 1PDNC 2FOWA 1S7OA 2FBKA 3I4PA 1HW1A 1XGSA 2Z5UA 3DTKA 3VPRA 3H3VK 3SEQA 4ZDOA 2NNYA 1O3QA 4RAFA 3CMMA 3PSIA 2LOOA 1R1UA 2BVMA 1TWCJ 5DD8A 2PX9A 3QP6A 1OCCH 4O3MA 3DPLC 2A5WA 2LK2A 4G7ZF 2KLOA 3MN2A 3AG2H 3IWFA 2UV1A 1KU7A 3WHCA 1UAAA 1VZ0A 2XPWA 2GAUA 2DOFA 2CS3A 3NRVA 4BQNA 3KP2A 1J59A 3DEUA 2LF8A 1FYLA 3BT9A 3K9TA 1YJNI 1YE9A 2G9WA 4PUSA 5GTHC 2XRNA 4S04A 4CHUA 5ERIA 3F8CA 1MMDA 4I98B 4A69C 1N77A 2EZIA 2WAEA 3GZ6A 5KK1A 1HKQA 4EJUA 4MLOA 5M5WJ 5JFRA 4G8XA 4A2UA 4FX4A 4UB6C 2WY8Q 2JA8J 4A0ZA 1ETYA 1D1CA 5B1BH 3ZXSA 1W0TA 1G2HA 1WJAA 2VKDA 4KUMA 3OL4A 3OWTA 1RETA 3ABLH 1RZ4A 2DA2A 3CDIA 3TMOA 2HGCA 2OJED 3CP2A 2JUGA 5FROA 3I4NJ 5EF6A 5DDGA 2ZNYA 1SFKA 3KYDB 3FK7A 3K4KA 4F7ZA 2E60A 2E7XA 1U78A 3M07A 2Z2SB 1IRFA 1QZYA 2OD5A 2MLGA 3LSHA 1T8IA 2A6TA 2RKHA 1G3TA 4ABZA 5ICGA 2Q2EB 3HYIA 5BPDA 3SFZA 1LB2A 2X1CA 1D3YA 4H4KC 3S17J 3E3VA 2HQAA 3ISPA 1W5CC 2H1LA 2CW8A 2RREA 3A0HC 1VQOI 4Z6YA 5B66C 2V1UA 5CVIA 1TT0A 5FD6A 5LEKA 3CJQB 1BI1A 3PNVA 1HXDA 1B8IA 1IRGA 2P4WA 1NHAA 4A3IJ 2M3AA 5FD5A 1FMWA 2CV0A 4NC7A 4Y15A 1T0FC 2DMQA 3KP4A 4OU0A 2F2EA 2HWVA 3O8GA 2MYSA 3NQOA 2LBFB 2K3FA 4HRIA 3PIPF 2ADUA 5IT9Z 2KRFA 3OMYA 2JPBA 1R58A 3CCUI 3FKIJ 4KT6A 3C2GA 4DW6A 2QSGX 1T95A 1FIPA 1XTAA 3G2BA 4OIOF 2FMYA 2PLYA 2ECCA 1XSVA 3GWZA 4BNCA 2F5VA 1SVMA 2IGNA 1X1DA 2COMA 2XDVA 5GPCA 4WXHA 4AYBN 3TEDA 3E6DA 2O0YA 3DEEA 5FKNA 2WAFA 3ZCOA 2H8WA 2H8RA 2VC0A 2PJPA 3EYIA 2XF6A 2FA5A 4G9YA 4U7BA 1FOXA 5D5XB 1KGSA 3CJTB 1TWGJ 1IN6A 1R5ID 3GMEA 1ON1A 4I0BA 5DD4A 2GA1A 4FISA 2BY2A 3VYTB 1P2FA 3TBIA 2CSOA 1AWCA 2HNHA 2DFHA 2HOAA 2KL4A 5J40A 2VONA 4D7NA 3HOUJ 1Z21A 4XNFA 4XKWA 4PFPA 2HDDA 3QAHA 1F43A 5L3EA 2LKSA 5L3GA 4KIGA 1KQ9A 3CF5F 4HDVA 4I02A 1HW2A 2DXIA 1H88C 2B7EA 1ERDA 4IO9F 1TWHJ 2R4GA 2OTJI 4IRIA 1T33A 4RLFA 1GXQA 3M9AA 3ECHA 1IDZA 4LLNA 3OYIA 3W2AA 4QWQA 2HR3A 1HLVA 1LE8B 2R5ZA 4G6DA 2EZKA 5EZHA 1YS7A 3IH3A 2KP6A 3KX2A 1X19A 2K40A 5F0CA 5CQEA 2JA7J 2OZUA 3FDYA 2QLZA 2WV1A 2X6WA 3BJAA 3GZ5A 3IAS2 4M6XA 5FFXA 1L0OC 2P5KA 1STZA 4U7DA 3TP3A 1HW5A 2BY3A 4ZH4F 4UVBA 2EJRA 1S9HA 3U21A 1JTYA 1UZCA 2DJNA 4L5JA 4LITA 4DYCA 1LFPA 3CMYA 2HDCA 4IHTA 3BG6A 5LRRA 3F0CA 3HPHA 3KZYA 2LFBA 5A2QZ 3CMAI 4XN3A 3WTXC 1R23A 2E71A 3LSIA 5E1XA 1P4WA 1IXRC 4C2MJ 2GA2A 2G7HA 2KISA 1UB9A 2CQNA 3M1CA 5CLSA 3WG9A 4AD9A 1BI2A 3JRCA 4KT5C 2QKMB 5CJ9A 4A3JJ 2D5VA 4XLHA 5KCMA 3PIOF 2LDUA 5FLXK 3O2PE 3J7YJ 1TTYA 4EATA 3HKZN 5JVGF 4Y33A 2I10A 2J5PA 5E8IA 2XV4S 1JKRC 2E5NA 5TJJA 4N9HA 1QA6A 3SQNA 3ABTA 2CQKA 1BC8C 1W36D 3KIOA 4FE4A 3L2QA 2JSPA 4NC8A 1WJ5A 1H9GA 4B3AA 2VQCA 1ZG1A 2CQQA 2R3SA 4ENKA 3TGNA 1H8AC 2DMPA 4XLAA 1XS9A 2HQRA 1N25A 1PVEA 3I64A 5D8KB 2VBWA 4CZCA 2GXBA 4ZZLA 2PEXA 1FY7A 3CC4I 4JYKA 2G0EA 4A0XA 5D6FA 1M1EB 3VB2A 4M3FA 3HEFA 1R5GA 2MD5A 2EIKH 1OYIA 4JX5A 2LKPA 3IWZA 4II3A 3MKYB 2B63J 4ENNA 1A31A 1E0EA 1O3TA 1V5EA 1LVKA 2IJLA 4LIVA 4M9ZA 2F5DA 4IQ4A 2HPIA 4AVPA 3IUOA 3E97A 1MMGA 4P9FA 4L0ZB 3Q0UA 3CC2I 2QQ9A 2ZMEB 4NB5A 5DM7F 2V1NA 3PQJA 1ODDA 4MGRA 2V1DA 1XCVA 5M5YJ 4XLEA 1FZPB 2K9MA 2XGDA 2PQ8A 1B59A 5ICCA 1FP1D 2RGVA 4NC6A 3ZQQA 3ZR8X 4EGYA 4JK1X 2DODA 2ESHA 4XORA 2P6TA 3S14J 3J80Z 3ERMA 1JHHA 3NWSA 1ON2A 3J7ZI 5DUKA 1H89C 1K83J 4A5MA 2ZJRF 3BZCA 5D8LB 3A01B 4IKFA 3IV5A 2CUEA 4FHTA 2RNGA 3LSJA 4HSRA 2EB7A 5E8GA 1REPC 4ENJA 2VJIA 2Y69H 3H5AA 4AIKA 4E7HA 2OU2A 1MZBA 3QODA 3JRDA 3WE2A 3BR1A 3HKZA 1HQCA 4RA2A 5HLGA 4HX8A 1Q1HA 2CFOA 1RKTA 2AXTC 2E2JJ 4HF2A 5BNGA 4F55A 3FMSA 3WU2C 4J00A 1RESA 1EH7A 3W2WA 1OR7A 1JT0A 3PNTA 3GTMJ 1X3ZB 3OYDA 4XL9A 4QPOA 4I2OA 5LEJA 1GVJA 3IRQA 2ELHA 2VIXA 4XOTA 3TO7A 3DXJF 2EFPA 3OSGA 2EK5A 1SMYF 2DO7A 1J2XA 3BTIA 3FXJA 3HRTA 4WWCA 3GF2A 1X2MA 3SZTA 2ICWG 2XAGA 1VQMI 4CA0A 1D1AA 2LMDA 2PG4A 2CUFA 3MAJA 3TOBA 4BGDA 3QPHA 2X6OA 5CYVA 3F6VA 3GTPJ 5FGMA 1FWZA 1EH6A 2FJ1A 4RMNA 3E5XA 3ELKA 1B4AA 4BUPA 1P7JA 3KEOA 1T56A 5EEHA 3IRRA 3A2KA 1O3SA 1OCPA 4BJ5C 3K7AJ 4HNVA 2HFHA 1S8NA 1FBUA 2GXGA 3N05A 2TRTA 4E7ZA 4GCVA 1T39A 5GAGJ 1FTZA 3ZQFA 3COAC 5DCMB 4E7KA 4S05A 4UUSA 1VI0A 2VN2A 2W00A 4UB8C 5HOOA 2F4OB 2KQRA 2ZMEA 3R6SA 4X0GA 1QO0D 1R22A 2D1HA 2OF7A 5HDNA 3MZYA 2X4HA 3HRMA 5FKOA 1K4TA 2IBDA 2H94A 4ZC3A 3HC7A 1HF0A 4HPQA 5H20A 2DTZA 1AU7A 3FBIB 2H6CA 3LFKA 4ON0A 1R71A 3MKZA 2RC4A 1D0ZA 2D2WA 2DFIA 2XAUA 4EV0A 4O6JA 3OS0A 1SAXA 3MFKA 1MNMC 5HLTA 4HNTA 4F91B 2NVUB 4IZZA 2FOKA 1JHFA 3MZHA 1W0UA 1C0WA 3BJOA 3F21A 2FU4A 1ITYA 4P5OA 3HOWJ 2E1OA 4OINF 1VQKI 1T6SA 2W85A 2R7ZJ 2ZXWH 3REOA 3K4MA 3U2RA 5E1ZB 3HG9A 3GCMA 1G59A 4OAZA 3WG7H 1XMXA 1KYWA 1MMNA 3BQZA 1ZN2A 2GWRA 2YX4A 3AG1H 3GFJA 2H6BA 2IS2A 3OOUA 1ZREA 2A3SA 1RUNA 4KJZA 3K4LA 1RR7A 3M8EA 2DMNA 3M3YJ 2EV0A 3Q0WA 4OOIA 4MTDA 3JRIA 3DKYA 4M3EA 1R36A 2M2EA 4AC0A 3WU0A 4XONA 3CCQI 4CGZA 1D8JA 1TC3C 1GV5A 4Q4ZF 1BJAA 2V9KA 1SVOA 5LBQA 1WI9A 3H5RA 4EJVA 5IYBJ 1JUMA 2EV5A 2M4KA 3KLOA 2WB1A 3S3MA 2WAQA 4M74A 2R5YB 2EV6A 2K9LA 1XB4A 3BG5A 3GLLA 1W5SA 2PFBA 4R79A 1TLHB 1ENHA 2Z16A 5K7FA 5E3MA 2JUCA 1CQTA 2HEOA 2VOPA 3S15J 4H0EA 2IGKA 2R7OA 2K7LA 2NOGA 3M8JA 4HW0A 2W82A 4XM3A 3D0SA 2Z3YA 4CXFA 2K02A 2IS4A 3H1CA 1E17A 3JSPA 3FM3A 2P6SA 1GVDA 2HOSA 1XSDA 3SFIA 1Z3YA 1UCRA 2DU9A 3V4GA 1RI7A 4BDYA 1P6RA 5D4SA 3WTZA 3CTAA 5DCMA 1R49A 1P4XA 2L7MP 2OV7A 1X1BA 1TNTA 3EPZA 2ZXHA 3B6AA 5KNLA 3I0TA 2DYSH 2DPUA 3I3LA 5H6QA 1OISA 1KZHA 2VKEA 2HDWA 3CJNA 3V7RA 1EA3A 2PN6A 3G6EI 3JAMK 1ZRCA 3HDDA 5F0HA 5L3BA 4LOCA 4XKCA 4IHXA 1Z67A 1FSEA 2MLKA 1V4RA 3HZJA 5IP6A 1AKHA 4A3KJ 3K69A 4G7HF 3ZQ7A 1BI3A 4HLYA 1SFXA 1USTA 3D5RC 4ENMA 2KPMA 5AIPA 3FISA 4C3JJ 1TBXA 4HF0A 2IT0A 1J9IA 1RNLA 3FMQA 1QHHD 2VOOA 2FEZA 2BHYA 3GVAA 4M6VA 3FBNB 2XAHA 3Q0VA 4B47A 4F93B 3MZ8A 3OS2A 2K3PA 4D9JA 2LD5A 1LEBA 1V5FA 2R7DA 4KA4A 3K4NA 5C4JJ 1R4NB 3GW2A 4IX7A 1YW8A 2M0CA 2XB5A 4M3GA 2DA6A 3MKLA 2E2IJ 4HOBA 2MC4A 4A6EA 1HA8A 4A3GJ 5J4YA 2VKVA 4LFUA 4OIRF 1QPIA 4RGRA 3LA2A 4PJJA 3AL0B 2VXZA 2L7FP 1JTXA 1X4PA 2Q0OA 1I50J 2QM3A 2BY1A 2BBYA 3C1DA 1PUFB 3A4CA 4LG0B 1IO2A 3Q3SA 3ZGKA 1WCMJ 4N0BA 1F9NA 3FXKA 4JX4A 3ERED 1QZEA 5D6EA 4E7IA 2JT1A 1FYMA 2CUJA 3H3UA 2X85A 4XLFA 2WADA 2JA5J 2GZWA 4GYIA 1WKMA 1IN7A 2HQ5A 3FXOA 2FE3A 4K2EA 2Z1DA 2HOTA 3A1YA 5BS6A 2L9NA 1XD7A 2QGUA 2QKLB 4BXFA 1TQIA 5TGTA 3IC7A 2DN0A 2JJ7A 1XG1A 4GRIA 5E3NA 1LQ1A 2YX7A 4O5VA 4KFCA 5EGOB 3CCSI 2W57A 1U9NA 4KN4X 2GOMA 4HLXA 2LF7A 2MSYA 3ZMUA 1IZ1A 2X51A 2A61A 1HOMA 2VBZA 1WPKA 1U2WA 2ELKA 2YR2A 2E1MB 5ILSA 3RKWA 2X48A 4L0YB 4EJTA 3TOAA 3L1PA 4BQOA 3DLAA 1A35A 3QOPA 2ZKZA 3K2ZA 1R7JA 4PJ0C 1FSHA 3FXRA 4IVNA 1YX5A 3OYNA 1WSUA 5LGTA 1NK3P 4XRSG 1MNEA 3RIRA 4M3BA 4NQWB 1OYYA 2IA0A 1DPRA 2WV0A 4UXNA 4C2UA 1QPMA 3S16J 3FXMA 5FKKA 3AAFA 1LJ9A 1Y39A 1OQYA 2IXSA 3U1KA 3RI4A 3W3CA 4E4HA 1DUXC 3CCMI 3CESA 2FNPA 3QU3A 3LAJA 3P5JA 4G6TB 1QRYA 3F9KA 2DK5A 5F1JA 4Y7NJ 2ZO4A 2JTVA 4DYQA 1MH3A 3DF8A 1U3EM 1UG0A 2FBIA 3DTEA 3VEPA 4D1QA 2LTPA 4S0HB 1T98A 3KZZA 3QOEA 2QZ8A 2K4JA 4HA8A 2JA2A 5IT3A 5IT9K 3GFMA 1D5YA 2OUMA 4U88A 2JVHA 1BJZA 2JVGA 3KEQA 4IJAA 2FRHA 4IHYA 2RNJA 2B9SA 3DEWA 1K6YA 2VI6A 2XSDC 4JBAA 5E18F 4XKBA 3V8KA 5DCFA 3ZQGA 2M7AA 2DDAA 3G73A 4IHSA 2ACJA 2PI0A 1W7PA 2HZDA 4LLLA 2X6YA 1T38A 3ZMSA 1ZARA 3DCFA 4IQJA 4A5NA 4LMYA 5F0FA 4LG0A 1T08B 5GADJ 1PUFA 2V6CA 1TQMA 4RLQA 2CQXA 3T0YA 2KFDA 2HYJA 1USSA 1HKTA 1KONA 2E19A 2VXDA 2XVCA 4A3FJ 2DTRA 1R1VA 2DCEA 2L3DA 3OYCA 2XAJA 3QWLA 3U9GA 3W6VA 4ZTFA 1TZLA 4LB5A 4HZFA 4J01A 4B1RA 3KETA 3FKJA 4C3HJ 1WJDA 5CVVA 1SC7A 3WGGA 2DT6A 1R1TA 2KT0A 2A07F 1DU6A 4E7JA 2JQ7A 1PJRA 1Y1VJ 4XQFA 3NAUA 3PL8A 3JRGA 3BTCA 2KRCA 3T5XA 2CMPA 5FKLA 5EGOA 1HBXG 2R7WA 3HGGA 1RIOH 1MBFA 3VSKA 3EYYA 3M8FA 2QBYB 1Y56A 1H9TA 4GFBA 1BN5A 4CUGA 1SAUA 1I27A 2XAFA 4PCQA 1S6LA 2LY1A 3PM1A 3RPUD 3OYGA 1ZR2A 1Y8RB 3TO9A 4WXDA 3CJRB 4N4OB 1IN8A 4YFKF 2DA1A 1WJCA 5JLWA 1G6NA 5D5UB 1BW6A 3ZQLA 1NK2P 1X1PA 3DKWA 4NQWA 2DOEA 5EEGA 3ZQCA 3BR0A 2AO9A 3KP5A 3RDIA 3HRSA 5HDKA 1FX7A 3ABMH 5BOXA 3Q9VA 5HS7A 2EFOA 3LQRA 3M4OJ 3T8RA 3WTTC 4LK0F 4LB6B 2QCOA 2FQ3A 4X6AJ 2VPLA 3RPQA 4BY7J 3I5UA 5A2QK 1KU3A 2Y0MA 3D5LA 1IXSB 3B6CA 3HOSA 3S2WA 1RC9A 4HX7A 3LSGA 3VFZA 1QVTA 3HPGA 2YPRA 2L7KA 5DV5A 3ZMTA 4G7OF 2XHKA 3M1EA 4UHTA 1I39A 1S5LC 1U6GA 3CDLA 2M45A 2E7WA 2MG4A 2UXNA 3L00A 2GQQA 2Y9ZA 1MSEC 2Q1ZB 4ZYDA 4CO8A 3SZGA 4CCJA 4ZYHA 3RYPA 1ONVA 2E1NA 2KIFA 4BEHB 3G71I 1Z6RA 1MJBA 4BYYA 3S1RJ 3ZN0A 1XGNA 3E6CC 2VLAA 3GTOJ 2CWEA 3SXYA 3LA3A 2R7UA 2GBYA 1YX3A 4RAYA 2YU9J 1ZAOA 2EA4A 2W25A 1MMSA 1K78B 2CO5A 4WXCA 4FTHA 1U5TB 2AQEA 3GUDA 3PO2J 4AU7A 1ZLKA 2LRDA 5HDGA 3OIPA 1J09A 2MH9A 2BXYA 2ZB9A 1N75A 1JUPA 4Z2YA 3HL2A 2LR8A 4X1EA 4LD5A 2KDZA 1X3UA 2V4JC 2EINH 2ZXIA 3MD2A 2Q2EA 2EBIA 1W5TA 3A03A 1LNWA 1QBJA 2Z99A 3HSEA 3D1NI 4RBOA 3F6OA 2CFXA 1PP7U 3S1QJ 5JI6A 1H0MA 2QQAA 1WFXA 3O3KA 5J1YA 1QVUA 4A6DA 1IAWA 1U9OA 3FF5A 3JTHA 1X58A 4XRMA 3MCZA 1FNNA 1UJ8A 2E5ZA 3RKYA 4KDPA 3FXUA 4I7HA 5HVQC 4DYRA 2CH0A 1IRZA 1IRXA 1R6RA 4V2FA 5K5QA 2XROA 2VB6A 2K86A 4I09A 4UUTA 3VSLA 2R93J 4F92B 3CF2A 2CYYA 3FX3A 3L2UA 2VJ5A 4I01A 4XOPA 4IOCF 2LBFA 2AQFA 5B3SH 1JUSA 4UY8I 1SD6A 4L5EA 4A3BJ 1ETOA 3JSOA 4JX6A 3J80K 2K9QA 5LRSA 2L9VA 4GXOA 2DA4A 4F52A 4XSXF 4C30A 4E7SA 1V55H 2M8EA 2BYVE 5C4XJ 4M9SA 2L02A 4XLCA 3HBLA 3KYCB 1WJFA 2JA6J 2B0LA 5F1RA 1DGWY 5K7HA 1YJ9I 1IJWC 2V6EA 1JKOC 4G94A 1JJ6C 2ELJA 1J5YA 4DJAA 1ZRDA 4D7MA 2NS8A 4BL0B 2LKXA 2W1OA 3ZN1A 2W48A 4BDZA 3HHHA 3IAM2 1WJEA 1VQ7I 3O8HA 4FX0A 2AHQA 3HRUA 4PJNA 3JTGA 1BBYA 2QVOA 3HSFA 3GXOA 2DA5A 4KIFA 3QU6A 4BE0A 5M3MJ 2L9RA 3VDXA 3CUOA 5KHDA 2ZJQF 1V3FA 3BPXA 2UZKA 1OFCX 2XB0X 4BEHA 3K6GA 5JVTA 5HS8A 4PJLA 1WWXA 2HOEA 2L2OA 1B1BA 1LKXA 5DTDA 5H2FC 1K78A 2VC1A 1FYKA 3JRHA 1E3PA 3OIOA 1W4MA 3MQ0A 1PYVA 1WHUA 3WTWC 2M9HA 2HVQA 1ZQ3P 2LH9A 2QYOA 4NNJA 5HLHA 4Q47A 3F3XA 1VQ8I 1MBHA 4KIBA 1LE8A 4Y4RA 2W84A 4RS8A 4ZJZA 4IF4A 3QYEA 4U0YA 2RAEA 1XMKA 2DLLA 3LOCA 4JP0A 5KAFC 4MO7A 1TP4A 2X9DA 1BR2A 3OL3A 5K1YA 4L9TA 5F27A 1DGRM 3VYRB 1O57A 5K5OA 4M73A 3RYRA 2JZYA 3WODF 1SD4A 5E20A 1K6OA 5GTIC 5EZGA 4XICA 4A3EJ 4OIQF 1A6IA 4M9XA 4C2TA 3ZMDA 1ZLJA 2A69F 3AG4H 3BWGA 2MW8A 2CU7A 2HTJA 2Z9OA 2STTA 1T2KA 3NWTA 3JRFA 2ZXJA 2KMUA 4OWRB 4NBQA 1K61A 3ASOH 2JN6A 4QPQA 5BPIA 3W6KB 3JR9A 1KYZA 2F5EA 3CDHA 3BR3A 4V19K 3D5SC 3RPUA 3MMYB 2P7CB 4PGHA 4BJ6C 2XASA 2CRGA 2OTLI 2KJCA 1YRNB 3RKQA 2WA0A 4DOZA 5BQTA 2R0QC
chains in the Genus database with same CATH topology
2EFWA 3WU1B 4XLPF 2OQRA 3Q5FA 2WC2A 4KNYA 1UHMA 4XRFA 2HYFA 1XMAA 1G3SA 4UVAA 5LGUA 1KA8A 1Z7UA 3FHZA 4M6YA 3GFIA 2P7VB 1HSTA 3H92A 5D5VB 3GO5A 3WTVC 4RB0A 4I0AA 2MH2A 3GLXA 2Z33A 5ILUA 2FF4A 2WWYA 1ZYRF 3M7GA 5H6RA 3LSTA 3KCCA 5LLQA 1CF7B 2OZ6A 3K1NA 4MTEA 4XBFA 4ZYGA 2ZJ2A 4RAZA 3ZPLA 4DQ2A 3K1MA 2L4MA 3TO6A 1CGPA 3ECOA 3VODA 1XCBA 4U0VA 1F5TA 1JXSA 2KKOA 1XDUA 3CUQB 2QENA 4L9VA 1PP8F 4L9JA 2O3FA 2IW5A 3C3WA 1DDNA 2JPCA 4ESBA 2VT2A 3LAPA 2AS5F 3EQLF 4IPAA 4N9IA 5LHGA 3R60A 3CO7C 5AIQA 4AWXB 2A6HF 1MJ9A 5F64A 3GYHX 1ZGJA 1G3WA 2O6GE 2K27A 2KIUA 4RGXA 1JGSA 1ZRFA 3VOEA 5FB2A 4WK8F 3E6MA 2ZFWA 2DAOA 5L3FA 4IRGA 3C18A 1MJAA 2HKXA 4IXAA 1WRJA 1B9NA 1MD0A 2TDXA 5AONA 3J81K 4P55A 2DQLA 4NHJA 2IP2A 2HZTA 1LDDA 3JW4A 4HQEA 4CZZA 1CF7A 1Y0UA 2W24A 2H27A 2BV6A 3ABUA 2RDPA 2O8XA 1B9MA 1TW2A 4GO1A 1IF1A 4BXUA 2L4AA 3SHFA 2OQGA 3KE2A 4HDUA 4D0PA 4LLGF 3BPVA 3CUQA 1XDSA 3KP6A 1OMIA 2HQNA 3HTUA 4OIPF 1L3LA 4UVCA 4FT8A 3RTRA 4HF1A 1Z05A 3I54A 2Y48A 4OMYA 1DPUA 2O61A 3DP7A 1YTYA 4GYGA 3QPTA 1MDMB 1YQAA 2PBIA 2AXLA 4MHGA 2XUBA 1ZHFA 1K79A 3KP7A 4HAMA 3CLOA 3BJ6A 4KICA 1R00A 1FOKA 3OOPA 3P9IA 1E2XA 2BGCA 1XGMA 1S7AA 4BAYA 3I53A 5F6FA 5LGNA 4YIIA 1XGOA 2LNBA 2IPQX 3IKTA 1G3YA 2RN7A 5HS9A 6PAXA 4OMZA 4WCGA 4CYDA 2A68F 2KJBA 2MBFA 3L9FA 2DK8A 2X0LA 3NEUA 2QQBA 1J7KA 1QQIA 4KN7X 5LHHA 4EMSA 4A0YA 3IHUA 2XIGA 3DPTA 1O3RA 3F22A 1LEAA 1YS6A 4YIFA 3IL2A 4RB1A 4RGSA 2V1XA 3WGIA 3DQVC 2F5FA 2FMLA 1LVAA 2EFQA 3V8LA 1BIAA 2XGXA 3BDDA 4GGGA 5DEQA 1MGTA 1TW3A 1FLIA 2PMHA 3MWMA 5K5RA 5D5WB 2CG4A 1OKRA 3G3ZA 1U8RA 3HHGA 1T0FA 2IVMA 1MDMA 3LQQA 5D4RA 2HS5A 2L01A 4Q48A 1AOYA 2VE8A 3F72A 2MC3A 2IA2A 2STWA 3P9KA 4ESFA 1TQPA 1GHCA 2NRAC 1D8KA 3BY6A 3WTSC 4TV7A 4HV5A 1FP2A 2QWWA 4QLCU 1OYWA 2C6YA 1GXPA 2HTSA 2EA2A 4B8XA 3I71A 4XSZF 4R8HA 2VBXA 4EM1A 3ZMVA 1S29A 2P8TA 5J8FA 2OAZA 4HX4A 2BEOA 2D1VA 1BC7C 4EVIA 5JHUA 2XAQA 1Z91A 2P5LC 3GX4X 4ETSA 4RB3C 1I6XA 4MEXF 2NS0A 1R5HA 2Q8KA 4RGUA 2ESNA 3WE3A 5ICFA 3ZP5A 4CDGA 5ICEA 1UHWA 3PQKA 5JR3A 2NYXA 2V79A 1OPCA 1F4KA 4MEYF 1IUYA 4BHCA 2WTEA 1P92A 3C7JA 2OA4A 3PFIA 1I5ZA 1KU9A 2DI3A 1UFMA 3FXQA 3I58A 3WGHA 3F8NA 2CGPA 2A6EF 4PGGA 4L18B 3GEZA 3SZPA 2QBYA 1SMTA 3T1BA 3ML6A 2PMUA 2DBBA 4YFNF 4ZYEA 2ZCWA 1J0RA 1LDJA 4Y13A 4ZZDA 3EUHA 2RQPA 2DT5A 5L3DA 1MKMA 1P4AA 2D45A 1YIOA 5J8CA 1XN7A 4EJOA 1BIBA 4DNCA 4BQAA 2P5VA 3K1PA 2JRTA 2NNNA 2QUFA 3B02A 1QZZA 4LGWA 5E1WA 1O7FA 4JQFA 2ZBKA 1KQ0A 2L54A 3P9CA 4G6QA 2K4BA 3WTUC 2V9VA 1KU2A 4U0WA 2R7FA 2FNAA 3BP8A 4M71A 2KIMA 1U5TA 1SD5A 4B09A 3L09A 4YFXF 3H3ZA 1B6AA 2JSCA 5ED4A 4PDKA 1S3JA 4ESJA 3F8BA 1O7LA 1D5VA 3CO6C 4AIJA 3F23A 2FBHA 2YSRA 3HUGA 3BOQA 1FBSA 2UXXA 2M1BA 5FLXZ 4M72A 3OV8A 4EQQA 2ISZA 4EM0B 5ILVA 1U5TC 1IN5A 5FFZA 4EGZA 2M30A 2A5YB 1IW7F 4ASNA 4A12A 3O6BB 2OBPA 1ZG3A 5TRDA 1Z9CA 2RVCA 1LDKB 4AIHA 3HIFA 3FM5A 3Q9SA 3K0LA 4UUVA 3B73A 2CW0F 2ETHA 2J5OA 5CVJA 2Y75A 4EJWA 2HYGD 4UV9A 4MQVA 1SFEA 4E70A 1J75A 3HTSB 1BOAA 3F8MA 3L2CA 4IRHA 1FPQA 4L9NA 3RKXA 1Z1DA 1DP7P 1BI0A 1JE8A 1ZGAA 2VT3A 3RJPA 3F8FA 2M5WA 3KLNA 3BROA 3T8TA 1YYVA 3E5UA 3V7CA 4HYEA 1PUEE 1I1SA 2IA1A 4EM2A 2H09A 3L7WA 1HSJA 4UNOA 3ULQB 1FT9A 4HBLA 3KFWX 2DQRA 1IN4A 5E17F 1Z6TA 5DYMA 2E1CA 1BM9A 4LJZF 1SD7A 1EV7A 1YW7A 3EDPA 3EETA 1HKSA 2FXAA 4LK1F 5J6XA 1W7PD 1ZG5A 4MQ9F 3LA7A 2O03A 4MNUA 5CVRA 1ZH5A 2UWMA 2GIVA 1K7AA 3BZ6A 1YW9A 3I59B 4WF2A 1XSXA 3FZVA 2IRFG 2ZNZA 4HQMA 1A04A 5BMZA 1YG2A 4BH9A 2VODA 3TKYA 2EFNA 4YG2F 1YO5C 1KQ8A 4P9UA 2G7UA 3J7AO 1QGPA 2M87A 2F5CA 4PZJA 1SFUA 4HV6A 1VTNC 3N97A 4BHBA 1IXCA 5LHIA 2EWNA 1RUOA 3TQNA 2VE9A 1G4DA 3P7NA 4P96A 2ISYA 2HKOA 2FSWA 1TNSA 4RB2C 3E5QA 1WQ2A 3MEXA 1YLFA 3E6BA 1YFHA 3TDUC 5KVRA 2YU3A 2XKOA 3R0JA 4WX9A 3R0AA 4UV8A 2LSOA 5HLIA 3TDZC 3QRFF 3V7SA 4Q5SF 3R4KA 3FMRA 1FC3A 3HOTA 3W6JB 2RV8A 3FWEA 3ZMZA 5DUIA 1QNTA 2XKPA 3WTYC 1F1ZA 3GFLA 1W7PB 2DW4A 4Y17A 2BE5F 2MA3A 4BHPA 1EH8A 4R1HA 1ULYA 4XLNF 3U1DA 3CUQC 3QP5A 5L3CA 3I59A 3LWFA 5CVUA 3DV8A 3J81Z 3ROUA 4L5IA 4CICA 3HSRA 3KP3A 5FO5A 3N4MA 4KMFA 2NAZA 4KYWA 2DPDA 3JAMZ 4KMUX 3DFGA 3R61A 3IKVA 1FBQA 3V8JA 1I1GA 2VBYA 1PDNC 1S7OA 2FBKA 3I4PA 1HW1A 1XGSA 2Z5UA 2NNYA 1O3QA 1R1UA 5DD8A 3QP6A 4O3MA 3DPLC 4G7ZF 3IWFA 1KU7A 2GAUA 3NRVA 3KP2A 1J59A 3DEUA 2LF8A 1FYLA 3K9TA 2G9WA 2XRNA 4S04A 4CHUA 5ERIA 3F8CA 4I98B 3GZ6A 5KK1A 4EJUA 1HKQA 5JFRA 4G8XA 4A2UA 4FX4A 4A0ZA 4KUMA 1RZ4A 2HGCA 5DDGA 2ZNYA 4F7ZA 2E7XA 1U78A 1IRFA 1QZYA 2OD5A 2MLGA 2RKHA 1G3TA 5ICGA 3HYIA 5BPDA 3SFZA 1LB2A 1D3YA 3E3VA 3ISPA 2V1UA 5CVIA 5FD6A 5LEKA 1BI1A 1HXDA 1IRGA 2P4WA 1NHAA 5FD5A 4Y15A 3KP4A 4OU0A 2F2EA 2HWVA 3NQOA 2ADUA 5IT9Z 2KRFA 2JPBA 1R58A 4OIOF 2FMYA 2PLYA 1XSVA 3GWZA 4BNCA 2COMA 4WXHA 3E6DA 2O0YA 2VC0A 2PJPA 3EYIA 4G9YA 2FA5A 4U7BA 5D5XB 1KGSA 1IN6A 1ON1A 4I0BA 5DD4A 2GA1A 1P2FA 2CSOA 1AWCA 2VONA 3QAHA 5L3EA 5L3GA 4KIGA 1KQ9A 4HDVA 4I02A 1HW2A 4IRIA 1GXQA 3M9AA 3ECHA 4LLNA 4QWQA 2HR3A 4G6DA 1YS7A 2OZUA 2QLZA 3BJAA 3GZ5A 4M6XA 5FFXA 1L0OC 2P5KA 1STZA 4U7DA 1HW5A 4ZH4F 4UVBA 2EJRA 4L5JA 2HDCA 4IHTA 5LRRA 3KZYA 5A2QZ 3WTXC 1R23A 5E1XA 1P4WA 1IXRC 2GA2A 2G7HA 1UB9A 3WG9A 5CLSA 4AD9A 1BI2A 4KT5C 5CJ9A 2LDUA 5FLXK 3O2PE 1TTYA 2J5PA 5E8IA 2XV4S 5TJJA 4N9HA 3SQNA 3ABTA 2CQKA 1BC8C 1H9GA 1ZG1A 2R3SA 4ENKA 3TGNA 2HQRA 3I64A 5D8KB 2VBWA 2GXBA 4ZZLA 2PEXA 1FY7A 4A0XA 5D6FA 3VB2A 1R5GA 2MD5A 1OYIA 2LKPA 3IWZA 4ENNA 1O3TA 2IJLA 4M9ZA 2F5DA 4AVPA 4L0ZB 4P9FA 3E97A 2QQ9A 2ZMEB 4NB5A 3PQJA 1ODDA 4MGRA 2V1DA 1XCVA 1FZPB 2PQ8A 1B59A 5ICCA 1FP1D 2RGVA 4EGYA 4JK1X 2ESHA 2P6TA 3J80Z 1JHHA 1ON2A 5DUKA 4A5MA 5D8LB 4FHTA 2EB7A 5E8GA 1REPC 4ENJA 4AIKA 2OU2A 1MZBA 3WE2A 1HQCA 5HLGA 4HX8A 1Q1HA 4HF2A 3FMSA 1EH7A 1OR7A 4I2OA 5LEJA 1GVJA 3IRQA 2ELHA 3TO7A 3DXJF 2EFPA 2EK5A 1SMYF 2DO7A 1J2XA 3HRTA 4WWCA 3GF2A 3SZTA 2XAGA 2PG4A 3MAJA 3TOBA 3QPHA 5CYVA 3F6VA 5FGMA 1FWZA 1EH6A 3E5XA 3ELKA 1B4AA 3KEOA 5EEHA 3IRRA 1O3SA 2HFHA 1S8NA 1FBUA 2GXGA 4GCVA 1T39A 3COAC 5DCMB 4S05A 2VN2A 5HOOA 2ZMEA 3R6SA 1QO0D 1R22A 2D1HA 5HDNA 3MZYA 2X4HA 3HRMA 2H94A 5H20A 2H6CA 3LFKA 4ON0A 2RC4A 2D2WA 2DFIA 4EV0A 4O6JA 1SAXA 3MFKA 2FOKA 1JHFA 3MZHA 1C0WA 3BJOA 3F21A 2FU4A 4P5OA 4OINF 1T6SA 2W85A 3REOA 3U2RA 5E1ZB 1KYWA 1ZN2A 2YX4A 2GWRA 3GFJA 2H6BA 1ZREA 2A3SA 1RUNA 3M8EA 2EV0A 4OOIA 4MTDA 1R36A 3WU0A 4CGZA 1D8JA 4Q4ZF 1BJAA 5LBQA 1WI9A 4EJVA 2EV5A 3KLOA 4M74A 2EV6A 1XB4A 1W5SA 2PFBA 4R79A 1TLHB 2HEOA 2VOPA 4H0EA 2K7LA 4HW0A 3D0SA 2Z3YA 4CXFA 2K02A 1E17A 3JSPA 3FM3A 2P6SA 1XSDA 1UCRA 2DU9A 3V4GA 1RI7A 1P6RA 5D4SA 3WTZA 3CTAA 5DCMA 1P4XA 1TNTA 3I0TA 2DPUA 5H6QA 3CJNA 3V7RA 2PN6A 3JAMK 1ZRCA 5L3BA 1FSEA 2MLKA 1V4RA 3K69A 4G7HF 3ZQ7A 1BI3A 4HLYA 1SFXA 1USTA 4ENMA 5AIPA 1TBXA 4HF0A 2IT0A 1J9IA 1RNLA 3FMQA 2VOOA 2FEZA 3GVAA 2XAHA 1LEBA 4KA4A 2R7DA 3GW2A 1YW8A 4HOBA 4A6EA 4LFUA 4OIRF 4RGRA 3LA2A 2VXZA 2Q0OA 2QM3A 2BBYA 3C1DA 4LG0B 4N0BA 1F9NA 3ERED 5D6EA 2JT1A 1FYMA 3H3UA 2GZWA 4GYIA 1WKMA 1IN7A 4K2EA 2FE3A 5BS6A 1XD7A 1TQIA 3IC7A 1LQ1A 2YX7A 4O5VA 4KFCA 2W57A 4KN4X 4HLXA 2LF7A 3ZMUA 1IZ1A 2A61A 2VBZA 1U2WA 2YR2A 5ILSA 3RKWA 4L0YB 4EJTA 3TOAA 3QOPA 2ZKZA 3K2ZA 1R7JA 1FSHA 3FXRA 4IVNA 1WSUA 5LGTA 3RIRA 1OYYA 2IA0A 1DPRA 2WV0A 4UXNA 1QPMA 3AAFA 1LJ9A 3RI4A 1DUXC 2FNPA 3QU3A 3LAJA 2DK5A 2ZO4A 2JTVA 3DF8A 1U3EM 2FBIA 3VEPA 1T98A 3KZZA 2QZ8A 2K4JA 4HA8A 5IT3A 5IT9K 3GFMA 4U88A 3KEQA 4IJAA 2FRHA 2RNJA 4JBAA 5E18F 3V8KA 5DCFA 3G73A 4IHSA 2ACJA 2PI0A 1W7PA 4LLLA 1T38A 3ZMSA 1ZARA 4A5NA 4LMYA 4LG0A 2V6CA 1TQMA 3T0YA 1USSA 1HKTA 2XVCA 2DTRA 1R1VA 2L3DA 2XAJA 3U9GA 4LB5A 4HZFA 3KETA 5CVVA 3WGGA 1R1TA 2A07F 3T5XA 1HBXG 1RIOH 3EYYA 3M8FA 2QBYB 1H9TA 1BN5A 1I27A 2XAFA 4PCQA 1S6LA 3TO9A 4WXDA 4YFKF 1IN8A 1G6NA 5D5UB 3DKWA 4NQWA 5EEGA 3KP5A 3RDIA 3HRSA 5HDKA 1FX7A 5BOXA 3Q9VA 5HS7A 2EFOA 3LQRA 3T8RA 3WTTC 4LK0F 4LB6B 2FQ3A 3RPQA 3I5UA 5A2QK 1KU3A 2Y0MA 3D5LA 1IXSB 3HOSA 3S2WA 3VFZA 4HX7A 2YPRA 5DV5A 3ZMTA 4G7OF 2XHKA 3M1EA 4UHTA 1U6GA 2M45A 2E7WA 2UXNA 3L00A 2GQQA 4ZYDA 4CO8A 4ZYHA 3RYPA 1ONVA 2E1NA 2KIFA 1Z6RA 1MJBA 4BYYA 3ZN0A 1XGNA 3E6CC 2CWEA 3SXYA 3LA3A 4RAYA 1ZAOA 2EA4A 2W25A 1K78B 2CO5A 4WXCA 1U5TB 3GUDA 1ZLKA 5HDGA 2MH9A 4Z2YA 4LD5A 1X3UA 2Q2EA 1W5TA 1LNWA 1QBJA 2Z99A 3HSEA 3F6OA 2CFXA 1PP7U 5JI6A 1H0MA 2QQAA 3O3KA 4A6DA 1IAWA 3FF5A 3JTHA 3MCZA 1FNNA 3RKYA 4KDPA 3FXUA 4I7HA 5HVQC 5K5QA 2XROA 2K86A 4I09A 2CYYA 3FX3A 4I01A 1SD6A 3JSOA 3J80K 5LRSA 4GXOA 4XSXF 2M8EA 2BYVE 4M9SA 2L02A 2B0LA 5F1RA 4G94A 1J5YA 1ZRDA 3ZN1A 3HHHA 4FX0A 3HRUA 3JTGA 1BBYA 2QVOA 3HSFA 3GXOA 4KIFA 3QU6A 3CUOA 1V3FA 3BPXA 2UZKA 5JVTA 5HS8A 1WWXA 2HOEA 1B1BA 1K78A 2VC1A 1FYKA 1W4MA 3MQ0A 3WTWC 5HLHA 2QYOA 4Q47A 3F3XA 4KIBA 2W84A 4RS8A 4IF4A 4U0YA 1XMKA 2DLLA 5K1YA 4L9TA 1O57A 5K5OA 4M73A 3RYRA 2JZYA 3WODF 1SD4A 5E20A 1K6OA 4OIQF 4M9XA 3ZMDA 1ZLJA 2A69F 3BWGA 2HTJA 2Z9OA 2STTA 1T2KA 2ZXJA 5BPIA 3W6KB 1KYZA 2F5EA 3CDHA 3RPUA 2P7CB 4PGHA 2XASA 2KJCA 5BQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EFW A;  3WU1 B;  4XLP F;  2OQR A;  3Q5F A;  2WC2 A;  4KNY A;  1UHM A;  4XRF A;  2HYF A;  1XMA A;  1G3S A;  4UVA A;  5LGU A;  1KA8 A;  1Z7U A;  3FHZ A;  4M6Y A;  3GFI A;  2P7V B;  1HST A;  3H92 A;  5D5V B;  3GO5 A;  3WTV C;  4RB0 A;  4I0A A;  2MH2 A;  3GLX A;  2Z33 A;  5ILU A;  2FF4 A;  2WWY A;  1ZYR F;  3M7G A;  5H6R A;  3LST A;  3KCC A;  5LLQ A;  1CF7 B;  2OZ6 A;  3K1N A;  4MTE A;  4XBF A;  4ZYG A;  2ZJ2 A;  4RAZ A;  3ZPL A;  4DQ2 A;  3K1M A;  2L4M A;  3TO6 A;  1CGP A;  3ECO A;  3VOD A;  1XCB A;  4U0V A;  1F5T A;  1JXS A;  2KKO A;  1XDU A;  3CUQ B;  2QEN A;  4L9V A;  1PP8 F;  4L9J A;  2O3F A;  2IW5 A;  3C3W A;  1DDN A;  2JPC A;  4ESB A;  2VT2 A;  3LAP A;  2AS5 F;  3EQL F;  4IPA A;  4N9I A;  5LHG A;  3R60 A;  3CO7 C;  5AIQ A;  4AWX B;  2A6H F;  1MJ9 A;  5F64 A;  3GYH X;  1ZGJ A;  1G3W A;  2O6G E;  2K27 A;  2KIU A;  4RGX A;  1JGS A;  1ZRF A;  3VOE A;  5FB2 A;  4WK8 F;  3E6M A;  2ZFW A;  2DAO A;  5L3F A;  4IRG A;  3C18 A;  1MJA A;  2HKX A;  4IXA A;  1WRJ A;  1B9N A;  1MD0 A;  2TDX A;  5AON A;  3J81 K;  4P55 A;  2DQL A;  4NHJ A;  2IP2 A;  2HZT A;  1LDD A;  3JW4 A;  4HQE A;  4CZZ A;  1CF7 A;  1Y0U A;  2W24 A;  2H27 A;  2BV6 A;  3ABU A;  2RDP A;  2O8X A;  1B9M A;  1TW2 A;  4GO1 A;  1IF1 A;  4BXU A;  2L4A A;  3SHF A;  2OQG A;  3KE2 A;  4HDU A;  4D0P A;  4LLG F;  3BPV A;  3CUQ A;  1XDS A;  3KP6 A;  1OMI A;  2HQN A;  3HTU A;  4OIP F;  1L3L A;  4UVC A;  4FT8 A;  3RTR A;  4HF1 A;  1Z05 A;  3I54 A;  2Y48 A;  4OMY A;  1DPU A;  2O61 A;  3DP7 A;  1YTY A;  4GYG A;  3QPT A;  1MDM B;  1YQA A;  2PBI A;  2AXL A;  4MHG A;  2XUB A;  1ZHF A;  1K79 A;  3KP7 A;  4HAM A;  3CLO A;  3BJ6 A;  4KIC A;  1R00 A;  1FOK A;  3OOP A;  3P9I A;  1E2X A;  2BGC A;  1XGM A;  1S7A A;  4BAY A;  3I53 A;  5F6F A;  5LGN A;  4YII A;  1XGO A;  2LNB A;  2IPQ X;  3IKT A;  1G3Y A;  2RN7 A;  5HS9 A;  6PAX A;  4OMZ A;  4WCG A;  4CYD A;  2A68 F;  2KJB A;  2MBF A;  3L9F A;  2DK8 A;  2X0L A;  3NEU A;  2QQB A;  1J7K A;  1QQI A;  4KN7 X;  5LHH A;  4EMS A;  4A0Y A;  3IHU A;  2XIG A;  3DPT A;  1O3R A;  3F22 A;  1LEA A;  1YS6 A;  4YIF A;  3IL2 A;  4RB1 A;  4RGS A;  2V1X A;  3WGI A;  3DQV C;  2F5F A;  2FML A;  1LVA A;  2EFQ A;  3V8L A;  1BIA A;  2XGX A;  3BDD A;  4GGG A;  5DEQ A;  1MGT A;  1TW3 A;  1FLI A;  2PMH A;  3MWM A;  5K5R A;  5D5W B;  2CG4 A;  1OKR A;  3G3Z A;  1U8R A;  3HHG A;  1T0F A;  2IVM A;  1MDM A;  3LQQ A;  5D4R A;  2HS5 A;  2L01 A;  4Q48 A;  1AOY A;  2VE8 A;  3F72 A;  2MC3 A;  2IA2 A;  2STW A;  3P9K A;  4ESF A;  1TQP A;  1GHC A;  2NRA C;  1D8K A;  3BY6 A;  3WTS C;  4TV7 A;  4HV5 A;  1FP2 A;  2QWW A;  4QLC U;  1OYW A;  2C6Y A;  1GXP A;  2HTS A;  2EA2 A;  4B8X A;  3I71 A;  4XSZ F;  4R8H A;  2VBX A;  4EM1 A;  3ZMV A;  1S29 A;  2P8T A;  5J8F A;  2OAZ A;  4HX4 A;  2BEO A;  2D1V A;  1BC7 C;  4EVI A;  5JHU A;  2XAQ A;  1Z91 A;  2P5L C;  3GX4 X;  4ETS A;  4RB3 C;  1I6X A;  4MEX F;  2NS0 A;  1R5H A;  2Q8K A;  4RGU A;  2ESN A;  3WE3 A;  5ICF A;  3ZP5 A;  4CDG A;  5ICE A;  1UHW A;  3PQK A;  5JR3 A;  2NYX A;  2V79 A;  1OPC A;  1F4K A;  4MEY F;  1IUY A;  4BHC A;  2WTE A;  1P92 A;  3C7J A;  2OA4 A;  3PFI A;  1I5Z A;  1KU9 A;  2DI3 A;  1UFM A;  3FXQ A;  3I58 A;  3WGH A;  3F8N A;  2CGP A;  2A6E F;  4PGG A;  4L18 B;  3GEZ A;  3SZP A;  2QBY A;  1SMT A;  3T1B A;  3ML6 A;  2PMU A;  2DBB A;  4YFN F;  4ZYE A;  2ZCW A;  1J0R A;  1LDJ A;  4Y13 A;  4ZZD A;  3EUH A;  2RQP A;  2DT5 A;  5L3D A;  1MKM A;  1P4A A;  2D45 A;  1YIO A;  5J8C A;  1XN7 A;  4EJO A;  1BIB A;  4DNC A;  4BQA A;  2P5V A;  3K1P A;  2JRT A;  2NNN A;  2QUF A;  3B02 A;  1QZZ A;  4LGW A;  5E1W A;  1O7F A;  4JQF A;  2ZBK A;  1KQ0 A;  2L54 A;  3P9C A;  4G6Q A;  2K4B A;  3WTU C;  2V9V A;  1KU2 A;  4U0W A;  2R7F A;  2FNA A;  3BP8 A;  4M71 A;  2KIM A;  1U5T A;  1SD5 A;  4B09 A;  3L09 A;  4YFX F;  3H3Z A;  1B6A A;  2JSC A;  5ED4 A;  4PDK A;  1S3J A;  4ESJ A;  3F8B A;  1O7L A;  1D5V A;  3CO6 C;  4AIJ A;  3F23 A;  2FBH A;  2YSR A;  3HUG A;  3BOQ A;  1FBS A;  2UXX A;  2M1B A;  5FLX Z;  4M72 A;  3OV8 A;  4EQQ A;  2ISZ A;  4EM0 B;  5ILV A;  1U5T C;  1IN5 A;  5FFZ A;  4EGZ A;  2M30 A;  2A5Y B;  1IW7 F;  4ASN A;  4A12 A;  3O6B B;  2OBP A;  1ZG3 A;  5TRD A;  1Z9C A;  2RVC A;  1LDK B;  4AIH A;  3HIF A;  3FM5 A;  3Q9S A;  3K0L A;  4UUV A;  3B73 A;  2CW0 F;  2ETH A;  2J5O A;  5CVJ A;  2Y75 A;  4EJW A;  2HYG D;  4UV9 A;  4MQV A;  1SFE A;  4E70 A;  1J75 A;  3HTS B;  1BOA A;  3F8M A;  3L2C A;  4IRH A;  1FPQ A;  4L9N A;  3RKX A;  1Z1D A;  1DP7 P;  1BI0 A;  1JE8 A;  1ZGA A;  2VT3 A;  3RJP A;  3F8F A;  2M5W A;  3KLN A;  3BRO A;  3T8T A;  1YYV A;  3E5U A;  3V7C A;  4HYE A;  1PUE E;  1I1S A;  2IA1 A;  4EM2 A;  2H09 A;  3L7W A;  1HSJ A;  4UNO A;  3ULQ B;  1FT9 A;  4HBL A;  3KFW X;  2DQR A;  1IN4 A;  5E17 F;  1Z6T A;  5DYM A;  2E1C A;  1BM9 A;  4LJZ F;  1SD7 A;  1EV7 A;  1YW7 A;  3EDP A;  3EET A;  1HKS A;  2FXA A;  4LK1 F;  5J6X A;  1W7P D;  1ZG5 A;  4MQ9 F;  3LA7 A;  2O03 A;  4MNU A;  5CVR A;  1ZH5 A;  2UWM A;  2GIV A;  1K7A A;  3BZ6 A;  1YW9 A;  3I59 B;  4WF2 A;  1XSX A;  3FZV A;  2IRF G;  2ZNZ A;  4HQM A;  1A04 A;  5BMZ A;  1YG2 A;  4BH9 A;  2VOD A;  3TKY A;  2EFN A;  4YG2 F;  1YO5 C;  1KQ8 A;  4P9U A;  2G7U A;  3J7A O;  1QGP A;  2M87 A;  2F5C A;  4PZJ A;  1SFU A;  4HV6 A;  1VTN C;  3N97 A;  4BHB A;  1IXC A;  5LHI A;  2EWN A;  1RUO A;  3TQN A;  2VE9 A;  1G4D A;  3P7N A;  4P96 A;  2ISY A;  2HKO A;  2FSW A;  1TNS A;  4RB2 C;  3E5Q A;  1WQ2 A;  3MEX A;  1YLF A;  3E6B A;  1YFH A;  3TDU C;  5KVR A;  2YU3 A;  2XKO A;  3R0J A;  4WX9 A;  3R0A A;  4UV8 A;  2LSO A;  5HLI A;  3TDZ C;  3QRF F;  3V7S A;  4Q5S F;  3R4K A;  3FMR A;  1FC3 A;  3HOT A;  3W6J B;  2RV8 A;  3FWE A;  3ZMZ A;  5DUI A;  1QNT A;  2XKP A;  3WTY C;  1F1Z A;  3GFL A;  1W7P B;  2DW4 A;  4Y17 A;  2BE5 F;  2MA3 A;  4BHP A;  1EH8 A;  4R1H A;  1ULY A;  4XLN F;  3U1D A;  3CUQ C;  3QP5 A;  5L3C A;  3I59 A;  3LWF A;  5CVU A;  3DV8 A;  3J81 Z;  3ROU A;  4L5I A;  4CIC A;  3HSR A;  3KP3 A;  5FO5 A;  3N4M A;  4KMF A;  2NAZ A;  4KYW A;  2DPD A;  3JAM Z;  4KMU X;  3DFG A;  3R61 A;  3IKV A;  1FBQ A;  3V8J A;  1I1G A;  2VBY A;  1PDN C;  1S7O A;  2FBK A;  3I4P A;  1HW1 A;  1XGS A;  2Z5U A;  2NNY A;  1O3Q A;  1R1U A;  5DD8 A;  3QP6 A;  4O3M A;  3DPL C;  4G7Z F;  3IWF A;  1KU7 A;  2GAU A;  3NRV A;  3KP2 A;  1J59 A;  3DEU A;  2LF8 A;  1FYL A;  3K9T A;  2G9W A;  2XRN A;  4S04 A;  4CHU A;  5ERI A;  3F8C A;  4I98 B;  3GZ6 A;  5KK1 A;  4EJU A;  1HKQ A;  5JFR A;  4G8X A;  4A2U A;  4FX4 A;  4A0Z A;  4KUM A;  1RZ4 A;  2HGC A;  5DDG A;  2ZNY A;  4F7Z A;  2E7X A;  1U78 A;  1IRF A;  1QZY A;  2OD5 A;  2MLG A;  2RKH A;  1G3T A;  5ICG A;  3HYI A;  5BPD A;  3SFZ A;  1LB2 A;  1D3Y A;  3E3V A;  3ISP A;  2V1U A;  5CVI A;  5FD6 A;  5LEK A;  1BI1 A;  1HXD A;  1IRG A;  2P4W A;  1NHA A;  5FD5 A;  4Y15 A;  3KP4 A;  4OU0 A;  2F2E A;  2HWV A;  3NQO A;  2ADU A;  5IT9 Z;  2KRF A;  2JPB A;  1R58 A;  4OIO F;  2FMY A;  2PLY A;  1XSV A;  3GWZ A;  4BNC A;  2COM A;  4WXH A;  3E6D A;  2O0Y A;  2VC0 A;  2PJP A;  3EYI A;  4G9Y A;  2FA5 A;  4U7B A;  5D5X B;  1KGS A;  1IN6 A;  1ON1 A;  4I0B A;  5DD4 A;  2GA1 A;  1P2F A;  2CSO A;  1AWC A;  2VON A;  3QAH A;  5L3E A;  5L3G A;  4KIG A;  1KQ9 A;  4HDV A;  4I02 A;  1HW2 A;  4IRI A;  1GXQ A;  3M9A A;  3ECH A;  4LLN A;  4QWQ A;  2HR3 A;  4G6D A;  1YS7 A;  2OZU A;  2QLZ A;  3BJA A;  3GZ5 A;  4M6X A;  5FFX A;  1L0O C;  2P5K A;  1STZ A;  4U7D A;  1HW5 A;  4ZH4 F;  4UVB A;  2EJR A;  4L5J A;  2HDC A;  4IHT A;  5LRR A;  3KZY A;  5A2Q Z;  3WTX C;  1R23 A;  5E1X A;  1P4W A;  1IXR C;  2GA2 A;  2G7H A;  1UB9 A;  3WG9 A;  5CLS A;  4AD9 A;  1BI2 A;  4KT5 C;  5CJ9 A;  2LDU A;  5FLX K;  3O2P E;  1TTY A;  2J5P A;  5E8I A;  2XV4 S;  5TJJ A;  4N9H A;  3SQN A;  3ABT A;  2CQK A;  1BC8 C;  1H9G A;  1ZG1 A;  2R3S A;  4ENK A;  3TGN A;  2HQR A;  3I64 A;  5D8K B;  2VBW A;  2GXB A;  4ZZL A;  2PEX A;  1FY7 A;  4A0X A;  5D6F A;  3VB2 A;  1R5G A;  2MD5 A;  1OYI A;  2LKP A;  3IWZ A;  4ENN A;  1O3T A;  2IJL A;  4M9Z A;  2F5D A;  4AVP A;  4L0Z B;  4P9F A;  3E97 A;  2QQ9 A;  2ZME B;  4NB5 A;  3PQJ A;  1ODD A;  4MGR A;  2V1D A;  1XCV A;  1FZP B;  2PQ8 A;  1B59 A;  5ICC A;  1FP1 D;  2RGV A;  4EGY A;  4JK1 X;  2ESH A;  2P6T A;  3J80 Z;  1JHH A;  1ON2 A;  5DUK A;  4A5M A;  5D8L B;  4FHT A;  2EB7 A;  5E8G A;  1REP C;  4ENJ A;  4AIK A;  2OU2 A;  1MZB A;  3WE2 A;  1HQC A;  5HLG A;  4HX8 A;  1Q1H A;  4HF2 A;  3FMS A;  1EH7 A;  1OR7 A;  4I2O A;  5LEJ A;  1GVJ A;  3IRQ A;  2ELH A;  3TO7 A;  3DXJ F;  2EFP A;  2EK5 A;  1SMY F;  2DO7 A;  1J2X A;  3HRT A;  4WWC A;  3GF2 A;  3SZT A;  2XAG A;  2PG4 A;  3MAJ A;  3TOB A;  3QPH A;  5CYV A;  3F6V A;  5FGM A;  1FWZ A;  1EH6 A;  3E5X A;  3ELK A;  1B4A A;  3KEO A;  5EEH A;  3IRR A;  1O3S A;  2HFH A;  1S8N A;  1FBU A;  2GXG A;  4GCV A;  1T39 A;  3COA C;  5DCM B;  4S05 A;  2VN2 A;  5HOO A;  2ZME A;  3R6S A;  1QO0 D;  1R22 A;  2D1H A;  5HDN A;  3MZY A;  2X4H A;  3HRM A;  2H94 A;  5H20 A;  2H6C A;  3LFK A;  4ON0 A;  2RC4 A;  2D2W A;  2DFI A;  4EV0 A;  4O6J A;  1SAX A;  3MFK A;  2FOK A;  1JHF A;  3MZH A;  1C0W A;  3BJO A;  3F21 A;  2FU4 A;  4P5O A;  4OIN F;  1T6S A;  2W85 A;  3REO A;  3U2R A;  5E1Z B;  1KYW A;  1ZN2 A;  2YX4 A;  2GWR A;  3GFJ A;  2H6B A;  1ZRE A;  2A3S A;  1RUN A;  3M8E A;  2EV0 A;  4OOI A;  4MTD A;  1R36 A;  3WU0 A;  4CGZ A;  1D8J A;  4Q4Z F;  1BJA A;  5LBQ A;  1WI9 A;  4EJV A;  2EV5 A;  3KLO A;  4M74 A;  2EV6 A;  1XB4 A;  1W5S A;  2PFB A;  4R79 A;  1TLH B;  2HEO A;  2VOP A;  4H0E A;  2K7L A;  4HW0 A;  3D0S A;  2Z3Y A;  4CXF A;  2K02 A;  1E17 A;  3JSP A;  3FM3 A;  2P6S A;  1XSD A;  1UCR A;  2DU9 A;  3V4G A;  1RI7 A;  1P6R A;  5D4S A;  3WTZ A;  3CTA A;  5DCM A;  1P4X A;  1TNT A;  3I0T A;  2DPU A;  5H6Q A;  3CJN A;  3V7R A;  2PN6 A;  3JAM K;  1ZRC A;  5L3B A;  1FSE A;  2MLK A;  1V4R A;  3K69 A;  4G7H F;  3ZQ7 A;  1BI3 A;  4HLY A;  1SFX A;  1UST A;  4ENM A;  5AIP A;  1TBX A;  4HF0 A;  2IT0 A;  1J9I A;  1RNL A;  3FMQ A;  2VOO A;  2FEZ A;  3GVA A;  2XAH A;  1LEB A;  4KA4 A;  2R7D A;  3GW2 A;  1YW8 A;  4HOB A;  4A6E A;  4LFU A;  4OIR F;  4RGR A;  3LA2 A;  2VXZ A;  2Q0O A;  2QM3 A;  2BBY A;  3C1D A;  4LG0 B;  4N0B A;  1F9N A;  3ERE D;  5D6E A;  2JT1 A;  1FYM A;  3H3U A;  2GZW A;  4GYI A;  1WKM A;  1IN7 A;  4K2E A;  2FE3 A;  5BS6 A;  1XD7 A;  1TQI A;  3IC7 A;  1LQ1 A;  2YX7 A;  4O5V A;  4KFC A;  2W57 A;  4KN4 X;  4HLX A;  2LF7 A;  3ZMU A;  1IZ1 A;  2A61 A;  2VBZ A;  1U2W A;  2YR2 A;  5ILS A;  3RKW A;  4L0Y B;  4EJT A;  3TOA A;  3QOP A;  2ZKZ A;  3K2Z A;  1R7J A;  1FSH A;  3FXR A;  4IVN A;  1WSU A;  5LGT A;  3RIR A;  1OYY A;  2IA0 A;  1DPR A;  2WV0 A;  4UXN A;  1QPM A;  3AAF A;  1LJ9 A;  3RI4 A;  1DUX C;  2FNP A;  3QU3 A;  3LAJ A;  2DK5 A;  2ZO4 A;  2JTV A;  3DF8 A;  1U3E M;  2FBI A;  3VEP A;  1T98 A;  3KZZ A;  2QZ8 A;  2K4J A;  4HA8 A;  5IT3 A;  5IT9 K;  3GFM A;  4U88 A;  3KEQ A;  4IJA A;  2FRH A;  2RNJ A;  4JBA A;  5E18 F;  3V8K A;  5DCF A;  3G73 A;  4IHS A;  2ACJ A;  2PI0 A;  1W7P A;  4LLL A;  1T38 A;  3ZMS A;  1ZAR A;  4A5N A;  4LMY A;  4LG0 A;  2V6C A;  1TQM A;  3T0Y A;  1USS A;  1HKT A;  2XVC A;  2DTR A;  1R1V A;  2L3D A;  2XAJ A;  3U9G A;  4LB5 A;  4HZF A;  3KET A;  5CVV A;  3WGG A;  1R1T A;  2A07 F;  3T5X A;  1HBX G;  1RIO H;  3EYY A;  3M8F A;  2QBY B;  1H9T A;  1BN5 A;  1I27 A;  2XAF A;  4PCQ A;  1S6L A;  3TO9 A;  4WXD A;  4YFK F;  1IN8 A;  1G6N A;  5D5U B;  3DKW A;  4NQW A;  5EEG A;  3KP5 A;  3RDI A;  3HRS A;  5HDK A;  1FX7 A;  5BOX A;  3Q9V A;  5HS7 A;  2EFO A;  3LQR A;  3T8R A;  3WTT C;  4LK0 F;  4LB6 B;  2FQ3 A;  3RPQ A;  3I5U A;  5A2Q K;  1KU3 A;  2Y0M A;  3D5L A;  1IXS B;  3HOS A;  3S2W A;  3VFZ A;  4HX7 A;  2YPR A;  5DV5 A;  3ZMT A;  4G7O F;  2XHK A;  3M1E A;  4UHT A;  1U6G A;  2M45 A;  2E7W A;  2UXN A;  3L00 A;  2GQQ A;  4ZYD A;  4CO8 A;  4ZYH A;  3RYP A;  1ONV A;  2E1N A;  2KIF A;  1Z6R A;  1MJB A;  4BYY A;  3ZN0 A;  1XGN A;  3E6C C;  2CWE A;  3SXY A;  3LA3 A;  4RAY A;  1ZAO A;  2EA4 A;  2W25 A;  1K78 B;  2CO5 A;  4WXC A;  1U5T B;  3GUD A;  1ZLK A;  5HDG A;  2MH9 A;  4Z2Y A;  4LD5 A;  1X3U A;  2Q2E A;  1W5T A;  1LNW A;  1QBJ A;  2Z99 A;  3HSE A;  3F6O A;  2CFX A;  1PP7 U;  5JI6 A;  1H0M A;  2QQA A;  3O3K A;  4A6D A;  1IAW A;  3FF5 A;  3JTH A;  3MCZ A;  1FNN A;  3RKY A;  4KDP A;  3FXU A;  4I7H A;  5HVQ C;  5K5Q A;  2XRO A;  2K86 A;  4I09 A;  2CYY A;  3FX3 A;  4I01 A;  1SD6 A;  3JSO A;  3J80 K;  5LRS A;  4GXO A;  4XSX F;  2M8E A;  2BYV E;  4M9S A;  2L02 A;  2B0L A;  5F1R A;  4G94 A;  1J5Y A;  1ZRD A;  3ZN1 A;  3HHH A;  4FX0 A;  3HRU A;  3JTG A;  1BBY A;  2QVO A;  3HSF A;  3GXO A;  4KIF A;  3QU6 A;  3CUO A;  1V3F A;  3BPX A;  2UZK A;  5JVT A;  5HS8 A;  1WWX A;  2HOE A;  1B1B A;  1K78 A;  2VC1 A;  1FYK A;  1W4M A;  3MQ0 A;  3WTW C;  5HLH A;  2QYO A;  4Q47 A;  3F3X A;  4KIB A;  2W84 A;  4RS8 A;  4IF4 A;  4U0Y A;  1XMK A;  2DLL A;  5K1Y A;  4L9T A;  1O57 A;  5K5O A;  4M73 A;  3RYR A;  2JZY A;  3WOD F;  1SD4 A;  5E20 A;  1K6O A;  4OIQ F;  4M9X A;  3ZMD A;  1ZLJ A;  2A69 F;  3BWG A;  2HTJ A;  2Z9O A;  2STT A;  1T2K A;  2ZXJ A;  5BPI A;  3W6K B;  1KYZ A;  2F5E A;  3CDH A;  3RPU A;  2P7C B;  4PGH A;  2XAS A;  2KJC A;  5BQT A; 
#chains in the Genus database with same CATH topology
 2EFW A;  3WU1 B;  2ME6 A;  3OY9 A;  4XLP F;  2OQR A;  1JKP C;  3Q5F A;  1G8X A;  2WC2 A;  3RSN A;  4KNY A;  2DA3 A;  1UHM A;  1E3O C;  1Y6I A;  4XRF A;  2HYF A;  1RPW A;  1G3S A;  1XMA A;  4UVA A;  5LGU A;  3JRE A;  4BY1 J;  3EUA A;  3HOV J;  5JHF A;  1KA8 A;  1Z7U A;  3FHZ A;  1VQP I;  1OR7 C;  2ZSI B;  4M6Y A;  4JOM A;  1XX5 A;  3GFI A;  2WB1 N;  2IGO A;  2WAQ N;  4YEJ A;  2P7V B;  3GTL J;  1HST A;  3DBR B;  1MMA A;  3H92 A;  4NDL A;  5D5V B;  3GO5 A;  3WTV C;  2ZJP F;  2VJ4 A;  4RB0 A;  2QA4 I;  4I0A A;  5FJ8 J;  3BCA A;  1U8B A;  2MH2 A;  1ETK A;  3GLX A;  4PSW A;  3DBL B;  2FF4 A;  5ILU A;  3LL7 A;  3SDB A;  2WWY A;  2Z33 A;  1ZYR F;  3M7G A;  5J1U A;  2GLO A;  4XN0 A;  4CSW A;  5H6R A;  3LST A;  3KCC A;  5LLQ A;  1CF7 B;  2OZ6 A;  1W1W E;  3K1N A;  2ID3 A;  4MTE A;  4XBF A;  4ZYG A;  2ZJ2 A;  4RAZ A;  3ZPL A;  3A01 A;  1LFB A;  3RQ4 A;  2CW7 A;  3OYM A;  4DQ2 A;  3W2V A;  4CCM A;  3K1M A;  2L4M A;  3TO6 A;  5CQG A;  4Y52 J;  5CKT A;  4II2 A;  3HOX J;  1CGP A;  3ECO A;  3VOD A;  1XCB A;  4U0V A;  1F5T A;  1JXS A;  2KKO A;  3K10 A;  1DQU A;  5J4V A;  3BR5 A;  2VQL A;  1EKE A;  1ETV A;  1XDU A;  3CUQ B;  2QEN A;  4L9V A;  1PP8 F;  3S1N J;  4L9J A;  2EZH A;  5EJC A;  2O3F A;  2ZME C;  4AVZ A;  2IW5 A;  3E7L A;  3C3W A;  1DDN A;  2JPC A;  3HOY J;  1WZ2 A;  4ESB A;  2VT2 A;  5B1A H;  4AID A;  3LAP A;  4KIT B;  2AS5 F;  4W97 A;  3EQL F;  3LMM A;  3S3O A;  2F48 A;  2FD5 A;  3E1S A;  1UHS A;  3S93 A;  1X1A A;  1JKQ C;  1IUF A;  4IPA A;  1HDP A;  1WH5 A;  4N9I A;  4HST A;  5LHG A;  5F08 A;  3R60 A;  1ETQ A;  3CO7 C;  1YRN A;  5AIQ A;  4AWX B;  2A6H F;  9ANT A;  1MJ9 A;  3L2V A;  4QTR A;  5F64 A;  3GYH X;  3UR3 C;  3CCE I;  1ZGJ A;  1G3W A;  2O6G E;  2K27 A;  4DIQ A;  3OYJ A;  4PJM A;  2M34 A;  1IV8 A;  1A36 A;  1WVR A;  4B43 A;  2KIU A;  2Y30 A;  4RGX A;  4V2G A;  1JGS A;  1MW7 A;  1Y8Q B;  1ZRF A;  4XK4 A;  3VOE A;  5GAE J;  5FB2 A;  4WK8 F;  3E6M A;  2ZFW A;  2DAO A;  5L3F A;  1VQL I;  4IRG A;  3C18 A;  1MJA A;  2HKX A;  4IXA A;  1WRJ A;  1B9N A;  1MD0 A;  2TDX A;  5AON A;  3J81 K;  4P55 A;  2DQL A;  2DOA A;  3QQA A;  4XKV A;  2IP2 A;  2RQQ A;  4NHJ A;  4D5C A;  4CYC B;  2HZT A;  3X2Q H;  1LDD A;  3MVP A;  3HM5 A;  3JW4 A;  5F04 A;  4F3Q A;  2YUS A;  4HQE A;  4CZZ A;  1CF7 A;  3OYE A;  1QHG A;  1Y0U A;  1W36 C;  2W24 A;  2L9S A;  5EYR A;  2H27 A;  1E3H A;  3GTG J;  2BV6 A;  3ABU A;  3G1O A;  2O7O A;  1ZR4 A;  4DZJ A;  2RDP A;  2WY7 Q;  2IAI A;  2O8X A;  4I6Z A;  1ORK A;  1I3Q J;  1B9M A;  1TW2 A;  2I8D A;  4GO1 A;  1IF1 A;  4BXU A;  2L4A A;  4CCN A;  3G4S I;  3SHF A;  1MBJ A;  2OQG A;  2MAB A;  4AM3 A;  3KE2 A;  4HDU A;  3IH4 A;  4D0P A;  4LLG F;  3J7A Y;  2XF5 A;  3BPV A;  3CUQ A;  3BTJ A;  1XDS A;  3OYF A;  3KP6 A;  2P0W A;  1OMI A;  2HQN A;  5GAH J;  5E79 C;  2E2H J;  1MBG A;  3DU5 A;  3HTU A;  4IEJ A;  4OIP F;  3H9G A;  1L3L A;  2BVL A;  4ITV A;  4UVC A;  1MH4 A;  4FT8 A;  1S7E A;  3RTR A;  4HF1 A;  1Z05 A;  3I54 A;  1TT5 B;  3UKG A;  2BXZ A;  2Y48 A;  4BXX J;  4OMY A;  2DMU A;  3WHB A;  1DPU A;  2O61 A;  3CCV I;  2HVR A;  3DP7 A;  1AHD P;  2P81 A;  1YTY A;  1YHQ I;  4GYG A;  5K7Z A;  2LY2 A;  3PUB A;  3QPT A;  1EF4 A;  3HOZ J;  1MDM B;  1VQ9 I;  1YQA A;  3HXL A;  2PBI A;  2AXL A;  3PUF A;  2R5Y A;  1WI3 A;  4MHG A;  5LFA A;  2XUB A;  1ZHF A;  3CQZ J;  1K79 A;  1ETX A;  2LLK A;  3OS1 A;  3KP7 A;  1GV2 A;  1XC5 A;  4HAM A;  3CLO A;  2F6C A;  3BJ6 A;  4KIC A;  2OC6 A;  3BQY A;  1R00 A;  5E3O A;  1FOK A;  2HU9 A;  2W4S A;  4XID A;  1JJ8 C;  3OOP A;  3P9I A;  1E2X A;  3H0D A;  4A3M J;  2BGC A;  1FOW A;  1XGM A;  2A05 A;  1FMV A;  4CCL A;  1S7A A;  2DDB A;  3I53 A;  5F6F A;  4BAY A;  5LGN A;  1O4X A;  3H5N A;  1XGO A;  2LNB A;  4YII A;  4A3L J;  2IPQ X;  1TWF J;  3IKT A;  1G3Y A;  1ZEL A;  2RN7 A;  2IS6 A;  5HS9 A;  1B8I B;  1NH3 A;  6PAX A;  4OMZ A;  4WCG A;  2DYR H;  4E7L A;  4CYD A;  2A68 F;  2KJB A;  1DP3 A;  3OYB A;  2EIJ H;  2MBF A;  4DBR A;  4CYC A;  4LIU A;  1WJB A;  3L9F A;  2DK8 A;  2X0L A;  3NEU A;  2QQB A;  1Z0X A;  3CC7 I;  5EEA A;  1J7K A;  1QQI A;  4KN7 X;  5HNH A;  2MFZ A;  5LHH A;  3K4C A;  1IC8 A;  4EMS A;  4A0Y A;  1I3A A;  1OJL A;  2PJR B;  1BA5 A;  3IHU A;  2XIG A;  4IOA F;  3DPT A;  1O3R A;  3LSR A;  2K85 A;  3F22 A;  1LEA A;  1YS6 A;  4YIF A;  3IL2 A;  2GIZ A;  2NVT J;  3OR2 C;  2IS1 A;  4RB1 A;  1APL C;  4RGS A;  2V1X A;  4LG3 A;  3WGI A;  2JWT A;  3DQV C;  2GM4 A;  2F5F A;  1ZGW A;  2FML A;  2LYC A;  1LVA A;  2EFQ A;  2ID6 A;  5IYC J;  3V8L A;  1BIA A;  2XGX A;  3BDD A;  4GGG A;  5M3F J;  1ZKG A;  1JI8 A;  4G12 A;  5DEQ A;  2FQ4 A;  1MGT A;  1TW3 A;  1FLI A;  2PMH A;  1AA7 A;  2R7R A;  3MWM A;  3S3N A;  4HNU A;  2PMZ A;  5IOZ A;  5K5R A;  3VYU B;  5D5W B;  2CG4 A;  4MFE A;  1OKR A;  1FJL A;  4A3C J;  3G3Z A;  1U8R A;  4C9Y A;  3HHG A;  1T0F A;  2IVM A;  5EG0 B;  1MDM A;  3CLQ A;  4D5F A;  3LQQ A;  4ZDL A;  4DZP A;  5D4R A;  2R7X A;  2HS5 A;  2L01 A;  1XPX A;  4Q48 A;  1LUJ B;  2GXA A;  1AOY A;  2VE8 A;  2IEK A;  2R5Z B;  2CUZ A;  3HGY A;  3F72 A;  3L2R A;  2MC3 A;  2IA2 A;  2STW A;  3P9K A;  1Y0N A;  2V26 A;  4HEA 2;  1VFC A;  3TL4 X;  1MND A;  1TQP A;  4ESF A;  1GHC A;  2NRA C;  1D8K A;  5GPA A;  2F4M B;  3BY6 A;  2NVQ J;  3WTS C;  4TV7 A;  4BE2 A;  4HV5 A;  1FP2 A;  2HI3 A;  2QWW A;  3I55 I;  3AL0 C;  4QLC U;  5B5E C;  1OYW A;  2M0M A;  2C6Y A;  1GXP A;  2MGQ A;  2HTS A;  2EA2 A;  2LG4 A;  3QPS A;  4P1W A;  1YJW I;  4BAC A;  4B8X A;  1GT0 C;  2ECB A;  3I71 A;  1JT6 A;  4XSZ F;  4ZDP A;  4R8H A;  4B4C A;  2X6X A;  5C3E J;  2VBX A;  2ZSH B;  1X2N A;  4EM1 A;  3ZMV A;  1S29 A;  3FXL A;  4PFO A;  1JGG A;  3S32 A;  3ABK H;  2LC2 A;  2ZC2 A;  2P8T A;  5J8F A;  2BOL A;  2OAZ A;  2OPT A;  2BEO A;  3KPH A;  4HX4 A;  3DLL F;  2D1V A;  3HJE A;  2NVY J;  1UMQ A;  3C2H A;  4EVI A;  1BC7 C;  5JHU A;  4AUX A;  2PJR A;  2XAQ A;  3LNQ A;  3PJR A;  1Z91 A;  2P5L C;  3GX4 X;  4YRV A;  4ETS A;  2XC7 A;  1HDD C;  3LFU A;  4FET A;  4RB3 C;  3OSF A;  2EIL H;  1RR8 C;  4RM2 A;  2VKH A;  2NXN B;  1I6X A;  2XGE A;  2E1M C;  3IH2 A;  2NS0 A;  4MEX F;  1R5H A;  2Q8K A;  4RGU A;  3TP0 A;  5C44 J;  2EH3 A;  2ESN A;  3WE3 A;  5ICF A;  2HVS A;  3ZP5 A;  3GZN B;  4CDG A;  2XPU A;  5ICE A;  1UHW A;  3PQK A;  5JR3 A;  2NYX A;  2V79 A;  1OPC A;  1IDY A;  2NVX J;  4QIW N;  2HXO A;  1F4K A;  4MEY F;  1IUY A;  3ZQI A;  4BHC A;  2WTE A;  4RM3 A;  1Y1W J;  3H36 A;  1FEX A;  3CCR I;  2M7B A;  1QU3 A;  3DU6 A;  2JK3 A;  4QSH A;  4RDU A;  5CPR B;  5EDN A;  2R7Q A;  1P92 A;  5EG0 A;  3JRB A;  3C7J A;  2OA4 A;  3PFI A;  1VQN I;  4I99 C;  3MKW B;  1I5Z A;  3S1M J;  1KU9 A;  3BC8 A;  1I6H J;  3TW7 A;  3GTQ J;  3PFY A;  3HUG B;  1YIT I;  4B3X A;  2VPR A;  4FQG A;  2TCT A;  1BL0 A;  3BR2 A;  2FUG 2;  3G1L A;  4BJT A;  2DI3 A;  1UFM A;  5DM6 F;  3FXQ A;  4YEL A;  3I58 A;  4A93 J;  1WH7 A;  3FIW A;  2M8G X;  3ONQ A;  3F8N A;  3WGH A;  3LSP A;  2CGP A;  2A6E F;  4PGG A;  3FK6 A;  4L18 B;  2JRM A;  3GEZ A;  3K70 D;  3SZP A;  3GBG A;  3QYB A;  2QBY A;  1SMT A;  3OIQ A;  4U87 A;  2LP0 A;  2K5C A;  3T1B A;  2VUM J;  1VQ4 I;  3BG3 A;  4Y3O A;  1LPQ A;  2QQ8 A;  3ML6 A;  2PMU A;  3H0G J;  2DBB A;  5IOY A;  4YFN F;  4ZYE A;  2ZCW A;  1S72 I;  1J0R A;  1LDJ A;  4Y13 A;  4ZZD A;  3EUH A;  2RQP A;  2LRE A;  4OAY A;  2DT5 A;  5L3D A;  3DKX A;  2K9S A;  1MKM A;  3PSF A;  1P4A A;  2D45 A;  1YIO A;  5IPA A;  5J8C A;  1XN7 A;  4EJO A;  1BIB A;  4AYB A;  4B44 A;  4DNC A;  5IP9 J;  4BQA A;  3S8P A;  3OYH A;  3ZRG A;  2P5V A;  5J47 A;  3K1P A;  2JRT A;  2NNN A;  3IP4 B;  1B72 B;  2QUF A;  3B02 A;  2DJI A;  1QZZ A;  4LGW A;  5E1W A;  2YS9 A;  1O7F A;  2R92 J;  4JQF A;  2ZBK A;  1D0X A;  1KQ0 A;  2IGM A;  2L54 A;  3P9C A;  5J1R A;  3BTL A;  2MD0 A;  1IV6 A;  2VAS A;  4G6Q A;  2K4B A;  3WTU C;  2V9V A;  3BG9 A;  1KU2 A;  4U0W A;  2R7F A;  3I4M J;  2FNA A;  3BP8 A;  4M71 A;  2KIM A;  5FRN A;  4BU2 A;  1U5T A;  3AKZ A;  2VJJ A;  1SD5 A;  2M4G A;  4B09 A;  3L09 A;  2BHZ A;  3EUH C;  1FIA A;  3C2B A;  4YFX F;  3H3Z A;  1B6A A;  2XSJ C;  3BCB A;  2JSC A;  2WBM A;  5ED4 A;  3ZOB A;  3PNY A;  1X1C A;  4PDK A;  2KIQ A;  4ZYA A;  1S3J A;  1A5J A;  5FLM J;  4UUS B;  1X3W B;  3H9Q A;  4ESJ A;  3FHN A;  3F8B A;  2GOX B;  1MBE A;  1O7L A;  1D5V A;  3CO6 C;  1V54 H;  1GUU A;  4AIJ A;  3F23 A;  2FBH A;  2YSR A;  4N4N B;  2DFE A;  2KZG A;  3HUG A;  3BOQ A;  1FBS A;  3CZ6 A;  2UXX A;  4HG2 A;  2M1B A;  2X1E A;  3V42 A;  5FLX Z;  4M72 A;  2Y0S N;  3OV8 A;  3SJM A;  4EQQ A;  2ISZ A;  3CCY A;  5FKM A;  3GTJ J;  2LVS A;  4EM0 B;  5ILV A;  2E35 A;  3DTI A;  3E0J B;  1U5T C;  4ANJ A;  2JMW A;  4CH7 A;  1IN5 A;  5FFZ A;  4ZTJ A;  2NOJ B;  4EGZ A;  2M30 A;  5GP9 A;  5KAI C;  2A5Y B;  1IW7 F;  2X1D A;  4ASN A;  2OCE A;  2DMT A;  1VND A;  2BW3 B;  3CME I;  2W7N A;  4NUB A;  1HCR A;  1ZK8 A;  4A12 A;  1BW5 A;  3BLY A;  1Z77 A;  2CQ7 A;  3HB9 A;  1VQ5 I;  2ME0 A;  3K4J A;  3H35 A;  4PK4 A;  3O6B B;  2OBP A;  1ZG3 A;  2EZL A;  4M3D A;  3SDG A;  5TRD A;  1Z9C A;  5FLV A;  1FTT A;  2RVC A;  1LDK B;  4AIH A;  3HIF A;  1FOY A;  3FM5 A;  3G1M A;  3Q9S A;  1B72 A;  2KDO A;  3K0L A;  4UUV A;  1P9Q C;  3B73 A;  2EPF A;  2CW0 F;  1TWA J;  2ETH A;  4RAG A;  3S2H J;  1N78 A;  2J5O A;  5CVJ A;  3JRA A;  2Y75 A;  4EJW A;  2HYG D;  4UV9 A;  4MQV A;  1OCO H;  3GTK J;  1SFE A;  3ASN H;  4E70 A;  1J75 A;  3HTS B;  1BOA A;  2R7V A;  3KZI C;  3F8M A;  1OCZ H;  3L2C A;  3VYS B;  3DWL E;  4IRH A;  3BZK A;  4GDF A;  4FE7 A;  3RQI A;  1FPQ A;  1BR4 A;  4L9N A;  3RKX A;  3UNG C;  1Z1D A;  1DP7 P;  3PO3 J;  1BI0 A;  2BZT A;  4E6K G;  1ZGA A;  1JE8 A;  2VQG A;  1K4S A;  2VT3 A;  3RJP A;  4BKX A;  3F8F A;  2M5W A;  5JLX A;  4FCY A;  2I5U A;  2Y0S A;  3KLN A;  5IYD J;  3BRO A;  1VQ6 I;  5DS9 A;  3T8T A;  4CCK A;  1YYV A;  2K9N A;  4XRS A;  3A02 A;  1Z7L A;  1R9T J;  3E5U A;  3SEZ A;  1VF9 A;  3V7C A;  1YI2 I;  2E34 A;  4HYE A;  4C3I J;  1PUE E;  2IA1 A;  4EM2 A;  2H09 A;  1I1S A;  3L7W A;  1HSJ A;  1SFO J;  1RKW A;  2HPM A;  4UNO A;  3ULQ B;  1FT9 A;  4HBL A;  3KFW X;  2DQR A;  1IN4 A;  5E17 F;  1BR1 A;  1Z6T A;  5DYM A;  2E1C A;  3BR6 A;  1AKH B;  4BS9 A;  4XR6 A;  3ZQH A;  1BM9 A;  2O8K A;  4B48 A;  3SYT A;  2BY0 A;  2QSH X;  4LJZ F;  2Y31 A;  1SD7 A;  2L0K A;  4IHV A;  1EV7 A;  1YW7 A;  3EDP A;  2CJJ A;  2ZFU A;  2DA7 A;  3LSK A;  3L2W A;  2VQH A;  4EEF G;  1P7I A;  2BW3 A;  3EET A;  1HKS A;  2XF7 A;  3KEY A;  2V7F A;  4YIR X;  2FXA A;  5IP7 J;  3DPU A;  1TL8 A;  4BE1 A;  4LK1 F;  2LY9 A;  5J6X A;  1W7P D;  1ZG5 A;  1A6Q A;  4MIM A;  3KYL A;  4MQ9 F;  2XGC A;  2F4I A;  3LA7 A;  1GDT A;  2O03 A;  2DFF A;  2L7Z A;  4MNU A;  3TW6 A;  5CVR A;  2L5Q A;  4BBR J;  1ZH5 A;  2UWM A;  1OCT C;  3H9J A;  2GIV A;  1ETW A;  1K7A A;  2OCC H;  1EJ9 A;  2O9L A;  3BZ6 A;  1YW9 A;  1NTC A;  1MBK A;  3I59 B;  4WF2 A;  5IY5 H;  1XSX A;  1SVL A;  1YIJ I;  3FZV A;  2IRF G;  2ZNZ A;  4HQM A;  5HNF A;  2UUZ A;  3RCO A;  1A04 A;  1U0J A;  5BMZ A;  1YG2 A;  2EQR A;  3I56 I;  4BH9 A;  2XPV A;  3VWB A;  2EIM H;  2VOD A;  3ESW B;  3K70 C;  1ACI A;  3TKY A;  2EFN A;  3K4B A;  4YG2 F;  2QEX I;  1YO5 C;  1KQ8 A;  4P9U A;  2G7U A;  3J7A O;  5HOD A;  1D0Y A;  2CV1 A;  1QGP A;  2M87 A;  2KZV A;  2F5C A;  2XRL A;  1NG6 A;  4PZJ A;  1SFU A;  4HV6 A;  1VTN C;  3N97 A;  3NAR A;  4BHB A;  1IXC A;  5LHI A;  2EWN A;  1OCR H;  1RUO A;  4MFD A;  3TQN A;  3QYF A;  2HXI A;  2KRH A;  4I76 A;  5FRM A;  2VE9 A;  1G4D A;  3P7N A;  4P96 A;  4IHW A;  2ISY A;  2Y9Y A;  2HKO A;  4KIS A;  1IGN A;  2FSW A;  2KHM A;  2H1K A;  3CCJ I;  5J3L A;  1WGX A;  1TNS A;  4RB2 C;  3E5Q A;  1HC8 A;  3RZD J;  1WQ2 A;  3MEX A;  1YLF A;  3A0B C;  3QPL A;  3RZO J;  3E6B A;  3JCU C;  4XMY A;  1YFH A;  1ZTR A;  1BOB A;  4A3D J;  3TDU C;  1RRJ A;  5KVR A;  3LSM A;  3CD6 I;  2E36 A;  4PSX A;  2YU3 A;  2XKO A;  3EUK L;  3R0J A;  4WX9 A;  2R7S A;  3R0A A;  4UV8 A;  2LSO A;  4IL6 C;  2QSF X;  3OR1 C;  5HLI A;  3TDZ C;  4DBQ A;  2FX0 A;  3V7S A;  3QRF F;  4Q5S F;  3R4K A;  3FMR A;  1X4O A;  1FC3 A;  3HOT A;  3W6J B;  3OYK A;  2RV8 A;  2O5R A;  1V5G A;  1YOV B;  3OYL A;  3FWE A;  3ZMZ A;  2DT7 B;  5DUI A;  1QNT A;  1POG A;  3CP8 A;  5TIS C;  4CCO A;  2XKP A;  3WTY C;  1F1Z A;  4FAS D;  1R4M B;  1UG2 A;  2V9P A;  4DGW B;  1Z3X A;  4BBS J;  4W1U A;  2NS7 A;  3GFL A;  1D1B A;  1MIJ A;  2VL8 A;  2COB A;  5E3L A;  1DU0 A;  1W7P B;  1F36 A;  3BG7 A;  2DW4 A;  4Y17 A;  5M5X J;  2BE5 F;  2MA3 A;  4BHP A;  1EH8 A;  1MSF C;  4R1H A;  1SAN A;  1GLN A;  1ULY A;  4J19 A;  2PMZ N;  4XLN F;  2R7T A;  3U1D A;  3CUQ C;  1UEL B;  3QP5 A;  5L3C A;  2CV2 A;  3I59 A;  3I9V 2;  3LWF A;  5CVU A;  3S2D J;  3DV8 A;  4BQQ A;  3ROU A;  4L5I A;  3J81 Z;  4CIC A;  3HSR A;  3KP3 A;  5FO5 A;  3N4M A;  4KMF A;  3OYA A;  2NAZ A;  3DBH B;  3K2A A;  4KYW A;  2DPD A;  1OLT A;  2Y2Z A;  3JAM Z;  5LD2 C;  4KMU X;  3DFG A;  3AG3 H;  3CCL I;  3R61 A;  2QF7 A;  1NG7 A;  3IKV A;  1LFU P;  1Q1V A;  1SEU A;  1FBQ A;  1IG7 A;  3V8J A;  1I1G A;  2VBY A;  3AFH A;  2N8G A;  1PDN C;  2FOW A;  1S7O A;  2FBK A;  3I4P A;  1HW1 A;  1XGS A;  2Z5U A;  3DTK A;  3VPR A;  3H3V K;  3SEQ A;  4ZDO A;  2NNY A;  1O3Q A;  4RAF A;  3CMM A;  3PSI A;  2LOO A;  1R1U A;  2BVM A;  1TWC J;  5DD8 A;  2PX9 A;  3QP6 A;  1OCC H;  4O3M A;  3DPL C;  2A5W A;  2LK2 A;  4G7Z F;  2KLO A;  3MN2 A;  3AG2 H;  3IWF A;  2UV1 A;  1KU7 A;  3WHC A;  1UAA A;  1VZ0 A;  2XPW A;  2GAU A;  2DOF A;  2CS3 A;  3NRV A;  4BQN A;  3KP2 A;  1J59 A;  3DEU A;  2LF8 A;  1FYL A;  3BT9 A;  3K9T A;  1YJN I;  1YE9 A;  2G9W A;  4PUS A;  5GTH C;  2XRN A;  4S04 A;  4CHU A;  5ERI A;  3F8C A;  1MMD A;  4I98 B;  4A69 C;  1N77 A;  2EZI A;  2WAE A;  3GZ6 A;  5KK1 A;  1HKQ A;  4EJU A;  4MLO A;  5M5W J;  5JFR A;  4G8X A;  4A2U A;  4FX4 A;  4UB6 C;  2WY8 Q;  2JA8 J;  4A0Z A;  1ETY A;  1D1C A;  5B1B H;  3ZXS A;  1W0T A;  1G2H A;  1WJA A;  2VKD A;  4KUM A;  3OL4 A;  3OWT A;  1RET A;  3ABL H;  1RZ4 A;  2DA2 A;  3CDI A;  3TMO A;  2HGC A;  2OJE D;  3CP2 A;  2JUG A;  5FRO A;  3I4N J;  5EF6 A;  5DDG A;  2ZNY A;  1SFK A;  3KYD B;  3FK7 A;  3K4K A;  4F7Z A;  2E60 A;  2E7X A;  1U78 A;  3M07 A;  2Z2S B;  1IRF A;  1QZY A;  2OD5 A;  2MLG A;  3LSH A;  1T8I A;  2A6T A;  2RKH A;  1G3T A;  4ABZ A;  5ICG A;  2Q2E B;  3HYI A;  5BPD A;  3SFZ A;  1LB2 A;  2X1C A;  1D3Y A;  4H4K C;  3S17 J;  3E3V A;  2HQA A;  3ISP A;  1W5C C;  2H1L A;  2CW8 A;  2RRE A;  3A0H C;  1VQO I;  4Z6Y A;  5B66 C;  2V1U A;  5CVI A;  1TT0 A;  5FD6 A;  5LEK A;  3CJQ B;  1BI1 A;  3PNV A;  1HXD A;  1B8I A;  1IRG A;  2P4W A;  1NHA A;  4A3I J;  2M3A A;  5FD5 A;  1FMW A;  2CV0 A;  4NC7 A;  4Y15 A;  1T0F C;  2DMQ A;  3KP4 A;  4OU0 A;  2F2E A;  2HWV A;  3O8G A;  2MYS A;  3NQO A;  2LBF B;  2K3F A;  4HRI A;  3PIP F;  2ADU A;  5IT9 Z;  2KRF A;  3OMY A;  2JPB A;  1R58 A;  3CCU I;  3FKI J;  4KT6 A;  3C2G A;  4DW6 A;  2QSG X;  1T95 A;  1FIP A;  1XTA A;  3G2B A;  4OIO F;  2FMY A;  2PLY A;  2ECC A;  1XSV A;  3GWZ A;  4BNC A;  2F5V A;  1SVM A;  2IGN A;  1X1D A;  2COM A;  2XDV A;  5GPC A;  4WXH A;  4AYB N;  3TED A;  3E6D A;  2O0Y A;  3DEE A;  5FKN A;  2WAF A;  3ZCO A;  2H8W A;  2H8R A;  2VC0 A;  2PJP A;  3EYI A;  2XF6 A;  2FA5 A;  4G9Y A;  4U7B A;  1FOX A;  5D5X B;  1KGS A;  3CJT B;  1TWG J;  1IN6 A;  1R5I D;  3GME A;  1ON1 A;  4I0B A;  5DD4 A;  2GA1 A;  4FIS A;  2BY2 A;  3VYT B;  1P2F A;  3TBI A;  2CSO A;  1AWC A;  2HNH A;  2DFH A;  2HOA A;  2KL4 A;  5J40 A;  2VON A;  4D7N A;  3HOU J;  1Z21 A;  4XNF A;  4XKW A;  4PFP A;  2HDD A;  3QAH A;  1F43 A;  5L3E A;  2LKS A;  5L3G A;  4KIG A;  1KQ9 A;  3CF5 F;  4HDV A;  4I02 A;  1HW2 A;  2DXI A;  1H88 C;  2B7E A;  1ERD A;  4IO9 F;  1TWH J;  2R4G A;  2OTJ I;  4IRI A;  1T33 A;  4RLF A;  1GXQ A;  3M9A A;  3ECH A;  1IDZ A;  4LLN A;  3OYI A;  3W2A A;  4QWQ A;  2HR3 A;  1HLV A;  1LE8 B;  2R5Z A;  4G6D A;  2EZK A;  5EZH A;  1YS7 A;  3IH3 A;  2KP6 A;  3KX2 A;  1X19 A;  2K40 A;  5F0C A;  5CQE A;  2JA7 J;  2OZU A;  3FDY A;  2QLZ A;  2WV1 A;  2X6W A;  3BJA A;  3GZ5 A;  3IAS 2;  4M6X A;  5FFX A;  1L0O C;  2P5K A;  1STZ A;  4U7D A;  3TP3 A;  1HW5 A;  2BY3 A;  4ZH4 F;  4UVB A;  2EJR A;  1S9H A;  3U21 A;  1JTY A;  1UZC A;  2DJN A;  4L5J A;  4LIT A;  4DYC A;  1LFP A;  3CMY A;  2HDC A;  4IHT A;  3BG6 A;  5LRR A;  3F0C A;  3HPH A;  3KZY A;  2LFB A;  5A2Q Z;  3CMA I;  4XN3 A;  3WTX C;  1R23 A;  2E71 A;  3LSI A;  5E1X A;  1P4W A;  1IXR C;  4C2M J;  2GA2 A;  2G7H A;  2KIS A;  1UB9 A;  2CQN A;  3M1C A;  5CLS A;  3WG9 A;  4AD9 A;  1BI2 A;  3JRC A;  4KT5 C;  2QKM B;  5CJ9 A;  4A3J J;  2D5V A;  4XLH A;  5KCM A;  3PIO F;  2LDU A;  5FLX K;  3O2P E;  3J7Y J;  1TTY A;  4EAT A;  3HKZ N;  5JVG F;  4Y33 A;  2I10 A;  2J5P A;  5E8I A;  2XV4 S;  1JKR C;  2E5N A;  5TJJ A;  4N9H A;  1QA6 A;  3SQN A;  3ABT A;  2CQK A;  1BC8 C;  1W36 D;  3KIO A;  4FE4 A;  3L2Q A;  2JSP A;  4NC8 A;  1WJ5 A;  1H9G A;  4B3A A;  2VQC A;  1ZG1 A;  2CQQ A;  2R3S A;  4ENK A;  3TGN A;  1H8A C;  2DMP A;  4XLA A;  1XS9 A;  2HQR A;  1N25 A;  1PVE A;  3I64 A;  5D8K B;  2VBW A;  4CZC A;  2GXB A;  4ZZL A;  2PEX A;  1FY7 A;  3CC4 I;  4JYK A;  2G0E A;  4A0X A;  5D6F A;  1M1E B;  3VB2 A;  4M3F A;  3HEF A;  1R5G A;  2MD5 A;  2EIK H;  1OYI A;  4JX5 A;  2LKP A;  3IWZ A;  4II3 A;  3MKY B;  2B63 J;  4ENN A;  1A31 A;  1E0E A;  1O3T A;  1V5E A;  1LVK A;  2IJL A;  4LIV A;  4M9Z A;  2F5D A;  4IQ4 A;  2HPI A;  4AVP A;  3IUO A;  3E97 A;  1MMG A;  4P9F A;  4L0Z B;  3Q0U A;  3CC2 I;  2QQ9 A;  2ZME B;  4NB5 A;  5DM7 F;  2V1N A;  3PQJ A;  1ODD A;  4MGR A;  2V1D A;  1XCV A;  5M5Y J;  4XLE A;  1FZP B;  2K9M A;  2XGD A;  2PQ8 A;  1B59 A;  5ICC A;  1FP1 D;  2RGV A;  4NC6 A;  3ZQQ A;  3ZR8 X;  4EGY A;  4JK1 X;  2DOD A;  2ESH A;  4XOR A;  2P6T A;  3S14 J;  3J80 Z;  3ERM A;  1JHH A;  3NWS A;  1ON2 A;  3J7Z I;  5DUK A;  1H89 C;  1K83 J;  4A5M A;  2ZJR F;  3BZC A;  5D8L B;  3A01 B;  4IKF A;  3IV5 A;  2CUE A;  4FHT A;  2RNG A;  3LSJ A;  4HSR A;  2EB7 A;  5E8G A;  1REP C;  4ENJ A;  2VJI A;  2Y69 H;  3H5A A;  4AIK A;  4E7H A;  2OU2 A;  1MZB A;  3QOD A;  3JRD A;  3WE2 A;  3BR1 A;  3HKZ A;  1HQC A;  4RA2 A;  5HLG A;  4HX8 A;  1Q1H A;  2CFO A;  1RKT A;  2AXT C;  2E2J J;  4HF2 A;  5BNG A;  4F55 A;  3FMS A;  3WU2 C;  4J00 A;  1RES A;  1EH7 A;  3W2W A;  1OR7 A;  1JT0 A;  3PNT A;  3GTM J;  1X3Z B;  3OYD A;  4XL9 A;  4QPO A;  4I2O A;  5LEJ A;  1GVJ A;  3IRQ A;  2ELH A;  2VIX A;  4XOT A;  3TO7 A;  3DXJ F;  2EFP A;  3OSG A;  2EK5 A;  1SMY F;  2DO7 A;  1J2X A;  3BTI A;  3FXJ A;  3HRT A;  4WWC A;  3GF2 A;  1X2M A;  3SZT A;  2ICW G;  2XAG A;  1VQM I;  4CA0 A;  1D1A A;  2LMD A;  2PG4 A;  2CUF A;  3MAJ A;  3TOB A;  4BGD A;  3QPH A;  2X6O A;  5CYV A;  3F6V A;  3GTP J;  5FGM A;  1FWZ A;  1EH6 A;  2FJ1 A;  4RMN A;  3E5X A;  3ELK A;  1B4A A;  4BUP A;  1P7J A;  3KEO A;  1T56 A;  5EEH A;  3IRR A;  3A2K A;  1O3S A;  1OCP A;  4BJ5 C;  3K7A J;  4HNV A;  2HFH A;  1S8N A;  1FBU A;  2GXG A;  3N05 A;  2TRT A;  4E7Z A;  4GCV A;  1T39 A;  5GAG J;  1FTZ A;  3ZQF A;  3COA C;  5DCM B;  4E7K A;  4S05 A;  4UUS A;  1VI0 A;  2VN2 A;  2W00 A;  4UB8 C;  5HOO A;  2F4O B;  2KQR A;  2ZME A;  3R6S A;  4X0G A;  1QO0 D;  1R22 A;  2D1H A;  2OF7 A;  5HDN A;  3MZY A;  2X4H A;  3HRM A;  5FKO A;  1K4T A;  2IBD A;  2H94 A;  4ZC3 A;  3HC7 A;  1HF0 A;  4HPQ A;  5H20 A;  2DTZ A;  1AU7 A;  3FBI B;  2H6C A;  3LFK A;  4ON0 A;  1R71 A;  3MKZ A;  2RC4 A;  1D0Z A;  2D2W A;  2DFI A;  2XAU A;  4EV0 A;  4O6J A;  3OS0 A;  1SAX A;  3MFK A;  1MNM C;  5HLT A;  4HNT A;  4F91 B;  2NVU B;  4IZZ A;  2FOK A;  1JHF A;  3MZH A;  1W0U A;  1C0W A;  3BJO A;  3F21 A;  2FU4 A;  1ITY A;  4P5O A;  3HOW J;  2E1O A;  4OIN F;  1VQK I;  1T6S A;  2W85 A;  2R7Z J;  2ZXW H;  3REO A;  3K4M A;  3U2R A;  5E1Z B;  3HG9 A;  3GCM A;  1G59 A;  4OAZ A;  3WG7 H;  1XMX A;  1KYW A;  1MMN A;  3BQZ A;  1ZN2 A;  2GWR A;  2YX4 A;  3AG1 H;  3GFJ A;  2H6B A;  2IS2 A;  3OOU A;  1ZRE A;  2A3S A;  1RUN A;  4KJZ A;  3K4L A;  1RR7 A;  3M8E A;  2DMN A;  3M3Y J;  2EV0 A;  3Q0W A;  4OOI A;  4MTD A;  3JRI A;  3DKY A;  4M3E A;  1R36 A;  2M2E A;  4AC0 A;  3WU0 A;  4XON A;  3CCQ I;  4CGZ A;  1D8J A;  1TC3 C;  1GV5 A;  4Q4Z F;  1BJA A;  2V9K A;  1SVO A;  5LBQ A;  1WI9 A;  3H5R A;  4EJV A;  5IYB J;  1JUM A;  2EV5 A;  2M4K A;  3KLO A;  2WB1 A;  3S3M A;  2WAQ A;  4M74 A;  2R5Y B;  2EV6 A;  2K9L A;  1XB4 A;  3BG5 A;  3GLL A;  1W5S A;  2PFB A;  4R79 A;  1TLH B;  1ENH A;  2Z16 A;  5K7F A;  5E3M A;  2JUC A;  1CQT A;  2HEO A;  2VOP A;  3S15 J;  4H0E A;  2IGK A;  2R7O A;  2K7L A;  2NOG A;  3M8J A;  4HW0 A;  2W82 A;  4XM3 A;  3D0S A;  2Z3Y A;  4CXF A;  2K02 A;  2IS4 A;  3H1C A;  1E17 A;  3JSP A;  3FM3 A;  2P6S A;  1GVD A;  2HOS A;  1XSD A;  3SFI A;  1Z3Y A;  1UCR A;  2DU9 A;  3V4G A;  1RI7 A;  4BDY A;  1P6R A;  5D4S A;  3WTZ A;  3CTA A;  5DCM A;  1R49 A;  1P4X A;  2L7M P;  2OV7 A;  1X1B A;  1TNT A;  3EPZ A;  2ZXH A;  3B6A A;  5KNL A;  3I0T A;  2DYS H;  2DPU A;  3I3L A;  5H6Q A;  1OIS A;  1KZH A;  2VKE A;  2HDW A;  3CJN A;  3V7R A;  1EA3 A;  2PN6 A;  3G6E I;  3JAM K;  1ZRC A;  3HDD A;  5F0H A;  5L3B A;  4LOC A;  4XKC A;  4IHX A;  1Z67 A;  1FSE A;  2MLK A;  1V4R A;  3HZJ A;  5IP6 A;  1AKH A;  4A3K J;  3K69 A;  4G7H F;  3ZQ7 A;  1BI3 A;  4HLY A;  1SFX A;  1UST A;  3D5R C;  4ENM A;  2KPM A;  5AIP A;  3FIS A;  4C3J J;  1TBX A;  4HF0 A;  2IT0 A;  1J9I A;  1RNL A;  3FMQ A;  1QHH D;  2VOO A;  2FEZ A;  2BHY A;  3GVA A;  4M6V A;  3FBN B;  2XAH A;  3Q0V A;  4B47 A;  4F93 B;  3MZ8 A;  3OS2 A;  2K3P A;  4D9J A;  2LD5 A;  1LEB A;  1V5F A;  2R7D A;  4KA4 A;  3K4N A;  5C4J J;  1R4N B;  3GW2 A;  4IX7 A;  1YW8 A;  2M0C A;  2XB5 A;  4M3G A;  2DA6 A;  3MKL A;  2E2I J;  4HOB A;  2MC4 A;  4A6E A;  1HA8 A;  4A3G J;  5J4Y A;  2VKV A;  4LFU A;  4OIR F;  1QPI A;  4RGR A;  3LA2 A;  4PJJ A;  3AL0 B;  2VXZ A;  2L7F P;  1JTX A;  1X4P A;  2Q0O A;  1I50 J;  2QM3 A;  2BY1 A;  2BBY A;  3C1D A;  1PUF B;  3A4C A;  4LG0 B;  1IO2 A;  3Q3S A;  3ZGK A;  1WCM J;  4N0B A;  1F9N A;  3FXK A;  4JX4 A;  3ERE D;  1QZE A;  5D6E A;  4E7I A;  2JT1 A;  1FYM A;  2CUJ A;  3H3U A;  2X85 A;  4XLF A;  2WAD A;  2JA5 J;  2GZW A;  4GYI A;  1WKM A;  1IN7 A;  2HQ5 A;  3FXO A;  2FE3 A;  4K2E A;  2Z1D A;  2HOT A;  3A1Y A;  5BS6 A;  2L9N A;  1XD7 A;  2QGU A;  2QKL B;  4BXF A;  1TQI A;  5TGT A;  3IC7 A;  2DN0 A;  2JJ7 A;  1XG1 A;  4GRI A;  5E3N A;  1LQ1 A;  2YX7 A;  4O5V A;  4KFC A;  5EGO B;  3CCS I;  2W57 A;  1U9N A;  4KN4 X;  2GOM A;  4HLX A;  2LF7 A;  2MSY A;  3ZMU A;  1IZ1 A;  2X51 A;  2A61 A;  1HOM A;  2VBZ A;  1WPK A;  1U2W A;  2ELK A;  2YR2 A;  2E1M B;  5ILS A;  3RKW A;  2X48 A;  4L0Y B;  4EJT A;  3TOA A;  3L1P A;  4BQO A;  3DLA A;  1A35 A;  3QOP A;  2ZKZ A;  3K2Z A;  1R7J A;  4PJ0 C;  1FSH A;  3FXR A;  4IVN A;  1YX5 A;  3OYN A;  1WSU A;  5LGT A;  1NK3 P;  4XRS G;  1MNE A;  3RIR A;  4M3B A;  4NQW B;  1OYY A;  2IA0 A;  1DPR A;  2WV0 A;  4UXN A;  4C2U A;  1QPM A;  3S16 J;  3FXM A;  5FKK A;  3AAF A;  1LJ9 A;  1Y39 A;  1OQY A;  2IXS A;  3U1K A;  3RI4 A;  3W3C A;  4E4H A;  1DUX C;  3CCM I;  3CES A;  2FNP A;  3QU3 A;  3LAJ A;  3P5J A;  4G6T B;  1QRY A;  3F9K A;  2DK5 A;  5F1J A;  4Y7N J;  2ZO4 A;  2JTV A;  4DYQ A;  1MH3 A;  3DF8 A;  1U3E M;  1UG0 A;  2FBI A;  3DTE A;  3VEP A;  4D1Q A;  2LTP A;  4S0H B;  1T98 A;  3KZZ A;  3QOE A;  2QZ8 A;  2K4J A;  4HA8 A;  2JA2 A;  5IT3 A;  5IT9 K;  3GFM A;  1D5Y A;  2OUM A;  4U88 A;  2JVH A;  1BJZ A;  2JVG A;  3KEQ A;  4IJA A;  2FRH A;  4IHY A;  2RNJ A;  2B9S A;  3DEW A;  1K6Y A;  2VI6 A;  2XSD C;  4JBA A;  5E18 F;  4XKB A;  3V8K A;  5DCF A;  3ZQG A;  2M7A A;  2DDA A;  3G73 A;  4IHS A;  2ACJ A;  2PI0 A;  1W7P A;  2HZD A;  4LLL A;  2X6Y A;  1T38 A;  3ZMS A;  1ZAR A;  3DCF A;  4IQJ A;  4A5N A;  4LMY A;  5F0F A;  4LG0 A;  1T08 B;  5GAD J;  1PUF A;  2V6C A;  1TQM A;  4RLQ A;  2CQX A;  3T0Y A;  2KFD A;  2HYJ A;  1USS A;  1HKT A;  1KON A;  2E19 A;  2VXD A;  2XVC A;  4A3F J;  2DTR A;  1R1V A;  2DCE A;  2L3D A;  3OYC A;  2XAJ A;  3QWL A;  3U9G A;  3W6V A;  4ZTF A;  1TZL A;  4LB5 A;  4HZF A;  4J01 A;  4B1R A;  3KET A;  3FKJ A;  4C3H J;  1WJD A;  5CVV A;  1SC7 A;  3WGG A;  2DT6 A;  1R1T A;  2KT0 A;  2A07 F;  1DU6 A;  4E7J A;  2JQ7 A;  1PJR A;  1Y1V J;  4XQF A;  3NAU A;  3PL8 A;  3JRG A;  3BTC A;  2KRC A;  3T5X A;  2CMP A;  5FKL A;  5EGO A;  1HBX G;  2R7W A;  3HGG A;  1RIO H;  1MBF A;  3VSK A;  3EYY A;  3M8F A;  2QBY B;  1Y56 A;  1H9T A;  4GFB A;  1BN5 A;  4CUG A;  1SAU A;  1I27 A;  2XAF A;  4PCQ A;  1S6L A;  2LY1 A;  3PM1 A;  3RPU D;  3OYG A;  1ZR2 A;  1Y8R B;  3TO9 A;  4WXD A;  3CJR B;  4N4O B;  1IN8 A;  4YFK F;  2DA1 A;  1WJC A;  5JLW A;  1G6N A;  5D5U B;  1BW6 A;  3ZQL A;  1NK2 P;  1X1P A;  3DKW A;  4NQW A;  2DOE A;  5EEG A;  3ZQC A;  3BR0 A;  2AO9 A;  3KP5 A;  3RDI A;  3HRS A;  5HDK A;  1FX7 A;  3ABM H;  5BOX A;  3Q9V A;  5HS7 A;  2EFO A;  3LQR A;  3M4O J;  3T8R A;  3WTT C;  4LK0 F;  4LB6 B;  2QCO A;  2FQ3 A;  4X6A J;  2VPL A;  3RPQ A;  4BY7 J;  3I5U A;  5A2Q K;  1KU3 A;  2Y0M A;  3D5L A;  1IXS B;  3B6C A;  3HOS A;  3S2W A;  1RC9 A;  4HX7 A;  3LSG A;  3VFZ A;  1QVT A;  3HPG A;  2YPR A;  2L7K A;  5DV5 A;  3ZMT A;  4G7O F;  2XHK A;  3M1E A;  4UHT A;  1I39 A;  1S5L C;  1U6G A;  3CDL A;  2M45 A;  2E7W A;  2MG4 A;  2UXN A;  3L00 A;  2GQQ A;  2Y9Z A;  1MSE C;  2Q1Z B;  4ZYD A;  4CO8 A;  3SZG A;  4CCJ A;  4ZYH A;  3RYP A;  1ONV A;  2E1N A;  2KIF A;  4BEH B;  3G71 I;  1Z6R A;  1MJB A;  4BYY A;  3S1R J;  3ZN0 A;  1XGN A;  3E6C C;  2VLA A;  3GTO J;  2CWE A;  3SXY A;  3LA3 A;  2R7U A;  2GBY A;  1YX3 A;  4RAY A;  2YU9 J;  1ZAO A;  2EA4 A;  2W25 A;  1MMS A;  1K78 B;  2CO5 A;  4WXC A;  4FTH A;  1U5T B;  2AQE A;  3GUD A;  3PO2 J;  4AU7 A;  1ZLK A;  2LRD A;  5HDG A;  3OIP A;  1J09 A;  2MH9 A;  2BXY A;  2ZB9 A;  1N75 A;  1JUP A;  4Z2Y A;  3HL2 A;  2LR8 A;  4X1E A;  4LD5 A;  2KDZ A;  1X3U A;  2V4J C;  2EIN H;  2ZXI A;  3MD2 A;  2Q2E A;  2EBI A;  1W5T A;  3A03 A;  1LNW A;  1QBJ A;  2Z99 A;  3HSE A;  3D1N I;  4RBO A;  3F6O A;  2CFX A;  1PP7 U;  3S1Q J;  5JI6 A;  1H0M A;  2QQA A;  1WFX A;  3O3K A;  5J1Y A;  1QVU A;  4A6D A;  1IAW A;  1U9O A;  3FF5 A;  3JTH A;  1X58 A;  4XRM A;  3MCZ A;  1FNN A;  1UJ8 A;  2E5Z A;  3RKY A;  4KDP A;  3FXU A;  4I7H A;  5HVQ C;  4DYR A;  2CH0 A;  1IRZ A;  1IRX A;  1R6R A;  4V2F A;  5K5Q A;  2XRO A;  2VB6 A;  2K86 A;  4I09 A;  4UUT A;  3VSL A;  2R93 J;  4F92 B;  3CF2 A;  2CYY A;  3FX3 A;  3L2U A;  2VJ5 A;  4I01 A;  4XOP A;  4IOC F;  2LBF A;  2AQF A;  5B3S H;  1JUS A;  4UY8 I;  1SD6 A;  4L5E A;  4A3B J;  1ETO A;  3JSO A;  4JX6 A;  3J80 K;  2K9Q A;  5LRS A;  2L9V A;  4GXO A;  2DA4 A;  4F52 A;  4XSX F;  4C30 A;  4E7S A;  1V55 H;  2M8E A;  2BYV E;  5C4X J;  4M9S A;  2L02 A;  4XLC A;  3HBL A;  3KYC B;  1WJF A;  2JA6 J;  2B0L A;  5F1R A;  1DGW Y;  5K7H A;  1YJ9 I;  1IJW C;  2V6E A;  1JKO C;  4G94 A;  1JJ6 C;  2ELJ A;  1J5Y A;  4DJA A;  1ZRD A;  4D7M A;  2NS8 A;  4BL0 B;  2LKX A;  2W1O A;  3ZN1 A;  2W48 A;  4BDZ A;  3HHH A;  3IAM 2;  1WJE A;  1VQ7 I;  3O8H A;  4FX0 A;  2AHQ A;  3HRU A;  4PJN A;  3JTG A;  1BBY A;  2QVO A;  3HSF A;  3GXO A;  2DA5 A;  4KIF A;  3QU6 A;  4BE0 A;  5M3M J;  2L9R A;  3VDX A;  3CUO A;  5KHD A;  2ZJQ F;  1V3F A;  3BPX A;  2UZK A;  1OFC X;  2XB0 X;  4BEH A;  3K6G A;  5JVT A;  5HS8 A;  4PJL A;  1WWX A;  2HOE A;  2L2O A;  1B1B A;  1LKX A;  5DTD A;  5H2F C;  1K78 A;  2VC1 A;  1FYK A;  3JRH A;  1E3P A;  3OIO A;  1W4M A;  3MQ0 A;  1PYV A;  1WHU A;  3WTW C;  2M9H A;  2HVQ A;  1ZQ3 P;  2LH9 A;  2QYO A;  4NNJ A;  5HLH A;  4Q47 A;  3F3X A;  1VQ8 I;  1MBH A;  4KIB A;  1LE8 A;  4Y4R A;  2W84 A;  4RS8 A;  4ZJZ A;  4IF4 A;  3QYE A;  4U0Y A;  2RAE A;  1XMK A;  2DLL A;  3LOC A;  4JP0 A;  5KAF C;  4MO7 A;  1TP4 A;  2X9D A;  1BR2 A;  3OL3 A;  5K1Y A;  4L9T A;  5F27 A;  1DGR M;  3VYR B;  1O57 A;  5K5O A;  4M73 A;  3RYR A;  2JZY A;  3WOD F;  1SD4 A;  5E20 A;  1K6O A;  5GTI C;  5EZG A;  4XIC A;  4A3E J;  4OIQ F;  1A6I A;  4M9X A;  4C2T A;  3ZMD A;  1ZLJ A;  2A69 F;  3AG4 H;  3BWG A;  2MW8 A;  2CU7 A;  2HTJ A;  2Z9O A;  2STT A;  1T2K A;  3NWT A;  3JRF A;  2ZXJ A;  2KMU A;  4OWR B;  4NBQ A;  1K61 A;  3ASO H;  2JN6 A;  4QPQ A;  5BPI A;  3W6K B;  3JR9 A;  1KYZ A;  2F5E A;  3CDH A;  3BR3 A;  4V19 K;  3D5S C;  3RPU A;  3MMY B;  2P7C B;  4PGH A;  4BJ6 C;  2XAS A;  2CRG A;  2OTL I;  2KJC A;  1YRN B;  3RKQ A;  2WA0 A;  4DOZ A;  5BQT A;  2R0Q C; 
#chains in the Genus database with same CATH homology
 2EFW A;  3WU1 B;  4XLP F;  2OQR A;  3Q5F A;  2WC2 A;  4KNY A;  1UHM A;  4XRF A;  2HYF A;  1XMA A;  1G3S A;  4UVA A;  5LGU A;  1KA8 A;  1Z7U A;  3FHZ A;  4M6Y A;  3GFI A;  2P7V B;  1HST A;  3H92 A;  5D5V B;  3GO5 A;  3WTV C;  4RB0 A;  4I0A A;  2MH2 A;  3GLX A;  2Z33 A;  5ILU A;  2FF4 A;  2WWY A;  1ZYR F;  3M7G A;  5H6R A;  3LST A;  3KCC A;  5LLQ A;  1CF7 B;  2OZ6 A;  3K1N A;  4MTE A;  4XBF A;  4ZYG A;  2ZJ2 A;  4RAZ A;  3ZPL A;  4DQ2 A;  3K1M A;  2L4M A;  3TO6 A;  1CGP A;  3ECO A;  3VOD A;  1XCB A;  4U0V A;  1F5T A;  1JXS A;  2KKO A;  1XDU A;  3CUQ B;  2QEN A;  4L9V A;  1PP8 F;  4L9J A;  2O3F A;  2IW5 A;  3C3W A;  1DDN A;  2JPC A;  4ESB A;  2VT2 A;  3LAP A;  2AS5 F;  3EQL F;  4IPA A;  4N9I A;  5LHG A;  3R60 A;  3CO7 C;  5AIQ A;  4AWX B;  2A6H F;  1MJ9 A;  5F64 A;  3GYH X;  1ZGJ A;  1G3W A;  2O6G E;  2K27 A;  2KIU A;  4RGX A;  1JGS A;  1ZRF A;  3VOE A;  5FB2 A;  4WK8 F;  3E6M A;  2ZFW A;  2DAO A;  5L3F A;  4IRG A;  3C18 A;  1MJA A;  2HKX A;  4IXA A;  1WRJ A;  1B9N A;  1MD0 A;  2TDX A;  5AON A;  3J81 K;  4P55 A;  2DQL A;  4NHJ A;  2IP2 A;  2HZT A;  1LDD A;  3JW4 A;  4HQE A;  4CZZ A;  1CF7 A;  1Y0U A;  2W24 A;  2H27 A;  2BV6 A;  3ABU A;  2RDP A;  2O8X A;  1B9M A;  1TW2 A;  4GO1 A;  1IF1 A;  4BXU A;  2L4A A;  3SHF A;  2OQG A;  3KE2 A;  4HDU A;  4D0P A;  4LLG F;  3BPV A;  3CUQ A;  1XDS A;  3KP6 A;  1OMI A;  2HQN A;  3HTU A;  4OIP F;  1L3L A;  4UVC A;  4FT8 A;  3RTR A;  4HF1 A;  1Z05 A;  3I54 A;  2Y48 A;  4OMY A;  1DPU A;  2O61 A;  3DP7 A;  1YTY A;  4GYG A;  3QPT A;  1MDM B;  1YQA A;  2PBI A;  2AXL A;  4MHG A;  2XUB A;  1ZHF A;  1K79 A;  3KP7 A;  4HAM A;  3CLO A;  3BJ6 A;  4KIC A;  1R00 A;  1FOK A;  3OOP A;  3P9I A;  1E2X A;  2BGC A;  1XGM A;  1S7A A;  4BAY A;  3I53 A;  5F6F A;  5LGN A;  4YII A;  1XGO A;  2LNB A;  2IPQ X;  3IKT A;  1G3Y A;  2RN7 A;  5HS9 A;  6PAX A;  4OMZ A;  4WCG A;  4CYD A;  2A68 F;  2KJB A;  2MBF A;  3L9F A;  2DK8 A;  2X0L A;  3NEU A;  2QQB A;  1J7K A;  1QQI A;  4KN7 X;  5LHH A;  4EMS A;  4A0Y A;  3IHU A;  2XIG A;  3DPT A;  1O3R A;  3F22 A;  1LEA A;  1YS6 A;  4YIF A;  3IL2 A;  4RB1 A;  4RGS A;  2V1X A;  3WGI A;  3DQV C;  2F5F A;  2FML A;  1LVA A;  2EFQ A;  3V8L A;  1BIA A;  2XGX A;  3BDD A;  4GGG A;  5DEQ A;  1MGT A;  1TW3 A;  1FLI A;  2PMH A;  3MWM A;  5K5R A;  5D5W B;  2CG4 A;  1OKR A;  3G3Z A;  1U8R A;  3HHG A;  1T0F A;  2IVM A;  1MDM A;  3LQQ A;  5D4R A;  2HS5 A;  2L01 A;  4Q48 A;  1AOY A;  2VE8 A;  3F72 A;  2MC3 A;  2IA2 A;  2STW A;  3P9K A;  4ESF A;  1TQP A;  1GHC A;  2NRA C;  1D8K A;  3BY6 A;  3WTS C;  4TV7 A;  4HV5 A;  1FP2 A;  2QWW A;  4QLC U;  1OYW A;  2C6Y A;  1GXP A;  2HTS A;  2EA2 A;  4B8X A;  3I71 A;  4XSZ F;  4R8H A;  2VBX A;  4EM1 A;  3ZMV A;  1S29 A;  2P8T A;  5J8F A;  2OAZ A;  4HX4 A;  2BEO A;  2D1V A;  1BC7 C;  4EVI A;  5JHU A;  2XAQ A;  1Z91 A;  2P5L C;  3GX4 X;  4ETS A;  4RB3 C;  1I6X A;  4MEX F;  2NS0 A;  1R5H A;  2Q8K A;  4RGU A;  2ESN A;  3WE3 A;  5ICF A;  3ZP5 A;  4CDG A;  5ICE A;  1UHW A;  3PQK A;  5JR3 A;  2NYX A;  2V79 A;  1OPC A;  1F4K A;  4MEY F;  1IUY A;  4BHC A;  2WTE A;  1P92 A;  3C7J A;  2OA4 A;  3PFI A;  1I5Z A;  1KU9 A;  2DI3 A;  1UFM A;  3FXQ A;  3I58 A;  3WGH A;  3F8N A;  2CGP A;  2A6E F;  4PGG A;  4L18 B;  3GEZ A;  3SZP A;  2QBY A;  1SMT A;  3T1B A;  3ML6 A;  2PMU A;  2DBB A;  4YFN F;  4ZYE A;  2ZCW A;  1J0R A;  1LDJ A;  4Y13 A;  4ZZD A;  3EUH A;  2RQP A;  2DT5 A;  5L3D A;  1MKM A;  1P4A A;  2D45 A;  1YIO A;  5J8C A;  1XN7 A;  4EJO A;  1BIB A;  4DNC A;  4BQA A;  2P5V A;  3K1P A;  2JRT A;  2NNN A;  2QUF A;  3B02 A;  1QZZ A;  4LGW A;  5E1W A;  1O7F A;  4JQF A;  2ZBK A;  1KQ0 A;  2L54 A;  3P9C A;  4G6Q A;  2K4B A;  3WTU C;  2V9V A;  1KU2 A;  4U0W A;  2R7F A;  2FNA A;  3BP8 A;  4M71 A;  2KIM A;  1U5T A;  1SD5 A;  4B09 A;  3L09 A;  4YFX F;  3H3Z A;  1B6A A;  2JSC A;  5ED4 A;  4PDK A;  1S3J A;  4ESJ A;  3F8B A;  1O7L A;  1D5V A;  3CO6 C;  4AIJ A;  3F23 A;  2FBH A;  2YSR A;  3HUG A;  3BOQ A;  1FBS A;  2UXX A;  2M1B A;  5FLX Z;  4M72 A;  3OV8 A;  4EQQ A;  2ISZ A;  4EM0 B;  5ILV A;  1U5T C;  1IN5 A;  5FFZ A;  4EGZ A;  2M30 A;  2A5Y B;  1IW7 F;  4ASN A;  4A12 A;  3O6B B;  2OBP A;  1ZG3 A;  5TRD A;  1Z9C A;  2RVC A;  1LDK B;  4AIH A;  3HIF A;  3FM5 A;  3Q9S A;  3K0L A;  4UUV A;  3B73 A;  2CW0 F;  2ETH A;  2J5O A;  5CVJ A;  2Y75 A;  4EJW A;  2HYG D;  4UV9 A;  4MQV A;  1SFE A;  4E70 A;  1J75 A;  3HTS B;  1BOA A;  3F8M A;  3L2C A;  4IRH A;  1FPQ A;  4L9N A;  3RKX A;  1Z1D A;  1DP7 P;  1BI0 A;  1JE8 A;  1ZGA A;  2VT3 A;  3RJP A;  3F8F A;  2M5W A;  3KLN A;  3BRO A;  3T8T A;  1YYV A;  3E5U A;  3V7C A;  4HYE A;  1PUE E;  1I1S A;  2IA1 A;  4EM2 A;  2H09 A;  3L7W A;  1HSJ A;  4UNO A;  3ULQ B;  1FT9 A;  4HBL A;  3KFW X;  2DQR A;  1IN4 A;  5E17 F;  1Z6T A;  5DYM A;  2E1C A;  1BM9 A;  4LJZ F;  1SD7 A;  1EV7 A;  1YW7 A;  3EDP A;  3EET A;  1HKS A;  2FXA A;  4LK1 F;  5J6X A;  1W7P D;  1ZG5 A;  4MQ9 F;  3LA7 A;  2O03 A;  4MNU A;  5CVR A;  1ZH5 A;  2UWM A;  2GIV A;  1K7A A;  3BZ6 A;  1YW9 A;  3I59 B;  4WF2 A;  1XSX A;  3FZV A;  2IRF G;  2ZNZ A;  4HQM A;  1A04 A;  5BMZ A;  1YG2 A;  4BH9 A;  2VOD A;  3TKY A;  2EFN A;  4YG2 F;  1YO5 C;  1KQ8 A;  4P9U A;  2G7U A;  3J7A O;  1QGP A;  2M87 A;  2F5C A;  4PZJ A;  1SFU A;  4HV6 A;  1VTN C;  3N97 A;  4BHB A;  1IXC A;  5LHI A;  2EWN A;  1RUO A;  3TQN A;  2VE9 A;  1G4D A;  3P7N A;  4P96 A;  2ISY A;  2HKO A;  2FSW A;  1TNS A;  4RB2 C;  3E5Q A;  1WQ2 A;  3MEX A;  1YLF A;  3E6B A;  1YFH A;  3TDU C;  5KVR A;  2YU3 A;  2XKO A;  3R0J A;  4WX9 A;  3R0A A;  4UV8 A;  2LSO A;  5HLI A;  3TDZ C;  3QRF F;  3V7S A;  4Q5S F;  3R4K A;  3FMR A;  1FC3 A;  3HOT A;  3W6J B;  2RV8 A;  3FWE A;  3ZMZ A;  5DUI A;  1QNT A;  2XKP A;  3WTY C;  1F1Z A;  3GFL A;  1W7P B;  2DW4 A;  4Y17 A;  2BE5 F;  2MA3 A;  4BHP A;  1EH8 A;  4R1H A;  1ULY A;  4XLN F;  3U1D A;  3CUQ C;  3QP5 A;  5L3C A;  3I59 A;  3LWF A;  5CVU A;  3DV8 A;  3J81 Z;  3ROU A;  4L5I A;  4CIC A;  3HSR A;  3KP3 A;  5FO5 A;  3N4M A;  4KMF A;  2NAZ A;  4KYW A;  2DPD A;  3JAM Z;  4KMU X;  3DFG A;  3R61 A;  3IKV A;  1FBQ A;  3V8J A;  1I1G A;  2VBY A;  1PDN C;  1S7O A;  2FBK A;  3I4P A;  1HW1 A;  1XGS A;  2Z5U A;  2NNY A;  1O3Q A;  1R1U A;  5DD8 A;  3QP6 A;  4O3M A;  3DPL C;  4G7Z F;  3IWF A;  1KU7 A;  2GAU A;  3NRV A;  3KP2 A;  1J59 A;  3DEU A;  2LF8 A;  1FYL A;  3K9T A;  2G9W A;  2XRN A;  4S04 A;  4CHU A;  5ERI A;  3F8C A;  4I98 B;  3GZ6 A;  5KK1 A;  4EJU A;  1HKQ A;  5JFR A;  4G8X A;  4A2U A;  4FX4 A;  4A0Z A;  4KUM A;  1RZ4 A;  2HGC A;  5DDG A;  2ZNY A;  4F7Z A;  2E7X A;  1U78 A;  1IRF A;  1QZY A;  2OD5 A;  2MLG A;  2RKH A;  1G3T A;  5ICG A;  3HYI A;  5BPD A;  3SFZ A;  1LB2 A;  1D3Y A;  3E3V A;  3ISP A;  2V1U A;  5CVI A;  5FD6 A;  5LEK A;  1BI1 A;  1HXD A;  1IRG A;  2P4W A;  1NHA A;  5FD5 A;  4Y15 A;  3KP4 A;  4OU0 A;  2F2E A;  2HWV A;  3NQO A;  2ADU A;  5IT9 Z;  2KRF A;  2JPB A;  1R58 A;  4OIO F;  2FMY A;  2PLY A;  1XSV A;  3GWZ A;  4BNC A;  2COM A;  4WXH A;  3E6D A;  2O0Y A;  2VC0 A;  2PJP A;  3EYI A;  4G9Y A;  2FA5 A;  4U7B A;  5D5X B;  1KGS A;  1IN6 A;  1ON1 A;  4I0B A;  5DD4 A;  2GA1 A;  1P2F A;  2CSO A;  1AWC A;  2VON A;  3QAH A;  5L3E A;  5L3G A;  4KIG A;  1KQ9 A;  4HDV A;  4I02 A;  1HW2 A;  4IRI A;  1GXQ A;  3M9A A;  3ECH A;  4LLN A;  4QWQ A;  2HR3 A;  4G6D A;  1YS7 A;  2OZU A;  2QLZ A;  3BJA A;  3GZ5 A;  4M6X A;  5FFX A;  1L0O C;  2P5K A;  1STZ A;  4U7D A;  1HW5 A;  4ZH4 F;  4UVB A;  2EJR A;  4L5J A;  2HDC A;  4IHT A;  5LRR A;  3KZY A;  5A2Q Z;  3WTX C;  1R23 A;  5E1X A;  1P4W A;  1IXR C;  2GA2 A;  2G7H A;  1UB9 A;  3WG9 A;  5CLS A;  4AD9 A;  1BI2 A;  4KT5 C;  5CJ9 A;  2LDU A;  5FLX K;  3O2P E;  1TTY A;  2J5P A;  5E8I A;  2XV4 S;  5TJJ A;  4N9H A;  3SQN A;  3ABT A;  2CQK A;  1BC8 C;  1H9G A;  1ZG1 A;  2R3S A;  4ENK A;  3TGN A;  2HQR A;  3I64 A;  5D8K B;  2VBW A;  2GXB A;  4ZZL A;  2PEX A;  1FY7 A;  4A0X A;  5D6F A;  3VB2 A;  1R5G A;  2MD5 A;  1OYI A;  2LKP A;  3IWZ A;  4ENN A;  1O3T A;  2IJL A;  4M9Z A;  2F5D A;  4AVP A;  4L0Z B;  4P9F A;  3E97 A;  2QQ9 A;  2ZME B;  4NB5 A;  3PQJ A;  1ODD A;  4MGR A;  2V1D A;  1XCV A;  1FZP B;  2PQ8 A;  1B59 A;  5ICC A;  1FP1 D;  2RGV A;  4EGY A;  4JK1 X;  2ESH A;  2P6T A;  3J80 Z;  1JHH A;  1ON2 A;  5DUK A;  4A5M A;  5D8L B;  4FHT A;  2EB7 A;  5E8G A;  1REP C;  4ENJ A;  4AIK A;  2OU2 A;  1MZB A;  3WE2 A;  1HQC A;  5HLG A;  4HX8 A;  1Q1H A;  4HF2 A;  3FMS A;  1EH7 A;  1OR7 A;  4I2O A;  5LEJ A;  1GVJ A;  3IRQ A;  2ELH A;  3TO7 A;  3DXJ F;  2EFP A;  2EK5 A;  1SMY F;  2DO7 A;  1J2X A;  3HRT A;  4WWC A;  3GF2 A;  3SZT A;  2XAG A;  2PG4 A;  3MAJ A;  3TOB A;  3QPH A;  5CYV A;  3F6V A;  5FGM A;  1FWZ A;  1EH6 A;  3E5X A;  3ELK A;  1B4A A;  3KEO A;  5EEH A;  3IRR A;  1O3S A;  2HFH A;  1S8N A;  1FBU A;  2GXG A;  4GCV A;  1T39 A;  3COA C;  5DCM B;  4S05 A;  2VN2 A;  5HOO A;  2ZME A;  3R6S A;  1QO0 D;  1R22 A;  2D1H A;  5HDN A;  3MZY A;  2X4H A;  3HRM A;  2H94 A;  5H20 A;  2H6C A;  3LFK A;  4ON0 A;  2RC4 A;  2D2W A;  2DFI A;  4EV0 A;  4O6J A;  1SAX A;  3MFK A;  2FOK A;  1JHF A;  3MZH A;  1C0W A;  3BJO A;  3F21 A;  2FU4 A;  4P5O A;  4OIN F;  1T6S A;  2W85 A;  3REO A;  3U2R A;  5E1Z B;  1KYW A;  1ZN2 A;  2YX4 A;  2GWR A;  3GFJ A;  2H6B A;  1ZRE A;  2A3S A;  1RUN A;  3M8E A;  2EV0 A;  4OOI A;  4MTD A;  1R36 A;  3WU0 A;  4CGZ A;  1D8J A;  4Q4Z F;  1BJA A;  5LBQ A;  1WI9 A;  4EJV A;  2EV5 A;  3KLO A;  4M74 A;  2EV6 A;  1XB4 A;  1W5S A;  2PFB A;  4R79 A;  1TLH B;  2HEO A;  2VOP A;  4H0E A;  2K7L A;  4HW0 A;  3D0S A;  2Z3Y A;  4CXF A;  2K02 A;  1E17 A;  3JSP A;  3FM3 A;  2P6S A;  1XSD A;  1UCR A;  2DU9 A;  3V4G A;  1RI7 A;  1P6R A;  5D4S A;  3WTZ A;  3CTA A;  5DCM A;  1P4X A;  1TNT A;  3I0T A;  2DPU A;  5H6Q A;  3CJN A;  3V7R A;  2PN6 A;  3JAM K;  1ZRC A;  5L3B A;  1FSE A;  2MLK A;  1V4R A;  3K69 A;  4G7H F;  3ZQ7 A;  1BI3 A;  4HLY A;  1SFX A;  1UST A;  4ENM A;  5AIP A;  1TBX A;  4HF0 A;  2IT0 A;  1J9I A;  1RNL A;  3FMQ A;  2VOO A;  2FEZ A;  3GVA A;  2XAH A;  1LEB A;  4KA4 A;  2R7D A;  3GW2 A;  1YW8 A;  4HOB A;  4A6E A;  4LFU A;  4OIR F;  4RGR A;  3LA2 A;  2VXZ A;  2Q0O A;  2QM3 A;  2BBY A;  3C1D A;  4LG0 B;  4N0B A;  1F9N A;  3ERE D;  5D6E A;  2JT1 A;  1FYM A;  3H3U A;  2GZW A;  4GYI A;  1WKM A;  1IN7 A;  4K2E A;  2FE3 A;  5BS6 A;  1XD7 A;  1TQI A;  3IC7 A;  1LQ1 A;  2YX7 A;  4O5V A;  4KFC A;  2W57 A;  4KN4 X;  4HLX A;  2LF7 A;  3ZMU A;  1IZ1 A;  2A61 A;  2VBZ A;  1U2W A;  2YR2 A;  5ILS A;  3RKW A;  4L0Y B;  4EJT A;  3TOA A;  3QOP A;  2ZKZ A;  3K2Z A;  1R7J A;  1FSH A;  3FXR A;  4IVN A;  1WSU A;  5LGT A;  3RIR A;  1OYY A;  2IA0 A;  1DPR A;  2WV0 A;  4UXN A;  1QPM A;  3AAF A;  1LJ9 A;  3RI4 A;  1DUX C;  2FNP A;  3QU3 A;  3LAJ A;  2DK5 A;  2ZO4 A;  2JTV A;  3DF8 A;  1U3E M;  2FBI A;  3VEP A;  1T98 A;  3KZZ A;  2QZ8 A;  2K4J A;  4HA8 A;  5IT3 A;  5IT9 K;  3GFM A;  4U88 A;  3KEQ A;  4IJA A;  2FRH A;  2RNJ A;  4JBA A;  5E18 F;  3V8K A;  5DCF A;  3G73 A;  4IHS A;  2ACJ A;  2PI0 A;  1W7P A;  4LLL A;  1T38 A;  3ZMS A;  1ZAR A;  4A5N A;  4LMY A;  4LG0 A;  2V6C A;  1TQM A;  3T0Y A;  1USS A;  1HKT A;  2XVC A;  2DTR A;  1R1V A;  2L3D A;  2XAJ A;  3U9G A;  4LB5 A;  4HZF A;  3KET A;  5CVV A;  3WGG A;  1R1T A;  2A07 F;  3T5X A;  1HBX G;  1RIO H;  3EYY A;  3M8F A;  2QBY B;  1H9T A;  1BN5 A;  1I27 A;  2XAF A;  4PCQ A;  1S6L A;  3TO9 A;  4WXD A;  4YFK F;  1IN8 A;  1G6N A;  5D5U B;  3DKW A;  4NQW A;  5EEG A;  3KP5 A;  3RDI A;  3HRS A;  5HDK A;  1FX7 A;  5BOX A;  3Q9V A;  5HS7 A;  2EFO A;  3LQR A;  3T8R A;  3WTT C;  4LK0 F;  4LB6 B;  2FQ3 A;  3RPQ A;  3I5U A;  5A2Q K;  1KU3 A;  2Y0M A;  3D5L A;  1IXS B;  3HOS A;  3S2W A;  3VFZ A;  4HX7 A;  2YPR A;  5DV5 A;  3ZMT A;  4G7O F;  2XHK A;  3M1E A;  4UHT A;  1U6G A;  2M45 A;  2E7W A;  2UXN A;  3L00 A;  2GQQ A;  4ZYD A;  4CO8 A;  4ZYH A;  3RYP A;  1ONV A;  2E1N A;  2KIF A;  1Z6R A;  1MJB A;  4BYY A;  3ZN0 A;  1XGN A;  3E6C C;  2CWE A;  3SXY A;  3LA3 A;  4RAY A;  1ZAO A;  2EA4 A;  2W25 A;  1K78 B;  2CO5 A;  4WXC A;  1U5T B;  3GUD A;  1ZLK A;  5HDG A;  2MH9 A;  4Z2Y A;  4LD5 A;  1X3U A;  2Q2E A;  1W5T A;  1LNW A;  1QBJ A;  2Z99 A;  3HSE A;  3F6O A;  2CFX A;  1PP7 U;  5JI6 A;  1H0M A;  2QQA A;  3O3K A;  4A6D A;  1IAW A;  3FF5 A;  3JTH A;  3MCZ A;  1FNN A;  3RKY A;  4KDP A;  3FXU A;  4I7H A;  5HVQ C;  5K5Q A;  2XRO A;  2K86 A;  4I09 A;  2CYY A;  3FX3 A;  4I01 A;  1SD6 A;  3JSO A;  3J80 K;  5LRS A;  4GXO A;  4XSX F;  2M8E A;  2BYV E;  4M9S A;  2L02 A;  2B0L A;  5F1R A;  4G94 A;  1J5Y A;  1ZRD A;  3ZN1 A;  3HHH A;  4FX0 A;  3HRU A;  3JTG A;  1BBY A;  2QVO A;  3HSF A;  3GXO A;  4KIF A;  3QU6 A;  3CUO A;  1V3F A;  3BPX A;  2UZK A;  5JVT A;  5HS8 A;  1WWX A;  2HOE A;  1B1B A;  1K78 A;  2VC1 A;  1FYK A;  1W4M A;  3MQ0 A;  3WTW C;  5HLH A;  2QYO A;  4Q47 A;  3F3X A;  4KIB A;  2W84 A;  4RS8 A;  4IF4 A;  4U0Y A;  1XMK A;  2DLL A;  5K1Y A;  4L9T A;  1O57 A;  5K5O A;  4M73 A;  3RYR A;  2JZY A;  3WOD F;  1SD4 A;  5E20 A;  1K6O A;  4OIQ F;  4M9X A;  3ZMD A;  1ZLJ A;  2A69 F;  3BWG A;  2HTJ A;  2Z9O A;  2STT A;  1T2K A;  2ZXJ A;  5BPI A;  3W6K B;  1KYZ A;  2F5E A;  3CDH A;  3RPU A;  2P7C B;  4PGH A;  2XAS A;  2KJC A;  5BQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...