3CV0A

Structure of peroxisomal targeting signal 1 (pts1) binding domain of trypanosoma brucei peroxin 5 (tbpex5)complexed to t. brucei phosphoglucoisomerase (pgi) pts1 peptide
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
325
structure length
300
Chain Sequence
GHMLQNNTDYPFEANNPYMYHENPMEEGLSMLKLANLAEAALAFEAVCQAAPEREEAWRSLGLTQAENEKDGLAIIALNHARMLDPKDIAVHAALAVSHTNEHNANAALASLRAWLLSQPQYEQLFFFAAPNEYRECRTLLHAALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVGGTTSREATRSMWDFFRMLLNVMNRPDLVELTYAQNVEPFAKEFGLQSM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peroxisome targeting signal 1 receptor PEX5
publication title Structural Insights into the recognition of peroxisomal targeting signal 1 by Trypanosoma brucei peroxin 5.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Transport protein
total genus 118
structure length 300
sequence length 325
ec nomenclature
pdb deposition date 2008-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3cv0A00
1QZ2A 3LY7A 5A7DB 2QFCA 4J8EA 3JYSA 3ASGA 2NC9A 4NRHB 3ZHEB 3OXGA 4GYWA 3ASDA 4GA1A 5C1DA 3GZ2A 4XIFA 2KCLA 5KJLA 1Y8MA 3LYAA 4I1AA 5EKQD 1ELWA 1W3BA 4RG6A 4I9CA 3HYMB 4UI9J 2IFUA 3PE3A 4I9EA 2UY1A 4H7XA 4N3AA 4I2WA 2WPVA 2VYIA 3CKBA 5KJKA 3CVPA 3CEQA 4WNEA 2GW1A 3Q47B 4CDRA 2LNIA 2XEVA 2JLBA 4BTAA 2PZIA 4UQXA 1HZ4A 2VQ2A 3TGOA 3CKCA 2UWJG 3GYZA 2V5FA 3QDNA 3QWPA 3N71A 4JA9A 5DBKA 2DBAA 2KCKA 3CVNA 4G26A 2LSVA 1NA3A 4WUYA 3LPZA 5CCLA 3CK7A 3CVLA 4GCOA 5A6CA 3ULQA 3O48A 2XGOA 3Q15A 5M72A 2HR2A 2FF4A 2AVPA 3S7BA 4G23A 2VGYA 3KS2A 4CGWA 3E4BA 1HH8A 3ZFWA 2VSNA 4GA0A 5KJNA 3SZ7A 4N39A 5EX0A 2FEZA 2KCVA 2PQNA 2KATA 4JA7A 4U0ZA 2PQRA 3QWWA 4WNFA 5FZSA 1B89A 4B94A 3S7JA 4I2ZA 4F3VA 3EDTB 4XI9A 4EQFA 2IF4A 4W9RA 2Y4UA 1IYGA 4BWRA 2XGSA 3S7FA 5CCMA 3R9AB 2UY1B 3URZA 1XNFA 3KAEA 4LEUA 2VSYA 3LY8A 4ME2A 1YA0A 4UI9C 2OOEA 3SF4A 3ESKA 4HOTA 4G24A 4YVOA 2FI7A 5JJTA 4I17A 2FO7A 1KT1A 4UI9K 2E2EA 5HI7A 2VGXB 4HOSA 4N2QA 4U0SA 2I6HA 3ASFA 1IHGA 3TG5A 3ASHA 2MHKA 3VTXA 3FP3A 5JJ6A 2WQHA 3GW4A 2L6JA 3AS8A 1P5QA 1KLXA 2Y4TA 4UQYA 3LKUA 4NQ0A 3Q4AB 4KYOB 3Q49B 3RIBA 3RKVA 3Q5MA 4G25A 4HOQA 5CHEE 3ZN3A 5LCWJ 4J8FA 3FFLA 4ABNA 2BUGA 2C0MA 3U4TA 4N3CA 4J8DA 2YQ8A 1ZU2A 1NZNA 1A17A 3AS4A 1OUVA 4GYYA 3GZ1A 4Y6CA 5FJYA 2P58C 3LY9A 1HXIA 3QKYA 4RG9A 1NA0A 4AY6A 5FZQA 4Y6WA 4G2VA 4UQZA 4A1SA 3PE4A 4GZ3A 4WNGA 3U3WA 2XCBA 3S7DA 3TG4A 1QQEA 4BT8A 3FWVA 4XI0A 3MV3B 5EX3A 5FTPA 2FBNA 4JHRA 4GPKA 4N3BA 3CVQA 5D0OD 2R5SA 5BW8C 5HQ8A 1ELRA 3CV0A 3RO2A 3RU0A 4IN3B 1WAO1 4AIFA 2C2LA 4HOUA 1TJCA 3MEKA 5BT1A 3UPVA 3KD7A 3MA5A 3MV2B 3UUXA 5D0QD 3OXFA 3K9IA 3VTYA 3OXLA 3ZPJA 3PDNA 3AS5A 4GCNA 3TAXA 4YVQC 5G05C 4J0UA 3RO3A 4GYOA 3LCAA 5G05J 4GZ5A 4BTBA 4O6FA 4G1TA 1E96B 4AM9A 2KC7A 2LSUA 3QWVA 1PC2A 3ZHEA 2XCCA 4U04A 4N5CA 5FZRA 4HORA 3RJVA 3WXXA 5ARGA 1WM5A 5JJ7A 4H7YA 2Q7FA 5FT9A 5KJMA 5DIZA 3QOUA 2HO1A 4GZ6A 3ZGQA 5G04C 5LCWC 2XGMA 5G04J 2C0LA 5AYWD 3MKRA 2VGXA 3UQ3A 1FCHA 1ZBPA 2HYZA 4APOA 4KXKB 2XPIA 4WNDA 3BEEA 2ONDA 4CGVA 4N2SA 4GA2A 4JL0A 3CK8A 4KBQA 5ARFA 4YNDA 4U0UA 3CK9A 4BT9A 3IEGA 2YHCA 1KT0A 4AY5A 4U07A 3NF1A 2J9QA 2PL2A 5BNWA
chains in the Genus database with same CATH superfamily
1Y6IA 3D9PA 3APFA 3G2UA 1Z6TA 2FULA 1D9SA 1JWGA 2QZAA 3DEPA 5CRUA 3ASGA 5E75A 1N54A 4NRHB 3G2TA 3P1UA 3ZHEB 2I2OA 3ASDA 5JA4D 4C0MA 4GA1A 5C1DA 1K3ZD 3GZ2A 3EHQA 3PEUB 1QBQA 3AG4E 3LYAA 1EDUA 4I1AA 4JXTA 2MRIA 4BEPA 1SVXA 4RLYA 3ZYMA 4G11A 4ZHBA 4I9CA 4MS6A 3UKUG 1OWNA 3D9JA 2ZGDA 1JCSA 4H7XA 4M7CA 2IONA 3CSTA 2PM6A 5CBNA 3TWRA 3CKBA 3CVPA 2GROB 4CT4A 3CEQA 4CDRA 2LNIA 4JB8P 4U95D 1H6KA 2JLBA 4UQXA 3UM3A 1HZ4A 3CKCA 1HX8A 3CQCB 2Y1LE 4K5BA 1N94A 2KCKA 2BTDA 4G26A 5EIDA 4EBAA 4RVBA 3SI5A 3U66A 4AJWA 4F7AA 4U8HA 4AVXA 4LG6A 3C72A 3UM2A 4I1MA 4BERA 5A6CA 3SBSA 2XGOA 1Z5SC 2HR2A 2J07A 4GB9A 5LX8A 3SHFA 2GRMA 5KBAA 4BSZB 3KSQA 4ILGA 1WY6A 1UOHA 4WAFA 4CGWA 2IO3C 4M3OA 3T5XA 3HDXA 3PUJA 2L0TB 4JEUA 1K8KG 3SZ7A 2XZDG 4N39A 4J6IA 4UUCA 1O1RA 4XE0A 5FZSA 5ANLA 3S7JA 4I2ZA 4F3VA 3EJNA 4EQFA 2IF4A 4CT0A 4DLOA 1IYGA 4BWRA 3S7FA 3DSWA 2R03A 2M63A 1XNFA 3KAEA 3LY8A 1TN8A 5ENSD 3CGHA 1TNZA 4UI9C 2CHWA 3MYVA 3SF4A 5AQAA 2WXNA 4YVOA 3F6QA 1EPUA 4A55A 3R9MA 2BKGA 2R05A 1IHGA 3IV0A 2EIJE 3Q9UC 3TG5A 3VTXA 5JJ6A 4FJYA 4FLHA 4B8AA 4OVVA 4MLPA 5EN5D 3FH5A 4GTVA 4Q94A 3NZUA 2ZISA 4NURA 3Q4AB 2VGEA 3RKVA 1JUQA 4J8FA 2V4LA 3ZRHA 3PNTB 1HO8A 3JCKC 5JHAA 1NZNA 1E90A 1A17A 1OUVA 3GZ1A 4TRQA 1SW6A 1HXIA 1H2TC 1LD8A 2WXHA 1PAQA 4EZLA 1UN9A 1NA0A 4G2VA 4AP2A 3AG2E 2RG8A 2WMNA 4GZ3A 2CG2A 4WNGA 2XEHA 1FPPA 5HKPA 3ML9A 4YDEA 4BT8A 4GU5A 1AWCB 1ZB1A 4QQIA 1K1BA 1AP7A 5FTPA 3LJ3A 4JHRA 1HU3A 3KSLA 4HRMB 3UT7A 3PS6A 2CG3A 4TUMA 1OCZE 2L6BA 4IN3B 3CVXA 1D8DA 3D9IA 2J4BA 2IU1A 5C2YA 2R2LA 3MV2B 4DLQA 2LAIA 1YMPA 3UUXA 4ZFHA 3CIAA 1IKND 5T8IA 3OXLA 3ZPJA 3ZUVB 5A23A 2KBXA 3PDNA 3PZ3A 3AU4A 3V2OA 4HB5A 3LEWA 5AQBA 2WXPA 5G05C 3JXIA 5G05J 4OYSA 3HVEA 3FH7A 4AM9A 2KC7A 2OEWA 3ABLE 3HXFA 3EIJA 4TXQA 4N5CA 4HORA 1NFIE 5ITZF 3RJVA 3FU0A 2MYOA 1LF8A 3L54A 5CEAA 3I5PA 5FT9A 3PRZA 3CHPA 5LP0A 1SQMA 3ZGQA 5G04C 5G04J 3DSTA 4O1OA 3E32A 2ETBA 3UQ3A 3V30A 1ZBPA 1UJJA 4C48B 2F8YA 2BEDA 3D9MA 1DC2A 3PZ2A 4L9PA 2VSOE 2DYRE 4WNDA 3TWSA 3VLFA 3BEEA 3L82A 1HG5A 1OT8A 4JC8A 3QK0A 3D9OA 4KVMA 2P9UG 3W9GA 5KNHD 4NACA 3QC1A 5IY5E 1MX4A 4J8SA 1LD7A 2X6KA 3C3QA 3SO8A 4BY6A 3Q7FA 4JL0A 3CK8A 4KBQA 3AG1E 2AWIA 3EUVA 3E33A 2H6IA 2WXKA 3HXCA 3U9WA 3FTYA 1XGWA 3TWXA 5KNGA 3AAAC 4AY5A 4HQDA 3FUJA 4J8YA 2XS1A 3RAUA 4A3VA 3G2WA 4K5CA 3SQVA 5BNWA 4AEZC 5A7DB 4G8LA 5AENA 5B1AE 5JHBA 3T8KA 4FP7A 2DVWA 4KT6B 3PREA 1RW2A 1BI8B 3DSXA 1MX2A 1E7VA 4CCAA 2F0YA 2IEJA 4HFGA 3I3NA 5KJLA 4FHJA 4YDOA 2P9NG 3WG7E 4UWHA 4RG6A 3ONKA 4L2LA 1MQSA 4JZYA 4U8YD 5ENPD 1N9AA 2IOLA 1TN7A 2DIWA 2IFUA 1U3CA 3FU3A 1TNYA 2VYIA 2NXPA 4WNEA 4MRUA 2WXFA 3BQOA 2XEVA 3AJIA 3FEYA 2JABA 3FUMA 2J08A 3NZSA 4BTAA 1S0PA 2UWJG 4ACLA 3MX3A 3QDNA 4JA9A 2DBAA 4CDMA 3D9KA 1OWPA 2LSVA 4ILHB 3EU5A 1NA3A 3FY4A 3HG0D 3TWTA 2P9IG 5J08A 2WXLA 5CERB 2OVBA 1Z3XA 1Q2ZA 5FWQA 3O48A 3UT8A 4K0RA 4RQIA 3BG0B 4ATGA 2OVFA 4ILIA 1HF8A 2OV8A 2AVPA 5BXOA 4LNGA 4G23A 1G3NB 3RK6A 3JQ1A 5AQ9A 2IY0C 2DCPA 2YHEA 3RRNB 3QB2A 1HH8A 4FU3A 3TWQA 4P29A 2KATA 5E76A 1FVHA 4JA7A 4XKCA 1INZA 4UWFA 2PQRA 1E8XA 4WNFA 5CMYA 3L08A 3HHMA 4DX5D 4XI9A 4W9RA 2Y4UA 1O5MA 5G55A 5CCMA 2UY1B 3W9FA 3URZA 2OEVA 1N0RA 2X6FA 3HIZA 2XEEA 1O1SA 5HRYA 2VSXE 3SFYA 2OOEA 3D9NA 4XKBA 3PEVB 3L16A 2FI7A 2ETAA 5AJDA 1JWFA 1KT1A 4HOSA 5HI7A 4UWGA 2I6HA 3UM0A 3MZLB 3NAWA 4V3IA 3FTUA 4CYMD 3GW4A 1P5QA 2Y4TA 4UQYA 4A63B 4I1OB 4OAUC 2LAHA 4MBGA 4N5QA 4PDXA 4PH4B 4PS7A 3UI2A 4G25A 3NB2A 4U63A 4HOQA 4XX5A 5LCWJ 5H7PA 2BUGA 4BSXA 3E37A 4EZJA 4URKA 4FJZA 3AS4A 4DPRA 1LTXA 5FJYA 3LY9A 3ZYKA 3APCA 3QKYA 4RG9A 3TL5A 2RFAA 5FZQA 4Y6WA 4UQZA 2F8XK 5EIBE 3JUIA 2V0PA 2QYUA 3L9TA 3S7DA 3TG4A 4B8CB 2RFMA 1N95A 4XI0A 2L0IA 4GAAA 2KZTA 2IQCA 3CVQA 5D0OD 4OAVB 5B3SE 3CV0A 1WAO1 4AIFA 4K5AB 1TYQG 4FC8A 1TJCA 3SFXA 2BF0X 5BT1A 1IQUA 3HRAA 2DZOA 3MA5A 1MJ0A 1DVPA 4KZ0A 5D0QD 2KXPC 2MOWA 1NP7A 3VTYA 5CEDB 4I6JA 4JPSA 1FT1A 3AS5A 2WXJA 1DNPA 4JHKA 3EHMA 3EU9A 2GRPB 5D2MC 4GYOA 3UINC 4O6FA 2LSUA 3ZHEA 1E8WA 4LRZA 3DPDA 4PS8A 3FUDA 4A3TA 4CRWA 3ONLA 5JJ7A 4H7YA 2IJGX 2Q7FA 1N52A 3DXMG 2JEKA 2HO1A 4GZ6A 3D9HA 2XGMA 1QNFA 2A5UA 3MKRA 2A4ZA 2LO6A 1E7UA 3FULA 1S64A 3C5RA 1BPOA 1FCHA 4EHMA 2B6CA 2XPZA 3QNKA 2XPIA 4PUCA 5ENNA 1SZ9A 4F6RD 3AU5A 4Q96A 3V2XA 1OCRE 4B93B 2WB2A 2Y3AA 1PY1A 4U8VD 2X6IA 3UTMA 3FUNA 3KEAA 3HXEA 4UWLA 5B1BE 5ARFA 3L13A 4U0UA 4HBDA 4WWOA 3BUAA 2YHCA 3DBSA 2XHEA 1JCQA 1SA5A 3TXMA 3CHQA 3FUEA 3QAQA 5AJLA 3LY7A 4FHKA 2ZGGA 4GTOA 4J8EA 2X38A 5D66A 5EYLA 3JYSA 2NC9A 2EILE 1A5EA 3IHYA 4LUNU 3D3MA 3CVVA 4FULA 2KCLA 1BU9A 2EINE 2P9KG 3CR3A 3Q7AA 1ELWA 4L1BA 4DX6D 2AJAA 3MKQB 3TJPA 4DK5A 4I43A 4I2WA 2WPVA 3GZSA 4GZDA 3Q47B 2PNNA 3SBTB 5AN8A 5EILA 3UKRG 2VQ2A 1H19A 3GYZA 2XRYA 2V5FA 1EYHA 3QWPA 4GMLA 3N71A 5DBKA 3CVNA 3U64A 3PZDA 5ANRA 2HE0A 4NIKA 4A1GA 2XRZA 4GPMA 3LS8A 4EBAG 4JEHA 4WUYA 4IYPA 5CCLA 3UX4A 1MYOA 2A5EA 3Q9NC 2YINA 5CRVA 4GCOA 3ULQA 3FH8A 3ZW3A 3SY2A 3IXEA 3APDA 1L5JA 1HG2A 2LXLA 2Y0BG 3CQGB 2VGYA 1DCEA 4GTSA 3SFZA 2WXMA 3B7SA 4B0ZA 3ZFWA 3DRAA 4GA0A 5KJNA 3ZXPA 1TNOA 2ILRA 4UWKA 2FEZA 3C3RA 3NOGD 2VTBB 2PQNA 4E85A 1OXJA 4U0ZA 4FADA 3UIPC 4GTMA 3QWWA 3CHSA 5AARA 1B89A 3NQPA 4B94A 3EDTB 3JXJA 3R9AB 2XZTG 4EZKA 1BI7B 3SNXA 4CEMA 3T5VA 3I4RB 3JUEA 4C0EA 1NI1A 2NSZA 3RSEG 3ESKA 4HOTA 3ZYQA 2RD0A 1S70B 5CBOA 5JJTA 2XS8A 4CZ2D 2RKKA 2E2EA 2VGXB 2H6GA 3HXDA 2AW6A 4PS3A 3ASFA 5AIJA 3ASHA 1OY3D 4QFVA 1U2VG 3FP3A 1RZ4A 2ETCA 5LOZA 2L6JA 3AS8A 1KLXA 3LKUA 4XZ4A 3FUIA 4KYOB 4Z68A 3IKOB 2V5QC 2CHXA 3ZN3A 4HLLA 3TWWA 1JPLA 1X81A 3ENEA 2C0MA 2WVIA 3U4TA 4N3CA 4TUUA 1BD8A 4J8DA 5JMND 1K1AA 4HI8A 1ZU2A 5ENRD 3B7UX 4GMRA 4Y6CA 3L6AA 4HI9A 1TNUA 2J09A 4AY6A 3LJNA 2WXIA 2AXZA 3PE4A 4O60A 1IQRA 4GTRA 3O4ZA 3L22A 4FA6A 4F1PA 3J5QB 5KCMA 2XCBA 1TJFA 1V54E 1S63A 3MV3B 3V31A 5EX3A 2FBNA 2HM8A 4TXPA 4BESA 4N3BA 2AXUA 2WQ6A 3X2QE 3EIQC 5BV1A 2R5SA 3PNLB 5HQ8A 4APFA 1ELRA 2ZXWE 4LERA 3RO2A 3B7TA 2C2LA 1OCOE 4D10C 2CHZA 4DI3A 2BKKB 3MEKA 3PZ1A 2I1JA 4J7WA 3OTNA 3FTSA 4AXHA 2FO1E 2WM9A 3L17A 3VLEA 3D9LA 3FTXA 3CVYA 4L2YA 4IULA 3TAXA 4LNUD 1OWMA 2B0OE 1N4QA 4J0UA 3RO3A 3V79K 2VTBA 4G1TA 4HS2A 1KZOA 4L23A 2CFZA 1H6PA 4HRNA 4U96D 3QWVA 2Y69E 1PC2A 3FTVA 1TR4A 2XCCA 4X8QA 4U04A 1TEZA 1TN6A 5ARGA 2P9LG 3DWLG 3CSFA 4AOFA 4LNBA 3LXUX 3ASNE 5LCWC 3ULEG 2C0LA 5LFAA 3CLJA 2VGXA 2HYZA 5ENOD 4APOA 2XQ0A 1N11A 1N0QA 1H6OA 3R7QA 3ESLA 3B95A 5FINA 2ONDA 3FEXA 3ASOE 3UM1A 1HFAA 5ENQD 4HLEA 3Q73A 2CFUA 2ZIRA 2V4HC 4DI4A 4CGVA 3DSUA 1DCQA 3ML8A 4N2SA 3BG1B 3CHMA 1IXVA 4R7LA 3B7RL 4YNDA 2P9SG 3FUHA 4MKTA 4HNAD 2WXQA 4BT9A 1EF1C 1H2UA 1KT0A 3AG3E 2J9QA 1H0AA 2PL2A 4WWPA 2X3MA 4GTTA 3FU5A 1QZ2A 3ZVVA 4TV3A 2QFCA 3IHVA 3HVEB 2WQ7A 4DX1A 3JQ0A 2AXVA 3OXGA 4GYWA 1MX6A 3J5PA 1MZCA 2R17C 1UJKA 4YDYA 2I1KA 3VLDA 4XIFA 3G2VA 5BV0A 1Y8MA 3CHRA 2QC9A 2EQXA 5EKQD 1W3BA 4I6GA 2DYSE 3HYMB 4UI9J 3S2AA 4DRXE 5HS0A 3PE3A 4I9EA 2UY1A 3Q75A 4N3AA 2J4DA 4IRUA 5KJKA 2J49A 2GW1A 1N4SA 3ZEFA 2XENA 3PVLA 2KM4A 2PZIA 3FDHA 4U7EB 2WXGA 3TGOA 3DEOA 4AV7A 4E6HA 4GZCA 1VDYA 4GMJA 5G2NA 4DUIA 3C98A 3ZIMA 4F53A 4LSZE 1KPSB 4B89A 3LPZA 2GGFA 3CK7A 2GRQB 3CVLA 1GW6A 2WMOA 3ZXSA 4WWNA 3QJZA 3Q78A 5FQ7A 2H6HA 3Q15A 5M72A 4ACKA 2FF4A 2X6JA 2J8SD 3CVUA 4G8KA 4HVBA 4L7TA 2GRLA 2F37A 4KVOA 3S7BA 2P9PG 1YCSB 3KS2A 4RSYA 3E4BA 1E8YA 1QYMA 1NL4A 2VSNA 3ULYA 3E34A 4O1PA 3NBNB 5EX0A 5EDSA 2KCVA 3I4GA 1WG0A 4JVSA 3UMVA 5BXUA 1HE8A 3DSVA 4ANUA 3LDZA 1U3DA 1X5BA 4DX7D 4BFRA 2L9BA 3CHOA 2LXMA 2XGSA 2I9CA 3B13A 2H6FA 4LEUA 2VSYA 4ME2A 1YA0A 2R59A 2NYJA 3SGHA 4Q69A 4OVUA 1Z3YA 2QYJA 3DSSA 4G24A 3FUFA 4I17A 4JD2G 2FO7A 4UI9K 4N2QA 2P2CP 4U0SA 3TWVA 4GTQA 4ATZD 3T9KA 1UW4B 5FQ4A 2MHKA 2WQHA 1UN8A 3MCXA 5CECB 4BX8A 4TXRA 4BETA 3TXNA 4NQ0A 1JCRA 3PUKA 3P2BA 4FLBA 3Q49B 3RIBA 5CMWA 3BU8A 3PH0C 3Q5MA 2X6HA 4C9BB 1FT2A 5CHEE 5FQ8A 5BPPA 2WXRA 3FUKA 3B7BA 3FFLA 4ABNA 1E8ZA 3FU6A 3ZU7B 4ANWA 2YQ8A 1MHQA 3QARA 1H2VC 4I6EA 1BLXB 4GYYA 2P58C 4KMOA 5J90A 3LVQE 4LCTA 4A1SA 2XPYA 4YDWA 3ISMC 3KEZA 3C3OA 3CVWA 2R02A 3TWUA 3U3WA 1OWLA 1QQEA 3FWVA 2IOSA 3ZYLA 4ANXA 1TNBA 4GPKA 3FTWA 4XEIG 1V55E 5BW8C 1SA4A 3EHNA 4JHJA 3RU0A 4ANVA 4HOUA 2LUHA 3DPYA 3ABKE 3UXGA 3ZKJA 3UPVA 3KD7A 3G2SA 1WDYA 5T3RA 1N4PA 1KZPA 3EHRA 3OXFA 3K9IA 2V8SE 3FHEA 1D8EA 4KZCA 3HXBA 2PM7A 4GCNA 2WXOA 4JW1A 4YVQC 3ZNGA 1N4RA 3DXKG 3UT4A 1UG3A 3LCAA 4GZ5A 4BTBA 1E96B 1OWOA 2GRNB 5FIOA 2E0IA 5FQ6A 3FTZA 4GTPA 3IBEA 3RRUA 3UIOC 1SZAA 3LVRE 5BUZA 5FZRA 1YYHA 4F1SA 5EYPF 3RRMB 3WXXA 2GRRB 3NOCD 2YNQA 1WM5A 2IO2C 2VJ8A 5KJMA 2ZU6B 3OAWA 5DIZA 3QOUA 4DJAA 3MKQA 4BX9A 3PZ4A 5AYWD 5KWDA 4K03A 2QY7A 2OCCE 4KXKB 1IHBA 1HS6A 2EIKE 3R7RA 3ABME 3MGBA 1OCCE 2KZTB 5ENTD 3T8MA 3E30A 4GA2A 2DZNA 4EECA 1O1TA 4HRLA 5AQ7A 3SD5A 3CK9A 1FVFA 2EIME 3IEGA 5T4YA 4CDNA 4EPZA 5AAOA 3Q79A 1ELKA 4HXIA 4U07A 3MJWA 3NF1A 4DX2A 2DWZA
chains in the Genus database with same CATH topology
1Y6IA 3D9PA 1QZ2A 3FU5A 3ZVVA 4AEZC 4TV3A 3LY7A 4FHKA 3APFA 3G2UA 5A7DB 2QFCA 1Z6TA 4J8EA 5AENA 2FULA 3IHVA 5JHBA 2X38A 3HVEB 1JWGA 4FP7A 2WQ7A 3JYSA 3ASGA 5E75A 2NC9A 4KT6B 3PREA 1N54A 3JQ0A 4NRHB 2AXVA 3G2TA 3P1UA 1E7VA 3OXGA 2I2OA 3ASDA 4GYWA 3ZHEB 4C0MA 4CCAA 2R17C 4GA1A 5C1DA 1UJKA 3GZ2A 3IHYA 2I1KA 4LUNU 3D3MA 3VLDA 3CVVA 3PEUB 3I3NA 3G2VA 2KCLA 4FULA 4HFGA 4XIFA 5BV0A 1Y8MA 5KJLA 3LYAA 1EDUA 4I1AA 3CHRA 4JXTA 4FHJA 2MRIA 2EQXA 3ZYMA 5EKQD 4UWHA 4L1BA 3CR3A 1ELWA 1W3BA 4G11A 4I6GA 4RG6A 4I9CA 3HYMB 4MS6A 3ONKA 4UI9J 3MKQB 4L2LA 1MQSA 4JZYA 3TJPA 1OWNA 3S2AA 3D9JA 2IOLA 2IFUA 2DIWA 3PE3A 4I9EA 2UY1A 4H7XA 1U3CA 4DK5A 4N3AA 4I43A 2J4DA 4I2WA 2IONA 3FU3A 3CSTA 4IRUA 2PM6A 2WPVA 2VYIA 2NXPA 3CKBA 5KJKA 2J49A 3CVPA 3GZSA 4CT4A 3CEQA 4GZDA 2GW1A 4MRUA 3Q47B 4WNEA 4CDRA 3ZEFA 2LNIA 2WXFA 3SBTB 2XEVA 3PVLA 1H6KA 3FEYA 3FUMA 2KM4A 2J08A 2JLBA 3NZSA 4BTAA 2PZIA 3FDHA 4UQXA 1HZ4A 2WXGA 2VQ2A 3TGOA 3CKCA 1HX8A 1S0PA 1H19A 3CQCB 2UWJG 4AV7A 3GYZA 2XRYA 4E6HA 2V5FA 1EYHA 4ACLA 3MX3A 3QDNA 3QWPA 4GMLA 3N71A 4JA9A 5DBKA 2DBAA 2KCKA 4GZCA 4CDMA 3CVNA 2BTDA 1VDYA 4G26A 3D9KA 4GMJA 1OWPA 4EBAA 5G2NA 3U64A 3PZDA 4RVBA 5ANRA 3C98A 3SI5A 4A1GA 3U66A 2XRZA 3ZIMA 3LS8A 2LSVA 4AJWA 4ILHB 4EBAG 4JEHA 4F53A 1NA3A 3FY4A 4WUYA 4B89A 4IYPA 3LPZA 2GGFA 4F7AA 5CCLA 4U8HA 3UX4A 4AVXA 5J08A 2WXLA 3CK7A 2OVBA 3CVLA 2YINA 1GW6A 1Z3XA 4I1MA 2WMOA 4GCOA 3ZXSA 4WWNA 5A6CA 3QJZA 5FQ7A 5FWQA 3FH8A 3O48A 3SBSA 2XGOA 3ULQA 3UT8A 4K0RA 3Q15A 3ZW3A 5M72A 3BG0B 2HR2A 2J07A 4GB9A 4ACKA 2FF4A 4ATGA 2OVFA 2X6JA 4ILIA 5LX8A 3CVUA 1HF8A 2OV8A 3SHFA 2AVPA 4HVBA 4L7TA 2GRMA 3APDA 4ILGA 2GRLA 1L5JA 1WY6A 4KVOA 4WAFA 3S7BA 4G23A 1HG2A 3CQGB 2VGYA 3KS2A 3RK6A 3JQ1A 3SFZA 4RSYA 3E4BA 4CGWA 2WXMA 2DCPA 3B7SA 4M3OA 3T5XA 2YHEA 3RRNB 3HDXA 1HH8A 3PUJA 1E8YA 3QB2A 3ZFWA 4B0ZA 2VSNA 4FU3A 4GA0A 5KJNA 2L0TB 4JEUA 2ILRA 3SZ7A 4UWKA 4N39A 5EX0A 2FEZA 5EDSA 2KCVA 4J6IA 4P29A 2VTBB 2PQNA 2KATA 5E76A 1FVHA 4E85A 4JA7A 3I4GA 4U0ZA 4XKCA 4UWFA 4JVSA 3UMVA 4FADA 1INZA 1HE8A 1E8XA 2PQRA 3LDZA 3QWWA 4XE0A 4ANUA 4WNFA 3CHSA 5FZSA 5CMYA 1B89A 1U3DA 3HHMA 3L08A 3NQPA 5ANLA 1X5BA 4I2ZA 3S7JA 3EDTB 3EJNA 4XI9A 4B94A 4EQFA 2IF4A 4W9RA 4F3VA 2Y4UA 4CT0A 4BFRA 2L9BA 3CHOA 4DLOA 1IYGA 4BWRA 5G55A 2XGSA 3S7FA 5CCMA 3R9AB 2UY1B 3URZA 4EZKA 2I9CA 3B13A 2M63A 3SNXA 2X6FA 3HIZA 1XNFA 4CEMA 3KAEA 4LEUA 2VSYA 3T5VA 3LY8A 4ME2A 3I4RB 1YA0A 2R59A 2VSXE 3CGHA 4C0EA 3SGHA 4UI9C 2NSZA 2CHWA 4Q69A 3MYVA 2OOEA 3SF4A 3D9NA 4XKBA 2WXNA 4OVUA 3ESKA 1Z3YA 4HOTA 3ZYQA 3PEVB 4G24A 4YVOA 3L16A 2RD0A 2FI7A 3FUFA 5JJTA 4I17A 2FO7A 5AJDA 1JWFA 1KT1A 4UI9K 1EPUA 2E2EA 2VGXB 5HI7A 4HOSA 4A55A 4UWGA 4N2QA 4U0SA 2AW6A 4PS3A 2I6HA 3ASFA 1UW4B 5FQ4A 3MZLB 1IHGA 3IV0A 5AIJA 3TG5A 3ASHA 4V3IA 2MHKA 4QFVA 3VTXA 3FTUA 3FP3A 5JJ6A 4FJYA 4FLHA 5LOZA 2WQHA 3GW4A 1UN8A 2L6JA 3MCXA 3AS8A 1P5QA 4B8AA 1KLXA 4OVVA 4MLPA 2Y4TA 4UQYA 3LKUA 4BX8A 4XZ4A 3FUIA 3TXNA 3FH5A 4I1OB 4Q94A 3NZUA 4NQ0A 2LAHA 4NURA 3Q4AB 3PUKA 4PDXA 3P2BA 4FLBA 4KYOB 4PH4B 3Q49B 3RIBA 3RKVA 5CMWA 3PH0C 3Q5MA 3IKOB 4PS7A 2X6HA 1JUQA 2CHXA 4G25A 4U63A 4C9BB 4HOQA 4XX5A 5CHEE 3ZN3A 5LCWJ 5FQ8A 5BPPA 2WXRA 3FUKA 4J8FA 2V4LA 1JPLA 3FFLA 4ABNA 2BUGA 3ENEA 1E8ZA 2C0MA 4BSXA 3FU6A 3ZRHA 2WVIA 3U4TA 4EZJA 4N3CA 4TUUA 4ANWA 4J8DA 3PNTB 1HO8A 4URKA 2YQ8A 1MHQA 3JCKC 1ZU2A 1NZNA 3QARA 1H2VC 4FJZA 4I6EA 5JHAA 3B7UX 1E90A 1A17A 3AS4A 1OUVA 4GYYA 3GZ1A 4DPRA 4TRQA 4Y6CA 3L6AA 5FJYA 2P58C 3LY9A 3ZYKA 1HXIA 4KMOA 3APCA 3QKYA 5J90A 1H2TC 2WXHA 2J09A 3LVQE 1PAQA 4EZLA 4RG9A 1UN9A 3TL5A 1NA0A 4AY6A 4LCTA 5FZQA 4Y6WA 4G2VA 4AP2A 2WXIA 4UQZA 4A1SA 2AXZA 2RG8A 3PE4A 1IQRA 3O4ZA 3L22A 2WMNA 2XPYA 4GZ3A 2CG2A 4FA6A 3KEZA 3JUIA 3CVWA 2V0PA 4WNGA 3U3WA 5KCMA 2XCBA 3S7DA 1OWLA 3ML9A 3TG4A 1TJFA 1QQEA 4B8CB 4BT8A 4GU5A 3FWVA 4XI0A 2L0IA 2IOSA 3MV3B 5EX3A 3ZYLA 5FTPA 2FBNA 3LJ3A 4ANXA 2HM8A 4GAAA 2KZTA 4JHRA 1HU3A 4N3BA 3FTWA 4GPKA 2IQCA 3CVQA 2AXUA 2WQ6A 5D0OD 3EIQC 5BV1A 3UT7A 2R5SA 3PS6A 5BW8C 3PNLB 5HQ8A 4APFA 1ELRA 3EHNA 2CG3A 4JHJA 3CV0A 4LERA 3RO2A 3B7TA 3RU0A 4IN3B 1WAO1 4AIFA 4ANVA 2C2LA 4HOUA 4FC8A 1TJCA 4D10C 2CHZA 3CVXA 2BF0X 3D9IA 2J4BA 2IU1A 4DI3A 3MEKA 5BT1A 1IQUA 3UPVA 2I1JA 5C2YA 3KD7A 3G2SA 3OTNA 3MA5A 3FTSA 3MV2B 5T3RA 4DLQA 2LAIA 4AXHA 1DVPA 3UUXA 4KZ0A 5D0QD 2WM9A 3L17A 3VLEA 3D9LA 2MOWA 3OXFA 3CIAA 1NP7A 3K9IA 3VTYA 2V8SE 3FTXA 3FHEA 5T8IA 4I6JA 3OXLA 4KZCA 3ZPJA 2PM7A 5A23A 4JPSA 3PDNA 3AS5A 4GCNA 3CVYA 2WXJA 4L2YA 4IULA 2WXOA 4JW1A 3AU4A 3TAXA 4YVQC 1DNPA 1OWMA 4JHKA 3EHMA 3LEWA 2WXPA 5G05C 3UT4A 4J0UA 3RO3A 2VTBA 4GYOA 1UG3A 3HVEA 3LCAA 4OYSA 4GZ5A 5G05J 4BTBA 4O6FA 4G1TA 4HS2A 1E96B 3FH7A 4AM9A 4L23A 2CFZA 2KC7A 1OWOA 2LSUA 3QWVA 2E0IA 1PC2A 3FTVA 3ZHEA 1E8WA 5FQ6A 3FTZA 3RRUA 3IBEA 1SZAA 2XCCA 3EIJA 3LVRE 5BUZA 4U04A 4N5CA 5FZRA 4F1SA 1TEZA 4LRZA 4HORA 3RRMB 3DPDA 3RJVA 3WXXA 3FU0A 4PS8A 5ARGA 3FUDA 4A3TA 2YNQA 1LF8A 4CRWA 3CSFA 4AOFA 1WM5A 2VJ8A 3L54A 3ONLA 3I5PA 5JJ7A 4H7YA 2IJGX 2Q7FA 5FT9A 1N52A 3PRZA 2ZU6B 5KJMA 3OAWA 5DIZA 2JEKA 3LXUX 3QOUA 2HO1A 4DJAA 3MKQA 3CHPA 4GZ6A 4BX9A 1SQMA 3ZGQA 5LP0A 5G04C 5LCWC 2XGMA 5G04J 1QNFA 2C0LA 5LFAA 5AYWD 2A5UA 3MKRA 2A4ZA 2LO6A 1E7UA 3CLJA 3FULA 2VGXA 3UQ3A 4K03A 1BPOA 1FCHA 1UJJA 1ZBPA 2HYZA 2QY7A 4APOA 3D9MA 4KXKB 2XQ0A 2XPZA 3QNKA 2XPIA 4PUCA 1HS6A 5ENNA 2VSOE 4WNDA 1SZ9A 3R7RA 3MGBA 3R7QA 3AU5A 3VLFA 4Q96A 3BEEA 3ESLA 1HG5A 4JC8A 2ONDA 3QK0A 3D9OA 3FEXA 4KVMA 2KZTB 1HFAA 4NACA 4HLEA 2CFUA 3QC1A 2WB2A 4J8SA 4DI4A 2X6KA 2Y3AA 1PY1A 4CGVA 3T8MA 2X6IA 3FUNA 3ML8A 4N2SA 4BY6A 3BG1B 3CHMA 4GA2A 4UWLA 4R7LA 3B7RL 4JL0A 3CK8A 4KBQA 5ARFA 4EECA 4YNDA 2AWIA 3L13A 3FUHA 4MKTA 4U0UA 3SD5A 2WXQA 1FVFA 3CK9A 4BT9A 4WWOA 1EF1C 2WXKA 3IEGA 5T4YA 4CDNA 2YHCA 4EPZA 3U9WA 3DBSA 1H2UA 2XHEA 1KT0A 3FTYA 1XGWA 3TXMA 1ELKA 3CHQA 4HXIA 4AY5A 4U07A 3FUJA 3FUEA 3MJWA 3QAQA 5AJLA 3NF1A 2J9QA 1H0AA 2PL2A 4WWPA 2X3MA 4A3VA 3G2WA 5BNWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QZ2 A;  3LY7 A;  5A7D B;  2QFC A;  4J8E A;  3JYS A;  3ASG A;  2NC9 A;  4NRH B;  3ZHE B;  3OXG A;  4GYW A;  3ASD A;  4GA1 A;  5C1D A;  3GZ2 A;  4XIF A;  2KCL A;  5KJL A;  1Y8M A;  3LYA A;  4I1A A;  5EKQ D;  1ELW A;  1W3B A;  4RG6 A;  4I9C A;  3HYM B;  4UI9 J;  2IFU A;  3PE3 A;  4I9E A;  2UY1 A;  4H7X A;  4N3A A;  4I2W A;  2WPV A;  2VYI A;  3CKB A;  5KJK A;  3CVP A;  3CEQ A;  4WNE A;  2GW1 A;  3Q47 B;  4CDR A;  2LNI A;  2XEV A;  2JLB A;  4BTA A;  2PZI A;  4UQX A;  1HZ4 A;  2VQ2 A;  3TGO A;  3CKC A;  2UWJ G;  3GYZ A;  2V5F A;  3QDN A;  3QWP A;  3N71 A;  4JA9 A;  5DBK A;  2DBA A;  2KCK A;  3CVN A;  4G26 A;  2LSV A;  1NA3 A;  4WUY A;  3LPZ A;  5CCL A;  3CK7 A;  3CVL A;  4GCO A;  5A6C A;  3ULQ A;  3O48 A;  2XGO A;  3Q15 A;  5M72 A;  2HR2 A;  2FF4 A;  2AVP A;  3S7B A;  4G23 A;  2VGY A;  3KS2 A;  4CGW A;  3E4B A;  1HH8 A;  3ZFW A;  2VSN A;  4GA0 A;  5KJN A;  3SZ7 A;  4N39 A;  5EX0 A;  2FEZ A;  2KCV A;  2PQN A;  2KAT A;  4JA7 A;  4U0Z A;  2PQR A;  3QWW A;  4WNF A;  5FZS A;  1B89 A;  4B94 A;  3S7J A;  4I2Z A;  4F3V A;  3EDT B;  4XI9 A;  4EQF A;  2IF4 A;  4W9R A;  2Y4U A;  1IYG A;  4BWR A;  2XGS A;  3S7F A;  5CCM A;  3R9A B;  2UY1 B;  3URZ A;  1XNF A;  3KAE A;  4LEU A;  2VSY A;  3LY8 A;  4ME2 A;  1YA0 A;  4UI9 C;  2OOE A;  3SF4 A;  3ESK A;  4HOT A;  4G24 A;  4YVO A;  2FI7 A;  5JJT A;  4I17 A;  2FO7 A;  1KT1 A;  4UI9 K;  2E2E A;  5HI7 A;  2VGX B;  4HOS A;  4N2Q A;  4U0S A;  2I6H A;  3ASF A;  1IHG A;  3TG5 A;  3ASH A;  2MHK A;  3VTX A;  3FP3 A;  5JJ6 A;  2WQH A;  3GW4 A;  2L6J A;  3AS8 A;  1P5Q A;  1KLX A;  2Y4T A;  4UQY A;  3LKU A;  4NQ0 A;  3Q4A B;  4KYO B;  3Q49 B;  3RIB A;  3RKV A;  3Q5M A;  4G25 A;  4HOQ A;  5CHE E;  3ZN3 A;  5LCW J;  4J8F A;  3FFL A;  4ABN A;  2BUG A;  2C0M A;  3U4T A;  4N3C A;  4J8D A;  2YQ8 A;  1ZU2 A;  1NZN A;  1A17 A;  3AS4 A;  1OUV A;  4GYY A;  3GZ1 A;  4Y6C A;  5FJY A;  2P58 C;  3LY9 A;  1HXI A;  3QKY A;  4RG9 A;  1NA0 A;  4AY6 A;  5FZQ A;  4Y6W A;  4G2V A;  4UQZ A;  4A1S A;  3PE4 A;  4GZ3 A;  4WNG A;  3U3W A;  2XCB A;  3S7D A;  3TG4 A;  1QQE A;  4BT8 A;  3FWV A;  4XI0 A;  3MV3 B;  5EX3 A;  5FTP A;  2FBN A;  4JHR A;  4GPK A;  4N3B A;  3CVQ A;  5D0O D;  2R5S A;  5BW8 C;  5HQ8 A;  1ELR A;  3CV0 A;  3RO2 A;  3RU0 A;  4IN3 B;  1WAO 1;  4AIF A;  2C2L A;  4HOU A;  1TJC A;  3MEK A;  5BT1 A;  3UPV A;  3KD7 A;  3MA5 A;  3MV2 B;  3UUX A;  5D0Q D;  3OXF A;  3K9I A;  3VTY A;  3OXL A;  3ZPJ A;  3PDN A;  3AS5 A;  4GCN A;  3TAX A;  4YVQ C;  5G05 C;  4J0U A;  3RO3 A;  4GYO A;  3LCA A;  5G05 J;  4GZ5 A;  4BTB A;  4O6F A;  4G1T A;  1E96 B;  4AM9 A;  2KC7 A;  2LSU A;  3QWV A;  1PC2 A;  3ZHE A;  2XCC A;  4U04 A;  4N5C A;  5FZR A;  4HOR A;  3RJV A;  3WXX A;  5ARG A;  1WM5 A;  5JJ7 A;  4H7Y A;  2Q7F A;  5FT9 A;  5KJM A;  5DIZ A;  3QOU A;  2HO1 A;  4GZ6 A;  3ZGQ A;  5G04 C;  5LCW C;  2XGM A;  5G04 J;  2C0L A;  5AYW D;  3MKR A;  2VGX A;  3UQ3 A;  1FCH A;  1ZBP A;  2HYZ A;  4APO A;  4KXK B;  2XPI A;  4WND A;  3BEE A;  2OND A;  4CGV A;  4N2S A;  4GA2 A;  4JL0 A;  3CK8 A;  4KBQ A;  5ARF A;  4YND A;  4U0U A;  3CK9 A;  4BT9 A;  3IEG A;  2YHC A;  1KT0 A;  4AY5 A;  4U07 A;  3NF1 A;  2J9Q A;  2PL2 A;  5BNW A; 
#chains in the Genus database with same CATH topology
 1Y6I A;  3D9P A;  3APF A;  3G2U A;  1Z6T A;  2FUL A;  1D9S A;  1JWG A;  2QZA A;  3DEP A;  5CRU A;  3ASG A;  5E75 A;  1N54 A;  4NRH B;  3G2T A;  3P1U A;  3ZHE B;  2I2O A;  3ASD A;  5JA4 D;  4C0M A;  4GA1 A;  5C1D A;  1K3Z D;  3GZ2 A;  3EHQ A;  3PEU B;  1QBQ A;  3AG4 E;  3LYA A;  1EDU A;  4I1A A;  4JXT A;  2MRI A;  4BEP A;  1SVX A;  4RLY A;  3ZYM A;  4G11 A;  4ZHB A;  4I9C A;  4MS6 A;  3UKU G;  1OWN A;  3D9J A;  2ZGD A;  1JCS A;  4H7X A;  4M7C A;  2ION A;  3CST A;  2PM6 A;  5CBN A;  3TWR A;  3CKB A;  3CVP A;  2GRO B;  4CT4 A;  3CEQ A;  4CDR A;  2LNI A;  4JB8 P;  4U95 D;  1H6K A;  2JLB A;  4UQX A;  3UM3 A;  1HZ4 A;  3CKC A;  1HX8 A;  3CQC B;  2Y1L E;  4K5B A;  1N94 A;  2KCK A;  2BTD A;  4G26 A;  5EID A;  4EBA A;  4RVB A;  3SI5 A;  3U66 A;  4AJW A;  4F7A A;  4U8H A;  4AVX A;  4LG6 A;  3C72 A;  3UM2 A;  4I1M A;  4BER A;  5A6C A;  3SBS A;  2XGO A;  1Z5S C;  2HR2 A;  2J07 A;  4GB9 A;  5LX8 A;  3SHF A;  2GRM A;  5KBA A;  4BSZ B;  3KSQ A;  4ILG A;  1WY6 A;  1UOH A;  4WAF A;  4CGW A;  2IO3 C;  4M3O A;  3T5X A;  3HDX A;  3PUJ A;  2L0T B;  4JEU A;  1K8K G;  3SZ7 A;  2XZD G;  4N39 A;  4J6I A;  4UUC A;  1O1R A;  4XE0 A;  5FZS A;  5ANL A;  3S7J A;  4I2Z A;  4F3V A;  3EJN A;  4EQF A;  2IF4 A;  4CT0 A;  4DLO A;  1IYG A;  4BWR A;  3S7F A;  3DSW A;  2R03 A;  2M63 A;  1XNF A;  3KAE A;  3LY8 A;  1TN8 A;  5ENS D;  3CGH A;  1TNZ A;  4UI9 C;  2CHW A;  3MYV A;  3SF4 A;  5AQA A;  2WXN A;  4YVO A;  3F6Q A;  1EPU A;  4A55 A;  3R9M A;  2BKG A;  2R05 A;  1IHG A;  3IV0 A;  2EIJ E;  3Q9U C;  3TG5 A;  3VTX A;  5JJ6 A;  4FJY A;  4FLH A;  4B8A A;  4OVV A;  4MLP A;  5EN5 D;  3FH5 A;  4GTV A;  4Q94 A;  3NZU A;  2ZIS A;  4NUR A;  3Q4A B;  2VGE A;  3RKV A;  1JUQ A;  4J8F A;  2V4L A;  3ZRH A;  3PNT B;  1HO8 A;  3JCK C;  5JHA A;  1NZN A;  1E90 A;  1A17 A;  1OUV A;  3GZ1 A;  4TRQ A;  1SW6 A;  1HXI A;  1H2T C;  1LD8 A;  2WXH A;  1PAQ A;  4EZL A;  1UN9 A;  1NA0 A;  4G2V A;  4AP2 A;  3AG2 E;  2RG8 A;  2WMN A;  4GZ3 A;  2CG2 A;  4WNG A;  2XEH A;  1FPP A;  5HKP A;  3ML9 A;  4YDE A;  4BT8 A;  4GU5 A;  1AWC B;  1ZB1 A;  4QQI A;  1K1B A;  1AP7 A;  5FTP A;  3LJ3 A;  4JHR A;  1HU3 A;  3KSL A;  4HRM B;  3UT7 A;  3PS6 A;  2CG3 A;  4TUM A;  1OCZ E;  2L6B A;  4IN3 B;  3CVX A;  1D8D A;  3D9I A;  2J4B A;  2IU1 A;  5C2Y A;  2R2L A;  3MV2 B;  4DLQ A;  2LAI A;  1YMP A;  3UUX A;  4ZFH A;  3CIA A;  1IKN D;  5T8I A;  3OXL A;  3ZPJ A;  3ZUV B;  5A23 A;  2KBX A;  3PDN A;  3PZ3 A;  3AU4 A;  3V2O A;  4HB5 A;  3LEW A;  5AQB A;  2WXP A;  5G05 C;  3JXI A;  5G05 J;  4OYS A;  3HVE A;  3FH7 A;  4AM9 A;  2KC7 A;  2OEW A;  3ABL E;  3HXF A;  3EIJ A;  4TXQ A;  4N5C A;  4HOR A;  1NFI E;  5ITZ F;  3RJV A;  3FU0 A;  2MYO A;  1LF8 A;  3L54 A;  5CEA A;  3I5P A;  5FT9 A;  3PRZ A;  3CHP A;  5LP0 A;  1SQM A;  3ZGQ A;  5G04 C;  5G04 J;  3DST A;  4O1O A;  3E32 A;  2ETB A;  3UQ3 A;  3V30 A;  1ZBP A;  1UJJ A;  4C48 B;  2F8Y A;  2BED A;  3D9M A;  1DC2 A;  3PZ2 A;  4L9P A;  2VSO E;  2DYR E;  4WND A;  3TWS A;  3VLF A;  3BEE A;  3L82 A;  1HG5 A;  1OT8 A;  4JC8 A;  3QK0 A;  3D9O A;  4KVM A;  2P9U G;  3W9G A;  5KNH D;  4NAC A;  3QC1 A;  5IY5 E;  1MX4 A;  4J8S A;  1LD7 A;  2X6K A;  3C3Q A;  3SO8 A;  4BY6 A;  3Q7F A;  4JL0 A;  3CK8 A;  4KBQ A;  3AG1 E;  2AWI A;  3EUV A;  3E33 A;  2H6I A;  2WXK A;  3HXC A;  3U9W A;  3FTY A;  1XGW A;  3TWX A;  5KNG A;  3AAA C;  4AY5 A;  4HQD A;  3FUJ A;  4J8Y A;  2XS1 A;  3RAU A;  4A3V A;  3G2W A;  4K5C A;  3SQV A;  5BNW A;  4AEZ C;  5A7D B;  4G8L A;  5AEN A;  5B1A E;  5JHB A;  3T8K A;  4FP7 A;  2DVW A;  4KT6 B;  3PRE A;  1RW2 A;  1BI8 B;  3DSX A;  1MX2 A;  1E7V A;  4CCA A;  2F0Y A;  2IEJ A;  4HFG A;  3I3N A;  5KJL A;  4FHJ A;  4YDO A;  2P9N G;  3WG7 E;  4UWH A;  4RG6 A;  3ONK A;  4L2L A;  1MQS A;  4JZY A;  4U8Y D;  5ENP D;  1N9A A;  2IOL A;  1TN7 A;  2DIW A;  2IFU A;  1U3C A;  3FU3 A;  1TNY A;  2VYI A;  2NXP A;  4WNE A;  4MRU A;  2WXF A;  3BQO A;  2XEV A;  3AJI A;  3FEY A;  2JAB A;  3FUM A;  2J08 A;  3NZS A;  4BTA A;  1S0P A;  2UWJ G;  4ACL A;  3MX3 A;  3QDN A;  4JA9 A;  2DBA A;  4CDM A;  3D9K A;  1OWP A;  2LSV A;  4ILH B;  3EU5 A;  1NA3 A;  3FY4 A;  3HG0 D;  3TWT A;  2P9I G;  5J08 A;  2WXL A;  5CER B;  2OVB A;  1Z3X A;  1Q2Z A;  5FWQ A;  3O48 A;  3UT8 A;  4K0R A;  4RQI A;  3BG0 B;  4ATG A;  2OVF A;  4ILI A;  1HF8 A;  2OV8 A;  2AVP A;  5BXO A;  4LNG A;  4G23 A;  1G3N B;  3RK6 A;  3JQ1 A;  5AQ9 A;  2IY0 C;  2DCP A;  2YHE A;  3RRN B;  3QB2 A;  1HH8 A;  4FU3 A;  3TWQ A;  4P29 A;  2KAT A;  5E76 A;  1FVH A;  4JA7 A;  4XKC A;  1INZ A;  4UWF A;  2PQR A;  1E8X A;  4WNF A;  5CMY A;  3L08 A;  3HHM A;  4DX5 D;  4XI9 A;  4W9R A;  2Y4U A;  1O5M A;  5G55 A;  5CCM A;  2UY1 B;  3W9F A;  3URZ A;  2OEV A;  1N0R A;  2X6F A;  3HIZ A;  2XEE A;  1O1S A;  5HRY A;  2VSX E;  3SFY A;  2OOE A;  3D9N A;  4XKB A;  3PEV B;  3L16 A;  2FI7 A;  2ETA A;  5AJD A;  1JWF A;  1KT1 A;  4HOS A;  5HI7 A;  4UWG A;  2I6H A;  3UM0 A;  3MZL B;  3NAW A;  4V3I A;  3FTU A;  4CYM D;  3GW4 A;  1P5Q A;  2Y4T A;  4UQY A;  4A63 B;  4I1O B;  4OAU C;  2LAH A;  4MBG A;  4N5Q A;  4PDX A;  4PH4 B;  4PS7 A;  3UI2 A;  4G25 A;  3NB2 A;  4U63 A;  4HOQ A;  4XX5 A;  5LCW J;  5H7P A;  2BUG A;  4BSX A;  3E37 A;  4EZJ A;  4URK A;  4FJZ A;  3AS4 A;  4DPR A;  1LTX A;  5FJY A;  3LY9 A;  3ZYK A;  3APC A;  3QKY A;  4RG9 A;  3TL5 A;  2RFA A;  5FZQ A;  4Y6W A;  4UQZ A;  2F8X K;  5EIB E;  3JUI A;  2V0P A;  2QYU A;  3L9T A;  3S7D A;  3TG4 A;  4B8C B;  2RFM A;  1N95 A;  4XI0 A;  2L0I A;  4GAA A;  2KZT A;  2IQC A;  3CVQ A;  5D0O D;  4OAV B;  5B3S E;  3CV0 A;  1WAO 1;  4AIF A;  4K5A B;  1TYQ G;  4FC8 A;  1TJC A;  3SFX A;  2BF0 X;  5BT1 A;  1IQU A;  3HRA A;  2DZO A;  3MA5 A;  1MJ0 A;  1DVP A;  4KZ0 A;  5D0Q D;  2KXP C;  2MOW A;  1NP7 A;  3VTY A;  5CED B;  4I6J A;  4JPS A;  1FT1 A;  3AS5 A;  2WXJ A;  1DNP A;  4JHK A;  3EHM A;  3EU9 A;  2GRP B;  5D2M C;  4GYO A;  3UIN C;  4O6F A;  2LSU A;  3ZHE A;  1E8W A;  4LRZ A;  3DPD A;  4PS8 A;  3FUD A;  4A3T A;  4CRW A;  3ONL A;  5JJ7 A;  4H7Y A;  2IJG X;  2Q7F A;  1N52 A;  3DXM G;  2JEK A;  2HO1 A;  4GZ6 A;  3D9H A;  2XGM A;  1QNF A;  2A5U A;  3MKR A;  2A4Z A;  2LO6 A;  1E7U A;  3FUL A;  1S64 A;  3C5R A;  1BPO A;  1FCH A;  4EHM A;  2B6C A;  2XPZ A;  3QNK A;  2XPI A;  4PUC A;  5ENN A;  1SZ9 A;  4F6R D;  3AU5 A;  4Q96 A;  3V2X A;  1OCR E;  4B93 B;  2WB2 A;  2Y3A A;  1PY1 A;  4U8V D;  2X6I A;  3UTM A;  3FUN A;  3KEA A;  3HXE A;  4UWL A;  5B1B E;  5ARF A;  3L13 A;  4U0U A;  4HBD A;  4WWO A;  3BUA A;  2YHC A;  3DBS A;  2XHE A;  1JCQ A;  1SA5 A;  3TXM A;  3CHQ A;  3FUE A;  3QAQ A;  5AJL A;  3LY7 A;  4FHK A;  2ZGG A;  4GTO A;  4J8E A;  2X38 A;  5D66 A;  5EYL A;  3JYS A;  2NC9 A;  2EIL E;  1A5E A;  3IHY A;  4LUN U;  3D3M A;  3CVV A;  4FUL A;  2KCL A;  1BU9 A;  2EIN E;  2P9K G;  3CR3 A;  3Q7A A;  1ELW A;  4L1B A;  4DX6 D;  2AJA A;  3MKQ B;  3TJP A;  4DK5 A;  4I43 A;  4I2W A;  2WPV A;  3GZS A;  4GZD A;  3Q47 B;  2PNN A;  3SBT B;  5AN8 A;  5EIL A;  3UKR G;  2VQ2 A;  1H19 A;  3GYZ A;  2XRY A;  2V5F A;  1EYH A;  3QWP A;  4GML A;  3N71 A;  5DBK A;  3CVN A;  3U64 A;  3PZD A;  5ANR A;  2HE0 A;  4NIK A;  4A1G A;  2XRZ A;  4GPM A;  3LS8 A;  4EBA G;  4JEH A;  4WUY A;  4IYP A;  5CCL A;  3UX4 A;  1MYO A;  2A5E A;  3Q9N C;  2YIN A;  5CRV A;  4GCO A;  3ULQ A;  3FH8 A;  3ZW3 A;  3SY2 A;  3IXE A;  3APD A;  1L5J A;  1HG2 A;  2LXL A;  2Y0B G;  3CQG B;  2VGY A;  1DCE A;  4GTS A;  3SFZ A;  2WXM A;  3B7S A;  4B0Z A;  3ZFW A;  3DRA A;  4GA0 A;  5KJN A;  3ZXP A;  1TNO A;  2ILR A;  4UWK A;  2FEZ A;  3C3R A;  3NOG D;  2VTB B;  2PQN A;  4E85 A;  1OXJ A;  4U0Z A;  4FAD A;  3UIP C;  4GTM A;  3QWW A;  3CHS A;  5AAR A;  1B89 A;  3NQP A;  4B94 A;  3EDT B;  3JXJ A;  3R9A B;  2XZT G;  4EZK A;  1BI7 B;  3SNX A;  4CEM A;  3T5V A;  3I4R B;  3JUE A;  4C0E A;  1NI1 A;  2NSZ A;  3RSE G;  3ESK A;  4HOT A;  3ZYQ A;  2RD0 A;  1S70 B;  5CBO A;  5JJT A;  2XS8 A;  4CZ2 D;  2RKK A;  2E2E A;  2VGX B;  2H6G A;  3HXD A;  2AW6 A;  4PS3 A;  3ASF A;  5AIJ A;  3ASH A;  1OY3 D;  4QFV A;  1U2V G;  3FP3 A;  1RZ4 A;  2ETC A;  5LOZ A;  2L6J A;  3AS8 A;  1KLX A;  3LKU A;  4XZ4 A;  3FUI A;  4KYO B;  4Z68 A;  3IKO B;  2V5Q C;  2CHX A;  3ZN3 A;  4HLL A;  3TWW A;  1JPL A;  1X81 A;  3ENE A;  2C0M A;  2WVI A;  3U4T A;  4N3C A;  4TUU A;  1BD8 A;  4J8D A;  5JMN D;  1K1A A;  4HI8 A;  1ZU2 A;  5ENR D;  3B7U X;  4GMR A;  4Y6C A;  3L6A A;  4HI9 A;  1TNU A;  2J09 A;  4AY6 A;  3LJN A;  2WXI A;  2AXZ A;  3PE4 A;  4O60 A;  1IQR A;  4GTR A;  3O4Z A;  3L22 A;  4FA6 A;  4F1P A;  3J5Q B;  5KCM A;  2XCB A;  1TJF A;  1V54 E;  1S63 A;  3MV3 B;  3V31 A;  5EX3 A;  2FBN A;  2HM8 A;  4TXP A;  4BES A;  4N3B A;  2AXU A;  2WQ6 A;  3X2Q E;  3EIQ C;  5BV1 A;  2R5S A;  3PNL B;  5HQ8 A;  4APF A;  1ELR A;  2ZXW E;  4LER A;  3RO2 A;  3B7T A;  2C2L A;  1OCO E;  4D10 C;  2CHZ A;  4DI3 A;  2BKK B;  3MEK A;  3PZ1 A;  2I1J A;  4J7W A;  3OTN A;  3FTS A;  4AXH A;  2FO1 E;  2WM9 A;  3L17 A;  3VLE A;  3D9L A;  3FTX A;  3CVY A;  4L2Y A;  4IUL A;  3TAX A;  4LNU D;  1OWM A;  2B0O E;  1N4Q A;  4J0U A;  3RO3 A;  3V79 K;  2VTB A;  4G1T A;  4HS2 A;  1KZO A;  4L23 A;  2CFZ A;  1H6P A;  4HRN A;  4U96 D;  3QWV A;  2Y69 E;  1PC2 A;  3FTV A;  1TR4 A;  2XCC A;  4X8Q A;  4U04 A;  1TEZ A;  1TN6 A;  5ARG A;  2P9L G;  3DWL G;  3CSF A;  4AOF A;  4LNB A;  3LXU X;  3ASN E;  5LCW C;  3ULE G;  2C0L A;  5LFA A;  3CLJ A;  2VGX A;  2HYZ A;  5ENO D;  4APO A;  2XQ0 A;  1N11 A;  1N0Q A;  1H6O A;  3R7Q A;  3ESL A;  3B95 A;  5FIN A;  2OND A;  3FEX A;  3ASO E;  3UM1 A;  1HFA A;  5ENQ D;  4HLE A;  3Q73 A;  2CFU A;  2ZIR A;  2V4H C;  4DI4 A;  4CGV A;  3DSU A;  1DCQ A;  3ML8 A;  4N2S A;  3BG1 B;  3CHM A;  1IXV A;  4R7L A;  3B7R L;  4YND A;  2P9S G;  3FUH A;  4MKT A;  4HNA D;  2WXQ A;  4BT9 A;  1EF1 C;  1H2U A;  1KT0 A;  3AG3 E;  2J9Q A;  1H0A A;  2PL2 A;  4WWP A;  2X3M A;  4GTT A;  3FU5 A;  1QZ2 A;  3ZVV A;  4TV3 A;  2QFC A;  3IHV A;  3HVE B;  2WQ7 A;  4DX1 A;  3JQ0 A;  2AXV A;  3OXG A;  4GYW A;  1MX6 A;  3J5P A;  1MZC A;  2R17 C;  1UJK A;  4YDY A;  2I1K A;  3VLD A;  4XIF A;  3G2V A;  5BV0 A;  1Y8M A;  3CHR A;  2QC9 A;  2EQX A;  5EKQ D;  1W3B A;  4I6G A;  2DYS E;  3HYM B;  4UI9 J;  3S2A A;  4DRX E;  5HS0 A;  3PE3 A;  4I9E A;  2UY1 A;  3Q75 A;  4N3A A;  2J4D A;  4IRU A;  5KJK A;  2J49 A;  2GW1 A;  1N4S A;  3ZEF A;  2XEN A;  3PVL A;  2KM4 A;  2PZI A;  3FDH A;  4U7E B;  2WXG A;  3TGO A;  3DEO A;  4AV7 A;  4E6H A;  4GZC A;  1VDY A;  4GMJ A;  5G2N A;  4DUI A;  3C98 A;  3ZIM A;  4F53 A;  4LSZ E;  1KPS B;  4B89 A;  3LPZ A;  2GGF A;  3CK7 A;  2GRQ B;  3CVL A;  1GW6 A;  2WMO A;  3ZXS A;  4WWN A;  3QJZ A;  3Q78 A;  5FQ7 A;  2H6H A;  3Q15 A;  5M72 A;  4ACK A;  2FF4 A;  2X6J A;  2J8S D;  3CVU A;  4G8K A;  4HVB A;  4L7T A;  2GRL A;  2F37 A;  4KVO A;  3S7B A;  2P9P G;  1YCS B;  3KS2 A;  4RSY A;  3E4B A;  1E8Y A;  1QYM A;  1NL4 A;  2VSN A;  3ULY A;  3E34 A;  4O1P A;  3NBN B;  5EX0 A;  5EDS A;  2KCV A;  3I4G A;  1WG0 A;  4JVS A;  3UMV A;  5BXU A;  1HE8 A;  3DSV A;  4ANU A;  3LDZ A;  1U3D A;  1X5B A;  4DX7 D;  4BFR A;  2L9B A;  3CHO A;  2LXM A;  2XGS A;  2I9C A;  3B13 A;  2H6F A;  4LEU A;  2VSY A;  4ME2 A;  1YA0 A;  2R59 A;  2NYJ A;  3SGH A;  4Q69 A;  4OVU A;  1Z3Y A;  2QYJ A;  3DSS A;  4G24 A;  3FUF A;  4I17 A;  4JD2 G;  2FO7 A;  4UI9 K;  4N2Q A;  2P2C P;  4U0S A;  3TWV A;  4GTQ A;  4ATZ D;  3T9K A;  1UW4 B;  5FQ4 A;  2MHK A;  2WQH A;  1UN8 A;  3MCX A;  5CEC B;  4BX8 A;  4TXR A;  4BET A;  3TXN A;  4NQ0 A;  1JCR A;  3PUK A;  3P2B A;  4FLB A;  3Q49 B;  3RIB A;  5CMW A;  3BU8 A;  3PH0 C;  3Q5M A;  2X6H A;  4C9B B;  1FT2 A;  5CHE E;  5FQ8 A;  5BPP A;  2WXR A;  3FUK A;  3B7B A;  3FFL A;  4ABN A;  1E8Z A;  3FU6 A;  3ZU7 B;  4ANW A;  2YQ8 A;  1MHQ A;  3QAR A;  1H2V C;  4I6E A;  1BLX B;  4GYY A;  2P58 C;  4KMO A;  5J90 A;  3LVQ E;  4LCT A;  4A1S A;  2XPY A;  4YDW A;  3ISM C;  3KEZ A;  3C3O A;  3CVW A;  2R02 A;  3TWU A;  3U3W A;  1OWL A;  1QQE A;  3FWV A;  2IOS A;  3ZYL A;  4ANX A;  1TNB A;  4GPK A;  3FTW A;  4XEI G;  1V55 E;  5BW8 C;  1SA4 A;  3EHN A;  4JHJ A;  3RU0 A;  4ANV A;  4HOU A;  2LUH A;  3DPY A;  3ABK E;  3UXG A;  3ZKJ A;  3UPV A;  3KD7 A;  3G2S A;  1WDY A;  5T3R A;  1N4P A;  1KZP A;  3EHR A;  3OXF A;  3K9I A;  2V8S E;  3FHE A;  1D8E A;  4KZC A;  3HXB A;  2PM7 A;  4GCN A;  2WXO A;  4JW1 A;  4YVQ C;  3ZNG A;  1N4R A;  3DXK G;  3UT4 A;  1UG3 A;  3LCA A;  4GZ5 A;  4BTB A;  1E96 B;  1OWO A;  2GRN B;  5FIO A;  2E0I A;  5FQ6 A;  3FTZ A;  4GTP A;  3IBE A;  3RRU A;  3UIO C;  1SZA A;  3LVR E;  5BUZ A;  5FZR A;  1YYH A;  4F1S A;  5EYP F;  3RRM B;  3WXX A;  2GRR B;  3NOC D;  2YNQ A;  1WM5 A;  2IO2 C;  2VJ8 A;  5KJM A;  2ZU6 B;  3OAW A;  5DIZ A;  3QOU A;  4DJA A;  3MKQ A;  4BX9 A;  3PZ4 A;  5AYW D;  5KWD A;  4K03 A;  2QY7 A;  2OCC E;  4KXK B;  1IHB A;  1HS6 A;  2EIK E;  3R7R A;  3ABM E;  3MGB A;  1OCC E;  2KZT B;  5ENT D;  3T8M A;  3E30 A;  4GA2 A;  2DZN A;  4EEC A;  1O1T A;  4HRL A;  5AQ7 A;  3SD5 A;  3CK9 A;  1FVF A;  2EIM E;  3IEG A;  5T4Y A;  4CDN A;  4EPZ A;  5AAO A;  3Q79 A;  1ELK A;  4HXI A;  4U07 A;  3MJW A;  3NF1 A;  4DX2 A;  2DWZ A; 
#chains in the Genus database with same CATH homology
 1Y6I A;  3D9P A;  1QZ2 A;  3FU5 A;  3ZVV A;  4AEZ C;  4TV3 A;  3LY7 A;  4FHK A;  3APF A;  3G2U A;  5A7D B;  2QFC A;  1Z6T A;  4J8E A;  5AEN A;  2FUL A;  3IHV A;  5JHB A;  2X38 A;  3HVE B;  1JWG A;  4FP7 A;  2WQ7 A;  3JYS A;  3ASG A;  5E75 A;  2NC9 A;  4KT6 B;  3PRE A;  1N54 A;  3JQ0 A;  4NRH B;  2AXV A;  3G2T A;  3P1U A;  1E7V A;  3OXG A;  2I2O A;  3ASD A;  4GYW A;  3ZHE B;  4C0M A;  4CCA A;  2R17 C;  4GA1 A;  5C1D A;  1UJK A;  3GZ2 A;  3IHY A;  2I1K A;  4LUN U;  3D3M A;  3VLD A;  3CVV A;  3PEU B;  3I3N A;  3G2V A;  2KCL A;  4FUL A;  4HFG A;  4XIF A;  5BV0 A;  1Y8M A;  5KJL A;  3LYA A;  1EDU A;  4I1A A;  3CHR A;  4JXT A;  4FHJ A;  2MRI A;  2EQX A;  3ZYM A;  5EKQ D;  4UWH A;  4L1B A;  3CR3 A;  1ELW A;  1W3B A;  4G11 A;  4I6G A;  4RG6 A;  4I9C A;  3HYM B;  4MS6 A;  3ONK A;  4UI9 J;  3MKQ B;  4L2L A;  1MQS A;  4JZY A;  3TJP A;  1OWN A;  3S2A A;  3D9J A;  2IOL A;  2IFU A;  2DIW A;  3PE3 A;  4I9E A;  2UY1 A;  4H7X A;  1U3C A;  4DK5 A;  4N3A A;  4I43 A;  2J4D A;  4I2W A;  2ION A;  3FU3 A;  3CST A;  4IRU A;  2PM6 A;  2WPV A;  2VYI A;  2NXP A;  3CKB A;  5KJK A;  2J49 A;  3CVP A;  3GZS A;  4CT4 A;  3CEQ A;  4GZD A;  2GW1 A;  4MRU A;  3Q47 B;  4WNE A;  4CDR A;  3ZEF A;  2LNI A;  2WXF A;  3SBT B;  2XEV A;  3PVL A;  1H6K A;  3FEY A;  3FUM A;  2KM4 A;  2J08 A;  2JLB A;  3NZS A;  4BTA A;  2PZI A;  3FDH A;  4UQX A;  1HZ4 A;  2WXG A;  2VQ2 A;  3TGO A;  3CKC A;  1HX8 A;  1S0P A;  1H19 A;  3CQC B;  2UWJ G;  4AV7 A;  3GYZ A;  2XRY A;  4E6H A;  2V5F A;  1EYH A;  4ACL A;  3MX3 A;  3QDN A;  3QWP A;  4GML A;  3N71 A;  4JA9 A;  5DBK A;  2DBA A;  2KCK A;  4GZC A;  4CDM A;  3CVN A;  2BTD A;  1VDY A;  4G26 A;  3D9K A;  4GMJ A;  1OWP A;  4EBA A;  5G2N A;  3U64 A;  3PZD A;  4RVB A;  5ANR A;  3C98 A;  3SI5 A;  4A1G A;  3U66 A;  2XRZ A;  3ZIM A;  3LS8 A;  2LSV A;  4AJW A;  4ILH B;  4EBA G;  4JEH A;  4F53 A;  1NA3 A;  3FY4 A;  4WUY A;  4B89 A;  4IYP A;  3LPZ A;  2GGF A;  4F7A A;  5CCL A;  4U8H A;  3UX4 A;  4AVX A;  5J08 A;  2WXL A;  3CK7 A;  2OVB A;  3CVL A;  2YIN A;  1GW6 A;  1Z3X A;  4I1M A;  2WMO A;  4GCO A;  3ZXS A;  4WWN A;  5A6C A;  3QJZ A;  5FQ7 A;  5FWQ A;  3FH8 A;  3O48 A;  3SBS A;  2XGO A;  3ULQ A;  3UT8 A;  4K0R A;  3Q15 A;  3ZW3 A;  5M72 A;  3BG0 B;  2HR2 A;  2J07 A;  4GB9 A;  4ACK A;  2FF4 A;  4ATG A;  2OVF A;  2X6J A;  4ILI A;  5LX8 A;  3CVU A;  1HF8 A;  2OV8 A;  3SHF A;  2AVP A;  4HVB A;  4L7T A;  2GRM A;  3APD A;  4ILG A;  2GRL A;  1L5J A;  1WY6 A;  4KVO A;  4WAF A;  3S7B A;  4G23 A;  1HG2 A;  3CQG B;  2VGY A;  3KS2 A;  3RK6 A;  3JQ1 A;  3SFZ A;  4RSY A;  3E4B A;  4CGW A;  2WXM A;  2DCP A;  3B7S A;  4M3O A;  3T5X A;  2YHE A;  3RRN B;  3HDX A;  1HH8 A;  3PUJ A;  1E8Y A;  3QB2 A;  3ZFW A;  4B0Z A;  2VSN A;  4FU3 A;  4GA0 A;  5KJN A;  2L0T B;  4JEU A;  2ILR A;  3SZ7 A;  4UWK A;  4N39 A;  5EX0 A;  2FEZ A;  5EDS A;  2KCV A;  4J6I A;  4P29 A;  2VTB B;  2PQN A;  2KAT A;  5E76 A;  1FVH A;  4E85 A;  4JA7 A;  3I4G A;  4U0Z A;  4XKC A;  4UWF A;  4JVS A;  3UMV A;  4FAD A;  1INZ A;  1HE8 A;  1E8X A;  2PQR A;  3LDZ A;  3QWW A;  4XE0 A;  4ANU A;  4WNF A;  3CHS A;  5FZS A;  5CMY A;  1B89 A;  1U3D A;  3HHM A;  3L08 A;  3NQP A;  5ANL A;  1X5B A;  4I2Z A;  3S7J A;  3EDT B;  3EJN A;  4XI9 A;  4B94 A;  4EQF A;  2IF4 A;  4W9R A;  4F3V A;  2Y4U A;  4CT0 A;  4BFR A;  2L9B A;  3CHO A;  4DLO A;  1IYG A;  4BWR A;  5G55 A;  2XGS A;  3S7F A;  5CCM A;  3R9A B;  2UY1 B;  3URZ A;  4EZK A;  2I9C A;  3B13 A;  2M63 A;  3SNX A;  2X6F A;  3HIZ A;  1XNF A;  4CEM A;  3KAE A;  4LEU A;  2VSY A;  3T5V A;  3LY8 A;  4ME2 A;  3I4R B;  1YA0 A;  2R59 A;  2VSX E;  3CGH A;  4C0E A;  3SGH A;  4UI9 C;  2NSZ A;  2CHW A;  4Q69 A;  3MYV A;  2OOE A;  3SF4 A;  3D9N A;  4XKB A;  2WXN A;  4OVU A;  3ESK A;  1Z3Y A;  4HOT A;  3ZYQ A;  3PEV B;  4G24 A;  4YVO A;  3L16 A;  2RD0 A;  2FI7 A;  3FUF A;  5JJT A;  4I17 A;  2FO7 A;  5AJD A;  1JWF A;  1KT1 A;  4UI9 K;  1EPU A;  2E2E A;  2VGX B;  5HI7 A;  4HOS A;  4A55 A;  4UWG A;  4N2Q A;  4U0S A;  2AW6 A;  4PS3 A;  2I6H A;  3ASF A;  1UW4 B;  5FQ4 A;  3MZL B;  1IHG A;  3IV0 A;  5AIJ A;  3TG5 A;  3ASH A;  4V3I A;  2MHK A;  4QFV A;  3VTX A;  3FTU A;  3FP3 A;  5JJ6 A;  4FJY A;  4FLH A;  5LOZ A;  2WQH A;  3GW4 A;  1UN8 A;  2L6J A;  3MCX A;  3AS8 A;  1P5Q A;  4B8A A;  1KLX A;  4OVV A;  4MLP A;  2Y4T A;  4UQY A;  3LKU A;  4BX8 A;  4XZ4 A;  3FUI A;  3TXN A;  3FH5 A;  4I1O B;  4Q94 A;  3NZU A;  4NQ0 A;  2LAH A;  4NUR A;  3Q4A B;  3PUK A;  4PDX A;  3P2B A;  4FLB A;  4KYO B;  4PH4 B;  3Q49 B;  3RIB A;  3RKV A;  5CMW A;  3PH0 C;  3Q5M A;  3IKO B;  4PS7 A;  2X6H A;  1JUQ A;  2CHX A;  4G25 A;  4U63 A;  4C9B B;  4HOQ A;  4XX5 A;  5CHE E;  3ZN3 A;  5LCW J;  5FQ8 A;  5BPP A;  2WXR A;  3FUK A;  4J8F A;  2V4L A;  1JPL A;  3FFL A;  4ABN A;  2BUG A;  3ENE A;  1E8Z A;  2C0M A;  4BSX A;  3FU6 A;  3ZRH A;  2WVI A;  3U4T A;  4EZJ A;  4N3C A;  4TUU A;  4ANW A;  4J8D A;  3PNT B;  1HO8 A;  4URK A;  2YQ8 A;  1MHQ A;  3JCK C;  1ZU2 A;  1NZN A;  3QAR A;  1H2V C;  4FJZ A;  4I6E A;  5JHA A;  3B7U X;  1E90 A;  1A17 A;  3AS4 A;  1OUV A;  4GYY A;  3GZ1 A;  4DPR A;  4TRQ A;  4Y6C A;  3L6A A;  5FJY A;  2P58 C;  3LY9 A;  3ZYK A;  1HXI A;  4KMO A;  3APC A;  3QKY A;  5J90 A;  1H2T C;  2WXH A;  2J09 A;  3LVQ E;  1PAQ A;  4EZL A;  4RG9 A;  1UN9 A;  3TL5 A;  1NA0 A;  4AY6 A;  4LCT A;  5FZQ A;  4Y6W A;  4G2V A;  4AP2 A;  2WXI A;  4UQZ A;  4A1S A;  2AXZ A;  2RG8 A;  3PE4 A;  1IQR A;  3O4Z A;  3L22 A;  2WMN A;  2XPY A;  4GZ3 A;  2CG2 A;  4FA6 A;  3KEZ A;  3JUI A;  3CVW A;  2V0P A;  4WNG A;  3U3W A;  5KCM A;  2XCB A;  3S7D A;  1OWL A;  3ML9 A;  3TG4 A;  1TJF A;  1QQE A;  4B8C B;  4BT8 A;  4GU5 A;  3FWV A;  4XI0 A;  2L0I A;  2IOS A;  3MV3 B;  5EX3 A;  3ZYL A;  5FTP A;  2FBN A;  3LJ3 A;  4ANX A;  2HM8 A;  4GAA A;  2KZT A;  4JHR A;  1HU3 A;  4N3B A;  3FTW A;  4GPK A;  2IQC A;  3CVQ A;  2AXU A;  2WQ6 A;  5D0O D;  3EIQ C;  5BV1 A;  3UT7 A;  2R5S A;  3PS6 A;  5BW8 C;  3PNL B;  5HQ8 A;  4APF A;  1ELR A;  3EHN A;  2CG3 A;  4JHJ A;  3CV0 A;  4LER A;  3RO2 A;  3B7T A;  3RU0 A;  4IN3 B;  1WAO 1;  4AIF A;  4ANV A;  2C2L A;  4HOU A;  4FC8 A;  1TJC A;  4D10 C;  2CHZ A;  3CVX A;  2BF0 X;  3D9I A;  2J4B A;  2IU1 A;  4DI3 A;  3MEK A;  5BT1 A;  1IQU A;  3UPV A;  2I1J A;  5C2Y A;  3KD7 A;  3G2S A;  3OTN A;  3MA5 A;  3FTS A;  3MV2 B;  5T3R A;  4DLQ A;  2LAI A;  4AXH A;  1DVP A;  3UUX A;  4KZ0 A;  5D0Q D;  2WM9 A;  3L17 A;  3VLE A;  3D9L A;  2MOW A;  3OXF A;  3CIA A;  1NP7 A;  3K9I A;  3VTY A;  2V8S E;  3FTX A;  3FHE A;  5T8I A;  4I6J A;  3OXL A;  4KZC A;  3ZPJ A;  2PM7 A;  5A23 A;  4JPS A;  3PDN A;  3AS5 A;  4GCN A;  3CVY A;  2WXJ A;  4L2Y A;  4IUL A;  2WXO A;  4JW1 A;  3AU4 A;  3TAX A;  4YVQ C;  1DNP A;  1OWM A;  4JHK A;  3EHM A;  3LEW A;  2WXP A;  5G05 C;  3UT4 A;  4J0U A;  3RO3 A;  2VTB A;  4GYO A;  1UG3 A;  3HVE A;  3LCA A;  4OYS A;  4GZ5 A;  5G05 J;  4BTB A;  4O6F A;  4G1T A;  4HS2 A;  1E96 B;  3FH7 A;  4AM9 A;  4L23 A;  2CFZ A;  2KC7 A;  1OWO A;  2LSU A;  3QWV A;  2E0I A;  1PC2 A;  3FTV A;  3ZHE A;  1E8W A;  5FQ6 A;  3FTZ A;  3RRU A;  3IBE A;  1SZA A;  2XCC A;  3EIJ A;  3LVR E;  5BUZ A;  4U04 A;  4N5C A;  5FZR A;  4F1S A;  1TEZ A;  4LRZ A;  4HOR A;  3RRM B;  3DPD A;  3RJV A;  3WXX A;  3FU0 A;  4PS8 A;  5ARG A;  3FUD A;  4A3T A;  2YNQ A;  1LF8 A;  4CRW A;  3CSF A;  4AOF A;  1WM5 A;  2VJ8 A;  3L54 A;  3ONL A;  3I5P A;  5JJ7 A;  4H7Y A;  2IJG X;  2Q7F A;  5FT9 A;  1N52 A;  3PRZ A;  2ZU6 B;  5KJM A;  3OAW A;  5DIZ A;  2JEK A;  3LXU X;  3QOU A;  2HO1 A;  4DJA A;  3MKQ A;  3CHP A;  4GZ6 A;  4BX9 A;  1SQM A;  3ZGQ A;  5LP0 A;  5G04 C;  5LCW C;  2XGM A;  5G04 J;  1QNF A;  2C0L A;  5LFA A;  5AYW D;  2A5U A;  3MKR A;  2A4Z A;  2LO6 A;  1E7U A;  3CLJ A;  3FUL A;  2VGX A;  3UQ3 A;  4K03 A;  1BPO A;  1FCH A;  1UJJ A;  1ZBP A;  2HYZ A;  2QY7 A;  4APO A;  3D9M A;  4KXK B;  2XQ0 A;  2XPZ A;  3QNK A;  2XPI A;  4PUC A;  1HS6 A;  5ENN A;  2VSO E;  4WND A;  1SZ9 A;  3R7R A;  3MGB A;  3R7Q A;  3AU5 A;  3VLF A;  4Q96 A;  3BEE A;  3ESL A;  1HG5 A;  4JC8 A;  2OND A;  3QK0 A;  3D9O A;  3FEX A;  4KVM A;  2KZT B;  1HFA A;  4NAC A;  4HLE A;  2CFU A;  3QC1 A;  2WB2 A;  4J8S A;  4DI4 A;  2X6K A;  2Y3A A;  1PY1 A;  4CGV A;  3T8M A;  2X6I A;  3FUN A;  3ML8 A;  4N2S A;  4BY6 A;  3BG1 B;  3CHM A;  4GA2 A;  4UWL A;  4R7L A;  3B7R L;  4JL0 A;  3CK8 A;  4KBQ A;  5ARF A;  4EEC A;  4YND A;  2AWI A;  3L13 A;  3FUH A;  4MKT A;  4U0U A;  3SD5 A;  2WXQ A;  1FVF A;  3CK9 A;  4BT9 A;  4WWO A;  1EF1 C;  2WXK A;  3IEG A;  5T4Y A;  4CDN A;  2YHC A;  4EPZ A;  3U9W A;  3DBS A;  1H2U A;  2XHE A;  1KT0 A;  3FTY A;  1XGW A;  3TXM A;  1ELK A;  3CHQ A;  4HXI A;  4AY5 A;  4U07 A;  3FUJ A;  3FUE A;  3MJW A;  3QAQ A;  5AJL A;  3NF1 A;  2J9Q A;  1H0A A;  2PL2 A;  4WWP A;  2X3M A;  4A3V A;  3G2W A;  5BNW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...