3CV0A

Structure of peroxisomal targeting signal 1 (pts1) binding domain of trypanosoma brucei peroxin 5 (tbpex5)complexed to t. brucei phosphoglucoisomerase (pgi) pts1 peptide
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
325
structure length
300
Chain Sequence
GHMLQNNTDYPFEANNPYMYHENPMEEGLSMLKLANLAEAALAFEAVCQAAPEREEAWRSLGLTQAENEKDGLAIIALNHARMLDPKDIAVHAALAVSHTNEHNANAALASLRAWLLSQPQYEQLFFFAAPNEYRECRTLLHAALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVGGTTSREATRSMWDFFRMLLNVMNRPDLVELTYAQNVEPFAKEFGLQSM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights into the recognition of peroxisomal targeting signal 1 by Trypanosoma brucei peroxin 5.
pubmed doi rcsb
molecule keywords Peroxisome targeting signal 1 receptor PEX5
molecule tags Transport protein
source organism Trypanosoma brucei
total genus 118
structure length 300
sequence length 325
ec nomenclature
pdb deposition date 2008-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3cv0A00
4U0UA 4XI9A 4GA1A 1KT0A 2KATA 3VTXA 4H7YA 4UQZA 3S7DA 2P58C 1KT1A 2XCCA 3LY7A 4GZ5A 5ARFA 4JL0A 4HOSA 3PE3A 4ME2A 5CCLA 3CVNA 3ESKA 2FI7A 3MA5A 3ZHEB 5EKQD 5ARGA 3AS8A 3PE4A 4I9CA 2VQ2A 5JJ7A 5LCWC 2PQNA 5BNWA 3ASDA 4XIFA 4G24A 3ZN3A 1Y8MA 5FZQA 4I1AA 3ASGA 3ULQA 3CK7A 5FJYA 3ASHA 3RKVA 4YVQC 2HR2A 4GCOA 3NF1A 4XI0A 4WNEA 3S7JA 4HOTA 3O48A 5G04C 4O6FA 4Y6CA 1E96B 3N71A 5JJ6A 3Q49B 4N2QA 2ONDA 4ABNA 2VGXB 2FO7A 2J9QA 4GPKA 4U07A 4CGVA 3CVLA 1PC2A 4AM9A 1NZNA 4I17A 3CVQA 4I2WA 4RG6A 3E4BA 4KYOB 4GYWA 5LCWJ 2Q7FA 4RG9A 4N3CA 2YHCA 2FF4A 1QQEA 3MEKA 2MHKA 3FWVA 5EX0A 4LEUA 4BT9A 5CHEE 4KXKB 4G23A 5C1DA 4JA9A 4H7XA 5M72A 4J8FA 4U0ZA 3MV2B 3Q4AB 4N39A 5A7DB 5G04J 3ZHEA 4UQYA 4A1SA 2PZIA 2DBAA 2XGOA 3CK9A 3S7FA 3EDTB 4YNDA 4GYYA 2Y4UA 4GZ3A 3RIBA 1ZBPA 3CKCA 3LKUA 4AY6A 4N5CA 1XNFA 2WQHA 4F3VA 2UY1A 4KBQA 2IFUA 2KCVA 3WXXA 4N3AA 5JJTA 1ELWA 1WM5A 2PL2A 2AVPA 4HOQA 2VSYA 3U4TA 4G1TA 3QOUA 2E2EA 1ZU2A 3OXGA 1QZ2A 1WAO1 1ELRA 3OXFA 3CEQA 1IHGA 3AS4A 3GW4A 3TGOA 4J8DA 3RU0A 3UPVA 1HH8A 4GCNA 1NA0A 5A6CA 4NRHB 4YVOA 4Y6WA 4G26A 5KJKA 4WNGA 5KJLA 4BWRA 5D0QD 3U3WA 4J8EA 2XPIA 2KCKA 4JHRA 3S7BA 4UI9K 3CV0A 2VYIA 2YQ8A 5KJMA 3ZFWA 2FBNA 1HXIA 3Q15A 2R5SA 3Q5MA 2I6HA 3KAEA 5EX3A 2UWJG 4GZ6A 4UI9C 4AIFA 2JLBA 3QWPA 4WUYA 3LCAA 4U04A 3R9AB 3RO3A 3RO2A 3GZ2A 4W9RA 3QKYA 4GA2A 4WNDA 5FT9A 3ASFA 2LSVA 3PDNA 3JYSA 4WNFA 3FFLA 3LYAA 2FEZA 3MV3B 4GYOA 5G05C 4U0SA 1W3BA 5DBKA 3SZ7A 2C2LA 3SF4A 3TG5A 5DIZA 4CDRA 3LPZA 2HYZA 3QWWA 4J0UA 1TJCA 3CKBA 1NA3A 5FZRA 2C0MA 3VTYA 4HOUA 2XCBA 3RJVA 3LY9A 1IYGA 3GYZA 4CGWA 4I2ZA 4UQXA 3GZ1A 3KD7A 5KJNA 3OXLA 2QFCA 2LNIA 4GA0A 5CCMA 4UI9J 5BT1A 3BEEA 3QWVA 3Q47B 4IN3B 5FZSA 4N2SA 2XGSA 2GW1A 3MKRA 2KCLA 2VGXA 4BTAA 2Y4TA 1P5QA 5AYWD 4APOA 1KLXA 1A17A 1OUVA 2IF4A 5G05J 4BTBA 3TAXA 3CK8A 3AS5A 3K9IA 4EQFA 5D0OD 3HYMB 4AY5A 2OOEA 2UY1B 2VSNA 4G25A 3ZGQA 2BUGA 3LY8A 5BW8C 2VGYA 4NQ0A 4JA7A 3CVPA 4BT8A 2L6JA 3FP3A 3UUXA 2V5FA 2NC9A 1YA0A 2LSUA 5HI7A 4HORA 1FCHA 2XGMA 4G2VA 4I9EA 2HO1A 2WPVA 4N3BA 3QDNA 3IEGA 1HZ4A 2KC7A 1B89A 2C0LA 3TG4A 2XEVA 3ZPJA 5HQ8A 3UQ3A 2PQRA 3KS2A 3URZA 5FTPA 4B94A
chains in the Genus database with same CATH superfamily
1MQSA 3HDXA 4U0UA 2ETCA 3ZVVA 2F8XK 3FUFA 1N11A 4LNGA 4ATZD 4FA6A 2XCCA 5ARFA 4HOSA 3PE3A 5CCLA 3V31A 1MX2A 3CVNA 5ENOD 3ESKA 1UOHA 3ZHEB 5ARGA 4DX2A 4C0EA 2IY0C 3FTZA 3FUIA 3JQ1A 2BTDA 2R02A 2XS1A 2KXPC 4I6JA 2XRYA 1SA5A 5BNWA 5CERB 3ASNE 3LVQE 4XIFA 1X5BA 3ZN3A 3PZ1A 4K5AB 3ULEG 5EIBE 1BPOA 4I1AA 4WWOA 2X3MA 2IQCA 4GTOA 1E7VA 2HR2A 4GMJA 4XI0A 4O60A 4HVBA 2NXPA 2WXLA 4Y6CA 4GZCA 2Y69E 2ONDA 4ABNA 2XEHA 4PS3A 2RD0A 4GPKA 4C48B 2WXRA 4U07A 2V8SE 4R7LA 4XE0A 3DSVA 3CVLA 1N4SA 1RZ4A 3CVQA 4RG6A 3E4BA 4GYWA 4GTMA 4N3CA 2FF4A 3MEKA 3L16A 2BKGA 4LEUA 3CHQA 3W9GA 4B93B 1O5MA 2EIME 4GTSA 4BFRA 4H7XA 3TWUA 4U0ZA 2R05A 3ZNGA 4NURA 3B7SA 4N39A 1N9AA 5G04J 3D9IA 2PZIA 2DBAA 5BUZA 4LSZE 3EDTB 3VLDA 5JHAA 4CT0A 4TUMA 3RIBA 5E75A 3DSXA 3LJ3A 5B3SE 4NIKA 1XNFA 2WXIA 4U63A 5ENSD 4IRUA 3Q78A 3UTMA 4MLPA 1E8WA 3EHQA 4F6RD 2QYUA 2DVWA 4N3AA 5JJTA 4K5CA 4L23A 3FTUA 3E33A 4ANXA 2PL2A 3L13A 3Q79A 2AVPA 2B6CA 3QOUA 5KNGA 1MYOA 2VSOE 1ZU2A 2BEDA 4IYPA 1SZ9A 2LXLA 4LERA 1HE8A 4HB5A 3T8KA 1WAO1 2P9KG 2WXNA 3OXFA 1FT2A 3CEQA 3GW4A 4JD2G 3L54A 4J8DA 3DXMG 4GCNA 3FH7A 5CRUA 4JEUA 1MHQA 4WNGA 3QAQA 2QZAA 3V79K 3DXKG 3BQOA 1SA4A 4ANWA 3FUKA 2LAHA 1JWGA 3G2UA 3Q9NC 2CHWA 3D9PA 3HIZA 3D3MA 3D9LA 3CVWA 4XKCA 2H6FA 1E90A 2YINA 3BG1B 2R03A 1HXIA 5HRYA 2OVFA 3ONLA 2R5SA 2CFZA 3Q7AA 5LX8A 4P29A 3Q5MA 1IXVA 1V55E 3SNXA 3EUVA 4GZ6A 4UI9C 4AIFA 2KZTB 2I1JA 5B1BE 3LCAA 3RSEG 3R9AB 3FUHA 3BG0B 3JXJA 3D9HA 2VTBA 1FPPA 3B7UX 3QKYA 3Q75A 2WXJA 1N0QA 4U96D 3T5VA 3LYAA 1W3BA 3EIQC 4DX7D 3L22A 4Q96A 3HXBA 3I3NA 2X6KA 3QWWA 3CKBA 3SBSA 2C0MA 1NI1A 3UMVA 3RK6A 1KPSB 4J8SA 1IYGA 2J09A 1OT8A 4I2ZA 5KJNA 2GGFA 4IN3B 3UT8A 2WB2A 4JPSA 3FTYA 1P5QA 4MRUA 4A3VA 5G2NA 2IOSA 1OUVA 2IF4A 3ZYQA 4I6EA 5KBAA 5D0OD 4A55A 4G25A 3C3RA 3LY8A 3L82A 5CEAA 1TNZA 1OY3D 3G2TA 4UWFA 2P9IG 3SFXA 1O1TA 3QARA 2Y3AA 4NQ0A 5EILA 4JA7A 1HU3A 5ANRA 4U95D 3CVPA 1HG2A 2V5FA 1H19A 4AVXA 4HORA 4GB9A 3E37A 3ZUVB 3MYVA 3PZ4A 1AP7A 2Y0BG 2XGMA 3ZXSA 2A5EA 2CG2A 4CEMA 3U64A 2H6IA 2BKKB 4G11A 3IEGA 3R7QA 2IO2C 1HZ4A 4EECA 1TJFA 3TWRA 3MZLB 3SO8A 3TG4A 2XEVA 3C5RA 3QK0A 2QC9A 1BU9A 4F53A 5FQ8A 2LAIA 5KNHD 1N0RA 5ENTD 3CVXA 2L0TB 3S2AA 5JMND 1UG3A 4XI9A 3VTXA 5CMWA 3LVRE 2P58C 1N95A 1KT1A 2ILRA 4GZ5A 1TNYA 4JL0A 5A23A 3G2SA 4GAAA 2HE0A 5BPPA 2FI7A 5EYPF 4DRXE 3MA5A 2MYOA 5AIJA 3CQCB 5FQ6A 2P9UG 3EU9A 3WG7E 3QNKA 2LXMA 3ONKA 4BY6A 3UT4A 3T5XA 3AU5A 4FP7A 3CHMA 4UWHA 2ZXWE 3V30A 4PH4B 2AXUA 3CK7A 3NAWA 4ILIA 5FJYA 4G8KA 3RKVA 2P2CP 4GCOA 3UXGA 5CRVA 4URKA 3S7JA 4HOTA 4JHJA 3FH5A 2P9NG 3O48A 1E96B 3N71A 1QYMA 5JJ6A 2X6FA 4AOFA 2VGXB 3SBTB 5AENA 2J9QA 4GZDA 4DLOA 3EIJA 5CEDB 3FTWA 4AM9A 2EILE 4I17A 1DCQA 2Q7FA 2V5QC 1N4QA 4RG9A 3TXNA 5E76A 4BT9A 3Q9UC 4LRZA 4I43A 3MV2B 2ETBA 2LUHA 4QFVA 3UKRG 5A7DB 3PZ3A 3NZUA 3ZHEA 1JWFA 3MGBA 2WQ6A 5JA4D 4CZ2D 4OVUA 2ZISA 2OV8A 3MCXA 2VJ8A 5AARA 3D9OA 3HXFA 1WY6A 1K1AA 2AXZA 2ETAA 3CKCA 3LKUA 4AY6A 4E85A 4N5CA 5AAOA 1LF8A 4XKBA 4B8AA 1K8KG 4BX9A 4F3VA 1DNPA 4HI9A 2KCVA 3NB2A 1JPLA 3LS8A 2RFMA 4U8YD 1OWLA 1ELWA 1D9SA 1H6OA 1O1SA 3DSTA 4GU5A 3FUDA 1OWPA 2VSYA 3U4TA 4G1TA 4AXHA 4LNUD 3B95A 3OXGA 3EHNA 1S64A 1N4PA 1U3DA 1ELRA 3G2VA 2H6HA 1OCOE 1IHGA 3AS4A 3TGOA 3B7TA 2IONA 1NA0A 5ENRD 4Y6WA 4G26A 3MKQA 5KJLA 2EIKE 1YYHA 4BWRA 2WXHA 4HFGA 4K5BA 4FHJA 3APDA 3NOGD 4BERA 4JHRA 3FU0A 3S7BA 3PS6A 4UI9K 1INZA 2WXKA 3UKUG 2YQ8A 4ATGA 3ZFWA 4MBGA 1H2TC 4PS8A 3KAEA 1QBQA 5EX3A 2UWJG 2JLBA 3QWPA 1H0AA 4WUYA 1TYQG 3TWWA 3B7BA 2VSXE 1OCZE 2DYRE 3RO3A 3TL5A 4CCAA 1QNFA 4PDXA 5FT9A 3ASFA 3PDNA 3JYSA 1H6PA 3FFLA 5G05C 5KWDA 4U0SA 3ABME 1SQMA 3DPDA 2C2LA 3TG5A 5DIZA 4FULA 3ASOE 3KEAA 5B1AE 3FU6A 3E32A 3VTYA 4G8LA 3LY9A 5D2MC 4UQXA 3GZ1A 3DEPA 3OXLA 2QFCA 1HG5A 4GA0A 3R9MA 4FLBA 4UI9J 3D9JA 3QWVA 2IO3C 2GW1A 2PNNA 1UN9A 3ZIMA 3MKRA 1HF8A 3PZDA 1K3ZD 4FHKA 3O4ZA 3RAUA 4LUNU 1HO8A 1UW4B 3V2OA 5J90A 1A17A 1UJKA 3CHSA 3CLJA 1BLXB 3AS5A 5EIDA 3HYMB 4AY5A 2BUGA 4X8QA 3ZEFA 4L1BA 5BW8C 3ZYMA 1Z6TA 3E30A 4AP2A 1V54E 2NC9A 4K0RA 4HRNA 3CVUA 1JCQA 1N4RA 1S0PA 2AJAA 4F7AA 4HRLA 3PH0C 4N3BA 3QDNA 1H6KA 1KZPA 4EBAA 1B89A 3FTVA 2C0LA 4TUUA 3ZPJA 5HQ8A 2GRQB 4A63B 2GRLA 3KEZA 2PQRA 1E8XA 3C98A 3FULA 3I4GA 3URZA 2YNQA 4B94A 2PM6A 2XPZA 1Z3XA 4DK5A 1KT0A 2KATA 3FUEA 1U2VG 3W9FA 3FU3A 4H7YA 4RLYA 4AJWA 2H6GA 4UQZA 4EZJA 3S7DA 3I5PA 4GTTA 4KVMA 2F37A 3CHPA 5FQ7A 1FT1A 2VTBB 2XHEA 1H2VC 1X81A 5EKQD 4JC8A 4B0ZA 3AAAC 2VGEA 5AQAA 1HS6A 4EPZA 3AS8A 1UN8A 3UIPC 2WQ7A 4L9PA 3UIOC 4V3IA 4KVOA 4IULA 5LCWC 3JCKC 2PQNA 1OCCE 4G24A 4TXRA 4UWGA 3SI5A 3DBSA 3ASGA 2WXFA 3ULQA 2V4HC 3ISMC 5HS0A 3SGHA 2WXMA 3ASHA 4GTPA 1ELKA 3EHRA 3NF1A 5EDSA 1OCRE 4WNEA 3ZU7B 4HNAD 4O6FA 4A3TA 5ITZF 3Q49B 4GMLA 4N2QA 1WG0A 3DRAA 1DCEA 4CDMA 4Q94A 1PC2A 3C72A 4Z68A 5BV1A 4KT6B 4OAUC 3AU4A 2X6HA 2R2LA 4GTQA 2YHCA 3CIAA 1QQEA 5T3RA 2MHKA 2J4DA 3FWVA 2P9PG 5EX0A 1EDUA 3IHYA 1U3CA 5C1DA 2RFAA 5BV0A 3FTSA 4J8FA 3U9WA 5AQ7A 2BF0X 2L0IA 4M3OA 1TNBA 3C3QA 4CDNA 4DUIA 4UQYA 2X6JA 2ZIRA 4N5QA 4HLEA 4EZKA 4A1SA 5KCMA 3IKOB 2XGOA 3JUIA 4HXIA 3D9KA 3HVEB 4YNDA 4WAFA 2CG3A 3TWSA 2Y4UA 4C0MA 3L08A 1D8DA 5HKPA 1K1BA 3AJIA 1LD8A 2WQHA 3PRZA 2UY1A 2WXOA 4U7EB 2IFUA 2XQ0A 3PZ2A 3NZSA 3CVVA 3IHVA 5C2YA 4GMRA 1PAQA 2A5UA 4HOQA 3T8MA 3J5QB 5LFAA 1N94A 2E2EA 4DX5D 3QJZA 4HRMB 1QZ2A 4MKTA 1GW6A 3FH8A 4DJAA 3P2BA 4OYSA 3ULYA 1S63A 1HH8A 1NFIE 4YVOA 5D66A 5KJKA 3OTNA 4FJZA 4UWKA 3LDZA 1H2UA 3ESLA 1TNUA 3U3WA 3DEOA 4J8EA 2Y1LE 3PUKA 4NACA 3CV0A 2L6BA 4TV3A 2XEEA 2MOWA 5KJMA 2FBNA 5AN8A 1HFAA 1A5EA 3Q15A 3CSFA 5H7PA 3HXDA 2I6HA 3L17A 3ZRHA 4CT4A 1WDYA 4F1PA 3P1UA 1MX6A 5ANLA 1E7UA 1Z3YA 4RQIA 4U04A 4PS7A 4DI4A 4W9RA 5EN5D 3HXEA 2LSVA 4WNFA 2P9SG 3MV3B 2IOLA 2V0PA 5DBKA 3SZ7A 3CHRA 3SF4A 1ZB1A 4HI8A 2HYZA 2I2OA 2LO6A 4J0UA 4BSXA 4DPRA 5FZRA 2GROB 3TJPA 1YCSB 4HOUA 1S70B 1FVFA 1XGWA 4ZHBA 4CGWA 2J08A 3KD7A 1EF1C 2M63A 5ENNA 2LNIA 3EJNA 3X2QE 3UINC 1Y6IA 3BEEA 3L6AA 3HG0D 3Q47B 4U8HA 2XGSA 3ZYLA 2KCLA 3DSWA 3FU5A 3BU8A 3AG3E 3FEYA 5FINA 1UJJA 1KLXA 4BESA 2R59A 1E8YA 3RRMB 5G05J 4BTBA 3F6QA 3TAXA 3CK8A 4EQFA 2OOEA 3UX4A 2VSNA 2IJGX 2FULA 3ZGQA 1EPUA 4FADA 4BETA 3FUJA 1PY1A 5AQBA 4L2YA 3EU5A 3FHEA 5LP0A 3SY2A 3GZSA 3FDHA 2EIJE 4BT8A 3FP3A 3UUXA 3ML9A 4JEHA 5HI7A 4K03A 2FO1E 2GRNB 4KZ0A 4RSYA 3PNLB 1FCHA 3ZKJA 2NYJA 3D9NA 4G2VA 2EQXA 4HS2A 1RW2A 2HO1A 2J8SD 3ABKE 4Q69A 3SQVA 3MKQB 4XZ4A 1L5JA 2KC7A 1LD7A 3R7RA 3IBEA 4JW1A 3I4RB 4I6GA 4AV7A 3ZW3A 2F8YA 3NQPA 5FWQA 3UQ3A 3KS2A 5AJLA 4YDYA 2AXVA 2OCCE 5FTPA 3UM2A 1IQUA 3JXIA 1TN6A 4EBAG 3PNTB 1N52A 2I9CA 1EYHA 2WMNA 4GA1A 1TN7A 5AQ9A 2F0YA 3KSQA 5FIOA 3B13A 3LY7A 3FUNA 1NP7A 4ME2A 2IU1A 1FVHA 3TWVA 3UM1A 4M7CA 4ACKA 4GPMA 2CHXA 3MX3A 1IKND 3PREA 2X38A 3PE4A 4I9CA 4KMOA 2DYSE 2VQ2A 5JJ7A 4ILHB 4O1OA 4U8VD 3ASDA 3C3OA 2J07A 4F1SA 1Y8MA 5FZQA 2OEVA 3TXMA 3DWLG 4JHKA 4DX1A 1DC2A 4YVQC 3LEWA 3SHFA 4ACLA 5J08A 3LXUX 1BD8A 2KZTA 3TWQA 5G04C 2QY7A 5CBNA 3G2WA 2WM9A 2DCPA 2FO7A 3NOCD 5G55A 2JABA 2CFUA 3L9TA 2EINE 3RRNB 2ZGGA 4CGVA 4DX6D 1MJ0A 2AWIA 2E0IA 2WVIA 4I1OB 3IXEA 1NZNA 4A1GA 5EYLA 4I2WA 4WWPA 4KYOB 5LCWJ 4XEIG 4UUCA 2R17C 3HRAA 4MS6A 1IHBA 4J7WA 1NL4A 5CHEE 3E34A 4YDWA 3QB2A 4KXKB 4G23A 5CMYA 4JA9A 2J49A 4AEZC 2RKKA 3APCA 3DSSA 5M72A 2MRIA 4WWNA 2PM7A 3Q4AB 4TXQA 2X6IA 1N54A 2WXGA 4FLHA 5ENPD 4ZFHA 4OVVA 4ILGA 1OWNA 3CK9A 2WXPA 3ML8A 3S7FA 3IV0A 2I1KA 3CSTA 4GTVA 2DZNA 1Q2ZA 4GYYA 3CVYA 4GZ3A 3PVLA 1ZBPA 2OEWA 5CBOA 3Q73A 2IEJA 3FY4A 4I1MA 4KBQA 2ZGDA 4BX8A 3WXXA 3PEVB 3CHOA 1JCSA 1WM5A 3ZXPA 2RG8A 3BUAA 3PUJA 3CQGB 3AG4E 2AW6A 4QQIA 2KBXA 4FJYA 3UT7A 4LCTA 4JB8P 2OVBA 3Q7FA 4APFA 1SZAA 1MZCA 4J8YA 1JCRA 2XZTG 1TR4A 3PEUB 3LJNA 3RU0A 3UPVA 3UI2A 2A4ZA 4GTRA 5A6CA 4NRHB 2WXQA 1TEZA 1SW6A 1OXJA 3EHMA 4CYMD 4C9BB 2NSZA 3SFZA 5D0QD 5T4YA 2XPIA 2KCKA 4YDEA 3DSUA 4XX5A 3T9KA 5AJDA 2VYIA 2DZOA 3QC1A 3ENEA 1OWMA 4L7TA 3FEXA 2WMOA 1TNOA 4LNBA 4O1PA 5T8IA 1OWOA 4LG6A 4RVBA 2P9LG 5BXOA 4DLQA 2XS8A 3HVEA 4JVSA 2DWZA 3CR3A 2XENA 3RO2A 1KZOA 3GZ2A 2JEKA 2ZU6B 4GA2A 4WNDA 4TXPA 4CRWA 5JHBA 1IQRA 1LTXA 4HQDA 2FEZA 4GYOA 3SFYA 5IY5E 2L9BA 4PUCA 2HM8A 4CDRA 1BI7B 3FUMA 3LPZA 2GRPB 1TJCA 1NA3A 2CHZA 3UM0A 3APFA 1G3NB 2YHEA 2XCBA 3RJVA 3TWTA 2B0OE 3GYZA 2XPYA 3AG2E 5LOZA 3NBNB 3DPYA 3TWXA 5CCMA 4D10C 1AWCB 5BXUA 3VLFA 5BT1A 5FZSA 4N2SA 4BEPA 4ANUA 5ENQD 3SD5A 2VGXA 4BTAA 2Y4TA 2GRMA 1HX8A 4E6HA 5AYWD 4KZCA 4APOA 2QYJA 3OAWA 3ZYKA 4HLLA 4B89A 3ABLE 2KM4A 3K9IA 4B8CB 1TN8A 3JQ0A 2UY1B 2J4BA 3AG1E 3UM3A 4OAVB 4L2LA 2VGYA 2V4LA 4YDOA 3D9MA 4DI3A 1YMPA 2L6JA 1YA0A 4ANVA 3B7RL 2LSUA 2DIWA 3MJWA 2XZDG 4EHMA 1BI8B 1E8ZA 4FC8A 3J5PA 1D8EA 1O1RA 1VDYA 4I9EA 3VLEA 4BSZB 3U66A 4HBDA 1JUQA 5CECB 2WPVA 3KSLA 1MX4A 4EZLA 1DVPA 4JXTA 3CGHA 1SVXA 4UWLA 5FQ4A 3JUEA 3FTXA 3HXCA 2GRRB 3V2XA 4J6IA 3HHMA 1Z5SC 3RRUA 4TRQA 4JZYA 2XRZA 4FU3A
chains in the Genus database with same CATH topology
1Z3XA 2L0TB 3S2AA 4EBAG 1MQSA 3HDXA 4U0UA 3ZVVA 1UG3A 3PNTB 4DK5A 1N52A 2I9CA 1EYHA 4XI9A 2WMNA 3FUFA 4GA1A 1KT0A 2KATA 3VTXA 3FUEA 3FU3A 4H7YA 5CMWA 3LVRE 4AJWA 4UQZA 4EZJA 3S7DA 3I5PA 2P58C 4FA6A 1KT1A 3B13A 2XCCA 2ILRA 3LY7A 4GZ5A 3FUNA 4KVMA 5ARFA 5A23A 4JL0A 4HOSA 1NP7A 3CHPA 3PE3A 3G2SA 4ME2A 5CCLA 4GAAA 5FQ7A 2VTBB 2XHEA 5BPPA 2IU1A 1FVHA 3CVNA 3ESKA 2FI7A 3MA5A 1H2VC 5AIJA 3ZHEB 5EKQD 3CQCB 5ARGA 4ACKA 4JC8A 5FQ6A 4C0EA 4B0ZA 3FTZA 3FUIA 3JQ1A 2BTDA 1HS6A 2CHXA 3MX3A 3AS8A 4EPZA 3PREA 1UN8A 2X38A 3PE4A 3QNKA 4I9CA 2WQ7A 4KMOA 4V3IA 4I6JA 4KVOA 4IULA 2XRYA 3ONKA 2VQ2A 5JJ7A 4ILHB 5LCWC 3JCKC 4BY6A 2PQNA 5BNWA 3ASDA 4XIFA 3LVQE 2J07A 4G24A 4F1SA 3UT4A 1X5BA 4UWGA 3T5XA 1Y8MA 3AU5A 3SI5A 3ZN3A 4FP7A 3DBSA 3CHMA 5FZQA 3TXMA 4UWHA 4JHKA 1BPOA 4I1AA 3ASGA 4PH4B 2AXUA 2WXFA 4WWOA 3ULQA 3CK7A 2X3MA 2IQCA 3SGHA 5FJYA 4ILIA 2WXMA 3ASHA 3RKVA 4YVQC 1ELKA 1E7VA 2HR2A 3LEWA 4GCOA 3NF1A 4GMJA 5EDSA 4XI0A 3SHFA 4URKA 4WNEA 4ACLA 3S7JA 5J08A 4HVBA 3LXUX 2NXPA 4HOTA 4JHJA 3FH5A 2WXLA 2KZTA 3O48A 5G04C 4O6FA 4Y6CA 1E96B 4A3TA 4GZCA 3N71A 5JJ6A 2QY7A 2X6FA 3Q49B 3G2WA 4AOFA 2WM9A 4GMLA 4N2QA 2ONDA 4ABNA 2VGXB 2DCPA 4PS3A 3SBTB 2FO7A 2RD0A 5AENA 5G55A 2J9QA 4GPKA 2CFUA 2WXRA 4GZDA 4U07A 2V8SE 4R7LA 3RRNB 4DLOA 4XE0A 4CGVA 3EIJA 3CVLA 4CDMA 2AWIA 4Q94A 1PC2A 3FTWA 2E0IA 2WVIA 4I1OB 4AM9A 5BV1A 1NZNA 4I17A 4A1GA 3CVQA 4KT6B 4I2WA 4RG6A 4WWPA 3E4BA 3AU4A 4GYWA 4KYOB 5LCWJ 2Q7FA 2X6HA 2R17C 4RG9A 4N3CA 3TXNA 2YHCA 2FF4A 1QQEA 3CIAA 3MEKA 2MHKA 5T3RA 3L16A 2J4DA 3FWVA 5EX0A 5E76A 4MS6A 1EDUA 4LEUA 3CHQA 4BT9A 5CHEE 3QB2A 3IHYA 4KXKB 4G23A 5CMYA 1U3CA 5C1DA 4JA9A 4BFRA 2J49A 4AEZC 3APCA 4H7XA 5BV0A 5M72A 4LRZA 2MRIA 3FTSA 4J8FA 4U0ZA 3U9WA 2BF0X 4I43A 3MV2B 2L0IA 2PM7A 4M3OA 4WWNA 4NURA 4QFVA 3B7SA 3Q4AB 4N39A 5A7DB 2X6IA 1N54A 3NZUA 5G04J 3ZHEA 4CDNA 1JWFA 2WXGA 2X6JA 3MGBA 4FLHA 4UQYA 2WQ6A 3D9IA 4HLEA 4OVVA 4OVUA 4A1SA 4EZKA 5KCMA 2PZIA 2DBAA 3IKOB 2XGOA 3JUIA 1OWNA 4ILGA 3CK9A 5BUZA 2WXPA 3ML8A 2OV8A 3S7FA 3EDTB 3IV0A 4HXIA 2I1KA 3CSTA 3VLDA 3D9KA 3MCXA 2VJ8A 3HVEB 4YNDA 4GYYA 4WAFA 2CG3A 3D9OA 5JHAA 4CT0A 3CVYA 2Y4UA 4GZ3A 4C0MA 1WY6A 3RIBA 2AXZA 3PVLA 1ZBPA 3CKCA 3L08A 3LKUA 5E75A 3LJ3A 4E85A 4AY6A 4N5CA 1XNFA 2WXIA 4U63A 1LF8A 4XKBA 4B8AA 4IRUA 2WQHA 3PRZA 3FY4A 4BX9A 4MLPA 1E8WA 4F3VA 2UY1A 4I1MA 2WXOA 1DNPA 2IFUA 4KBQA 2KCVA 1JPLA 2XQ0A 3LS8A 4BX8A 3WXXA 1OWLA 3PEVB 3CHOA 4N3AA 3NZSA 5JJTA 1ELWA 3CVVA 3IHVA 4L23A 3FTUA 4ANXA 1WM5A 2PL2A 5C2YA 1PAQA 4GU5A 2RG8A 3FUDA 3L13A 3PUJA 1OWPA 2AVPA 2A5UA 4HOQA 3T8MA 3CQGB 5LFAA 2VSYA 3U4TA 4G1TA 3QOUA 4AXHA 2E2EA 2AW6A 2VSOE 1ZU2A 4FJYA 3QJZA 3OXGA 1SZ9A 4IYPA 4LERA 3UT7A 1HE8A 3EHNA 1QZ2A 4LCTA 4MKTA 1GW6A 2OVBA 3FH8A 1WAO1 1U3DA 1ELRA 3G2VA 2WXNA 4APFA 4DJAA 3OXFA 3P2BA 4OYSA 1SZAA 3CEQA 1IHGA 3AS4A 3GW4A 3PEUB 3TGOA 3L54A 4J8DA 3RU0A 3UPVA 1HH8A 3B7TA 2A4ZA 4GCNA 2IONA 1NA0A 5A6CA 4NRHB 2WXQA 3FH7A 4YVOA 1TEZA 4Y6WA 4G26A 3MKQA 1MHQA 4JEUA 5KJKA 3OTNA 4WNGA 4FJZA 4UWKA 5KJLA 3EHMA 4BWRA 2WXHA 3LDZA 4HFGA 4C9BB 2NSZA 3SFZA 1H2UA 3ESLA 3QAQA 5D0QD 3U3WA 4FHJA 4J8EA 5T4YA 4ANWA 3APDA 3FUKA 2XPIA 2LAHA 1JWGA 2KCKA 3G2UA 2CHWA 4JHRA 3FU0A 3D9PA 3HIZA 3D3MA 4B94A 3S7BA 3D9LA 3PUKA 3PS6A 4NACA 4UI9K 4XX5A 3CV0A 1INZA 4TV3A 5AJDA 3CVWA 2MOWA 2VYIA 2WXKA 4XKCA 2YQ8A 4ATGA 1E90A 5KJMA 3ZFWA 2FBNA 2YINA 1HFAA 3BG1B 1OWMA 3ENEA 1HXIA 3QC1A 4L7TA 3FEXA 3CSFA 3Q15A 2OVFA 2WMOA 2R5SA 1H2TC 3ONLA 2CFZA 5LX8A 4P29A 4PS8A 5T8IA 3Q5MA 2I6HA 3L17A 3ZRHA 4CT4A 1OWOA 4RVBA 3KAEA 5EX3A 3SNXA 2UWJG 4GZ6A 4UI9C 4AIFA 2JLBA 4DLQA 2KZTB 3P1UA 1H0AA 2I1JA 3QWPA 4WUYA 5ANLA 1E7UA 1Z3YA 3LCAA 3HVEA 2VSXE 4JVSA 4U04A 3R9AB 3FUHA 3RO3A 3BG0B 3CR3A 4PS7A 3TL5A 4CCAA 4DI4A 1QNFA 4PDXA 3RO2A 2VTBA 3GZ2A 4W9RA 3B7UX 2JEKA 3QKYA 2ZU6B 2WXJA 4GA2A 4WNDA 5FT9A 3ASFA 2LSVA 3PDNA 3JYSA 4CRWA 5JHBA 4WNFA 1IQRA 3FFLA 3T5VA 3LYAA 2FEZA 2IOLA 2V0PA 3MV3B 4GYOA 5G05C 4U0SA 1W3BA 5DBKA 2L9BA 1SQMA 3DPDA 3SZ7A 2C2LA 3EIQC 4PUCA 2HM8A 3CHRA 3SF4A 3L22A 5DIZA 3TG5A 4Q96A 4CDRA 3FUMA 3LPZA 3I3NA 4FULA 2HYZA 2I2OA 2X6KA 3QWWA 2LO6A 4J0UA 4BSXA 3FU6A 4DPRA 1TJCA 3CKBA 1NA3A 5FZRA 2CHZA 3SBSA 3APFA 3TJPA 2C0MA 2YHEA 3VTYA 4HOUA 3UMVA 3RK6A 2XCBA 4J8SA 3RJVA 3LY9A 1IYGA 3GYZA 2XPYA 1FVFA 1XGWA 4CGWA 5LOZA 2J08A 2J09A 3GZ1A 4I2ZA 4UQXA 3KD7A 5KJNA 1EF1C 3OXLA 2QFCA 2M63A 5ENNA 2LNIA 3EJNA 1HG5A 4GA0A 5CCMA 4D10C 4FLBA 3VLFA 4UI9J 5BT1A 3D9JA 2GGFA 1Y6IA 3BEEA 3L6AA 3Q47B 3QWVA 4IN3B 5FZSA 4N2SA 4U8HA 2XGSA 2GW1A 3UT8A 2WB2A 4JPSA 1UN9A 3ZIMA 3MKRA 3ZYLA 2KCLA 3FU5A 4ANUA 1HF8A 3SD5A 3FTYA 2VGXA 4BTAA 2Y4TA 2GRMA 1HX8A 1P5QA 3PZDA 4E6HA 5AYWD 4MRUA 4A3VA 3FEYA 4FHKA 3O4ZA 5G2NA 4KZCA 1UJJA 4APOA 4LUNU 1KLXA 2IOSA 1HO8A 1UW4B 5J90A 2R59A 1E8YA 1A17A 1OUVA 1UJKA 3CHSA 3RRMB 2IF4A 5G05J 3ZYQA 3OAWA 4BTBA 3CLJA 3ZYKA 3TAXA 4I6EA 4B89A 3CK8A 3AS5A 3K9IA 2KM4A 4B8CB 5D0OD 4EQFA 3HYMB 3JQ0A 4AY5A 4A55A 2OOEA 2UY1B 2VSNA 3UX4A 2IJGX 4G25A 2FULA 3ZGQA 2BUGA 1EPUA 2J4BA 4FADA 3ZEFA 4L1BA 3LY8A 5BW8C 3FUJA 4L2LA 2VGYA 1PY1A 2V4LA 3ZYMA 3G2TA 4UWFA 1Z6TA 3QARA 4L2YA 3FHEA 5LP0A 2Y3AA 4NQ0A 3D9MA 4JA7A 1HU3A 3FDHA 3GZSA 5ANRA 4AP2A 3CVPA 4DI3A 4BT8A 2L6JA 3FP3A 1HG2A 3UUXA 2V5FA 2NC9A 4K0RA 1YA0A 3ML9A 4ANVA 3B7RL 2LSUA 1H19A 4JEHA 5HI7A 2DIWA 4AVXA 3MJWA 4K03A 4HORA 4GB9A 4KZ0A 4RSYA 3MYVA 3PNLB 1FCHA 3CVUA 1E8ZA 4FC8A 3D9NA 1VDYA 2EQXA 2XGMA 4G2VA 4HS2A 4I9EA 3VLEA 1S0PA 3ZXSA 4F7AA 3U66A 2CG2A 1JUQA 2HO1A 2WPVA 3PH0C 4N3BA 4CEMA 3QDNA 1H6KA 3U64A 4EZLA 4EBAA 1DVPA 4Q69A 4JXTA 4G11A 3IEGA 3MKQB 3R7QA 3CGHA 4UWLA 5FQ4A 4XZ4A 1L5JA 1HZ4A 4EECA 2KC7A 3R7RA 3IBEA 4JW1A 1B89A 1TJFA 3MZLB 3I4RB 4I6GA 3FTVA 3FTXA 2C0LA 3TG4A 2XEVA 4AV7A 3ZW3A 4J6IA 3NQPA 3HHMA 3QK0A 4TUUA 3ZPJA 4F53A 5HQ8A 5FWQA 3RRUA 2GRLA 3UQ3A 3KEZA 4TRQA 2PQRA 1E8XA 2LAIA 5FQ8A 3C98A 3KS2A 5AJLA 4JZYA 3FULA 3I4GA 2XRZA 4FU3A 3URZA 2AXVA 5FTPA 1IQUA 3CVXA 2YNQA 2PM6A 2XPZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U0U A;  4XI9 A;  4GA1 A;  1KT0 A;  2KAT A;  3VTX A;  4H7Y A;  4UQZ A;  3S7D A;  2P58 C;  1KT1 A;  2XCC A;  3LY7 A;  4GZ5 A;  5ARF A;  4JL0 A;  4HOS A;  3PE3 A;  4ME2 A;  5CCL A;  3CVN A;  3ESK A;  2FI7 A;  3MA5 A;  3ZHE B;  5EKQ D;  5ARG A;  3AS8 A;  3PE4 A;  4I9C A;  2VQ2 A;  5JJ7 A;  5LCW C;  2PQN A;  5BNW A;  3ASD A;  4XIF A;  4G24 A;  3ZN3 A;  1Y8M A;  5FZQ A;  4I1A A;  3ASG A;  3ULQ A;  3CK7 A;  5FJY A;  3ASH A;  3RKV A;  4YVQ C;  2HR2 A;  4GCO A;  3NF1 A;  4XI0 A;  4WNE A;  3S7J A;  4HOT A;  3O48 A;  5G04 C;  4O6F A;  4Y6C A;  1E96 B;  3N71 A;  5JJ6 A;  3Q49 B;  4N2Q A;  2OND A;  4ABN A;  2VGX B;  2FO7 A;  2J9Q A;  4GPK A;  4U07 A;  4CGV A;  3CVL A;  1PC2 A;  4AM9 A;  1NZN A;  4I17 A;  3CVQ A;  4I2W A;  4RG6 A;  3E4B A;  4KYO B;  4GYW A;  5LCW J;  2Q7F A;  4RG9 A;  4N3C A;  2YHC A;  2FF4 A;  1QQE A;  3MEK A;  2MHK A;  3FWV A;  5EX0 A;  4LEU A;  4BT9 A;  5CHE E;  4KXK B;  4G23 A;  5C1D A;  4JA9 A;  4H7X A;  5M72 A;  4J8F A;  4U0Z A;  3MV2 B;  3Q4A B;  4N39 A;  5A7D B;  5G04 J;  3ZHE A;  4UQY A;  4A1S A;  2PZI A;  2DBA A;  2XGO A;  3CK9 A;  3S7F A;  3EDT B;  4YND A;  4GYY A;  2Y4U A;  4GZ3 A;  3RIB A;  1ZBP A;  3CKC A;  3LKU A;  4AY6 A;  4N5C A;  1XNF A;  2WQH A;  4F3V A;  2UY1 A;  4KBQ A;  2IFU A;  2KCV A;  3WXX A;  4N3A A;  5JJT A;  1ELW A;  1WM5 A;  2PL2 A;  2AVP A;  4HOQ A;  2VSY A;  3U4T A;  4G1T A;  3QOU A;  2E2E A;  1ZU2 A;  3OXG A;  1QZ2 A;  1WAO 1;  1ELR A;  3OXF A;  3CEQ A;  1IHG A;  3AS4 A;  3GW4 A;  3TGO A;  4J8D A;  3RU0 A;  3UPV A;  1HH8 A;  4GCN A;  1NA0 A;  5A6C A;  4NRH B;  4YVO A;  4Y6W A;  4G26 A;  5KJK A;  4WNG A;  5KJL A;  4BWR A;  5D0Q D;  3U3W A;  4J8E A;  2XPI A;  2KCK A;  4JHR A;  3S7B A;  4UI9 K;  3CV0 A;  2VYI A;  2YQ8 A;  5KJM A;  3ZFW A;  2FBN A;  1HXI A;  3Q15 A;  2R5S A;  3Q5M A;  2I6H A;  3KAE A;  5EX3 A;  2UWJ G;  4GZ6 A;  4UI9 C;  4AIF A;  2JLB A;  3QWP A;  4WUY A;  3LCA A;  4U04 A;  3R9A B;  3RO3 A;  3RO2 A;  3GZ2 A;  4W9R A;  3QKY A;  4GA2 A;  4WND A;  5FT9 A;  3ASF A;  2LSV A;  3PDN A;  3JYS A;  4WNF A;  3FFL A;  3LYA A;  2FEZ A;  3MV3 B;  4GYO A;  5G05 C;  4U0S A;  1W3B A;  5DBK A;  3SZ7 A;  2C2L A;  3SF4 A;  3TG5 A;  5DIZ A;  4CDR A;  3LPZ A;  2HYZ A;  3QWW A;  4J0U A;  1TJC A;  3CKB A;  1NA3 A;  5FZR A;  2C0M A;  3VTY A;  4HOU A;  2XCB A;  3RJV A;  3LY9 A;  1IYG A;  3GYZ A;  4CGW A;  4I2Z A;  4UQX A;  3GZ1 A;  3KD7 A;  5KJN A;  3OXL A;  2QFC A;  2LNI A;  4GA0 A;  5CCM A;  4UI9 J;  5BT1 A;  3BEE A;  3QWV A;  3Q47 B;  4IN3 B;  5FZS A;  4N2S A;  2XGS A;  2GW1 A;  3MKR A;  2KCL A;  2VGX A;  4BTA A;  2Y4T A;  1P5Q A;  5AYW D;  4APO A;  1KLX A;  1A17 A;  1OUV A;  2IF4 A;  5G05 J;  4BTB A;  3TAX A;  3CK8 A;  3AS5 A;  3K9I A;  4EQF A;  5D0O D;  3HYM B;  4AY5 A;  2OOE A;  2UY1 B;  2VSN A;  4G25 A;  3ZGQ A;  2BUG A;  3LY8 A;  5BW8 C;  2VGY A;  4NQ0 A;  4JA7 A;  3CVP A;  4BT8 A;  2L6J A;  3FP3 A;  3UUX A;  2V5F A;  2NC9 A;  1YA0 A;  2LSU A;  5HI7 A;  4HOR A;  1FCH A;  2XGM A;  4G2V A;  4I9E A;  2HO1 A;  2WPV A;  4N3B A;  3QDN A;  3IEG A;  1HZ4 A;  2KC7 A;  1B89 A;  2C0L A;  3TG4 A;  2XEV A;  3ZPJ A;  5HQ8 A;  3UQ3 A;  2PQR A;  3KS2 A;  3URZ A;  5FTP A;  4B94 A; 
#chains in the Genus database with same CATH topology
 1MQS A;  3HDX A;  4U0U A;  2ETC A;  3ZVV A;  2F8X K;  3FUF A;  1N11 A;  4LNG A;  4ATZ D;  4FA6 A;  2XCC A;  5ARF A;  4HOS A;  3PE3 A;  5CCL A;  3V31 A;  1MX2 A;  3CVN A;  5ENO D;  3ESK A;  1UOH A;  3ZHE B;  5ARG A;  4DX2 A;  4C0E A;  2IY0 C;  3FTZ A;  3FUI A;  3JQ1 A;  2BTD A;  2R02 A;  2XS1 A;  2KXP C;  4I6J A;  2XRY A;  1SA5 A;  5BNW A;  5CER B;  3ASN E;  3LVQ E;  4XIF A;  1X5B A;  3ZN3 A;  3PZ1 A;  4K5A B;  3ULE G;  5EIB E;  1BPO A;  4I1A A;  4WWO A;  2X3M A;  2IQC A;  4GTO A;  1E7V A;  2HR2 A;  4GMJ A;  4XI0 A;  4O60 A;  4HVB A;  2NXP A;  2WXL A;  4Y6C A;  4GZC A;  2Y69 E;  2OND A;  4ABN A;  2XEH A;  4PS3 A;  2RD0 A;  4GPK A;  4C48 B;  2WXR A;  4U07 A;  2V8S E;  4R7L A;  4XE0 A;  3DSV A;  3CVL A;  1N4S A;  1RZ4 A;  3CVQ A;  4RG6 A;  3E4B A;  4GYW A;  4GTM A;  4N3C A;  2FF4 A;  3MEK A;  3L16 A;  2BKG A;  4LEU A;  3CHQ A;  3W9G A;  4B93 B;  1O5M A;  2EIM E;  4GTS A;  4BFR A;  4H7X A;  3TWU A;  4U0Z A;  2R05 A;  3ZNG A;  4NUR A;  3B7S A;  4N39 A;  1N9A A;  5G04 J;  3D9I A;  2PZI A;  2DBA A;  5BUZ A;  4LSZ E;  3EDT B;  3VLD A;  5JHA A;  4CT0 A;  4TUM A;  3RIB A;  5E75 A;  3DSX A;  3LJ3 A;  5B3S E;  4NIK A;  1XNF A;  2WXI A;  4U63 A;  5ENS D;  4IRU A;  3Q78 A;  3UTM A;  4MLP A;  1E8W A;  3EHQ A;  4F6R D;  2QYU A;  2DVW A;  4N3A A;  5JJT A;  4K5C A;  4L23 A;  3FTU A;  3E33 A;  4ANX A;  2PL2 A;  3L13 A;  3Q79 A;  2AVP A;  2B6C A;  3QOU A;  5KNG A;  1MYO A;  2VSO E;  1ZU2 A;  2BED A;  4IYP A;  1SZ9 A;  2LXL A;  4LER A;  1HE8 A;  4HB5 A;  3T8K A;  1WAO 1;  2P9K G;  2WXN A;  3OXF A;  1FT2 A;  3CEQ A;  3GW4 A;  4JD2 G;  3L54 A;  4J8D A;  3DXM G;  4GCN A;  3FH7 A;  5CRU A;  4JEU A;  1MHQ A;  4WNG A;  3QAQ A;  2QZA A;  3V79 K;  3DXK G;  3BQO A;  1SA4 A;  4ANW A;  3FUK A;  2LAH A;  1JWG A;  3G2U A;  3Q9N C;  2CHW A;  3D9P A;  3HIZ A;  3D3M A;  3D9L A;  3CVW A;  4XKC A;  2H6F A;  1E90 A;  2YIN A;  3BG1 B;  2R03 A;  1HXI A;  5HRY A;  2OVF A;  3ONL A;  2R5S A;  2CFZ A;  3Q7A A;  5LX8 A;  4P29 A;  3Q5M A;  1IXV A;  1V55 E;  3SNX A;  3EUV A;  4GZ6 A;  4UI9 C;  4AIF A;  2KZT B;  2I1J A;  5B1B E;  3LCA A;  3RSE G;  3R9A B;  3FUH A;  3BG0 B;  3JXJ A;  3D9H A;  2VTB A;  1FPP A;  3B7U X;  3QKY A;  3Q75 A;  2WXJ A;  1N0Q A;  4U96 D;  3T5V A;  3LYA A;  1W3B A;  3EIQ C;  4DX7 D;  3L22 A;  4Q96 A;  3HXB A;  3I3N A;  2X6K A;  3QWW A;  3CKB A;  3SBS A;  2C0M A;  1NI1 A;  3UMV A;  3RK6 A;  1KPS B;  4J8S A;  1IYG A;  2J09 A;  1OT8 A;  4I2Z A;  5KJN A;  2GGF A;  4IN3 B;  3UT8 A;  2WB2 A;  4JPS A;  3FTY A;  1P5Q A;  4MRU A;  4A3V A;  5G2N A;  2IOS A;  1OUV A;  2IF4 A;  3ZYQ A;  4I6E A;  5KBA A;  5D0O D;  4A55 A;  4G25 A;  3C3R A;  3LY8 A;  3L82 A;  5CEA A;  1TNZ A;  1OY3 D;  3G2T A;  4UWF A;  2P9I G;  3SFX A;  1O1T A;  3QAR A;  2Y3A A;  4NQ0 A;  5EIL A;  4JA7 A;  1HU3 A;  5ANR A;  4U95 D;  3CVP A;  1HG2 A;  2V5F A;  1H19 A;  4AVX A;  4HOR A;  4GB9 A;  3E37 A;  3ZUV B;  3MYV A;  3PZ4 A;  1AP7 A;  2Y0B G;  2XGM A;  3ZXS A;  2A5E A;  2CG2 A;  4CEM A;  3U64 A;  2H6I A;  2BKK B;  4G11 A;  3IEG A;  3R7Q A;  2IO2 C;  1HZ4 A;  4EEC A;  1TJF A;  3TWR A;  3MZL B;  3SO8 A;  3TG4 A;  2XEV A;  3C5R A;  3QK0 A;  2QC9 A;  1BU9 A;  4F53 A;  5FQ8 A;  2LAI A;  5KNH D;  1N0R A;  5ENT D;  3CVX A;  2L0T B;  3S2A A;  5JMN D;  1UG3 A;  4XI9 A;  3VTX A;  5CMW A;  3LVR E;  2P58 C;  1N95 A;  1KT1 A;  2ILR A;  4GZ5 A;  1TNY A;  4JL0 A;  5A23 A;  3G2S A;  4GAA A;  2HE0 A;  5BPP A;  2FI7 A;  5EYP F;  4DRX E;  3MA5 A;  2MYO A;  5AIJ A;  3CQC B;  5FQ6 A;  2P9U G;  3EU9 A;  3WG7 E;  3QNK A;  2LXM A;  3ONK A;  4BY6 A;  3UT4 A;  3T5X A;  3AU5 A;  4FP7 A;  3CHM A;  4UWH A;  2ZXW E;  3V30 A;  4PH4 B;  2AXU A;  3CK7 A;  3NAW A;  4ILI A;  5FJY A;  4G8K A;  3RKV A;  2P2C P;  4GCO A;  3UXG A;  5CRV A;  4URK A;  3S7J A;  4HOT A;  4JHJ A;  3FH5 A;  2P9N G;  3O48 A;  1E96 B;  3N71 A;  1QYM A;  5JJ6 A;  2X6F A;  4AOF A;  2VGX B;  3SBT B;  5AEN A;  2J9Q A;  4GZD A;  4DLO A;  3EIJ A;  5CED B;  3FTW A;  4AM9 A;  2EIL E;  4I17 A;  1DCQ A;  2Q7F A;  2V5Q C;  1N4Q A;  4RG9 A;  3TXN A;  5E76 A;  4BT9 A;  3Q9U C;  4LRZ A;  4I43 A;  3MV2 B;  2ETB A;  2LUH A;  4QFV A;  3UKR G;  5A7D B;  3PZ3 A;  3NZU A;  3ZHE A;  1JWF A;  3MGB A;  2WQ6 A;  5JA4 D;  4CZ2 D;  4OVU A;  2ZIS A;  2OV8 A;  3MCX A;  2VJ8 A;  5AAR A;  3D9O A;  3HXF A;  1WY6 A;  1K1A A;  2AXZ A;  2ETA A;  3CKC A;  3LKU A;  4AY6 A;  4E85 A;  4N5C A;  5AAO A;  1LF8 A;  4XKB A;  4B8A A;  1K8K G;  4BX9 A;  4F3V A;  1DNP A;  4HI9 A;  2KCV A;  3NB2 A;  1JPL A;  3LS8 A;  2RFM A;  4U8Y D;  1OWL A;  1ELW A;  1D9S A;  1H6O A;  1O1S A;  3DST A;  4GU5 A;  3FUD A;  1OWP A;  2VSY A;  3U4T A;  4G1T A;  4AXH A;  4LNU D;  3B95 A;  3OXG A;  3EHN A;  1S64 A;  1N4P A;  1U3D A;  1ELR A;  3G2V A;  2H6H A;  1OCO E;  1IHG A;  3AS4 A;  3TGO A;  3B7T A;  2ION A;  1NA0 A;  5ENR D;  4Y6W A;  4G26 A;  3MKQ A;  5KJL A;  2EIK E;  1YYH A;  4BWR A;  2WXH A;  4HFG A;  4K5B A;  4FHJ A;  3APD A;  3NOG D;  4BER A;  4JHR A;  3FU0 A;  3S7B A;  3PS6 A;  4UI9 K;  1INZ A;  2WXK A;  3UKU G;  2YQ8 A;  4ATG A;  3ZFW A;  4MBG A;  1H2T C;  4PS8 A;  3KAE A;  1QBQ A;  5EX3 A;  2UWJ G;  2JLB A;  3QWP A;  1H0A A;  4WUY A;  1TYQ G;  3TWW A;  3B7B A;  2VSX E;  1OCZ E;  2DYR E;  3RO3 A;  3TL5 A;  4CCA A;  1QNF A;  4PDX A;  5FT9 A;  3ASF A;  3PDN A;  3JYS A;  1H6P A;  3FFL A;  5G05 C;  5KWD A;  4U0S A;  3ABM E;  1SQM A;  3DPD A;  2C2L A;  3TG5 A;  5DIZ A;  4FUL A;  3ASO E;  3KEA A;  5B1A E;  3FU6 A;  3E32 A;  3VTY A;  4G8L A;  3LY9 A;  5D2M C;  4UQX A;  3GZ1 A;  3DEP A;  3OXL A;  2QFC A;  1HG5 A;  4GA0 A;  3R9M A;  4FLB A;  4UI9 J;  3D9J A;  3QWV A;  2IO3 C;  2GW1 A;  2PNN A;  1UN9 A;  3ZIM A;  3MKR A;  1HF8 A;  3PZD A;  1K3Z D;  4FHK A;  3O4Z A;  3RAU A;  4LUN U;  1HO8 A;  1UW4 B;  3V2O A;  5J90 A;  1A17 A;  1UJK A;  3CHS A;  3CLJ A;  1BLX B;  3AS5 A;  5EID A;  3HYM B;  4AY5 A;  2BUG A;  4X8Q A;  3ZEF A;  4L1B A;  5BW8 C;  3ZYM A;  1Z6T A;  3E30 A;  4AP2 A;  1V54 E;  2NC9 A;  4K0R A;  4HRN A;  3CVU A;  1JCQ A;  1N4R A;  1S0P A;  2AJA A;  4F7A A;  4HRL A;  3PH0 C;  4N3B A;  3QDN A;  1H6K A;  1KZP A;  4EBA A;  1B89 A;  3FTV A;  2C0L A;  4TUU A;  3ZPJ A;  5HQ8 A;  2GRQ B;  4A63 B;  2GRL A;  3KEZ A;  2PQR A;  1E8X A;  3C98 A;  3FUL A;  3I4G A;  3URZ A;  2YNQ A;  4B94 A;  2PM6 A;  2XPZ A;  1Z3X A;  4DK5 A;  1KT0 A;  2KAT A;  3FUE A;  1U2V G;  3W9F A;  3FU3 A;  4H7Y A;  4RLY A;  4AJW A;  2H6G A;  4UQZ A;  4EZJ A;  3S7D A;  3I5P A;  4GTT A;  4KVM A;  2F37 A;  3CHP A;  5FQ7 A;  1FT1 A;  2VTB B;  2XHE A;  1H2V C;  1X81 A;  5EKQ D;  4JC8 A;  4B0Z A;  3AAA C;  2VGE A;  5AQA A;  1HS6 A;  4EPZ A;  3AS8 A;  1UN8 A;  3UIP C;  2WQ7 A;  4L9P A;  3UIO C;  4V3I A;  4KVO A;  4IUL A;  5LCW C;  3JCK C;  2PQN A;  1OCC E;  4G24 A;  4TXR A;  4UWG A;  3SI5 A;  3DBS A;  3ASG A;  2WXF A;  3ULQ A;  2V4H C;  3ISM C;  5HS0 A;  3SGH A;  2WXM A;  3ASH A;  4GTP A;  1ELK A;  3EHR A;  3NF1 A;  5EDS A;  1OCR E;  4WNE A;  3ZU7 B;  4HNA D;  4O6F A;  4A3T A;  5ITZ F;  3Q49 B;  4GML A;  4N2Q A;  1WG0 A;  3DRA A;  1DCE A;  4CDM A;  4Q94 A;  1PC2 A;  3C72 A;  4Z68 A;  5BV1 A;  4KT6 B;  4OAU C;  3AU4 A;  2X6H A;  2R2L A;  4GTQ A;  2YHC A;  3CIA A;  1QQE A;  5T3R A;  2MHK A;  2J4D A;  3FWV A;  2P9P G;  5EX0 A;  1EDU A;  3IHY A;  1U3C A;  5C1D A;  2RFA A;  5BV0 A;  3FTS A;  4J8F A;  3U9W A;  5AQ7 A;  2BF0 X;  2L0I A;  4M3O A;  1TNB A;  3C3Q A;  4CDN A;  4DUI A;  4UQY A;  2X6J A;  2ZIR A;  4N5Q A;  4HLE A;  4EZK A;  4A1S A;  5KCM A;  3IKO B;  2XGO A;  3JUI A;  4HXI A;  3D9K A;  3HVE B;  4YND A;  4WAF A;  2CG3 A;  3TWS A;  2Y4U A;  4C0M A;  3L08 A;  1D8D A;  5HKP A;  1K1B A;  3AJI A;  1LD8 A;  2WQH A;  3PRZ A;  2UY1 A;  2WXO A;  4U7E B;  2IFU A;  2XQ0 A;  3PZ2 A;  3NZS A;  3CVV A;  3IHV A;  5C2Y A;  4GMR A;  1PAQ A;  2A5U A;  4HOQ A;  3T8M A;  3J5Q B;  5LFA A;  1N94 A;  2E2E A;  4DX5 D;  3QJZ A;  4HRM B;  1QZ2 A;  4MKT A;  1GW6 A;  3FH8 A;  4DJA A;  3P2B A;  4OYS A;  3ULY A;  1S63 A;  1HH8 A;  1NFI E;  4YVO A;  5D66 A;  5KJK A;  3OTN A;  4FJZ A;  4UWK A;  3LDZ A;  1H2U A;  3ESL A;  1TNU A;  3U3W A;  3DEO A;  4J8E A;  2Y1L E;  3PUK A;  4NAC A;  3CV0 A;  2L6B A;  4TV3 A;  2XEE A;  2MOW A;  5KJM A;  2FBN A;  5AN8 A;  1HFA A;  1A5E A;  3Q15 A;  3CSF A;  5H7P A;  3HXD A;  2I6H A;  3L17 A;  3ZRH A;  4CT4 A;  1WDY A;  4F1P A;  3P1U A;  1MX6 A;  5ANL A;  1E7U A;  1Z3Y A;  4RQI A;  4U04 A;  4PS7 A;  4DI4 A;  4W9R A;  5EN5 D;  3HXE A;  2LSV A;  4WNF A;  2P9S G;  3MV3 B;  2IOL A;  2V0P A;  5DBK A;  3SZ7 A;  3CHR A;  3SF4 A;  1ZB1 A;  4HI8 A;  2HYZ A;  2I2O A;  2LO6 A;  4J0U A;  4BSX A;  4DPR A;  5FZR A;  2GRO B;  3TJP A;  1YCS B;  4HOU A;  1S70 B;  1FVF A;  1XGW A;  4ZHB A;  4CGW A;  2J08 A;  3KD7 A;  1EF1 C;  2M63 A;  5ENN A;  2LNI A;  3EJN A;  3X2Q E;  3UIN C;  1Y6I A;  3BEE A;  3L6A A;  3HG0 D;  3Q47 B;  4U8H A;  2XGS A;  3ZYL A;  2KCL A;  3DSW A;  3FU5 A;  3BU8 A;  3AG3 E;  3FEY A;  5FIN A;  1UJJ A;  1KLX A;  4BES A;  2R59 A;  1E8Y A;  3RRM B;  5G05 J;  4BTB A;  3F6Q A;  3TAX A;  3CK8 A;  4EQF A;  2OOE A;  3UX4 A;  2VSN A;  2IJG X;  2FUL A;  3ZGQ A;  1EPU A;  4FAD A;  4BET A;  3FUJ A;  1PY1 A;  5AQB A;  4L2Y A;  3EU5 A;  3FHE A;  5LP0 A;  3SY2 A;  3GZS A;  3FDH A;  2EIJ E;  4BT8 A;  3FP3 A;  3UUX A;  3ML9 A;  4JEH A;  5HI7 A;  4K03 A;  2FO1 E;  2GRN B;  4KZ0 A;  4RSY A;  3PNL B;  1FCH A;  3ZKJ A;  2NYJ A;  3D9N A;  4G2V A;  2EQX A;  4HS2 A;  1RW2 A;  2HO1 A;  2J8S D;  3ABK E;  4Q69 A;  3SQV A;  3MKQ B;  4XZ4 A;  1L5J A;  2KC7 A;  1LD7 A;  3R7R A;  3IBE A;  4JW1 A;  3I4R B;  4I6G A;  4AV7 A;  3ZW3 A;  2F8Y A;  3NQP A;  5FWQ A;  3UQ3 A;  3KS2 A;  5AJL A;  4YDY A;  2AXV A;  2OCC E;  5FTP A;  3UM2 A;  1IQU A;  3JXI A;  1TN6 A;  4EBA G;  3PNT B;  1N52 A;  2I9C A;  1EYH A;  2WMN A;  4GA1 A;  1TN7 A;  5AQ9 A;  2F0Y A;  3KSQ A;  5FIO A;  3B13 A;  3LY7 A;  3FUN A;  1NP7 A;  4ME2 A;  2IU1 A;  1FVH A;  3TWV A;  3UM1 A;  4M7C A;  4ACK A;  4GPM A;  2CHX A;  3MX3 A;  1IKN D;  3PRE A;  2X38 A;  3PE4 A;  4I9C A;  4KMO A;  2DYS E;  2VQ2 A;  5JJ7 A;  4ILH B;  4O1O A;  4U8V D;  3ASD A;  3C3O A;  2J07 A;  4F1S A;  1Y8M A;  5FZQ A;  2OEV A;  3TXM A;  3DWL G;  4JHK A;  4DX1 A;  1DC2 A;  4YVQ C;  3LEW A;  3SHF A;  4ACL A;  5J08 A;  3LXU X;  1BD8 A;  2KZT A;  3TWQ A;  5G04 C;  2QY7 A;  5CBN A;  3G2W A;  2WM9 A;  2DCP A;  2FO7 A;  3NOC D;  5G55 A;  2JAB A;  2CFU A;  3L9T A;  2EIN E;  3RRN B;  2ZGG A;  4CGV A;  4DX6 D;  1MJ0 A;  2AWI A;  2E0I A;  2WVI A;  4I1O B;  3IXE A;  1NZN A;  4A1G A;  5EYL A;  4I2W A;  4WWP A;  4KYO B;  5LCW J;  4XEI G;  4UUC A;  2R17 C;  3HRA A;  4MS6 A;  1IHB A;  4J7W A;  1NL4 A;  5CHE E;  3E34 A;  4YDW A;  3QB2 A;  4KXK B;  4G23 A;  5CMY A;  4JA9 A;  2J49 A;  4AEZ C;  2RKK A;  3APC A;  3DSS A;  5M72 A;  2MRI A;  4WWN A;  2PM7 A;  3Q4A B;  4TXQ A;  2X6I A;  1N54 A;  2WXG A;  4FLH A;  5ENP D;  4ZFH A;  4OVV A;  4ILG A;  1OWN A;  3CK9 A;  2WXP A;  3ML8 A;  3S7F A;  3IV0 A;  2I1K A;  3CST A;  4GTV A;  2DZN A;  1Q2Z A;  4GYY A;  3CVY A;  4GZ3 A;  3PVL A;  1ZBP A;  2OEW A;  5CBO A;  3Q73 A;  2IEJ A;  3FY4 A;  4I1M A;  4KBQ A;  2ZGD A;  4BX8 A;  3WXX A;  3PEV B;  3CHO A;  1JCS A;  1WM5 A;  3ZXP A;  2RG8 A;  3BUA A;  3PUJ A;  3CQG B;  3AG4 E;  2AW6 A;  4QQI A;  2KBX A;  4FJY A;  3UT7 A;  4LCT A;  4JB8 P;  2OVB A;  3Q7F A;  4APF A;  1SZA A;  1MZC A;  4J8Y A;  1JCR A;  2XZT G;  1TR4 A;  3PEU B;  3LJN A;  3RU0 A;  3UPV A;  3UI2 A;  2A4Z A;  4GTR A;  5A6C A;  4NRH B;  2WXQ A;  1TEZ A;  1SW6 A;  1OXJ A;  3EHM A;  4CYM D;  4C9B B;  2NSZ A;  3SFZ A;  5D0Q D;  5T4Y A;  2XPI A;  2KCK A;  4YDE A;  3DSU A;  4XX5 A;  3T9K A;  5AJD A;  2VYI A;  2DZO A;  3QC1 A;  3ENE A;  1OWM A;  4L7T A;  3FEX A;  2WMO A;  1TNO A;  4LNB A;  4O1P A;  5T8I A;  1OWO A;  4LG6 A;  4RVB A;  2P9L G;  5BXO A;  4DLQ A;  2XS8 A;  3HVE A;  4JVS A;  2DWZ A;  3CR3 A;  2XEN A;  3RO2 A;  1KZO A;  3GZ2 A;  2JEK A;  2ZU6 B;  4GA2 A;  4WND A;  4TXP A;  4CRW A;  5JHB A;  1IQR A;  1LTX A;  4HQD A;  2FEZ A;  4GYO A;  3SFY A;  5IY5 E;  2L9B A;  4PUC A;  2HM8 A;  4CDR A;  1BI7 B;  3FUM A;  3LPZ A;  2GRP B;  1TJC A;  1NA3 A;  2CHZ A;  3UM0 A;  3APF A;  1G3N B;  2YHE A;  2XCB A;  3RJV A;  3TWT A;  2B0O E;  3GYZ A;  2XPY A;  3AG2 E;  5LOZ A;  3NBN B;  3DPY A;  3TWX A;  5CCM A;  4D10 C;  1AWC B;  5BXU A;  3VLF A;  5BT1 A;  5FZS A;  4N2S A;  4BEP A;  4ANU A;  5ENQ D;  3SD5 A;  2VGX A;  4BTA A;  2Y4T A;  2GRM A;  1HX8 A;  4E6H A;  5AYW D;  4KZC A;  4APO A;  2QYJ A;  3OAW A;  3ZYK A;  4HLL A;  4B89 A;  3ABL E;  2KM4 A;  3K9I A;  4B8C B;  1TN8 A;  3JQ0 A;  2UY1 B;  2J4B A;  3AG1 E;  3UM3 A;  4OAV B;  4L2L A;  2VGY A;  2V4L A;  4YDO A;  3D9M A;  4DI3 A;  1YMP A;  2L6J A;  1YA0 A;  4ANV A;  3B7R L;  2LSU A;  2DIW A;  3MJW A;  2XZD G;  4EHM A;  1BI8 B;  1E8Z A;  4FC8 A;  3J5P A;  1D8E A;  1O1R A;  1VDY A;  4I9E A;  3VLE A;  4BSZ B;  3U66 A;  4HBD A;  1JUQ A;  5CEC B;  2WPV A;  3KSL A;  1MX4 A;  4EZL A;  1DVP A;  4JXT A;  3CGH A;  1SVX A;  4UWL A;  5FQ4 A;  3JUE A;  3FTX A;  3HXC A;  2GRR B;  3V2X A;  4J6I A;  3HHM A;  1Z5S C;  3RRU A;  4TRQ A;  4JZY A;  2XRZ A;  4FU3 A; 
#chains in the Genus database with same CATH homology
 1Z3X A;  2L0T B;  3S2A A;  4EBA G;  1MQS A;  3HDX A;  4U0U A;  3ZVV A;  1UG3 A;  3PNT B;  4DK5 A;  1N52 A;  2I9C A;  1EYH A;  4XI9 A;  2WMN A;  3FUF A;  4GA1 A;  1KT0 A;  2KAT A;  3VTX A;  3FUE A;  3FU3 A;  4H7Y A;  5CMW A;  3LVR E;  4AJW A;  4UQZ A;  4EZJ A;  3S7D A;  3I5P A;  2P58 C;  4FA6 A;  1KT1 A;  3B13 A;  2XCC A;  2ILR A;  3LY7 A;  4GZ5 A;  3FUN A;  4KVM A;  5ARF A;  5A23 A;  4JL0 A;  4HOS A;  1NP7 A;  3CHP A;  3PE3 A;  3G2S A;  4ME2 A;  5CCL A;  4GAA A;  5FQ7 A;  2VTB B;  2XHE A;  5BPP A;  2IU1 A;  1FVH A;  3CVN A;  3ESK A;  2FI7 A;  3MA5 A;  1H2V C;  5AIJ A;  3ZHE B;  5EKQ D;  3CQC B;  5ARG A;  4ACK A;  4JC8 A;  5FQ6 A;  4C0E A;  4B0Z A;  3FTZ A;  3FUI A;  3JQ1 A;  2BTD A;  1HS6 A;  2CHX A;  3MX3 A;  3AS8 A;  4EPZ A;  3PRE A;  1UN8 A;  2X38 A;  3PE4 A;  3QNK A;  4I9C A;  2WQ7 A;  4KMO A;  4V3I A;  4I6J A;  4KVO A;  4IUL A;  2XRY A;  3ONK A;  2VQ2 A;  5JJ7 A;  4ILH B;  5LCW C;  3JCK C;  4BY6 A;  2PQN A;  5BNW A;  3ASD A;  4XIF A;  3LVQ E;  2J07 A;  4G24 A;  4F1S A;  3UT4 A;  1X5B A;  4UWG A;  3T5X A;  1Y8M A;  3AU5 A;  3SI5 A;  3ZN3 A;  4FP7 A;  3DBS A;  3CHM A;  5FZQ A;  3TXM A;  4UWH A;  4JHK A;  1BPO A;  4I1A A;  3ASG A;  4PH4 B;  2AXU A;  2WXF A;  4WWO A;  3ULQ A;  3CK7 A;  2X3M A;  2IQC A;  3SGH A;  5FJY A;  4ILI A;  2WXM A;  3ASH A;  3RKV A;  4YVQ C;  1ELK A;  1E7V A;  2HR2 A;  3LEW A;  4GCO A;  3NF1 A;  4GMJ A;  5EDS A;  4XI0 A;  3SHF A;  4URK A;  4WNE A;  4ACL A;  3S7J A;  5J08 A;  4HVB A;  3LXU X;  2NXP A;  4HOT A;  4JHJ A;  3FH5 A;  2WXL A;  2KZT A;  3O48 A;  5G04 C;  4O6F A;  4Y6C A;  1E96 B;  4A3T A;  4GZC A;  3N71 A;  5JJ6 A;  2QY7 A;  2X6F A;  3Q49 B;  3G2W A;  4AOF A;  2WM9 A;  4GML A;  4N2Q A;  2OND A;  4ABN A;  2VGX B;  2DCP A;  4PS3 A;  3SBT B;  2FO7 A;  2RD0 A;  5AEN A;  5G55 A;  2J9Q A;  4GPK A;  2CFU A;  2WXR A;  4GZD A;  4U07 A;  2V8S E;  4R7L A;  3RRN B;  4DLO A;  4XE0 A;  4CGV A;  3EIJ A;  3CVL A;  4CDM A;  2AWI A;  4Q94 A;  1PC2 A;  3FTW A;  2E0I A;  2WVI A;  4I1O B;  4AM9 A;  5BV1 A;  1NZN A;  4I17 A;  4A1G A;  3CVQ A;  4KT6 B;  4I2W A;  4RG6 A;  4WWP A;  3E4B A;  3AU4 A;  4GYW A;  4KYO B;  5LCW J;  2Q7F A;  2X6H A;  2R17 C;  4RG9 A;  4N3C A;  3TXN A;  2YHC A;  2FF4 A;  1QQE A;  3CIA A;  3MEK A;  2MHK A;  5T3R A;  3L16 A;  2J4D A;  3FWV A;  5EX0 A;  5E76 A;  4MS6 A;  1EDU A;  4LEU A;  3CHQ A;  4BT9 A;  5CHE E;  3QB2 A;  3IHY A;  4KXK B;  4G23 A;  5CMY A;  1U3C A;  5C1D A;  4JA9 A;  4BFR A;  2J49 A;  4AEZ C;  3APC A;  4H7X A;  5BV0 A;  5M72 A;  4LRZ A;  2MRI A;  3FTS A;  4J8F A;  4U0Z A;  3U9W A;  2BF0 X;  4I43 A;  3MV2 B;  2L0I A;  2PM7 A;  4M3O A;  4WWN A;  4NUR A;  4QFV A;  3B7S A;  3Q4A B;  4N39 A;  5A7D B;  2X6I A;  1N54 A;  3NZU A;  5G04 J;  3ZHE A;  4CDN A;  1JWF A;  2WXG A;  2X6J A;  3MGB A;  4FLH A;  4UQY A;  2WQ6 A;  3D9I A;  4HLE A;  4OVV A;  4OVU A;  4A1S A;  4EZK A;  5KCM A;  2PZI A;  2DBA A;  3IKO B;  2XGO A;  3JUI A;  1OWN A;  4ILG A;  3CK9 A;  5BUZ A;  2WXP A;  3ML8 A;  2OV8 A;  3S7F A;  3EDT B;  3IV0 A;  4HXI A;  2I1K A;  3CST A;  3VLD A;  3D9K A;  3MCX A;  2VJ8 A;  3HVE B;  4YND A;  4GYY A;  4WAF A;  2CG3 A;  3D9O A;  5JHA A;  4CT0 A;  3CVY A;  2Y4U A;  4GZ3 A;  4C0M A;  1WY6 A;  3RIB A;  2AXZ A;  3PVL A;  1ZBP A;  3CKC A;  3L08 A;  3LKU A;  5E75 A;  3LJ3 A;  4E85 A;  4AY6 A;  4N5C A;  1XNF A;  2WXI A;  4U63 A;  1LF8 A;  4XKB A;  4B8A A;  4IRU A;  2WQH A;  3PRZ A;  3FY4 A;  4BX9 A;  4MLP A;  1E8W A;  4F3V A;  2UY1 A;  4I1M A;  2WXO A;  1DNP A;  2IFU A;  4KBQ A;  2KCV A;  1JPL A;  2XQ0 A;  3LS8 A;  4BX8 A;  3WXX A;  1OWL A;  3PEV B;  3CHO A;  4N3A A;  3NZS A;  5JJT A;  1ELW A;  3CVV A;  3IHV A;  4L23 A;  3FTU A;  4ANX A;  1WM5 A;  2PL2 A;  5C2Y A;  1PAQ A;  4GU5 A;  2RG8 A;  3FUD A;  3L13 A;  3PUJ A;  1OWP A;  2AVP A;  2A5U A;  4HOQ A;  3T8M A;  3CQG B;  5LFA A;  2VSY A;  3U4T A;  4G1T A;  3QOU A;  4AXH A;  2E2E A;  2AW6 A;  2VSO E;  1ZU2 A;  4FJY A;  3QJZ A;  3OXG A;  1SZ9 A;  4IYP A;  4LER A;  3UT7 A;  1HE8 A;  3EHN A;  1QZ2 A;  4LCT A;  4MKT A;  1GW6 A;  2OVB A;  3FH8 A;  1WAO 1;  1U3D A;  1ELR A;  3G2V A;  2WXN A;  4APF A;  4DJA A;  3OXF A;  3P2B A;  4OYS A;  1SZA A;  3CEQ A;  1IHG A;  3AS4 A;  3GW4 A;  3PEU B;  3TGO A;  3L54 A;  4J8D A;  3RU0 A;  3UPV A;  1HH8 A;  3B7T A;  2A4Z A;  4GCN A;  2ION A;  1NA0 A;  5A6C A;  4NRH B;  2WXQ A;  3FH7 A;  4YVO A;  1TEZ A;  4Y6W A;  4G26 A;  3MKQ A;  1MHQ A;  4JEU A;  5KJK A;  3OTN A;  4WNG A;  4FJZ A;  4UWK A;  5KJL A;  3EHM A;  4BWR A;  2WXH A;  3LDZ A;  4HFG A;  4C9B B;  2NSZ A;  3SFZ A;  1H2U A;  3ESL A;  3QAQ A;  5D0Q D;  3U3W A;  4FHJ A;  4J8E A;  5T4Y A;  4ANW A;  3APD A;  3FUK A;  2XPI A;  2LAH A;  1JWG A;  2KCK A;  3G2U A;  2CHW A;  4JHR A;  3FU0 A;  3D9P A;  3HIZ A;  3D3M A;  4B94 A;  3S7B A;  3D9L A;  3PUK A;  3PS6 A;  4NAC A;  4UI9 K;  4XX5 A;  3CV0 A;  1INZ A;  4TV3 A;  5AJD A;  3CVW A;  2MOW A;  2VYI A;  2WXK A;  4XKC A;  2YQ8 A;  4ATG A;  1E90 A;  5KJM A;  3ZFW A;  2FBN A;  2YIN A;  1HFA A;  3BG1 B;  1OWM A;  3ENE A;  1HXI A;  3QC1 A;  4L7T A;  3FEX A;  3CSF A;  3Q15 A;  2OVF A;  2WMO A;  2R5S A;  1H2T C;  3ONL A;  2CFZ A;  5LX8 A;  4P29 A;  4PS8 A;  5T8I A;  3Q5M A;  2I6H A;  3L17 A;  3ZRH A;  4CT4 A;  1OWO A;  4RVB A;  3KAE A;  5EX3 A;  3SNX A;  2UWJ G;  4GZ6 A;  4UI9 C;  4AIF A;  2JLB A;  4DLQ A;  2KZT B;  3P1U A;  1H0A A;  2I1J A;  3QWP A;  4WUY A;  5ANL A;  1E7U A;  1Z3Y A;  3LCA A;  3HVE A;  2VSX E;  4JVS A;  4U04 A;  3R9A B;  3FUH A;  3RO3 A;  3BG0 B;  3CR3 A;  4PS7 A;  3TL5 A;  4CCA A;  4DI4 A;  1QNF A;  4PDX A;  3RO2 A;  2VTB A;  3GZ2 A;  4W9R A;  3B7U X;  2JEK A;  3QKY A;  2ZU6 B;  2WXJ A;  4GA2 A;  4WND A;  5FT9 A;  3ASF A;  2LSV A;  3PDN A;  3JYS A;  4CRW A;  5JHB A;  4WNF A;  1IQR A;  3FFL A;  3T5V A;  3LYA A;  2FEZ A;  2IOL A;  2V0P A;  3MV3 B;  4GYO A;  5G05 C;  4U0S A;  1W3B A;  5DBK A;  2L9B A;  1SQM A;  3DPD A;  3SZ7 A;  2C2L A;  3EIQ C;  4PUC A;  2HM8 A;  3CHR A;  3SF4 A;  3L22 A;  5DIZ A;  3TG5 A;  4Q96 A;  4CDR A;  3FUM A;  3LPZ A;  3I3N A;  4FUL A;  2HYZ A;  2I2O A;  2X6K A;  3QWW A;  2LO6 A;  4J0U A;  4BSX A;  3FU6 A;  4DPR A;  1TJC A;  3CKB A;  1NA3 A;  5FZR A;  2CHZ A;  3SBS A;  3APF A;  3TJP A;  2C0M A;  2YHE A;  3VTY A;  4HOU A;  3UMV A;  3RK6 A;  2XCB A;  4J8S A;  3RJV A;  3LY9 A;  1IYG A;  3GYZ A;  2XPY A;  1FVF A;  1XGW A;  4CGW A;  5LOZ A;  2J08 A;  2J09 A;  3GZ1 A;  4I2Z A;  4UQX A;  3KD7 A;  5KJN A;  1EF1 C;  3OXL A;  2QFC A;  2M63 A;  5ENN A;  2LNI A;  3EJN A;  1HG5 A;  4GA0 A;  5CCM A;  4D10 C;  4FLB A;  3VLF A;  4UI9 J;  5BT1 A;  3D9J A;  2GGF A;  1Y6I A;  3BEE A;  3L6A A;  3Q47 B;  3QWV A;  4IN3 B;  5FZS A;  4N2S A;  4U8H A;  2XGS A;  2GW1 A;  3UT8 A;  2WB2 A;  4JPS A;  1UN9 A;  3ZIM A;  3MKR A;  3ZYL A;  2KCL A;  3FU5 A;  4ANU A;  1HF8 A;  3SD5 A;  3FTY A;  2VGX A;  4BTA A;  2Y4T A;  2GRM A;  1HX8 A;  1P5Q A;  3PZD A;  4E6H A;  5AYW D;  4MRU A;  4A3V A;  3FEY A;  4FHK A;  3O4Z A;  5G2N A;  4KZC A;  1UJJ A;  4APO A;  4LUN U;  1KLX A;  2IOS A;  1HO8 A;  1UW4 B;  5J90 A;  2R59 A;  1E8Y A;  1A17 A;  1OUV A;  1UJK A;  3CHS A;  3RRM B;  2IF4 A;  5G05 J;  3ZYQ A;  3OAW A;  4BTB A;  3CLJ A;  3ZYK A;  3TAX A;  4I6E A;  4B89 A;  3CK8 A;  3AS5 A;  3K9I A;  2KM4 A;  4B8C B;  5D0O D;  4EQF A;  3HYM B;  3JQ0 A;  4AY5 A;  4A55 A;  2OOE A;  2UY1 B;  2VSN A;  3UX4 A;  2IJG X;  4G25 A;  2FUL A;  3ZGQ A;  2BUG A;  1EPU A;  2J4B A;  4FAD A;  3ZEF A;  4L1B A;  3LY8 A;  5BW8 C;  3FUJ A;  4L2L A;  2VGY A;  1PY1 A;  2V4L A;  3ZYM A;  3G2T A;  4UWF A;  1Z6T A;  3QAR A;  4L2Y A;  3FHE A;  5LP0 A;  2Y3A A;  4NQ0 A;  3D9M A;  4JA7 A;  1HU3 A;  3FDH A;  3GZS A;  5ANR A;  4AP2 A;  3CVP A;  4DI3 A;  4BT8 A;  2L6J A;  3FP3 A;  1HG2 A;  3UUX A;  2V5F A;  2NC9 A;  4K0R A;  1YA0 A;  3ML9 A;  4ANV A;  3B7R L;  2LSU A;  1H19 A;  4JEH A;  5HI7 A;  2DIW A;  4AVX A;  3MJW A;  4K03 A;  4HOR A;  4GB9 A;  4KZ0 A;  4RSY A;  3MYV A;  3PNL B;  1FCH A;  3CVU A;  1E8Z A;  4FC8 A;  3D9N A;  1VDY A;  2EQX A;  2XGM A;  4G2V A;  4HS2 A;  4I9E A;  3VLE A;  1S0P A;  3ZXS A;  4F7A A;  3U66 A;  2CG2 A;  1JUQ A;  2HO1 A;  2WPV A;  3PH0 C;  4N3B A;  4CEM A;  3QDN A;  1H6K A;  3U64 A;  4EZL A;  4EBA A;  1DVP A;  4Q69 A;  4JXT A;  4G11 A;  3IEG A;  3MKQ B;  3R7Q A;  3CGH A;  4UWL A;  5FQ4 A;  4XZ4 A;  1L5J A;  1HZ4 A;  4EEC A;  2KC7 A;  3R7R A;  3IBE A;  4JW1 A;  1B89 A;  1TJF A;  3MZL B;  3I4R B;  4I6G A;  3FTV A;  3FTX A;  2C0L A;  3TG4 A;  2XEV A;  4AV7 A;  3ZW3 A;  4J6I A;  3NQP A;  3HHM A;  3QK0 A;  4TUU A;  3ZPJ A;  4F53 A;  5HQ8 A;  5FWQ A;  3RRU A;  2GRL A;  3UQ3 A;  3KEZ A;  4TRQ A;  2PQR A;  1E8X A;  2LAI A;  5FQ8 A;  3C98 A;  3KS2 A;  5AJL A;  4JZY A;  3FUL A;  3I4G A;  2XRZ A;  4FU3 A;  3URZ A;  2AXV A;  5FTP A;  1IQU A;  3CVX A;  2YNQ A;  2PM6 A;  2XPZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...