3CVHH

How tcr-like antibody recognizes mhc-bound peptide
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
219
structure length
213
Chain Sequence
b'VLLQQSGPELVKPGASVKIPCKASGYTFTDYNMDWVKQSHGKSLEWIGDINPNNGGTIYNQKFKGKATLTVDKSSSAAYMEVRSLTSEDTAVYYCARKPYYGNFAWFAYWGQGTLVTVSAAKTTPPSVYPLAPGSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title How a T cell receptor-like antibody recognizes major histocompatibility complex-bound peptide
pubmed doi rcsb
molecule tags Immune system
total genus 41
structure length 213
sequence length 219
chains with identical sequence Q
ec nomenclature
pdb deposition date 2008-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cvhH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cvhH02
1RZGA 1WK0A 3WKML 5L0QB 4HG4K 4EI5B 4L4TA 5HHXL 1I1FA 4LLDA 4BZ1H 3OPZH 3T08A 5HXMA 5T33H 5CBAB 4WY7L 4PV8A 1XFPA 4JREB 4MA7H 3CC5B 1F4YL 3SBWC 5HPMB 1JYWA 4UUJA 3RDTA 1I8KB 3NA9L 4UDTB 2HRPL 3ARBA 3UTSA 1K3ZA 1DANU 5C07E 1T2QH 2YUVA 4ODBD 5HVGB 4EJ1C 4LMQI 5DMKA 4RQQA 3TCXA 3QJHB 3F12A 1M7IB 4PRAB 3VG0L 3BKMH 1OTUD 3HE7C 3BGMA 5FB8B 2AXGA 5HDQL 4E0RB 2PXYD 2ICEB 3QHZH 4C4KT 2R0KL 5IKCB 5JIHA 4Q9RH 5DI8A 3KYNB 1KNOA 2CLRB 2G60H 1XIWC 1KN2L 4XWGL 2IAMA 3GSOB 1HINH 2OL3A 5D7KE 5IW6A 1IEHA 4MNHB 3HZKA 5I6XC 2B0SH 1CFBA 3O3EB 4P0DA 4UILL 4G6JL 1PLGH 3T65B 3GGWB 3GHBL 3VGDA 1NGXB 1QVOB 5ADOL 4FZEH 5E8OA 4M1CC 5MEOA 4L9DA 3OXSB 2YA1A 3LMJL 5EU4A 4KTEH 3M1BA 3W39A 2V5SA 2AJ3B 4Q6IA 1EJOL 5DLMH 1VFAB 3VFWA 1BFVL 1YEKH 4U6TA 4Z7UB 4WTXA 5F72S 3HAEH 2XFXB 2W38A 4GW4A 4NKOA 5E24E 4ISVA 2OSLB 3QUZC 1N6QH 4PTUA 5EOCL 4LSRH 2PXYA 4L29A 2PTTB 3LIZH 3QR2A 4HXBL 5SV3A 2NPLX 1VADA 3DARA 3BJ91 1U8LB 4H1LB 4R2GB 5E8EA 1OSPL 3Q1SL 3MROA 2VISA 3FJTA 3QQ9D 2YA2A 1HOCA 4XNZC 5DJDA 5FUCC 4XCCH 4ZFOB 3IFOB 4HDIB 3DMMD 1SMAA 1I9RH 3ARSA 3BKJL 3ULVF 2BSRA 4QRUA 1M7DA 1XGYH 2A77H 4PJFE 2X1XR 2QADC 4QRSA 1T83C 5D6DC 4NYLB 2UVEA 5ADPL 4GXUN 3OR6B 4Y4KA 3GSQB 2F53B 3SDAD 1JJUA 2X4TA 5IB4B 5I1CL 5C0IB 4NNPL 4XI5C 2IBZY 5K9QG 4P4RA 3DWTA 4ZUUB 5SX5K 4OUUA 2HJKB 2OP4H 3FB8B 4D9LL 5LAXA 3VD7A 2ILLA 1HEZB 5DK0B 5E08H 4NN6B 4RDQG 2EO1A 2HA1A 3AFLA 1NMAH 2DBLH 3QZWB 2GJZB 3JV4A 1J86A 1U95B 3DUUB 4UT6H 5EO9A 5MENE 3VD9A 1TJGH 3CZFB 1Z0MA 5BRZB 4UDUB 4YHOL 5EWIL 2DKUA 1Z5LA 2IQAB 1OPGH 1LO3H 4F7PA 1G7PA 2CDFB 2XG5A 4HG4J 3UTZB 4CMMA 3DMMA 3BE1L 4P2YA 5LXGH 3HB3D 1G9ML 4WDIA 1G9EA 5EU7E 5F9JB 4AL8L 4HS8L 5GS0D 5GS1C 3IFLL 4F9PA 2RAMA 2XRAH 4ZS7L 4XPBH 3KPLA 1QLFB 3OKDA 5TF1L 5BXFA 4FN0A 2F58H 4GMTL 4I9WD 1TMCB 1ZGLA 3SDAA 1NPUA 3NCCB 5JQ6H 2DQDH 3BHBB 3QNYB 4WJ5B 1A7QH 1M1SA 3IFPA 2X4NA 4WFED 5INCA 32C2A 4ZPTA 1CVSC 2VWEE 2BSTB 4P2RA 1NFIA 3QWOA 2VLKE 3FCTB 3RKDD 4K3JL 4LEOA 3EO9H 3ARRA 2IH3B 1XH3A 3H9HA 4LRIA 5E03A 1X5ZA 1T3FB 5ESQB 3VFVB 4LP4A 2YXFA 2NW3A 2GSGA 4RAUA 3BSZH 4JO1H 4M6NH 5J4MA 43C9A 3VGHA 3IYLW 5J12C 2HYMA 4HAFA 5E2WL 1RZIB 2DF3A 2ID5A 2CKBB 4DN3L 3X14B 1PY4A 5JO5B 1S5IL 1FE8H 4CNIB 1AIFA 1JNNH 3TO4D 5IFJB 2H1PL 2W0LA 1KIRA 3MYZA 5EULV 1T1ZA 1HSAA 1UH3A 3VWJD 3PABA 4M5ZH 4JN1L 1BLNB 2OBGA 4NM8H 5DJ6A 5J56B 1BF2A 2AXJA 1WCBB 1OAXL 2CLVA 2DQCL 3OKKA 5IF0A 3MRHA 4JDZB 1DR9A 3L3JB 4HBCH 1DQJB 2CO6B 2BXZA 4UIMB 1MAMH 1RZFH 1JPFB 3PGDA 2VAAB 3ZE2E 3U0WH 3SO3C 3QAZC 5T1DL 1P4IL 2KZWA 2X05A 1QR1B 1RUPL 1G0YR 4Y2DC 4BH7A 1QOKA 2HJLB 1E6OL 3B9KC 2UYLB 5E94B 2GQHA 3O3BA 4JFFD 4XVTL 4O9HH 3PNWB 2VABA 1XEDA 3UC0L 2GYSA 2BNUB 2JELL 2R29L 2NY0D 1YJDL 4JM2D 3STBA 4OIAA 5HYQB 4TULL 3FQTB 5ITFA 1TJHL 4HIXL 4ODSL 5GJTL 3MLTB 1KCRH 4ZO7A 1Z3GL 4HFWA 3T77A 4DTGH 2IPUG 2W91A 2JIXB 1U8JB 5LKNA 3EW3B 3TO4A 3O4LD 1A4JA 5LCVL 2P8LA 4KDTC 1JPGB 1PD6A 5IB3B 3VWJA 3QI9B 4M9PA 3WFBL 4PGZA 5D5MA 1RURH 1I1FB 1DLFH 2XN9E 3K2UH 3O2VH 1UVQA 5C92A 4PV8B 3VW3H 4GG8B 1MFEH 5EZIL 4O58L 4N90D 3RDTB 3B2UC 5DJ8A 3UTSB 5DMKB 4RQQB 1AQDB 3GMMA 4RWHA 4YBLB 3MLYL 1XGUB 4XC3H 4RDQF 3U4BL 1T04A 1WITA 4G80A 3D2UD 5HYEA 5FDYA 2AXGB 1A7OL 1K6QH 4JFFA 2PR4L 5K9OA 1ACZA 3QWQB 4LU5L 5DI8B 4HIEA 1KNOB 4JM2A 2ED9A 4MB4A 4X8XA 4APQD 1NFDE 2AK4A 2VDKL 3BIKA 2ZCKH 4HAGA 5HI4D 1XGRB 2V9RA 2OL3B 5IW6B 3T8XB 5IFAH 3HZKB 4HGWA 3L3KA 2ESVE 3O4LA 4FG6C 1QLRB 3LRGA 3TBYA 5E6ID 1FZKA 3TBSA 1G9NC 5E8OB 2AQ1A 5MEOB 1TCRA 2FECL 2ICES 1HH9B 5EU4B 4G8GE 3R0NA 5F8QC 3W39B 5C3TA 4Q6IB 3A6OA 5DQ9A 4M1DL 1GC1C 1LO4H 1WF5A 3H2WA 3VFWB 1WIOA 3NFNB 5HHVH 4NKOB 4RGOH 4TUKH 3ZDZF 4BYHA 5MP6L 1WT5A 2LAGB 5DD0L 3RWGB 1UJTA 3QIBD 1J0JA 3D2UA 4PTUB 1ZE3C 4H8WC 2PXYB 4L29B 4X6CA 2YWYA 3F65A 2ZG3A 1BVZA 2Q3ZA 1TPXB 3BEWB 5I8CA 1VADB 1BZQK 1RIVL 1DVFC 3I3BA 1AGCB 4P9HH 4APQA 4IRSB 1OAYH 4FQ1H 2AXFA 4P5KB 2VISB 5D5MF 3GMRA 1HOCB 5DJDB 5C0AA 1INDL 2JB5H 3W9DA 1WZLA 2QBWA 1YNTA 5IHLB 5TH2A 1LDPL 3OAYK 3UPAA 1Z9SA 4OIIH 4QRUB 4UT9L 1M7DB 3F7QA 1XF5B 4ZSOA 5E6IA 4X4MA 2AVGA 4ZUVA 1A64A 3F8UB 5J89A 5DXWA 2APWA 3E8UH 3PJSB 4UINL 3QXAA 4BFIA 3C5JA 3GNMH 2X4TB 4PJDA 4DGYL 2AJSH 4TNWF 4OI7A 2RR3A 3MACH 1ITCA 4PJIA 3MXWH 4P4RB 4JAMA 4OUUB 5AAMA 3EYFA 4XNUH 3C5ZC 4J3TA 3BZ4A 3BYTA 4WW2B 3T1WA 4UOW0 1NH6A 3A0OA 2FX7L 1FQ9C 5LAXB 3L95A 3QIBA 5D4QA 4N1EA 2VDPH 3P9LA 1G7MA 3EDFA 3V7AE 2VC2H 4HT1H 4MZ2A 1MCLA 3JV4B 1CXEA 3DTXA 3KWWA 4K9EC 4V1DE 3QH3A 1NANI 4L4TE 3PWPD 3LN9A 3K0WA 2A9ML 1U3ZA 5A2KH 4YHML 4NKQB 2MNUA 3AAZB 2ICWI 4O4YH 4ZUWB 1Z5LB 1MJ8H 4F7PB 2I9LA 2VKWA 1G7PB 2VITA 1XF2A 3EYQC 2XY1A 4CMMB 5C6WH 1CICC 5I15H 1LO0L 1EV2E 2A6JA 1FPTH 2G2RB 3MRIA 4OZHA 2V5RA 3KYAA 1P6AB 1D5MA 2E5EA 4K94C 4G9FD 3KPLB 3OKDB 3BGFC 1G84A 1GZQA 1U6AH 4L4VA 5C9KA 5ACLA 3SDAB 5AWNL 3I9GL 1NGWA 3DYOA 2O5XH 4JG1H 5CINL 5C9JB 2DLEA 1JYNA 3IFPB 4NQEE 5D93C 5INCB 4ZPTB 3OB0K 5DVMA 3BO8A 1NFIB 3EBAA 3QWOB 3P0YL 5BV7C 3BWUC 5AUMA 3IDNA 4M1GL 4JO2L 1PX4A 4DAGH 4X9IA 5IFHH 1QEWA 1XH3B 4TRPH 5GGTA 4MXQD 3RX7A 4JQXC 3KJ6L 2XWTA 4GQPH 1BM3H 4F9LC 3K4AA 1MOEA 3B83A 2ZG1A 3CK0L 1JNLL 4RAUB 3WD5L 1EAJA 1UZ8A 1LQSR 43C9B 4DOHB 3PWPA 4P99A 3O2WH 3MLRH 4PGDB 2PTVA 5E95B 3V4VL 4FQHA 4F37K 5KJRL 1MFAH 4PRHE 3HUJA 5HVWA 5IHBA 3BN9D 1T1ZB 5FYKH 2YZ8A 3PABB 3V6OC 1I8IA 2PYFA 3BESR 4G9FA 4NP4H 4YGAB 5HYSG 43CAA 4FQIL 1TVBA 5I1DA 3U36B 3KLAB 1CGSH 4FXGA 4KROC 2B4CL 1JWMA 4MAUL 3U4EA 5GS2H 1IFHL 3PGDB 1F42A 2AQ2A 4KUZL 2XQYK 3KLHD 3GSNH 4OKVB 1NQBA 4BH7B 4KV5F 3NABH 3LPFA 4F58L 1PSKL 4Z7QE 3HHRB 5ALBH 3C5SA 8CGTA 5HDOA 2YD3A 3HFML 3MJ7B 4OZHF 1DBBL 5DRWA 1HKLH 4GMSL 4HFWB 3T1FA 3T77B 5FKAB 2Z8VC 1H3UA 3UDWC 1L6XA 2CJUH 4LHJB 4NZUL 3P4MB 4RZCA 3TO4B 4ETQA 3KHOA 4OLUH 3QDJE 1DFBL 1W0WB 1EBAA 4X8JA 1R3LA 2P8LB 4ENEC 4YHKH 4WUUE 4Q2ZB 4RISH 4J12A 5C6TL 5EOQH 2DDQL 1A6PA 2HFTA 4N0YH 1UVQB 2G5BA 4X5LA 1ZLWH 1G7QB 1P4LA 4WCYH 5ISZD 5DRZA 4EI5C 5DJ8B 3RAJL 4CUCA 1DBML 2D0GA 3B9EA 4K07A 4YXHL 1C16A 4JREC 4PG2A 4OQTA 2OZ4A 5FK9B 3ARYA 3GMMB 1AO7D 1AY1H 1T04B 2IFFL 3WFEL 3X12A 1QFWM 2NYYC 1U41A 2VIRA 3HMWL 1CZ8H 1LO5A 4JFFB 2ZOLA 3O9WD 5IOPA 4OD1L 5ID0A 5K9OB 3I6GB 4ZFZA 1YEGL 3UO1L 2EH8L 2Z31A 3BPLC 3HUJF 5EN2A 4XHQA 2F5BH 2NY0B 4JM2B 5CJOL 3BRDA 3WXVH 4R4ND 3BIKB 1YQVL 4QYOA 3VFGH 5IGXL 3WIHA 3MV01 4WO4D 5D2NA 4HGWB 3L3KB 2VWEC 3K7UA 4P2RE 2KL6A 2BVOA 5T1LD 4KI5D 5JPMA 1G9NH 2PYEE 5CFHA 3O4LB 1F3RB 4C56B 5DR5H 3TBYB 1CDHA 3O0RH 4Z5RA 2EEBA 1YN6B 3TBSB 1EHLH 5DD1H 2W9DL 3QISA 3SDDB 1GC1H 2YRZA 4FZ8L 3W81A 4XPHL 2R9HC 4R96A 1FNGB 1FH5L 1CLOL 3QPXH 4GW1A 3NCJH 3PDOB 5FYJL 2KBGA 3EFDL 4OAWA 3H7BA 4YDIH 5I19L 1DZBA 5TDNB 3RUGA 1U2HA 3WN5C 2W59A 3RVWC 2AV1A 1AO7A 2C4FU 4JJ5A 4JM4L 2HVJA 2D7PA 4JGMA 3D2UB 4QHNA 3T3PF 1NAMH 5KVFL 2I07B 1T0PB 4EI6B 4X6CB 3O9WA 5DFVC 1WGOA 3GJFK 3MZTA 4YUEL 5I8CB 3EHBD 1OT1A 1QTYT 5T3ZD 1DLHA 3L6FB 4LSVH 4APQB 2F54D 4RCAA 4ERSH 3GMRB 1YYMH 3MBXH 4DVRL 3QA3A 2GAZA 2ZJSL 4QCIA 4WO4A 4XP5H 3W9DB 3MLWL 5EOTA 3N9GH 5T1LA 5TH2B 1REIA 1MPAL 2CIIA 5I1LA 4L5FL 4YNYA 3MLVH 1CGYA 4XGZB 5E6IB 1QRND 2BRRL 4ZUVB 3WFCL 4QTIL 1UXWA 2LU7A 5DVKA 3B9AA 3BPCA 5D7IA 3RJDA 1UQSA 4MA1B 3QXAB 1MCIA 4JJHA 4BFIB 3BDYH 3C5JB 4QXUL 4LF3A 4PJDB 5MEPA 1P6FA 3UBXG 4X7SL 4PJIB 1OOAA 4W81A 1A5FL 4JAMB 3AM8C 4XPFL 3T0VA 3S35X 4EDXA 3VRLF 2WSKA 25C8L 3D39E 3SY0A 1G7MB 1NLBL 4YHLL 4MQXD 1RY7B 5GIRA 4PP2B 1FZJA 3DTXB 5F97E 3MRQA 2V7NA 3QH3B 4HIJA 3CDGB 4N1HB 4UIKL 4RFNB 3MGTB 3ZZ1A 3Q2CA 4L3CA 2G9HA 3E6FA 5FYJE 3ORJA 1NGQH 2MQ0A 4HKBA 3NBNA 3TIEB 1AGDA 3MXVH 2LTQB 4L8SC 2I9LB 1I85C 4KMTL 2D7TL 2YPLD 3QDGA 3UTQA 4D0BB 1XF2B 4R90L 2I24N 3LN5A 3NN8A 3F58L 5E00A 5SV4A 3L3HA 1QSEE 4CU6A 4K55A 4N9GB 4OZHB 1GXEA 3RFZC 1QRNA 1D5MB 1SMOA 3RUGF 1GPOH 1IKNA 1CBVH 2EIZB 4RMRA 3VGFA 3LQMA 1HSBA 4M43L 1RZKC 1UKSA 1DJSA 1NGWB 5J6GA 2OX5A 2VXVL 3CLEH 1MUJA 3BO8B 2AK4E 1X4ZA 1RVFH 2GFBB 5AUMB 1W72A 3IDNB 3TBVA 3BPOB 1A3LL 5A2IH 4QRRE 4UT7L 3KPTA 3WIFA 4EQ2A 1R0AL 2E8YA 3KYOA 1V8HA 3UBXA 3VWKD 2GJ6D 3GIZH 3TZVD 4MAYC 4D3CH 2D9QB 4KI5F 1N2RA 4HW6A 2F19H 1UZ8B 5I8KH 4GXVL 3PWPB 1KXQE 4YK4B 1MCKA 1YJDC 4XXCC 5F21B 1AGEA 4FQHB 4Y88A 3KXFB 4MNQD 3MUJA 5D7IF 2R2BA 3BUYB 5GSVA 1BGXL 5FM4A 4OLXL 5JOFA 1MLBA 2O5ZL 2YPLA 2DI9A 3HUJB 1C5DA 2R1WA 1T1WA 2DTMH 1QKZL 1JPSL 3WKMH 4F8QA 2YC1B 4RGMB 1UH2A 2X2YA 3VGAB 1I8IB 1YMME 1IKFL 1J05B 1U42A 2PYFB 5HHXH 4U3XA 5LG1A 4G9FB 4KJWD 4D2NA 4Q7DA 4WY7H 43CAB 3MCKB 3U30C 4YE4L 1F4YH 1Y0LB 3BDBA 4UQ2A 5F8RC 4HGMA 3NA9H 3VD5A 3QUXC 1QG3A 2HRPH 5I75C 2HVKA 5ALCL 3SKNA 5HD8D 3MJ9A 1T2XA 4F7TA 4MSWA 3LHPL 4UQ3A 5C0AE 3QEUA 5F9AC 4DK6A 4DK3A 4NQSB 3HZYB 5HDQH 1OGAD 5SWZD 3SE3A 4KZEL 1R5IB 3VWKA 3PV7A 2R0KH 2GJ6A 4ZSOE 4KUCD 3TZVA 1JP5A 1WWWX 1KN2H 3MR9A 1AGFA 3C5SB 4XWGH 5JMRA 1Q0YL 1EFQA 5GISL 5C07B 1V05A 2R8SL 2LQRA 3DX9B 3IGAA 5DRWB 3T1FB 2ENYA 4NPYA 3EIFA 4MNQA 3CSBA 1TFHA 4UILH 4G6JH 1U92A 4OM1L 2PW1B 2J1KA 4RZCB 3GHBH 4MCYA 4N0CC 4X8JB 1R3LB 4H26A 2D0FA 3IRPX 4CJ1A 3LMJH 4U1LA 3NPZB 4V2CB 1YC7A 2X6MA 3OWEA 1EJOH 2G5BB 3QCVL 5F6HJ 3IT8D 3IXTA 4M93C 2F74A 1J1OL 1RJLA 4OFYD 3VFRA 3CIQA 3D3VE 3ULVC 1C16B 5GGVY 1MFDL 2JJUA 3UTOA 3RDTC 4U4BA 1NDGA 3ARBC 4NFCA 3W2DL 5EOCH 1OGAA 5K9JL 5SWZA 2VIRB 4GRLD 1VGKA 1LO5B 4XMPL 5GZNC 5IOPB 5ESAA 5CS7A 1T22B 3MA9L 4ZFZB 4Z6AT 1R3IL 3WFHB 2UV3A 4KQ3L 1V5JA 1QD0A 1V7MH 5HGAA 1OSPH 3Q1SH 5LQBL 4L4VE 1PEWA 1R24A 4LGPB 4QYOB 1CDBA 1WFNA 1FIGL 3CFEA 3LB6D 1PY9A 5D2NB 1BQLL 4HFUL 2IAMC 3BKJH 5JPMB 3RIFK 1TJIL 5FA3A 5GGSA 4YGVA 3MFGB 3R8BB 3UTTD 4MJ5A 2Z8RA 4HPOL 4Z5RB 4JPVL 5ADPH 4ZO9A 5DEFA 3SDXE 4KMLB 4Z8FL 3OF6A 3V8OA 3BFOA 5DRXA 5IQ9A 1O5DT 4M7ZB 5FM8A 3WNNA 5I1CH 4NNPH 5FO9A 2BFVH 1KTLB 5ISZB 4HHAB 2OJZL 3KG5A 5AEAA 2APBA 2HKFL 4OFYA 3VI4F 2IMNA 2Q86B 4Q6IC 3RUGB 3SQOL 4D9LH 1E4WL 1ZT4A 1IGCL 2ZKHL 4G7VL 2AV1B 1AO7B 4JJ5B 2BVPB 4W4OA 4OQTL 3LS4L 4WI7A 2HVJB 1KJ2L 1D5BA 2D7MA 4QHNB 1WZKA 4GRLA 1EDQA 1K4DA 2V2XA 3ARED 2EE2A 1N7MH 1OTUC 3VXTB 2XY2A 3VXUD 3ZDYF 1XF4B 2PXYC 2YBRB 1DLHB 2NNAA 4WHDA 3E3QE 4P2QE 1IEBB 2NY7L 5EWIH 3RWEB 1TPXC 3FQXB 4PB9H 5F1SA 4QCIB 2GAZB 4WO4B 1ZHKA 2W9LA 3VXRD 5EBGA 1CFTA 1MCPL 5EO1B 3BE1H 3LKQA 5B22A 4ELKA 1G9MH 1CLYL 2X9YA 2EE3A 5C0FA 4YNYB 3AU1A 5IVOA 3UTTA 4AL8H 4U3CA 3NMEA 4HS8H 1WLHA 3IFLH 4M4RA 4WTWA 4CRPA 3VXSE 5TF1H 3T0WA 2NQCA 4GMTH 2HT2D 5CEZL 4NGHL 3HPJA 3UAJD 1Q9WA 3ESVF 3FHQA 3ILQD 4LLWA 3NIDF 4LF3B 2EDXA 1QBBA 4HUMB 4Y4KC 5KSBE 2BZDA 4OZFA 4MXVF 1TQBB 4K3JH 4XNQA 4O2EA 5CZXD 2I9TA 1JWSA 1UWGL 4P49A 2A74A 4EDXB 3CZJA 4Y2OA 5EBMA 3I75A 3SY0B 3TIDA 3NFPA 1S9XA 2V9QA 1SQ2N 2CGRL 2ZCHL 5GIRB 1H3PL 3AREA 2BCKB 2C3GA 2XTJD 3MRQB 3VXUA 2C1OB 2V7NB 4HIJB 5IVXA 1QZ1A 2H3NA 3MRMA 1FVEA 3N1MC 4PJHE 3RPIA 4W68A 2VNCA 5E2WH 1DBJL 2F54B 5FGRA 3E6FB 1G1CA 4DN3H 4HKBB 2FECI 3H9ZA 5TE7L 1AGDB 1S5IH 4HMDA 3VXRA 3UTQB 2H1PH 1BD2D 4JN2A 4OI9A 3QQ9C 5JPNA 3LN5B 5E00B 3QUMA 3JVGA 5J1TC 3L3HB 1S7SA 4JN1H 5E5UB 1QRNB 4BA8A 3DMMC 4HWZA 5LBSL 1PG7X 5EIIA 1OAXH 2DQCH 2HRLA 4LVNB 4P23B 1F6AA 1HSBB 4OCSH 4F9PC 5J6GB 4X98B 5M7QA 3VG9B 1MUJB 3SDAC 5T1DH 2AQ3A 1P4IH 2I5YL 1RUPH 3TBVB 1LEIA 3RWIB 1E6OH 3I84A 3WIFB 4JO3L 4XVTH 1UM6L 4U1SB 1KPUA 4ORZC 3UC0H 3BP5A 4LRIC 1NEZA 2JELH 2R29H 4TSCL 1YJDH 5CEZE 4TULH 1TJHH 4HIXH 4ODSH 3TGXA 3WKNA 1P7KA 3HRZA 2BHZA 4JE4B 1Z3GH 5F89A 5AYUL 1AGEB 3B6SB 5E2JA 1JK8A 3CFCL 3C08L 5LJYH 1BHGA 3B9VA 3CLFL 5JA9A 4XNMB 2R2BB 4CVWA 4Y19E 1JPTL 5GSVB 1R5WB 2XZAL 4OD2A 1BD2A 3FZUD 3EZ8A 5LCVH 4YZFF 2AV7B 4QHLA 3WFBH 4WTZG 2AEWA 3CDCA 3I6LD 2VQ1A 3MJGX 3HB3C 4XTRC 3TN0B 5EZIH 5GS0C 4MD0A 4O58H 4BQ8A 4UQ2B 3H42L 2ZSVA 2XZQL 1J8HD 2APFA 1ZT7A 5HGBA 2EE6A 4KRPB 2HVKB 2P7TA 3U83A 3SKNB 5T5FL 4C54A 4F7TB 4MSWB 3VXNA 4EKXA 4UQ3B 5IVXF 3WUZA 3MLYH 3U4BH 2O26U 5LGJB 1W72L 1TZGL 3FN3A 1A7OH 4XCEA 3RKDC 5EC1B 3CCHB 3PG2A 3VWKB 2XN9B 2IMMA 4PBWD 5JDSA 3TZVB 5IV2B 4ZO8A 1AGFB 2VDKH 1A8JH 2JJSA 2OI9B 2EDTA 2P1YA 2DMKA 1UJ3A 3IGAB 1JN6A 4BZ2L 1NCDL 1U92B 5IJVA 5GRZA 4JFED 4K2UH 3V95A 4HKZA 4RFEA 2AJXL 3D6GA 4MCYB 1PKQA 4JFHD 4OIBA 5K93A 2V17L 1T7VA 1P2CA 1UWXH 2OMNA 2N4IA 3MRRA 4U1LB 3TO4C 4UAOB 4MHHG 4JLRB 4R0LA 3UXFA 3VWJC 3G9VA 4PLJD 4M1DH 2VLMD 2A2QT 5FV1L 3IXTB 1J8HA 2F74B 4WTZA 3VFRB 5ANME 5HYIA 5MP6H 5DURD 1C12A 2ZUUA 5DD0H 3MJ9L 1NDGB 2O5YL 4ODWB 1FZMA 4P3DA 5E4EB 3QDGE 1OGAB 5SWZB 5I1AA 2YZ1A 1B0GA 5E4IA 1OM3L 4YIQA 5ESAB 4P4KA 4XMLL 2XNAA 4NQTA 3IDUA 3AROA 3H3KA 1RIVH 3QCTL 1D9KD 3MGAA 1UB5A 3K8MA 4G6AD 1TZHA 4NKDA 1R24B 4ZOEA 4ZUTB 1CR9L 1INDH 4JM2C 2JTDA 4YPGA 5CBEA 1LDPH 2E7MA 1BMGA 4UT9H 3Q6GL 2Q20A 4JFEA 1WBYA 5GGSB 3U9PL 1PQZA 3B43A 4MJ5B 1S3KH 1SEQL 5FYKU 4UV4H 4P3WA 1I3UA 1RV6X 3GSRA 5TE4L 4UINH 5DEFB 4GG6E 1DSFL 1NUDA 2Q6WB 1FFRA 4L8CB 5GQBA 4FMFA 5DRXB 2EE9A 5IQ9B 4DGYH 5FO9B 4AYFA 2NY4B 1VDGA 1J9CT 1F4XL 3LRSB 4LLUB 1BJMA 5CEXB 4G8IA 5K9QI 4K7PY 5EH1A 1ZT4B 2FX7H 4WU7A 2LV4A 4D8PA 5D9SA 5ENWA 3MNZB 4AG4L 2YPLE 5J9PB 1RUAL 1D5BB 2FHBA 1AXIB 4GRLB 1WT5C 2EH7L 1K4DB 1INEL 2V2XB 1EK3A 4AIOA 1D9KA 2C7UA 2A9MH 4YHMH 3ZE1F 1Q72L 1KGCD 2NNAB 3O45A 3EYUL 3PF2A 5EPMA 2L4OA 1HK6A 1PG7L 4H20L 4F3FA 3IAPA 3BH8A 4TNVK 1DUZA 1ZHKB 1CFTB 1YNKL 2R2EB 3MRNA 4APQC 5HI4C 1LO0H 2X89D 1ZKAA 3LKQB 4ELKB 2XXMB 3LPGA 2R23A 5C0FB 3UTTB 2R2HA 3AU1B 1NBVL 1AGBA 3HNVL 5EUOA 1JI1A 4R26L 1SBBA 4V1DB 5C0BD 3TESA 2EC8A 5GGRY 1WAAE 5EZLA 2G5RA 5JOPD 5AWNH 5E6IC 3HPJB 3VI4E 1Q9WB 3I9GH 3EDKA 2DWDA 5CINH 4LLWB 4ONHB 4JFPA 3BI9X 4KU1A 4OGXL 3REWA 2M2DA 3FQRA 4MA1C 3OAZH 4JFDD 3LD8B 4OZFB 5J57B 4HH9B 3P0YH 3ARVA 3TVMD 4CAGA 4NIKB 4XNQB 4M1GH 4JO2H 1JWSB 3QG7L 3VA2C 4QEGA 3PV6A 4HPYL 5EBMB 3KJ6H 3S36X 1N59A 3I75B 1T20A 3T04D 3TIDB 3NFPB 1S9XB 3CK0H 1JNLH 4JY6A 4DGIL 5C0RL 3L9RA 3WD5H 1YA5A 1JGLL 3AREB 1B6UA 3QIBC 2XPGA 5IVXB 1U8PA 4FFZH 4O5LL 2DLTA 1MHCA 4X9FA 3RPIB 3V4VH 3I85A 3T4AA 5D6CB 3IDJA 2YPVL 4RFNC 2Y23A 3RL2A 3MRGA 3VXRB 4DCQA 4IMKA 5B21A 2X89A 2K3TA 5JPNB 3ZL4H 1S7SB 5MHSE 4Y5XA 4HWZB 5C0BA 4WFFE 5EIIB 1L9NA 4FQIH 2QHRL 4MGXA 4O2FB 1F6AB 3F7YB 4XAKD 2B4CH 4MAUH 2Z4QA 4OCXL 1MI5E 5FGCB 4JFDA 1IFHH 4KUZH 3TVMA 1UWEL 1OAQL 1F02I 3FFDA 3MODL 2OXHA 1AD0A 2MQCA 3SCMD 2Y5TB 1H0DB 4WI6A 4A2MA 4BSVA 4BQ9A 4CU8A 3KPPA 4F58H 1PSKH 4DZBA 2R69L 1I1AA 1NEZB 3DSNA 5FA4A 5KS9F 2FJGA 2XTJB 3O6FD 1A7RL 3HFMH 2ADIA 4RRPG 4Y16D 2D9CA 3HRZB 1P7KB 2ZUSA 4Q74A 5E8PA 1DBBH 2MKLC 3A67L 5EUOF 5F89B 4GMSH 3TNNA 3K80A 1JK8B 4NZUH 2YMXL 1BD2B 1QSFE 1DFBH 3FAXA 4MQ7A 1D5IL 2XKNA 4HF5L 5HHPA 1MCBA 4QHLB 1JNJA 5C6TH 5SWSE 3HZVB 3QUML 4NO0B 2WIMA 2ICCA 3GM0A 4YHPB 4PY7A 1MFBL 4RGMC 3VGAC 3WL9A 3RAJH 3IDYB 5T1KB 1NMCC 1ZT7B 4NN5C 5HGBB 3HC3L 1G6RL 4YXHH 3CFKA 1XCQA 2P7TB 1TZIB 2MQ3A 3VXNB 3M8OL 1NGYB 3O11B 4WI9A 3WFEH 2IFFH 1RZ7L 3HMWH 4KHTH 4XCEB 3SCMA 5KG9B 1G7HA 4OD1H 4FABL 1BEYH 3UO1H 2EH8H 3PQYD 2ZCLL 1RUQL 2VDOH 4MXQC 5CJOH 4CN1A 1N64L 3MV8A 3O6FA 4X6DF 4Y0GA 3CDYA 4Y16A 2VMFA 1YQVH 5IGXH 3BGAA 4I48A 4DFHA 4TQEH 1H9VA 1JN6B 4AEFA 2PN5A 2P5WE 1NCWL 5IJVB 3QJFB 3FO1A 4HKZB 1DEDA 6CGTA 1MCQA 2K7PA 1QP1A 1P2CB 1R3KA 3FQWB 5DJCB 3MRRB 4JQVA 1VCAA 3BN9C 1EHNA 2ZG2A 4HXAL 4XPHH 4R0LB 1FH5H 2QSCL 1UKTA 2WQRA 1U3HD 2W1NA 4XXDA 5CJXA 3HA0A 4HJGA 3EFDH 4UTBL 1J8HB 5FM5O 3U9UB 5I19H 4LAQL 5C7XL 4CDHA 2E8ZA 3INUL 1A3RL 3UPCA 5I66B 1C12B 4Y5VB 4JM4H 5H2BB 3K8KA 1FZMB 1QBML 5E0QA 5KVFH 2NX5E 4LHUD 5I1AB 4PG2C 2CDGA 4YIQB 3HLAA 3KLHC 4J4PD 4OLWL 3ZDXE 2XNAB 4YUEH 3PQYA 4LKXB 4EN3D 3QEQE 1UB5B 4NKDB 1KIQA 2Z31C 1OL0A 2ZJSH 3STLA 3E6HA 4YPGB 3MLWH 1VGEL 2MJWA 3GFUA 4LPCA 3V6ZA 4Z78A 5E70A 1MPAH 4L5FH 3L3IA 4L1HA 3CVHA 3WNKA 1PQZB 2BRRH 2BY2A 4ORGA 5D2NC 4QTIH 3WFCH 2X41A 5EU6D 1KCVL 2E7CA 2NXZD 2X1PA 2Q7YB 2WLYA 3RA7L 1ORSA 3H9SD 5E2UH 5C2BL 3S36L 4QXUH 1SJHA 1JTOA 3AGVA 1U3HA 4X7SH 3D48R 3W0WD 2ICWJ 1NFKA 1A5FH 4M7ZC 4OZGE 5L2KA 4G8IB 4XPFH 3FB7A 3ISWA 1DDHA 1MNUL 4WU7B 25C8H 5D9SB 1B2WH 3CMOL 4E42B 4I3SL 5C2UB 1NLBH 3LKNA 4LIQH 4HIIB 4LLMB 4YHLH 3VI3F 1S8DA 1T7YA 2AI0L 4AM0A 3OB8A 4LSQL 4I5BA 4J4PA 4XMKL 1Q9LA 3RY6A 3OKNA 4H0GA 4BUHA 4UIKH 1IRAY 2X4RA 1FJ1A 4EN3A 1D9KB 2C7UB 1IAII 3O9WC 3O45B 3FFCE 4NQDA 3CFBB 5EPMB 3KPSD 2ITDB 1JGDB 4LL9A 4F3FB 5ICZA 3RPKA 4KMTH 1JHTA 1VEPA 2D7TH 3P30L 4XZUA 1DUZB 4G43A 3MRNB 4S0TD 3OV6A 1SEBA 4R4NC 4R90H 5C1MB 1IEAA 3F58H 3JWOC 3CXDL 5DJ0A 3MYJA 2R23B 1GGIL 2R2HB 4WO4C 4MVBD 1YEHL 5FUOL 3LEVL 5EU6A 3RZCD 4KI5C 3QNXA 5MERA 3H9SA 4MJIE 3TO2A 2B39A 5D96B 1RJCA 2DWDB 4JFPB 4OI8A 2VXVH 3SGDI 2XXCB 3CFJA 3REWB 3MNWA 3W0WA 3FQRB 4LFHG 4FRWA 3MC0A 1B0RB 4U1KA 2LABA 4M6OL 4F2MA 1GIGL 4F33A 2BOBA 3VFSA 1QSEB 4UT7H 3PV6B 3VFPA 1TQBC 1R0AH 2FRGP 1T20B 4LFHD 2NY2D 3ZE1E 4JY6B 3L9RB 4DVBA 1MLCA 2FLRT 4TUJA 2CR6A 2XPGB 4GXVH 5AD0A 1U8PB 1ZA3A 3VXOB 3GO1L 5F7NC 3T4AB 4XP9L 3IDJB 3KPSA 3IDIA 3MRBB 4QLRA 1XZ0A 3W5NA 1BGXH 2FWOB 4OLXH 3EHBC 3LCYA 2O5ZH 4UU9A 5C08D 3ARGD 3CH8A 3RL2B 3MRGB 1AXSA 4IS6A 5SWQA 1JVKA 4DCQB 2MCG1 1QKZH 1JPSH 3RVTD 1JHLL 3PHSA 1IKFH 1KIPA 4Y5XB 1H15B 3RZCA 2O93L 4NO3A 4WUKL 3JV5A 3P9MA 3MRPB 4Z7WA 1FYTD 1CDYA 4U6XA 1IAOA 4L3ED 4KKAD 1A6VL 1IKNC 5I76A 5ALCH 3FRPG 1I4FA 3GBLA 1FSKB 3ECBA 3G6JA 4OTXL 3LHPH 3TVMB 4XBGA 4JDTL 3VG9C 5CGMA 5IMOA 1U9KA 3SKJL 4KZEH 4PFEA 1AD0B 4X6BB 4JFEE 5L88H 2GTZB 4NJAH 3KPPB 4Q9CA 1XCTB 3MRCB 1Q1JL 4OLEA 4LNRA 3QULA 5FA4B 3VFTB 3RY5A 1Q0YH 2ADIB 5GISH 4MQXC 2R8SH 1KBGL 2PO6B 1U3YA 1XF3B 3TNNB 1N5YL 2FEDD 5C71A 4OM1H 5C08A 3ARGA 4B50A 4NO5A 4KK9D 4NKMA 4Z77A 1IAIH 2D7NA 5HHPB 2HFFA 1H5BA 2HT4C 2HMID 4KPHH 3X11A 1J0IA 3QCVH 1H8NA 2E9IA 1FYTA 1JFQL 3WL9B 1J1OH 4L3EA 4B7LA 3VFUA 2Y9RT 1XCQB 3CFKB 4MA8L 3ULUL 2J8OA 4PYHA 1MFDH 4PJ5E 3W2DH 5C0EA 1I8LA 5HGHA 4NRYB 5K9JH 1S7WA 2DICA 3SGDH 5DUPL 4JANB 5B3NA 4QRPD 3DVFA 5KS9E 5CP3H 4XMPH 5T3XD 3HCVA 1G7HB 2C3VA 3O4OB 3MA9H 1R3IH 5BS0D 3DURB 2IALA 4KQ3H 3SE3C 4MJ2A 4DEPB 2FR4A 3O6FB 3CGTA 2ARJA 4HUKB 5LQBH 3VWKC 1HCFX 2RBLA 3JTTA 1FIGH 3TZVC 1YEEL 4YHYC 4X6FA 1QO3A 1ZVYA 1BQLH 4HFUH 3V0WL 4XCYA 3ABZA 2OI9C 4IEFB 4HULB 1I3GL 1TJIH 4Z7WF 2DJSA 4UV7L 1NCTA 3LQAC 1YPZE 4HPOH 1FFOA 4JPVH 1R3KB 1NLDL 1ZHLA 4Z8FH 5J13B 4HUVA 4PG9A 3KPRD 5I1GL 1OSZA 2GY5A 4KJWC 1FGNL 3AMLA 4HJGB 3BQUD 2H32H 1Z0NA 2WBWB 3SQOH 3U6RB 1E4WH 1IGCH 2ZKHH 4G7VH 4GBXD 5IESL 5KSAD 3L3OA 2ZUYA 4OQTH 2J2ZA 3LS4H 1KJ2H 2P4AB 4BQ6A 3P4OA 4OCNC 5HD8C 4QRPA 2IPTL 5ELIA 4X6DE 4JHZA 2QJDA 3V5HA 2CDGB 2AKRA 1LILA 1T5WA 2J5LB 3WHXA 1Q0XL 3DPBA 3PQYB 5BS0A 3EAKA 3EKCA 4YDLB 3QQNA 2VR5A 4NKIL 4PP1C 4WIQA 1VFUA 2NY7H 4HKXB 4MQSB 4TUOB 3SPVA 2DQEL 1KIQB 5JQHC 1I1YA 4P9ML 5F71A 3STLB 3ULUE 3WIHH 1MCPH 3NCMA 3KPMB 4GRMA 4JFDE 4J2XA 1CLYH 2BC4A 4Z78B 5CIPH 1YMHA 3WDHA 3O2DA 5B38A 1BZ9A 3X3FL 2E6QA 3GSVA 4LCCA 3CVHB 4WEMB 3D0LA 5JW4Q 1AKJD 4G5ZL 1O0VA 5F1KC 2BXYA 5ILTL 5CEZH 1ORSB 1MCCA 1OW0A 3BOVA 3DYPA 4RAVB 2OR9L 2ZZUT 1SJHB 3H3BC 4P2QB 4ZG1A 5FECB 3KPRA 3IB4A 1U3HB 3BQUA 1PW3A 3UBXI 3VCLB 1F6LL 1UWGH 2VDLH 4NDMA 4NZDA 4AIZA 4M7LL 3T0AA 1H3TA 2J8UE 3FB7B 2QQKL 2R1YA 1DDHB 4GBXA 5KSAA 3G5ZA 1RZJL 1A6ZB 4PJ8B 5EFIA 2DRUA 3ARQA 4PRDB 3DJ9A 4G42A 3VXSB 3WFZA 4RWYL 2CGRH 5BJTB 2ZCHH 1S8DB 4LHUB 1YNLL 1MWAA 4X7EC 1H3PH 5FYLL 1XMWA 4I5BB 4W4OC 1Q9LB 5IW1A 3OKNB 5JW3H 4ZFFA 4HUXA 2X4RB 1FJ1B 3ZT7A 4GRLC 4HEPG 4EN3B 5E08L 1DBJH 3R06B 1N0XL 5TE7H 3MRLA 1D3CA 2ED8A 4XAKE 5ICZB 1MCWM 5FEBA 4LLYA 4G43B 4OCMC 1SEBB 2EYRB 1IEAB 5DJ0B 5E5MB 3VRJA 3LB6C 1F58L 4GKNB 4WW1B 1AKJA 4LAJH 3DVNA 5E9DD 5LBSH 2NXZB 1LO3L 3QNXB 3S4SB 3H9SB 3NACL 4PJHB 2K9UA 1MAJA 2YD1A 3D1MC 5JW4N 2AERT 4QHUA 3AVEA 3BP6B 2XKSA 3MV8E 4XBPA 3MNWB 4MB3A 4RMQA 1LE9A 2EZ0C 2XRAL 1ADQA 2DIAA 4HJ0D 1FLRL 2I5YH 3OR7A 4U1KB 4FXKA 1KJ2B 5DMYA 2BOBB 3LD8C 3VFPB 4JO3H 2P47B 4O2CA 4ZNEE 1MEXL 1UM6H 4LVOB 1UZ6F 1WWBX 2F5AL 3NTCL 4TSCH 5F6IC 1MLCB 4N0FA 4TUJB 1JF1A 5AD0B 1ZA3B 3ILPB 4X0KA 3HKFA 1BFOA 5AYUH 2CR3A 3AREC 3CFCH 2IF7A 1XGTA 3C08H 3CLFH 3KPSB 1JPTH 3LRHA 4U2YA 4UU9B 1U0QA 2XZAH 4LK4A 3T0ED 4ELMA 5IEKA 2B7DT 5SWQB 5CILL 1OGTB 4K71C 3DXAE 3LEXB 4L9LA 5I1KL 5JMOC 1KIPB 1M05A 4Z7NE 5E9DA 5FYLE 3RZCB 3MRKA 3JVGC 3V5KA 4AQOA 1JNNL 3H42H 5F88A 2XZQH 1IAOB 2A83A 3U7AA 3P3YA 5I76B 4J1UA 1I4FB 4XT1C 1U91A 3UAJC 3G6JB 1V3MA 3J8F7 4XBGB 5DD5L 4I2XA 4LRNL 1W72H 2EC9U 1TZGH 5KANG 4F57L 4NCC1 3IU4L 1UWXK 3HR6A 5CZXC 2KPNA 2NY2B 4GAFB 5BCAA 5IBTH 1M7XA 4LNRB 3QULB 3OL2A 1IE5A 4K23L 4KK6C 4E5XA 1T03L 4YDKL 1FL3A 2Y25A 4BZ2H 1NCDH 2XTJC 4EUPH 1INQB 1MF2L 2OXGA 2YD9A 2OJEA 4AT6A 3T0EA 3FQNB 2QSTA 1HQRA 2UWEB 5L2KE 3T4YA 4LPXA 4NKMB 2AJXH 4GH7B 4Z77B 3QQ4A 1HH6A 1KCRL 2V17H 4CADA 1H5BB 4A6YA 2YD6A 2YOCA 4LCUA 4UB0L 2QR0A 3X11B 1KLGA 2EYTA 4XWOD 3SJVE 1LWRA 3MUGA 3O6KL 5IB2A 4OSUL 3DBXA 2IQ9L 4ZAKB 3VFUB 2RQ8A 1XGPB 4NQDE 4XVUD 5E1HB 1IC4H 1AC6A 2Y72A 3GB7A 3GRWA 3MJ9H 2A1WL 3IDYC 4OCWL 5F7YC 2O5YH 4EDWL 3QBTB 4KJPD 1UB6A 4K7FB 4XCFL 1OM3H 2H8PA 3HCVB 3CX5K 2C3VB 4XMLH 4ELMF 5FHAL 4WFHE 3KVQA 5EU6E 3F5WB 3QCTH 2IALB 2C4XA 3OJDB 2VDML 4ZOCA 2ARJB 5DHVH 1CR9H 4KZDL 4X5XA 4X6FB 1QO3B 3W0WE 4QT5B 1MHEA 3MV7E 4XCYB 2JJSC 2DI7A 3Q6GH 1UJ3C 5TDOA 1SJEB 2Y07L 5D2LF 1SEQH 4D94A 1FVDA 1JTPA 3JV6A 1FFOB 5TE4H 3SKOA 4GAYB 1DSFH 1ZHLB 3MJ6A 3FZUC 4LLVB 2L7JA 5FM5M 4PJ7A 2FDBP 5MEQB 4HUVB 2ZP0T 2NXYD 4AMKL 1F4XH 1OSZB 2ZWLT 2DMBA 1IAMA 3CDFA 3ZKQD 4R0LC 1MCDA 4NSKA 5F7DB 1P9MA 1EHAA 1LO2L 4HCRA 4AG4H 4HZLA 2OLDA 4HIHA 5ETUB 3PGFL 1RUAH 3K46A 4QRPB 2WMPA 2BERA 2EH7H 3QIUD 4NUJA 1INEH 3V5HB 2AKRB 1T5WB 5E1AA 3WHXB 4Z18A 5BS0B 3L7EA 3EYSL 1Q72H 2J6EA 3OAZK 3LKOA 5IT2L 4QRQA 3P0VL 3EYUH 4P4KC 1PG7H 4H20H 3SPVB 2FLBT 5L7XL 4EUPB 5BMFL 1QHOA 1YNKH 1I7RB 4BM7A 1QRKA 5F3HA 1IGYB 2BC4B 5DZLA 1O7VA 1YMHB 3MLPA 5B38B 1NBVH 4G8EA 4WFGD 1RQ5A 3HNVH 4M8VA 3D0LB 4N0UA 5HY9A 4R26H 3GUTA 5I1JL 2VLJA 2NW2A 4J3SA 4ZQKA 1CDCA 1I1CA 2JB5L 1KB5L 1UH4A 3MX0A 4BFGA 2C3XA 4FTVE 5GGUA 5CD5D 2VZTA 4OGXH 3GBNL 4X4YA 2QL1A 8FABA 1MRFL 2DD8L 4PRNA 3HZMB 1HE7A 3ZKSD 4PRID 2XWBB 3BQUB 1T4KA 4YLQT 4LDLB 4NDMB 5BVJB 4PLJC 1ES0A 4JVPA 3QG7H 4M9OA 1CL7L 5FXCH 5CJQL 5KSAB 4HPYH 3G5ZB 2RIKA 2VL5A 3UZQA 5EFIB 3HI5L 1UC6A 4G42B 2C1PB 4GFTB 2MWCA 4I0PD 3QIUA 5C0RH 4DGIH 3BXNA 2JE8A 2DM7A 4HUXB 4O5LH 5SX4I 1A3QA 3I6KA 4MNGE 3QPQD 3V4PL 5GRVK 3OAYH 3ARFD 2X7LA 1FYTE 2YPVH 3MRLB 3C2AL 5C0DA 1TVDA 1D9KC 4PJ7F 1CYGA 4LLYB 5HYJE 1BBDL 4G6AC 1FAIL 3WLWD 1A7BA 3FONA 3VRJB 1Z9MA 2A6IA 1AKJB 1WICA 4JZOB 4PJ9D 4JR9L 1J1XL 2QHRH 1CI5A 2NY6D 4JZNA 2EEAA 1AJ7L 4XHJD 5DJXA 5FCUL 4QHUB 1TETL 4OCXH 2X44D 4XBPB 4PRIA 1LE9B 2DL9A 1UWEH 5D96C 1OAQH 3CX5J 4W6WB 4PJXA 4YHZL 1F4WL 3MODH 1FNEA 5CGYD 5FUCE 4O2CB 5D70L 2BY0A 5ERWB 4I0PA 1GOFA 2R69H 1J5OL 1RZ8A 3WNMA 1A7RH 3OBAA 3QRFM 1WQVT 1CXFA 3A67H 5L9DL 1BFOB 4PJEA 3UX9B 3EOTL 3ZKMD 1S7UA 1KG0B 3ARFA 4HWUA 2CIKA 1IZKA 5FO8B 4ELMB 2YMXH 4PV9A 5DQDL 1D5IH 4HF5H 1EZVY 1HHJB 4LKCA 4NOFA 4YHIB 1QFHA 1ETZB 4I0KA 4PJBF 3QUMH 3DIFB 1CF8H 4IMKC 1MCSA 4PJ9A 4F7MA 2V5TA 5DVLA 1JZ8A 4GSDL 3OB0H 1N5AB 1MFBH 3MRKB 3PGCA 4Z7OF 3SO5A 2P49B 1K4CA 5F88B 3ZHLA 4Y5XC 1EEZA 2A83B 1VEOA 5D7LD 5JHDE 1G6RH 2X10A 4J1UB 4ODXB 1U91B 4OGZA 3ARZA 2AXHA 2N56A 1ADQL 1RZ7H 1UZ6E 5HPMA 3CC5A 4GRWB 1FSKC 2EYSB 1I8KA 3TVMC 5J1SC 1WZMA 4FABH 4NRZA 2ZCLH 1RUQH 1N64H 4JKLA 3G04A 3K74B 1SYVB 3O81A 4QOKD 4H1LG 4E0RA 1EO7A 2HJFB 4UOJA 3ZLQC 1FL3B 15C8L 1JMXA 4HBQA 4ZS6D 5J1AB 1IBGH 1T89A 3NGBB 3KYNA 5B8CA 1NCWH 4AT6B 2CLRA 2W0KA 3T0EB 1HQRB 5SX4H 4Q58C 1S7TA 4R2GD 3T2NL 3QQ4B 1E27A 1HH6B 2KZ1B 1NCCL 3GSOA 4TNWK 5GRWA 5C09E 3W5MA 4CADB 3S3JA 1J0HA 3HMXA 4A6YB 2YD8A 2CRIA 2FZ3B 4PJXF 4HXAH 5T1MB 4HJJL 3ZYIA 1KLGB 1RPQA 4MHHI 2EYTB 4X9GA 4QF1A 2QSCH 4R97C 2BHYA 1QVOA 3DRQA 4UTBH 5D7LA 5IB2B 1JZ7A 4LAQH 5HI3D 5C7XH 3INUH 1A3RH 1NCNA 2QHLA 1DQML 3GB7B 3TBTB 5L8JB 2LFGA 5HHOE 3BAEL 4PJEF 1UB6B 4N8VB 5GGRA 2IAND 1BREA 2WP3O 5F7FA 2XFXA 4JB9L 2IPUK 3PWNA 2H8PB 3RBSA 4OLWH 2EECA 4Y4FB 3QZWG 2VN7A 4N8PA 4OZ4B 2IPKA 1KT2A 3SCMC 4JO4H 4QOKA 3MLSL 2J3SA 1ZHBA 4M8QB 1C7TA 1OD9A 2PTTA 4ONFL 4X5XB 4DEPC 3O6FC 2YWZA 1VGEH 4Y16C 1MHEB 3FOMA 1WCQA 5JW4R 5TDOB 2FO1A 3B5HA 3LH2L 3QFJE 3T0BA 1S9KC 5I1EH 1KCVH 1BWMA 1FVDB 3JV6B 1AP2A 3RA7H 3SKOB 5C2BH 3BKCL 5CCKL 2BNQD 3S36H 2YN5A 1G9NL 3SKUD 2O61A 2XZCL 4JQVC 3KYKL 3QUYD 5TQ0L 5J13C 4TVPL 5DD1L 1MNUH 4NSKB 4C59B 4JEGB 5CJXC 3CMOH 3MV9D 4HZLB 5C0IA 3PL6D 2IANA 2AI0H 2ADFL 1K85A 4XB8A 4LSQH 4M6ML 4XMKH 3IDMB 3FB8A 3W11C 1A7NL 3CFDA 1HEZA 5DK0A 4H8WL 3LKOB 4QRQB 2J5LC 3MREB 2ERJB 2VUOA 4YDLC 3NFSL 4TPRL 3P30H 5D2LE 3DUUA 4EEEA 4LLQA 2FCBA 3CXDH 1GGIH 2ZNWA 4G8EB 1ZHNA 1YEHH 4KVCL 1LDSA 1NKRA 5FUOH 3ARWA 5HY9B 3LEVH 3GUTB 3QP3A 2NW2B 1BZ7B 4K7PX 3Q0HA 3WMSA 3X3GL 1P4BL 5GGUB 3FFCB 4X4YB 8FABB 2VH5L 4Z7UF 4PRNB 2WANA 2NXYB 4K8RD 3QUYA 3P2TA 1DQTA 2VR9A 5HHME 1ES0B 1X9QA 4YXKL 3HC4L 4M6OH 1GIGH 1U3HC 2VL5B 3GJFH 5E8NA 4XB7A 1ZAGA 2BSTA 4S1SL 4E41D 3Q6FA 3V5DA 1Z9OA 3KS0J 2V7HA 2BP3A 2IH3A 3SGEI 3I6KB 3V52L 3GO1H 5ESQA 4FS0A 3VFVA 5F9WB 4XP9H 4J4PC 4K9EL 3RY6C 1ZA6B 5EO0B 5EBLB 2XI9A 5C0DB 4TVPE 4EN3C 3DX6A 2P8MA 4WWID 3UJJL 1BQHG 1JHLH 3FONB 4FQLL 1RZIA 1X44A 1KN4L 3X14A 5JO5A 4WUKH 2J8HA 4TVSa 1EX0A 4JZNB 2QEJA 3CUPB 1M4KA 4K94L 4OT1L 1A6VH 3R4DA 1NBYA 1QA9A 4PREA 1BLNA 4OTXH 4PRIB 3BMVA 2J7LA 4JDTH 1DUYA 3DLQR 4PJXB 1P53A 1QUNA 4JDZA 5I17A 3L3JA 1DQJA 2JKXA 1FNEB 3SKJH 3MQIA 1RU9L 2GW5A 5BV7L 4JRWA 2D0HA 3OMZA 4I0PB 1Q1JH 2VAAA 5LWYL 1MJJA 1RZ8B 1JBJA 4LVOC 1KBGH 2UYLA 4PJ7E 3D5OF 2CDEB 4PJEB 4I8DA 1FGVL 1S7UB 3ARFB 1N5YH 2CIKB 2DQGL 2V5YA 4X4XA 1X5JA 1CS6A 4D3CL 4PV9B 4Q9BA 3NCFB 3FTGA 3MLTA 5I8KL 4LKCB 3N85H 3JUZA 5DK3A 1T5XB 5TF0A 1HDMB 2Z0BA 4PJ9B 4XPAL 4F7MB 1U8JA 4X7TA 4PIRF 3BX7C 2NY6B 2GT9A 1R3JB 3MBEB 3PGCB 1WIUA 4MVBC 1F6FB 1BQHA 1JFQH 1FO0L 3OAUL 3ZO0A 1EEZB 3RZCC 3QI9A 3ZKXB 3MRJA 4JRYE 1IM3B 1L0QA 4MA8H 3ULUH 3MMEB 1BAFL 3SGKA 3KNBA 3F7VA 1A9EB 4HSQA 4HKJB 4KKBD 1QACA 1MCFA 1OT2A 2AEPL 4GG8A 4PGCA 5DUPH 2Z9TA 1D6VH 4XX1G 3ZHDA 4YBQC 1AD9A 1T2JA 5DC4B 1B3JA 3N1PC 4N0UE 4NRZB 3FHAA 1AQDA 3E0GA 4IOSD 4D0DB 2VLJE 3P11L 1XGUA 3G04B 5ITBL 3VXMD 2NY2C 1I3RA 4WEBL 1YEEH 3DVGB 4PJGA 1IGML 1UM5L 2AEQL 3V0WH 5D1ZD 5B8CB 1RJYA 4NBXB 4U1GB 3VFOB 1I3GH 5I18L 4PJBE 3QWRD 1CFSA 4UV7H 3H8NA 4OD3L 1S7TB 4OFPA 3SGEH 4IRSD 4X9BA 1E27B 1XGRA 3C09B 4JZJA 1QR4A 2Z92A 3ARGC 1NLDH 5F3BA 3T8XA 2NR6D 3NPSB 1YEJL 1A6TB 1ZS8A 4HUNB 3RVTC 1H5BC 1F00I 5EZJA 1QLRA 4QF1B 5I1GH 1FGNH 3DRQB 5D7LB 3LKSA 2BY1A 1HH9A 5IESH 2R0WL 4KKAC 1M71A 4Q6YA 1YPZB 5IP4A 5HGGS 5HJ3A 5E2VL 5GGRB 2IPTH 3NFNA 1JZ3A 4YO0A 3PWNB 4U49A 2W60A 4TYUA 5IB1B 1Q0XH 1I8LC 3S97C 4LCWD 4NKIH 3RWGA 2IPKB 1KT2B 2OYPA 3S96B 4LSUL 4OZIA 3V6OE 2AK1L 3RWDA 3VXMA 5DD6A 4QOKB 4KY1L 2X70A 1ZHBB 2DQEH 2V9TA 4P9MH 5GPRA 5BVPL 5DGQA 5D1ZA 4HC1A 1ZSDA 3BEWA 3FOMB 4HUUB 3QWRA 1UCTA 3X3FH 4Y1AE 2IBGA 3JWDC 1AGCA 1V7ML 4Z7VB 4IRSA 2P5EE 2FEDC 4P5KA 1MCRA 3PE9A 4G5ZH 1PGRB 4YAQB 4F7EA 5GSRA 1AP2B 5ILTH 4KK9C 1D5ZA 3G5XB 4M1CD 2OR9H 2NY5C 5DQJB 4U1MB 4YJZL 1XF5A 4H25A 2HMIC 1QPPA 2ITCA 4NQCD 5JA8B 2O61B 1F13A 2JJWA 5EA0L 4JFQA 1EMTL 4M7LH 2AW2A 3PJSA 2QQKH 3ES6A 3MTRA 5KAQF 2RGSA 4UOW1 1RZJH 3QB7C 3A6CL 1EO8L 3GMOB 2BFVL 4RWYH 5CZVL 2B20A 3AXLB 2DS4A 2IANB 1YNLH 1JTTA 5FYLH 4HWBA 2MPAL 4WW2A 3CFDB 4LCWA 1TQCB 3M17B 1P1ZB 4TSAL 1N0XH 2AJUL 3RP1A 1N7ML 3DYMA 4LLQB 4GOSA 3RIAF 1F58H 5F7WC 3T3MF 1ZHNB 1RSFA 3VH8A 2OTPA 5DJ2B 3AAZA 3VA6A 4GXUM 5DSCA 5HYFA 4U1HA 1EGJL 4ZUWA 1OQXA 3RWJA 4D9RE 4PB9L 5IMMB 3NACH 4P46D 2QADD 4LCCC 2BNQB 3UROR 4ZFOL 5E7FA 4ODUA 2G2RA 2H9GB 3CXHK 2X1OA 3DETD 4NQCA 1KENL 2EXYD 5CLWA 1OW0C 3QUYB 2DIBA 1FLRH 3LEYL 2B2XL 3WXWH 5GS3A 1OARL 3EDEA 3DO7A 5C9JA 4P3CL 3BQUC 3MV9B 1WVZA 1MEXH 3PL6B 3HAEB 5E8NB 3VGGA 4GBXC 4LBEA 2F5AH 3NTCH 5KSAC 1TXKA 1ND0B 3Q6FB 3V5DB 4U6HA 3O6LL 2V7HB 2XKUA 3GSXB 1H3WM 3EZJB 5GHWL 1SVZA 3TJHD 5CP7A 2R4SL 3QUKA 3HE6B 4DGVL 5JW5B 4X99A 4JHBA 3C8DA 3IF1B 4JKPL 3DX6B 2P8MB 5CILH 2JCCE 1KPRB 3ALPA 3KGRA 4PGDA 2VL4A 3SE8L 4LEXL 4NWUH 5I1KH 4JVWA 1EVUA 3BZFB 2XQBL 4Z7UE 4P46A 4MJ6A 1HNFA 1CGXA 1V3JA 1VFOA 1NBYB 1QA9B 4FFVC 4PREB 4ZOBA 4LSSL 1RZKL 4WW2F 1DUYB 2FATL 2JLLA 5DD5H 5EZOH 4LRNH 4LQ1A 3B3IB 5TQ2L 3FMGL 4F57H 5I17B 3U36A 4OCSL 3KLAA 3IU4H 4BK4A 5HSFA 2CXKA 3NIGE 1ZK9A 1XT5A 3ESUF 4E41B 5E56A 1MJJB 1IC1A 1Q8MA 5C0ND 3WEXA 3I02A 3T2OA 4OKVA 4K23H 4S1RL 1T03H 1QSVA 4YDKH 3RY4A 3BWAB 2H2PD 2LU3A 1X7QA 1MF2H 5IWLA 3V2AR 2AAVA 1QLEL 4X4XB 2VN4A 3FTGB 1RUKL 2F53E 3MJ7A 1JNHA 2VLRE 1S5HB 1WBZA 4UB0H 5FKAA 4ZXBD 4JHAL 1MVUB 5BW7A 1ACYL 1CL7I 5A43C 2CKBL 4X7TB 5B4MD 3P4MA 5IK3B 2GT9B 3UTPD 3VXPA 4C56D 1W0WA 4L9LC 5HVFB 1BQHB 5FYKD 3O6KH 2CKNA 2FB4L 4OFVA 4OSUH 1CQKA 2XA8L 4Q2ZA 1DTUA 3HNTL 3U0TB 2BSSA 2IQ9H 3MRJB 5JOEA 3SDDD 3LKRB 1JF5A 3KNBB 3F7VB 1IT9L 1B0WA 2A1WH 1A9BB 4OCWH 4EDWH 4LNVA 5DUML 5HVHB 1G7QA 4PGCB 1LD9B 4XCFH 4LQFL 3EUUA 4HJ0C 4IMLB 1LP9A 2F15A 5GS2D 1AD9B 1J10A 5BRZE 3OKOA 5FHAH 5JLZB 3R0MA 5FK9A 3H0TA 3BYYA 3K4ZA 2VDMH 2BSED 1I3RB 2OTUA 3WO4B 4YC2C 4PJGB 4KZDH 3KR3L 3I6GA 5J6HA 2IADB 1FL5A 1RJYB 1CFSB 4NT6B 4OF3A 5BO1L 2Y07H 2Q7NA 1KF9B 1OP5K 3NGBC 4JRXD 4POZD 1VFMA 4JZJB 5DVOA 3T0EC 2Z92B 5F3BB 2GSIA 4ZXBA 2Q87A 4X7DC 1WTLA 2FSEA 1GHFL 1ZS8B 4R8WL 1J7VR 4RIRA 1PDKA 5EZJB 4C56A 4K2UL 3QXWA 4HD9A 4AMKH 4N5UA 3TC9A 1YN6A 4LSDA 3DNKA 1C08A 3BW9B 3LKSB 4HLJA 3SDDA 3HG1D 3PDDA 1LO2H 4PYGA 3FT4B 1M71B 3PGFH 4JDVB 3RVUD 1FNGA 1NDMB 4IOIA 3B9DA 5HJ3B 3ALXA 1TLKA 3ULVL 1KCUL 3PDOA 5IMLA 1RI8A 1MCOL 4YO0B 3VGEA 3MFFB 2W60B 5TDNA 5J3HD 3OQ3B 1KFAL 1D5XB 1K8DA 4D9QD 2D4FA 4KAQL 3EYSH 2H6PB 5IT2H 1UACL 2QLVB 3P0VH 3RWDB 3Q3GB 3VXMB 2MHAA 4OZIB 5DD6B 2X70B 5L7XH 2HFGL 5BMFH 2I07A 4EI6A 1JGEA 3QO1B 4IDJL 5D1ZB 3CU1A 1HNGA 1ZSDB 3IJYA 3W9EB 3S8WA 3TEUA 4RGND 4IDLA 1J87A 3L6FA 1FNSL 3RVVD 3CVIL 5I1JH 4JRXA 3Q5TA 4KH2A 4F7EB 3RVXD 5GSRB 4R4FL 1D5ZB 1KB5H 2OL3L 3GBNH 1E4JA 1MRFH 4G9DA 2DD8H 5MI0B 1L7TL 4PRPD 3H3PL 4XGZA 4H25B 2VXSL 2ITCB 4YXLL 1S3KL 5K59F 3NCEB 4UV4L 3QDMD 4JFQB 3VDAA 4GW5A 5HGDB 5F7UA 2UZYB 1KJVA 2Y6SC 3QIWD 3HG1A 1CL7H 4XWOC 5CJQH 3ES6B 3B2VL 5DJAA 4FQCL 5C0CD 2CUIA 2QQQA 3HI5H 3LV3A 1FCGA 4NZTL 1IGTB 3TA3D 1NMBL 1ZLUK 4OCRL 4U6YB 3ROLA 3NZHH 1P9MC 2R2CA 4HEME 1JL8A 4DFIA 4KJPC 4JM2F 4LCWB 3V4PH 5A16B 3SKMB 2HN7A 3ZT5A 1DVFD 1L6ZA 3C2AH 3GK8L 2GITA 4PP2A 2A9NL 2ZUWA 1BBDH 4OLYL 3CDGA 3BPNB 1FAIH 1X5LA 4PGJA 3UPRA 2UZIL 2ERJC 3IXAA 3MGTA 5DFWH 2R1XA 1ZXQA 1EH9A 5I6XB 4HC1L 3VH8B 3KXFD 3ULVE 3RHWF 4LSTL 4ZD3L 5DSCB 4U1HB 3TIEA 4JR9H 1J1XH 4I77L 3RWJB 4NN7B 1RIUL 5FFLA 3UTSE 1AJ7H 4D0BA 5FCUH 5C8JB 2P8PA 3ETBF 4ODUB 1TETH 4AEHL 2DYPD 4PRPA 5I0DA 4N9GA 3WUWA 1U8MA 4NQCB 3QXVA 3QDMA 4IIQB 3C8KA 4YHZH 1CTNA 1I9IL 3QIWA 1F4WH 2EIZA 3REVA 2BNRD 2NXYC 5C0CA 3DO7B 3ZE0F 1WWCA 5D70H 3DECA 5E5RB 3VFNA 3TA3A 4X6CF 3U82B 2D31A 1ONQA 3BMWA 4LBEB 3NAAL 2DAVA 2GFBA 1MWAH 2IH1B 1J5OH 4U6HB 1GOGA 5K33A 5L9DH 3QIUC 3DOSA 1NAMA 3EOTH 1QBAA 5CP7B 1WJ3A 2PETA 2WLZA 3QUKB 5FV2A 3EOAB 2GK2A 4X99B 1BJ1H 5DQDH 1IGIL 4FFZL 1HHKB 3V79C 3JZ7A 1PAMA 5C07D 2XOTA 3AS3A 3KXFA 2A0LD 4YDVB 3P73A 3QHTC 3BUYA 4WGWB 2IGFL 4GSDH 4P46B 2QADB 3AY4A 4N9OB 5EIVA 4MJ6B 5GRUL 1NUGA 4PJDF 3N50A 2ARJQ 1OP9A 2DYPA 3ZL4L 2YC1A 1T1YA 4PJIF 2JF1A 4OF8A 1J05A 1EA9C 2V2WA 4XX1E 4K3DL 5CD5C 4RA0C 1ADQH 3MCKA 2OS7A 1Y0LA 3T09A 5D7KD 2JK5B 5KANI 1J1PL 1F8TL 3C87A 5E6YA 5C86A 3MRFB 5GRVL 1P69B 3QDHA 2X4QA 1AR2A 3WEXB 2HTLD 3I02B 4NQSA 3HZYA 4I0PC 5JHDB 2WIIB 4PJCB 3V0AC 3IKKA 4WNQA 3R1GL 2AABL 15C8H 1R5IA 3NCBB 5CWSA 1S9YB 1X7QB 2I60L 1PX3A 1NJ9A 4UZGA 3QPQC 4GT7A 4NCC2 1JGVL 3ARFC 3T2NH 1NCCH 5C07A 1JNHB 3DX9A 2XICA 1WBZB 5DA0B 1NC4D 3TYFA 1U8OA 3WLWC 5DMGD 2PW1A 4HJJH 5IHZA 1NANH 2X5PA 3VXPB 4YDJA 2CXGA 4PJ9C 3OKMB 3SE9L 2BSSB 2NY6C 1CGTA 2VERN 3KPQA 4XHJC 1DQMH 4IJ3C 5HDBF 4PGBB 5GS0L 3PXHA 5F96L 3BAEH 3ZKXC 3L1OL 1LE5B 4TTGA 5C09B 5L0QC 3WS3A 1MIEL 3AS1A 3IETA 4JB9H 4O51A 1LP9B 4M48L 5I9QB 2EIBA 3OKOB 3H0TB 5CGYC 2DQTL 2IWGA 3MLSH 2OTUB 4HX1A 4KHTL 4ONFH 3LS5L 2MTPA 1T22A 5J6HB 1BEYL 5DHXB 1FG9C 1FL5B 1TCMA 4FFWC 3WFHA 2VDOL 3B5GA 3ZKMC 3LH2H 1T89C 2AJYL 5B8CC 4U1GC 2V2TB 3WO3B 4TQEL 2GSIB 4ZXBB 3BKCH 1NC4A 5CCKH 1OAUL 2FSEB 1LEGA 1A47A 4MLIA 3C9NA 4RIRB 1BPVA 2XZCH 1UGNA 3KYKH 2CRYA 5TQ0H 1C08B 4TVPH 5MEND 4ZNCD 1HXMA 2OMBA 3L5HA 3KYMB 5GZOD 5DYOB 1KTLA 5ISZA 3SO3B 4IOIB 2OM5A 4KHXL 4HHAA 3RWHB 2ADFH 3DV6A 4XVSL 2YR3A 5IMLB 1H3GA 4M6MH 4N5ED 2Q86A 4XCNB 5DEZA 4GS7B 3B5TA 3GKWL 3RGVD 1A7NH 1X3DA 4GKZA 1RK1A 1K8DB 3GSNB 4P57A 4H8WH 4WVRA 2BVPA 5IB5A 4PJFA 4YQXL 2MHAB 1CFVL 3D85D 2PCPB 9CGTA 3NFSH 4TPRH 4EIGB 4RMTA 1JUFB 1HI6B 4YFDB 1JGEB 2E9BA 2YXMA 3VXTA 1FLTX 1XF4A 3IJYB 1E4KA 2YBRA 4JGJA 4KVCH 4I9WE 1IEBA 2L0DA 4ZS6C 5DUBA 2VLKD 3RWEA 4JRXB 1WFOA 3FQXA 4ALAL 3B8YA 5HHNA 3MRDA 4OB5L 4WFEE 5IQ7L 4R2GC 3SHSA 5EO1A 3X3GH 1P4BH 3LZFL 2BRQA 2VH5H 4G9DB 1LMKA 3RNKA 1OLZA 2ICWB 4I3GA 4GW5B 5MENA 1I1RA 4B0MM 1KJVB 1W8OA 3D69B 4YXKH 3HG1B 3HC4H 4KRLB 3QO0B 5E2UL 1N6VA 1H3XA 4P23D 5DJAB 3ZDZE 5F9OL 3LV3B 5HI3C 2C4FT 5DJYA 4S1SH 3ROLB 4NC2B 3Q48A 3ARPA 1CXHA 4GKSA 2NTSP 3RGVA 4G7YL 1KULA 1KIUA 3V52H 2VTFA 1OP3H 1B2WL 3M45A 5I0ZA 1ED3A 1DQQA 4K9EH 1AE6L 3D85A 2J6EH 2HN7B 1KUMA 4MLSA 4LIQL 1ROWA 5K9KA 2GITB 3EDDA 3PHOA 4NN6C 4XPGL 5FCSH 1WEJL 2DQUL 3GSWB 2BCKA 5D5ME 2C1OA 3UJJH 3UPRB 1ERNA 3WHE1 3IXAB 1QNZL 5CZKA 2R1XB 4XVJL 1A1OB 4FQLH 4RGNB 2F54A 2VLKA 1VACA 1AR1D 1KN4H 4KKNA 1YY8B 4OGAD 1BF8A 1XGQB 1RK0B 1OB1A 3P4NB 4NUGL 3U7YL 1CDUA 5K59E 3BN3B 4X7FC 2P8PB 4K94H 4J3OC 2GUOA 4OT1H 5DDHB 4PRPB 1QPXA 3WUWB 1U8MB 4GKOA 3MOQA 1W0VB 3MOAH 3QDMB 3C8KB 4JFFE 3QIWB 3REVB 3TN0D 4P23A 3QUYC 5C0CB 3HNSL 1RU9H 4X98A 3V0VA 4IRJD 1EAPA 5BV7H 3VFNB 3TA3B 4KRPD 4MA3A 4QNPF 2D31B 2DLIA 3BD4A 4PJAB 1ONQB 4DKDC 5LWYH 5CMAB 4FQQA 1EFXB 3RWIA 3EJZD 5H8DA 1NAMB 1FGVH 3UTPE 2Q8AH 1CD9B 3O4LE 3HC0A 1FL6A 2XN9D 4U1SA 2DQGH 1DVFB 5IMKA 5B3JF 5A3ID 1BVKB 4DKAA 1AI1L 2DIJA 3KLSA 2M26A 1YYLH 2PTUA 1VENA 3B6SA 3GI8L 1YC8A 2E3VA 4BUGA 1A0QL 1RJZB 3P73B 4N90E 4XNMA 4XPAH 5F1NA 1R5WA 3KLDA 1YY9D 2QQNL 1FO0H 2AGJH 3BKYL 3OAUH 2DYPB 2AV7A 3ARUA 4ODHL 4B41A 1N26A 1Z9LA 1T1YB 3U2SA 4LIQE 1MJ7L 1BAFH 4YFEA 2KKQA 1MCNA 3ZE0E 2FHFA 2V2WB 4YWGH 3IJHB 4X6CE 2AEPH 2B8OT 2E9WA 4XRCB 2BNRB 3TN0A 2DL2A 4K8RC 4IRJA 1FVCA 3C60D 2HT3D 4HWNA 5ESVB 3S5LB 1BOYA 3H6JA 4RMSA 2ESVD 4LLAA 3P11H 2X4QB 2KQMA 5ITBH 4HS3A 5LGJA 2CK0L 4WEBH 1EZVX 2X1QA 1KCSL 4WI8A 5GRYA 4WNQB 3CCHA 5EC1A 1IGMH 5GGTL 1UM5H 2AEQH 2XN9A 4G8GD 4NJAL 5CWSB 5L88L 2AP2A 1NJ9B 4X4ME 4J3UA 5IV2A 1NL0L 5I18H 2WP3T 5H37G 4OD3H 1IC7L 1NBZA 1F4HA 4ZTOL 2UY7A 1MQKL 4PJDE 1CICB 1JZ4A 4EQ3A 3TYFB 1YEJH 1U8OB 3TV3H 4PJIE 3NCYP 3RKPA 5IHZB 1GGBL 4M7LT 1VKXA 4YDJB 5INDB 1IAIL 1CG9A 2HKHL 1EBPA 3D0VA 3KPQB 3V6FB 1WZ1L 4KPHL 4Z95L 5LGHL 1FNHA 2DQFA 2R0WH 4W70A 3IAGC 4JLRA 1U8QA 2VDRL 1NFDA 1E28B 3QI9C 2NY4D 3WS3B 5E2VH 4DKEL 5BV7B 2E7HA 3SGKC 4NQVA 3IETB 3EFFB 4O51B 3C60A 4ZUSA 5HVHC 3HR5B 2GK0A 4QXGL 3BRFA 4KV5E 4LSUH 2AK1H 4ODWA 2ATKA 3MGOB 4KY1H 4WENB 5F70A 3L3DA 3ZE2F 3EO0A 4HX1B 5BVPH 1PZUB 4YBLC 4G8GA 4NO2A 4OZHE 4ONOA 2Y7QA 3RQ3A 1UADC 2NLJB 3WO4C 1K8IB 1S7XB 3V7AG 2IC2A 2VXQL 5IBUB 4ZUTA 2YD4A 4RX4D 1NC4B 2FL5A 2Y4SA 2RJMA 1LEGB 4U33A 3ROOB 1FO0B 3C9NB 5IW3A 3C6LD 4JZJC 4XPTL 5HDBE 5A2JH 4CN4A 1LHZA 2BVUA 1F2QA 5EA0H 1FC2D 1I8MA 1EMTH 4OZFG 4V1DD 3LDBB 3FO2A 2NZ9D 1VB9A 1HXMB 4L4TD 1OQOA 3OSKA 4KROB 2Q6WA 3S35L 4L8CA 4ZOAA 4Y1AB 1UT9A 2W9EL 1DEEA 3OJ2C 3A6CH 1EO8H 5CZVH 2NZIA 4CN6A 2K7QA 3DV6B 3PWPE 2LAAA 3LRSA 4LLUA 4KKBC 3ZTJG 5TDPB 5CEXA 4OJFL 2MPAH 3KXFE 3RNQA 1DP0A 4GKZB 1RK1B 2XACC 4P57B 3MNZA 4L4JA 3Q5OA 5IB5B 2WM0A 2OZ4L 4PJFB 1YZZA 3V4UL 5J9PA 4TSAH 5B39B 3HUJE 4WEUD 1W2KT 2DM4A 2VSDA 2AJUH 5EUKA 4OKDA 3UYRL 3AB0B 4BJLA 4LASL 2X09A 4G9FE 4NQED 4WI5A 1IQDB 5DUBB 4H1LH 5D1ZC 1EGJH 5ICYA 2NY1D 1AQKL 3EO1B 3WJJC 4RX4A 2FO4B 3MRDB 5HHNB 3WIHL 2R2EA 5J06A 4IRSC 1NFDF 3C6LA 3F62A 4X4ZA 1GZPB 1KENH 1TITA 4S2SB 5D8JH 3RNKB 3DX7B 3LEYH 2B2XH 4CDGC 4V1DA 3G5VA 4H88L 5F93C 1P5VA 5MENB 5MI0C 4LVEA 1OARH 5HBBA 1JCKA 5EU5A 2DKMA 1E6JL 4P3CH 4ONHA 5JIIA 2FHCA 1L7IH 5DJYB 2DLHA 4HH9A 4PRHD 4KUCF 4M61B 4GKSB 3T3PE 2VDLL 3L5XL 3RGVB 3O6LH 1NEZG 4Z0XA 2ZOKA 5GHWH 1SY6A 2R4SH 3TF7C 4O02L 1ED3B 3BPLB 5IR1A 1DQQB 4EXPX 3D85B 1X5FA 3E2HB 4WW2C 5K9KB 4DGVH 4P2OD 5C0GB 3AMKA 2EDHA 2JJTA 1UEYA 3ARTA 3PHOB 1LEKB 4JKPH 1DCLA 3UCRA 5JW3L 4NQEA 2Z8SA 3SE8H 4LEXH 5D6CA 3RTQD 1KCKA 1C1EL 2VLKB 4EVNA 1VACB 3BPNC 2XQBH 1PYWA 1Y6NR 3JWOL 1OB1B 3DSFL 2E7LA 3WHE0 1RD6A 1U8KB 3TNMA 1HHHA 2GUOB 4RBPK 3T0XA 4NN7C 2ADJA 4LSSH 2AJVL 4NO0D 4OFDA 1RZKH 1HKFA 2FATH 4Y4KD 2JCCB 4O2FA 5TQ2H 3FMGH 1CWVA 5DK2A 3F7YA 3WN5B 2RFXB 4IIQC 2PW2A 3V0VB 1EAPB 5T1KD 2WZPD 4PUBL 3VRLE 4B7IA 4MA3B 4PRHA 5KN5A 2APTA 1X5XA 3QDJD 1WV7T 3FT2A 4FQQB 3FO0L 5D2NE 4WUUD 1DL7L 1P84K 4S1RH 3MPCA 2Y5TA 1H0DA 1VERA 3HC0B 2ORBL 1FL6B 3J7HA 4GQ9L 5FOBA 4P2OA 1MIML 1R6VA 5IMKB 1MHPL 1QLEH 2DM2A 1RUKH 3IFNL 1CE1L 3OXRB 3LN4A 3O3AB 2J12B 1GH7A 3RTQA 5T3ZL 1MHHA 5ISZE 1LK3L 4JHAH 1RULL 2C9AA 1ACYH 1CFQA 1GRWA 5DZOA 2CKBH 4P9HC 5F1NB 3V9FA 3QFDB 1X5KA 4U05A 2YHGA 1U93A 2MKWA 5FIEA 3RUGE 5EG6C 2VQUA 1JF6A 2FB4H 2XA8H 1AO7E 3HNTH 3U2SB 3QEGL 4P46C 3DUHA 3HZVA 4NO0A 4Q9QL 4XAWH 2WUBL 1S7RA 1IT9H 4K8RH 4JPKL 1YEFL 4YHPA 1IM9B 2Q8BH 3OG6B 5DUMH 4QNPE 3R8QA 3DETC 2EXYC 4KVNL 2YRLA 4LQFH 2VLRB 4XC1L 1II4E 4IRJB 5T1KA 1FVCB 5D7SH 5E2TL 4Y4HD 5IM7A 1VEMA 3V8CA 4P2RD 1TZIA 1BJ8A 4NC1C 2PYED 1NGYA 3O11A 3QDJA 1K9TA 4HS3B 4WUUA 5B3JE 5DT1L 4LPYA 4KI5E 4OUOA 1T66D 2IG2L 5KG9A 5KBNC 3HRPA 3KR3H 3PWLB 2UZXB 5IBTL 3WE6B 4HS6B 3C6SA 4A2LA 1FP5A 3TJHC 1S9WB 5IJKA 5BO1H 2H2SD 5D7IE 1HQ4A 1NBZB 4L8SB 5IWLC 1DE4B 3I2CL 4NBYB 1GHFH 3CSYA 3IRZA 4R8WH 1U58B 3GIVA 1F11A 3QJFA 1VKXB 2FH6A 5FDWA 1MH5A 3STZB 3CD4A 5BW7C 1CG9B 4XTRD 1ZWIA 3D0VB 3PHQB 5IEHB 3FQWA 5DJCA 1GCFA 2UUDH 3QXTA 2VQTA 5JIKA 2DQFB 1GGCL 5ID1B 3TYGL 2YPKA 1U8QB 1NFDB 1MAKA 2EEDA 2FBJL 4FNLH 5CKAA 2LVCA 3ULVH 1KCUH 3RX8A 4NQVB 2VDQL 1MCOH 5T3ZE 1ZTXL 4Y4HA 3U9UA 1PBYA 3C60B 5TE6L 5JR1L 4KDWA 4JQIL 2F54E 4ZUSB 5BZWA 1KFAH 2PYEA 2ESVB 2GK0B 4KAQH 5I66A 1IC4L 4Y5VA 1UACH 5H2BA 5I9QC 3TT3L 2ATKB 1MVFA 1PJ9A 4MAYB 3L3DB 2HFGH 1F97A 3EO0B 3CU7A 5CD3B 4G8GB 5C0NC 4K3HA 4NO2B 4IDJH 1D6EA 5J8OA 1QRNE 4LKXA 1T80A 2Y7QB 1EEQA 4JFYA 4MQTB 3IU3B 1DN2A 1YQ2A 1FNSH 2H2PC 3CVIH 2V5MA 5DC9B 1ZLVH 1OAKL 4Z7QF 3C2SA 2GY7B 2NY0C 4R4FH 1EEUA 1PFCA 2OL3H 2FL5B 3D39D 3QQ3A 3GHEL 3LQAL 1QYGL 2DLFL 1QFWI 1L7TH 4WRLA 3H3PH 1FFQA 4KC3B 2VXSH 1TTGA 4ZXBC 3WIIH 3EYVA 2A73A 4YXLH 3MO1A 1T0MB 1I8MB 2Q7YA 3U30B 4EZMA 5B4MC 3ULSA 3FO2B 2JJVA 3QUXB 4AENB 5BOZG 3B2VH 3UZVB 1BOGA 1DEEB 4FQCH 5DC0A 5I75B 2CO7B 5FYJD 4NZTH 5D72L 1NMBH 4N8CL 4L8BB 1P84J 4OCRH 3SDDC 1DN0A 2W0FB 5F44A 4JY4B 3IDGA 3RNQB 3SEPA 1A6AA 1Q9KB 1QSED 4FQPA 1JI2A 1CU4L 3UZEA 4GS7C 3AC0A 4JFOA 4M03A 4E42A 1T1XB 4LLMA 4HIIA 3GK8H 2A9NH 5EUKB 1YEIH 4OLYH 1FG2B 2UZIH 4CJ0A 4HC1H 5D1XD 2Z93A 3VJ6A 2BVEA 4WWKD 1KXTB 1MSPA 2AK4D 2HTKD 3CFBA 4LSTH 4ZD3H 2ITDA 1JGDA 3VGBA 2APVA 4I77H 2VUYA 3NIFF 1Q38A 1RIUH 5ICYB 1WIPA 3CMGA 3D39A 3QT2A 1HHIA 4QRRD 3B8SA 5D1QD 2WINA 4POZC 4AEHH 4ETYA 3C6LB 5EU3B 1CLZL 1CN4A 1RZGB 2IBZX 3I3DA 3G5VB 1I9IH 4L4TB 4M93B 4LLDB 3BT2L 2GJ6E 4JY5H 5EU5B 2OTWA 2DLGA 1J88A 4UUJB 3ARBB 3NAAH 3TBWA 1B0RA 4NNYA 3RU8L 3RVUC 4Z0XB 4HWBH 5E99L 4MNQE 3F12B 2ZOKB 1QSEA 7FABL 2GIYA 3KPOA 1YMMD 3ZDYE 2EDFA 5IR1B 3BGMB 3MA7A 5J3HC 4W6XB 3BH9A 5ACMA 3HI1A 3S9DB 1VSCA 4NJ9L 1IGIH 1A7PL 3VXOA 1HZHL 4NQEB 5D1XA 2PO6D 4X5WA 1DBKL 5DO2D 4WWKA 2D03L 2IAMB 5I71B 4HV8A 3MRBA 4EVNB 1FRGL 2IGFH 2FWOA 1PYWB 2NY1B 4Y89A 1A22B 5C0AD 3N1GC 5GRUH 4RGNC 3RVVC 4QRRA 5D1QA 3TNMB 1HHHB 1KTDA 3HN3A 3RVXC 4RMVA 2LTQC 2ADJB 4PGEA 3AS2A 2D2OA 3TH3T 3NIDE 1OGAE 1H15A 5SWZE 4K3DH 4YX2L 4J3VA 5KTEL 1R3HA 3MRPA 4MXVE 3M1BB 1CXIA 1QFWH 5DK2B 2Z35A 2A38A 7CGTA 1SHMA 2PW2B 1J1PH 1F8TH 4LOUD 3QIWC 4PRHB 4GW4B 5KN5B 3X17A 3FT2B 4Q0XL 4KJYA 1AHWA 5C0JA 3TA3C 4ISVB 3UP1A 2H45A 3U79A 35C8L 2BJML 1YMMA 2AABH 3R1GH 1F4AA 3NOIA 4X6BA 5JORA 2GTZA 3DX8A 2I60H 1SY6L 3BPOC 4B53A 3OG4B 3OGCA 1XCTA 3MRCA 2VAJA 4P2OB 5FOBB 1CLCA 3VFTA 1JGVH 1N4XL 1NGZA 4LVHB 4TSBL 1HXYA 4GAGL 3X13A 2PO6A 3LN4B 3D3VD 4FOMA 1XF3A 5E8EB 4S1DD 3RTQB 3MROB 1MHHB 5DD3L 3L5JA 5D71L 1CFQB 3BVNA 4YK4C 1U93B 2BSRB 5DFTA 1IGJA 3SE9H 4X80L 3AY4C 4QRSB 2WQ8A 1CF8L 5GS0H 2MSPA 1S7RB 3NVQA 5F96H 4Y4KB 2XA3A 1U36A 3L1OH 4L4VD 1BFSA 4JKMA 1MIEH 4M3KB 4JFXA 5I73B 4M48H 1KJ3L 2VYRE 3BEVA 5IM7B 3QXD