3CVLA

Structure of peroxisomal targeting signal 1 (pts1) binding domain of trypanosoma brucei peroxin 5 (tbpex5)complexed to t. brucei phosphofructokinase (pfk) pts1 peptide
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
317
structure length
294
Chain Sequence
b'TDYPFEANNPYMYHENPMEEGLSMLKLANLAEAALAFEAVCQAAPEREEAWRSLGLTQAENEKDGLAIIALNHARMLDPKDIAVHAALAVSHTNEHNANAALASLRAWLLSQPQYEQLFFFAAPNEYRECRTLLHAALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVGGTTPASREATRSMWDFFRMLLNVMNRPDLVELTYAQNVEPFAKEFGLQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peroxisome targeting signal 1 receptor PEX5
publication title Structural Insights into the recognition of peroxisomal targeting signal 1 by Trypanosoma brucei peroxin 5.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Transport protein
total genus 116
structure length 294
sequence length 317
ec nomenclature
pdb deposition date 2008-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3cvlA00
2VSYA 4N3BA 3FP3A 4BT9A 4HOTA 3S7DA 2AVPA 4GCOA 2WPVA 5G04C 4YVOA 2HYZA 2VGXB 2VGYA 4WNDA 1B89A 3FFLA 2R5SA 2XGOA 3MV3B 1ELRA 5A6CA 3BEEA 4NQ0A 5ARFA 2FI7A 2YHCA 5FZRA 5HI7A 3ASGA 3PE4A 5BNWA 4Y6WA 5EKQD 4HOUA 4GZ6A 3Q47B 1FCHA 4AIFA 3Q15A 1W3BA 1WAO1 3GZ1A 5M72A 4GCNA 3ZGQA 4W9RA 3CVNA 2KCVA 2Y4TA 1KT1A 4GYOA 3CVLA 3ZHEB 3UPVA 3WXXA 2UY1B 2LSVA 3VTYA 3CKCA 2LNIA 4N2QA 3HYMB 2JLBA 3U3WA 4G26A 4BTBA 3ZPJA 5A7DB 1NA0A 4LEUA 5EX0A 2E2EA 3E4BA 3MV2B 1KLXA 3GW4A 4GA2A 4GZ5A 5FJYA 2PL2A 2FBNA 3ZFWA 4U0UA 2L6JA 2J9QA 2FEZA 4HOSA 4APOA 5JJTA 4XI9A 3N71A 3VTXA 2XGMA 4I9CA 3ULQA 1ELWA 4I9EA 4YNDA 3LY7A 1YA0A 1OUVA 4JA9A 4J8EA 3S7BA 3SF4A 1NA3A 3MA5A 2QFCA 4AY6A 1Y8MA 3AS4A 3ASHA 4UQYA 1IHGA 5ARGA 4GYWA 3KD7A 5JJ6A 3RO2A 3RIBA 3QWWA 4AY5A 2KATA 2Q7FA 2KCKA 3KAEA 4IN3B 3AS8A 2XCCA 2XPIA 4KXKB 2FF4A 3RKVA 5FZSA 4O6FA 3ZN3A 2IFUA 5G05J 3CVQA 2HO1A 2C0LA 4G25A 5CHEE 3CK9A 3CK8A 4I2ZA 4N3AA 4GA1A 4HOQA 2PQNA 4YVQC 4GZ3A 4JHRA 3QOUA 3MEKA 2IF4A 2VYIA 2GW1A 3UQ3A 3S7FA 5BW8C 4U0ZA 1ZBPA 5G05C 3NF1A 2I6HA 3ZHEA 2PQRA 3R9AB 1E96B 3GYZA 3RU0A 3MKRA 2XGSA 3CK7A 4KYOB 2DBAA 4I1AA 3CVPA 2MHKA 1TJCA 3EDTB 3FWVA 3URZA 4HORA 3GZ2A 3AS5A 3PDNA 4XIFA 3UUXA 2C0MA 3LPZA 3Q5MA 4CGVA 3QWVA 4GPKA 1HZ4A 2C2LA 4G24A 2FO7A 4H7XA 2KC7A 4UQZA 3CV0A 4JA7A 2HR2A 3LYAA 4U07A 5D0OD 4BT8A 4N3CA 2LSUA 3LKUA 3OXGA 4J0UA 3TGOA 3SZ7A 2V5FA 3LY9A 3QKYA 4UQXA 4B94A 4U0SA 4ME2A 5HQ8A 1HH8A 1XNFA 3PE3A 3O48A 5C1DA 4Y6CA 4WUYA 2VGXA 3OXFA 4A1SA 4RG9A 3JYSA 4J8FA 3TG5A 4J8DA 1IYGA 4G2VA 5BT1A 4GA0A 3TG4A 4CDRA 1WM5A 5KJLA 4WNGA 3U4TA 5CCLA 5DBKA 2OOEA 2XCBA 1KT0A 4UI9J 2P58C 4H7YA 2NC9A 1HXIA 4WNFA 3QWPA 5EX3A 2PZIA 5AYWD 1A17A 1QZ2A 5FTPA 3Q49B 3K9IA 4UI9K 5D0QD 4GYYA 5KJMA 2UWJG 5FZQA 3CKBA 4AM9A 1NZNA 3LCAA 4UI9C 5CCMA 5KJNA 2UY1A 4I17A 1PC2A 4G1TA 2VQ2A 3KS2A 5LCWJ 4I2WA 4U04A 3RJVA 4CGWA 3ASFA 2VSNA 3OXLA 2Y4UA 4RG6A 4BTAA 5JJ7A 2BUGA 4N5CA 4N39A 5G04J 3ASDA 4JL0A 4BWRA 2KCLA 3RO3A 4ABNA 3QDNA 5KJKA 4EQFA 3S7JA 3CEQA 4NRHB 4F3VA 4KBQA 4G23A 1P5QA 2XEVA 2WQHA 4WNEA 2YQ8A 5LCWC 3TAXA 5DIZA 5FT9A 3LY8A 3IEGA 4XI0A 1QQEA 2ONDA 3Q4AB 1ZU2A 4N2SA 3ESKA
chains in the Genus database with same CATH superfamily
4DX2A 4BT9A 3S7DA 4GCOA 4Q94A 5KWDA 4YVOA 4BSXA 5T3RA 5E76A 4DX1A 4WAFA 2LO6A 3SFXA 4B0ZA 3NZUA 3FH7A 3FU6A 3QARA 4A55A 1N95A 3Q9NC 3TWXA 3SNXA 4AVXA 2R17C 2ZXWE 2FI7A 1SVXA 5FZRA 5CEDB 5HI7A 1YCSB 3BG1B 3PEVB 4C0MA 5HKPA 3ABLE 1DNPA 4K5AB 3DXKG 4GZ6A 1K3ZD 4AIFA 4GTPA 3IV0A 3E32A 4HBDA 5LOZA 1MZCA 4DI3A 1UJKA 1SW6A 2QYJA 3UXGA 4U8HA 4JW1A 3EIJA 4GMJA 1HU3A 3RRMB 2A5EA 2LXLA 1U2VG 3FHEA 4NIKA 4ZHBA 3VTYA 4BFRA 4BESA 3Q75A 3FTUA 4U8YD 3ZXSA 4MLPA 1H19A 2JLBA 4BX8A 4HVBA 2XEHA 4TV3A 4TRQA 4E6HA 2Y3AA 4OVUA 4K5BA 3E4BA 5LX8A 3SFZA 2I1JA 1D8EA 1KLXA 3ONKA 3GW4A 4GA2A 1SZAA 2X3MA 5FQ8A 5FJYA 3IBEA 3FUDA 2PL2A 3UIPC 2FBNA 3ZFWA 1H6OA 4RVBA 1S0PA 2KM4A 3CIAA 2BKKB 3TWTA 2FO1E 4A3TA 3E37A 2X6IA 4CZ2D 2F8XK 4IYPA 5EIBE 4LCTA 2J07A 1ELWA 3CR3A 4YNDA 2OVBA 3DSVA 4FJZA 3SI5A 4JA9A 4LSZE 2B0OE 3EUVA 2MOWA 1NA3A 3MA5A 5EILA 4RSYA 3FDHA 3C3OA 3AS4A 5ANLA 5ARGA 2XEEA 1V54E 3FU3A 3PZ4A 3L54A 3RO2A 1U3CA 3ZYQA 2OEVA 1RZ4A 1N4RA 4ILHB 2KCKA 3CGHA 2VJ8A 3AS8A 3PREA 2XCCA 2IQCA 3LVQE 1E90A 2FF4A 5AQBA 1HS6A 2FULA 4PDXA 5G05J 3G2SA 4YDEA 5FWQA 4GA1A 2CHZA 3FU5A 2AWIA 3BUAA 2ZGGA 3UM1A 2IF4A 4C9BB 4G8KA 1QNFA 3FUNA 2WXNA 3FEYA 2MYOA 4U0ZA 3D9JA 5G05C 3NF1A 5JHAA 3SD5A 4CT0A 3D9KA 2KZTB 4BETA 1DCQA 3FUEA 4B93B 3GYZA 3FTWA 3C3RA 3TXNA 4KYOB 3Q73A 2ETCA 2ETAA 5EDSA 2MHKA 4HS2A 4GTOA 1TJCA 3ZNGA 4HORA 5ENSD 3D9HA 3VLFA 4Q69A 3CHRA 4JEHA 2C0MA 2OV8A 1EPUA 2JEKA 3HIZA 3FH5A 3PEUB 3CSFA 4H7XA 4PH4B 5CEAA 2KC7A 1ZB1A 1IHBA 4U7EB 4BX9A 3DRAA 4EZLA 2WXJA 4HQDA 3TGOA 2Y1LE 2V5FA 3SHFA 4URKA 4UQXA 4B94A 2VSXE 3DSUA 4ME2A 5HQ8A 4A3VA 3B13A 5C1DA 4A1SA 4RG9A 3JYSA 2L9BA 1LF8A 3FTYA 5BT1A 4MBGA 4GA0A 4CDRA 3UX4A 1FT2A 5JMND 3MGBA 1VDYA 1Z5SC 4L23A 3PUJA 2XS1A 2CHWA 3O4ZA 3T8KA 2EIME 3MZLB 4H7YA 2NC9A 4B8CB 1UG3A 5ENQD 4CDMA 2V4HC 2X6HA 2IO2C 2QZAA 3C98A 4ATGA 4UWGA 1H6PA 5KJMA 5AIJA 2Y69E 5CMWA 1TN6A 3CSTA 3LCAA 3AU4A 2JABA 2I9CA 1GW6A 5KJNA 4HRMB 3AJIA 1FVHA 3I4RB 4G8LA 4OAUC 4JPSA 1MX2A 4DLQA 4LNUD 3ASFA 3DXMG 4IULA 3PVLA 3OXLA 2KBXA 4RG6A 4Q96A 5JJ7A 2WMNA 2BUGA 4N5CA 5G04J 3ASDA 4JL0A 3J5QB 4BWRA 3DSTA 3FH8A 2P9PG 2V5QC 2X6KA 3CEQA 2GRMA 4PS3A 2XHEA 1TYQG 1IQUA 1HO8A 1QQEA 5A23A 1JCRA 3Q4AB 2ILRA 4N2SA 3W9FA 3HDXA 1X5BA 2L6BA 2ZIRA 2OEWA 4J8YA 5G04C 1N11A 3IXEA 2IU1A 2H6GA 2HYZA 3FY4A 4WWPA 3AG4E 3G2VA 2P2CP 3AAAC 3ZYMA 2H6IA 3FFLA 1BU9A 4TUUA 5CRVA 2XPZA 4B89A 2R5SA 3MV3B 1OWNA 1ELRA 5A6CA 5ARFA 2RFAA 4OYSA 2YHCA 4X8QA 3PZDA 2XZTG 4CEMA 4GMLA 1D8DA 4DJAA 4LRZA 2GRPB 5BNWA 3CVVA 2EIKE 3RAUA 3Q47B 1BI7B 3FUJA 4I6GA 3GZ1A 1N94A 4GCNA 2L0IA 2KCVA 4U95D 3AG3E 3EU9A 4GYOA 4UUCA 4YDWA 2J4DA 2DZOA 4F7AA 3FTZA 3QK0A 3V2XA 1E8YA 2LSVA 3CKCA 1NI1A 2LAIA 4V3IA 3G2UA 5T4YA 4DUIA 3QB2A 3MKQA 4BTBA 4ATZD 4KMOA 5AQ7A 4E85A 5A7DB 2EILE 4TXPA 1OCOE 3ZRHA 5ITZF 2IY0C 3MV2B 1SZ9A 3LDZA 3PUKA 5FQ7A 3CQCB 4FLBA 3CHQA 3HG0D 4U0UA 1Q2ZA 2GROB 4O60A 4GZCA 1JUQA 4HOSA 4A63B 3B7TA 4L2LA 5JA4D 3VTXA 2XQ0A 3ESLA 4HLLA 1UOHA 4BY6A 1YA0A 1OUVA 3UT7A 2WXIA 3BU8A 1HX8A 2L0TB 4I6EA 2HE0A 4KZCA 4F1PA 1JWFA 3P2BA 1Y8MA 2E0IA 4J8SA 4UQYA 2J8SD 3R7RA 2BF0X 4GYWA 3U66A 4FU3A 4L9PA 1UW4B 4ILIA 5JJ6A 3QWWA 3QJZA 3SFYA 2KATA 4DPRA 3TWVA 4NURA 4CRWA 2VTBB 4XKCA 3UM0A 3KAEA 4IN3B 5C2YA 4ILGA 4KXKB 1U3DA 5B1AE 4MRUA 4DK5A 3UI2A 1ELKA 1LTXA 2HO1A 4PUCA 4G25A 2WVIA 3CQGB 3CK9A 1V55E 2J09A 3Q79A 4HOQA 3D9NA 1A5EA 4YVQC 4GZ3A 4CCAA 5EIDA 3LJNA 3MEKA 2GW1A 3R7QA 1G3NB 5AENA 4GZDA 3UQ3A 3UMVA 2F0YA 2B6CA 1S70B 3S7FA 4O1PA 1OXJA 4OAVB 3MKQB 2I6HA 3U64A 3ZEFA 1TN7A 1HG5A 3ZHEA 3RU0A 1NFIE 3MKRA 4AEZC 5KNGA 3CK7A 2I1KA 3ULEG 1TNYA 1KZPA 3DSXA 2ZU6B 4I1MA 5ENPD 3BQOA 3FWVA 3URZA 4KZ0A 3GZ2A 4BSZB 3UUXA 3Q5MA 3QWVA 3UT8A 3E30A 4GPKA 1HZ4A 4FJYA 2XS8A 3TWQA 4GTRA 4CT4A 2HR2A 4U07A 2QYUA 4AP2A 3UM3A 4HNAD 4N3CA 3LKUA 1DVPA 1QYMA 3L9TA 3QKYA 3KEZA 1WG0A 4HLEA 3X2QE 1XNFA 4FADA 4AV7A 3CHPA 5D66A 2BEDA 2YINA 1MX6A 2H6FA 5LP0A 2WQ7A 1IYGA 4KVOA 3G2WA 5KJLA 5CECB 4WNGA 2RG8A 5DBKA 5KBAA 5ANRA 5IY5E 2WB2A 3PZ3A 1BI8B 2MRIA 3T5VA 1N9AA 5KCMA 3B7BA 3LVRE 3NOCD 4GTMA 2AJAA 1HE8A 2P58C 1E7VA 2M63A 4JHKA 3CHOA 5FQ4A 2LUHA 3PRZA 3NBNB 4ACKA 3S2AA 5G2NA 5AYWD 1LD7A 3SBTB 2PM7A 1QZ2A 2IONA 1NL4A 4TUMA 5FZQA 2J4BA 3CKBA 1NZNA 2WQ6A 4L7TA 2P9IG 5CCMA 4B8AA 3EHRA 4I17A 2YNQA 1PC2A 3RRUA 3FUHA 4I2WA 4RQIA 1MHQA 4U04A 3RJVA 3EIQC 4ANXA 4EHMA 3SGHA 3J5PA 3GZSA 2KCLA 3RO3A 5KJKA 4EQFA 4LG6A 4NRHB 2DCPA 1P5QA 4MS6A 4HXIA 4CDNA 2YQ8A 5EN5D 5FT9A 4XI0A 2ONDA 1OWMA 1L5JA 4EBAA 5BXUA 3PH0C 3TJPA 4HOTA 2IOLA 3CLJA 3C3QA 3DSSA 5CBNA 3TWSA 3CVUA 4GAAA 1OWLA 2VGYA 3UT4A 3DBSA 4WNDA 1B89A 3L16A 2RFMA 2ZGDA 2X6FA 5EYPF 3BEEA 1OWOA 5CBOA 2P9LG 2XZDG 3EHQA 4U8VD 4FHKA 3PE4A 4AOFA 2A4ZA 4Y6WA 3D9PA 4DX7D 2GRNB 4HRNA 3Q15A 4K5CA 5M72A 3D9OA 3ZGQA 1K8KG 3CVNA 4GTSA 4YDYA 4F53A 1S64A 2Y4TA 3SQVA 3JUEA 1TNBA 2LXMA 1EYHA 3WXXA 1E8ZA 3U9WA 3JXJA 4C48B 3MJWA 2LNIA 4N2QA 2RKKA 3EHMA 3D9IA 4G26A 4U96D 3ZIMA 4O1OA 3ZPJA 3DPYA 2DVWA 1NA0A 5EX0A 2E2EA 3V2OA 3IHYA 4EPZA 1BD8A 4GZ5A 4WWOA 5AAOA 4RLYA 4EECA 4DX6D 5LFAA 2LAHA 5J90A 4EZJA 3AG1E 3B95A 3EU5A 3PZ1A 2DIWA 1JWGA 5CMYA 2XGMA 3ULQA 1Y6IA 2QC9A 3FUKA 1Z3XA 2V4LA 4F1SA 4J8EA 3UKUG 3S7BA 3SF4A 5CERB 4BEPA 4AY6A 5B1BE 2ETBA 2EINE 3KD7A 3ISMC 3FUFA 4JZYA 3RIBA 1OWPA 4PS7A 5AQ9A 2Q7FA 1INZA 2XPIA 3NZSA 3HXBA 3IHVA 3HXEA 2P9UG 3RKVA 4EZKA 1H2VC 3ZN3A 2IFUA 2C0LA 3RSEG 5CHEE 5BXOA 3L13A 4XE0A 3CK8A 3D3MA 4N3AA 4DRXE 3FUIA 2PQNA 2CFUA 3E33A 4FLHA 3QOUA 3D9MA 2NYJA 4LNBA 1H0AA 2BTDA 2CG2A 4A1GA 5JHBA 4AJWA 3ZUVB 1FT1A 3HXFA 4KVMA 3TWUA 3ZVVA 3R9AB 2J08A 1K1AA 1E8XA 3I5PA 2BKGA 4J7WA 3CHMA 3DPDA 2DBAA 4JB8P 2X6JA 3EDTB 3EJNA 2XPYA 2OCCE 3L22A 3OTNA 3PDNA 4IRUA 3JUIA 2XENA 3B7RL 3DEOA 1JPLA 3LXUX 5T8IA 2GRQB 1O1SA 4XZ4A 2FO7A 4UQZA 3CV0A 4ANWA 2P9KG 4U63A 4UWKA 5J08A 3I4GA 3LYAA 5B3SE 2F8YA 4BT8A 2LSUA 3FTSA 1N0RA 2IO3C 1BLXB 2P9NG 3OXGA 1YYHA 2WM9A 2PNNA 2RD0A 4HI9A 4UWFA 4HRLA 3LY9A 4XKBA 3ENEA 3V79K 3Q9UC 3PE3A 3DWLG 2VGXA 3OXFA 4WUYA 2WXPA 1EDUA 3UM2A 4J8FA 5EYLA 4J8DA 2P9SG 3PNTB 2WXQA 5G55A 3VLEA 1WM5A 3G2TA 3ULYA 3U4TA 2VGEA 2AXVA 3HXDA 2IOSA 1SA4A 2XCBA 1KT0A 3PNLB 3FTVA 1QBQA 1N4QA 4GTQA 1K1BA 4UI9J 2OVFA 4ACLA 3FTXA 3QWPA 2PZIA 3TWRA 1A17A 3L82A 4APFA 1O5MA 5FTPA 3K9IA 4GYYA 3ABME 3T9KA 4UI9C 3FULA 1HF8A 4M7CA 2UY1A 4GTVA 2WXMA 2CFZA 2VQ2A 3KS2A 5LCWJ 4ANVA 3RK6A 2KZTA 4BTAA 3IKOB 4KT6B 4TXQA 4ZFHA 4FP7A 4ABNA 3QDNA 5BUZA 4KBQA 3D9LA 3CVYA 2XEVA 2WQHA 1AWCB 1D9SA 2R2LA 3QNKA 3ZXPA 2HM8A 4DLOA 3TAXA 5DIZA 5LCWC 4OVVA 4LNGA 2AW6A 2IJGX 3ESKA 1TR4A 3DSWA 3JCKC 4HB5A 1PY1A 2VSYA 4N3BA 3FP3A 1JCSA 2AVPA 2R02A 1N4SA 1PAQA 3SO8A 2WPVA 4JVSA 3APFA 1XGWA 2I2OA 2VGXB 1E8WA 5E75A 4CYMD 3JQ0A 2WXOA 2AXUA 2XGOA 4P29A 1N54A 3C5RA 2GGFA 3KSQA 1H2UA 2H6HA 4NQ0A 4TXRA 4HI8A 3ASGA 4JEUA 1IQRA 4MKTA 5EKQD 1WY6A 4HFGA 4HOUA 4UWHA 1FCHA 3ML9A 4K03A 1UJJA 1W3BA 1LD8A 1WAO1 1O1TA 3NQPA 2EQXA 3AU5A 4LERA 4W9RA 2DZNA 3HVEA 3L08A 1KT1A 1N4PA 2DYRE 3CVLA 3ZHEB 2CG3A 3MCXA 1X81A 3UPVA 2GRRB 1MYOA 3V30A 1MJ0A 3HRAA 2UY1B 1DC2A 3L17A 3TXMA 2AXZA 4BERA 2J49A 2NXPA 3HYMB 4GB9A 5AQAA 3U3WA 5ENTD 4D10C 4QQIA 2XRYA 1TJFA 4NACA 2R05A 4LEUA 3AG2E 3CVWA 5FINA 1WDYA 4JC8A 2Y0BG 4GMRA 3L6AA 5BV0A 4WWNA 2WXGA 2IEJA 3ABKE 3HHMA 2L6JA 4K0RA 3APDA 4ANUA 4L1BA 2J9QA 2FEZA 4APOA 5JJTA 1SQMA 4XI9A 3N71A 2F37A 4I9CA 1IXVA 2VSOE 4I9EA 4PS8A 3TL5A 3LY7A 1TEZA 3ZKJA 1N52A 1DCEA 1SA5A 4GTTA 5ENNA 1FPPA 2QFCA 1UN9A 1S63A 3ASHA 1IHGA 1RW2A 2WXKA 4AXHA 3MYVA 3B7UX 3PZ2A 4AY5A 1AP7A 3ZYLA 1OY3D 3PS6A 5KNHD 2YHEA 4EBAG 3B7SA 5H7PA 1EF1C 4FA6A 5FZSA 4O6FA 4YDOA 2KXPC 3CVQA 4GU5A 4M3OA 4QFVA 3HVEB 4XX5A 1MQSA 3JQ1A 4FHJA 4I2ZA 1O1RA 4I43A 4JHRA 2V0PA 1MX4A 2VYIA 4J6IA 3VLDA 3ASNE 3ZU7B 2WXFA 2WXHA 1OCRE 1BPOA 3NOGD 5BW8C 1KPSB 1ZBPA 2QY7A 3OAWA 2EIJE 1UN8A 1TN8A 2PQRA 5FQ6A 4FULA 1E96B 3UIOC 3JXIA 2CHXA 2XGSA 3E34A 4I1AA 1OCZE 3CVPA 4LUNU 3EHNA 3ONLA 3ZW3A 5HS0A 3I3NA 3AS5A 4F6RD 1TNUA 4XIFA 4CGVA 3LPZA 3P1UA 3LJ3A 3ML8A 1TNZA 2C2LA 4N5QA 3Q78A 4G24A 3UTMA 3FEXA 3CVXA 2X38A 4JA7A 3NAWA 3QC1A 3W9GA 5D0OD 1H2TC 4R7LA 1OCCE 3LS8A 1NP7A 1HFAA 4J0UA 1JCQA 3SZ7A 4Z68A 2NSZA 3MX3A 1IKND 4G11A 3SY2A 5AJLA 5AJDA 3KSLA 4U0SA 3CHSA 1HH8A 4JXTA 3TWWA 3O48A 4Y6CA 4JHJA 3ZYKA 3Q7FA 4DX5D 3TG5A 2V8SE 2WMOA 4DI4A 5ENRD 4G2VA 2WXLA 3TG4A 1Z3YA 5CRUA 4I6JA 1N0QA 2ZISA 5CCLA 3FU0A 3T5XA 2GRLA 5HRYA 3HXCA 2OOEA 3C72A 5D2MC 2VTBA 2WXRA 1Z6TA 1KZOA 3F6QA 2R03A 3RRNB 3NB2A 1HXIA 4WNFA 4L2YA 5EX3A 5AARA 4UWLA 1FVFA 1OT8A 5BPPA 4JD2G 2A5UA 3Q7AA 3Q49B 4XEIG 4UI9K 5D0QD 2R59A 3BG0B 2UWJG 3UINC 1E7UA 1TNOA 4AM9A 3UKRG 3T8MA 3KEAA 3R9MA 4G1TA 3QAQA 3APCA 3LEWA 5FIOA 4FC8A 4CGWA 4GPMA 1YMPA 2VSNA 2Y4UA 2XRZA 4N39A 3FUMA 2DYSE 3ASOE 4C0EA 3S7JA 5ENOD 4F3VA 3WG7E 4G23A 3V31A 5AN8A 4WNEA 2DWZA 1HG2A 3LY8A 1H6KA 3IEGA 4I1OB 5BV1A 1ZU2A 3SBSA 2PM6A 3DEPA
chains in the Genus database with same CATH topology
2VSYA 4N3BA 3FP3A 4BT9A 4HOTA 3S7DA 2AVPA 2IOLA 4GCOA 1PAQA 2WPVA 5G04C 3CLJA 4JVSA 4Q94A 4YVOA 3APFA 2IU1A 4BSXA 2HYZA 3FY4A 5T3RA 4WWPA 1XGWA 2I2OA 5E76A 2VGXB 3CVUA 4GAAA 1OWLA 2LO6A 1E8WA 3G2VA 4WAFA 2VGYA 3ZYMA 3UT4A 4B0ZA 3DBSA 4WNDA 1B89A 3FFLA 5E75A 3NZUA 4TUUA 3L16A 3FH7A 2XPZA 3FU6A 3QARA 4A55A 3JQ0A 4B89A 2R5SA 2WXOA 2AXUA 2XGOA 3MV3B 1OWNA 4P29A 3SNXA 1N54A 4AVXA 1ELRA 2GGFA 2R17C 2X6FA 5A6CA 1H2UA 3BEEA 1OWOA 4NQ0A 5ARFA 2FI7A 4OYSA 2YHCA 5FZRA 3PZDA 5HI7A 3ASGA 4CEMA 4GMLA 4JEUA 3BG1B 4FHKA 4DJAA 3PE4A 4LRZA 4AOFA 1IQRA 2A4ZA 5BNWA 3CVVA 4MKTA 4Y6WA 3PEVB 5EKQD 3D9PA 1WY6A 4C0MA 4HFGA 4HOUA 4UWHA 1DNPA 4GZ6A 3Q47B 1FCHA 3ML9A 4K03A 4AIFA 3FUJA 3IV0A 1UJJA 4I6GA 5LOZA 4DI3A 3Q15A 1W3BA 1WAO1 1UJKA 3GZ1A 3NQPA 5M72A 3D9OA 4GCNA 2EQXA 3AU5A 3ZGQA 4LERA 2L0IA 4W9RA 4U8HA 4JW1A 3CVNA 2KCVA 4F53A 3HVEA 3L08A 2Y4TA 3EIJA 4GMJA 1HU3A 1KT1A 4GYOA 3RRMB 3CVLA 2J4DA 3ZHEB 2CG3A 3MCXA 1EYHA 4F7AA 3FTZA 3UPVA 3QK0A 3FHEA 3WXXA 1E8ZA 1E8YA 3U9WA 2UY1B 2LSVA 3VTYA 4BFRA 3MJWA 3CKCA 3L17A 2LNIA 3TXMA 4N2QA 2LAIA 2AXZA 4V3IA 2J49A 3FTUA 2NXPA 3HYMB 3ZXSA 3G2UA 4MLPA 5T4YA 3EHMA 1H19A 2JLBA 4GB9A 3U3WA 4BX8A 4D10C 4HVBA 3D9IA 3QB2A 3MKQA 4G26A 2XRYA 3ZIMA 1TJFA 3ZPJA 4NACA 4BTBA 4KMOA 4TV3A 4E85A 5A7DB 4TRQA 4E6HA 1NA0A 4LEUA 2Y3AA 4OVUA 3ZRHA 5EX0A 3CVWA 2E2EA 3E4BA 5LX8A 3SFZA 3IHYA 3MV2B 4EPZA 2I1JA 1SZ9A 1KLXA 3ONKA 3GW4A 4GA2A 4JC8A 1SZAA 2X3MA 3LDZA 3PUKA 5FQ8A 5FQ7A 4GZ5A 5FJYA 4WWOA 3IBEA 3L6AA 3FUDA 2PL2A 3CQCB 4EECA 2FBNA 4FLBA 3ZFWA 3CHQA 4WWNA 5BV0A 2WXGA 3HHMA 4U0UA 2L6JA 5LFAA 2LAHA 4K0RA 4RVBA 1S0PA 2KM4A 3CIAA 3APDA 4GZCA 4ANUA 4EZJA 4L1BA 5J90A 1JUQA 2J9QA 2FEZA 4HOSA 4APOA 2DIWA 5JJTA 4A3TA 1SQMA 2X6IA 4XI9A 1JWGA 5CMYA 3B7TA 3N71A 4L2LA 3VTXA 2XGMA 2XQ0A 4IYPA 4I9CA 3ULQA 2VSOE 3ESLA 1Y6IA 4LCTA 2J07A 1ELWA 3CR3A 4I9EA 4PS8A 3TL5A 4YNDA 2OVBA 3FUKA 1Z3XA 4FJZA 3LY7A 4BY6A 1YA0A 1OUVA 3SI5A 2V4LA 1TEZA 4JA9A 4F1SA 4J8EA 3UT7A 2WXIA 1N52A 2MOWA 3S7BA 3SF4A 1HX8A 2L0TB 5ENNA 1NA3A 4I6EA 3MA5A 4KZCA 2QFCA 4AY6A 4RSYA 3FDHA 1JWFA 3P2BA 1UN9A 1Y8MA 2E0IA 4J8SA 3AS4A 3ASHA 4UQYA 1IHGA 5ANLA 5ARGA 2WXKA 3FU3A 3R7RA 2BF0X 4GYWA 3KD7A 3U66A 4FU3A 1UW4B 3FUFA 4ILIA 5JJ6A 4AXHA 3L54A 3MYVA 3RO2A 3B7UX 1U3CA 4JZYA 3RIBA 3ZYQA 1OWPA 3QWWA 3QJZA 4AY5A 2KATA 4PS7A 4DPRA 4NURA 2Q7FA 4CRWA 2VTBB 4ILHB 4XKCA 2KCKA 1INZA 3KAEA 4IN3B 3CGHA 3ZYLA 2VJ8A 3AS8A 3PREA 2XCCA 3PS6A 2YHEA 4EBAG 2XPIA 5C2YA 3NZSA 4ILGA 2IQCA 3B7SA 3LVQE 3IHVA 1E90A 4KXKB 1U3DA 1EF1C 2FF4A 4FA6A 3RKVA 4EZKA 1HS6A 5FZSA 1H2VC 4O6FA 2FULA 3ZN3A 4MRUA 4PDXA 2IFUA 5G05J 4DK5A 3CVQA 1ELKA 3G2SA 2HO1A 4GU5A 2C0LA 4PUCA 4G25A 5CHEE 2WVIA 3CQGB 3L13A 4M3OA 4QFVA 3CK9A 3HVEB 1MQSA 4XE0A 4XX5A 3JQ1A 3CK8A 3D3MA 2J09A 4FHJA 4I2ZA 4GA1A 4N3AA 4HOQA 5FWQA 2CHZA 4I43A 3FUIA 3D9NA 2PQNA 3FU5A 2CFUA 4GZ3A 4YVQC 4FLHA 2AWIA 4JHRA 4CCAA 3QOUA 3MEKA 2IF4A 2V0PA 2VYIA 3D9MA 4C9BB 1H0AA 2GW1A 4J6IA 3VLDA 1QNFA 3FUNA 2WXFA 2WXHA 3R7QA 5AENA 2BTDA 4GZDA 1BPOA 2WXNA 3UQ3A 3UMVA 3FEYA 2CG2A 3S7FA 5BW8C 4U0ZA 4A1GA 1ZBPA 3D9JA 2QY7A 5JHBA 5G05C 3NF1A 4AJWA 3OAWA 5JHAA 1UN8A 3MKQB 3SD5A 4CT0A 2I6HA 3D9KA 3U64A 3ZEFA 1HG5A 3ZHEA 4KVMA 2KZTB 2PQRA 5FQ6A 3ZVVA 4FULA 3FUEA 3R9AB 1E96B 3GYZA 3RU0A 3FTWA 2J08A 3MKRA 2CHXA 1E8XA 2XGSA 3I5PA 3TXNA 4AEZC 3CK7A 3CHMA 4KYOB 2I1KA 3DPDA 2DBAA 5EDSA 4I1AA 3CVPA 4LUNU 2MHKA 2X6JA 2ZU6B 3EHNA 3ONLA 4HS2A 4I1MA 1TJCA 3EDTB 3FWVA 3EJNA 2XPYA 3URZA 3ZW3A 4HORA 4KZ0A 3GZ2A 3I3NA 3L22A 3AS5A 3VLFA 4Q69A 3OTNA 3PDNA 4IRUA 3JUIA 4XIFA 3CHRA 3B7RL 4JEHA 3UUXA 2C0MA 3LPZA 3Q5MA 4CGVA 2OV8A 3P1UA 3QWVA 3UT8A 3LJ3A 1JPLA 3ML8A 1EPUA 4GPKA 2JEKA 3LXUX 5T8IA 1HZ4A 3HIZA 3FH5A 4FJYA 2C2LA 4G24A 3FEXA 4XZ4A 2FO7A 3PEUB 3CSFA 4H7XA 4PH4B 2KC7A 4UQZA 3CV0A 2X38A 4JA7A 3CVXA 4CT4A 4ANWA 4U63A 3QC1A 4UWKA 2HR2A 5J08A 3I4GA 3LYAA 4U07A 5D0OD 4BX9A 4EZLA 4AP2A 2WXJA 4BT8A 4N3CA 1H2TC 2LSUA 3FTSA 4R7LA 3LS8A 3LKUA 1DVPA 1NP7A 1HFAA 3OXGA 4J0UA 2WM9A 3SZ7A 2RD0A 3TGOA 2NSZA 4UWFA 2V5FA 3MX3A 4G11A 3SHFA 5AJLA 3LY9A 3QKYA 4URKA 4XKBA 3ENEA 5AJDA 3KEZA 4UQXA 4B94A 2VSXE 4U0SA 3CHSA 4HLEA 4ME2A 5HQ8A 1HH8A 1XNFA 4JXTA 3PE3A 4A3VA 4AV7A 4FADA 3O48A 3B13A 5C1DA 3CHPA 4Y6CA 4WUYA 2VGXA 3OXFA 4JHJA 3ZYKA 4A1SA 4RG9A 2WXPA 1EDUA 3JYSA 2YINA 2L9BA 4J8FA 3TG5A 5LP0A 2V8SE 4J8DA 1LF8A 2WMOA 2WQ7A 4DI4A 3FTYA 1IYGA 4G2VA 4KVOA 3G2WA 5BT1A 2WXLA 3PNTB 2WXQA 5G55A 4GA0A 3TG4A 3VLEA 1Z3YA 1WM5A 4CDRA 5KJLA 3G2TA 4WNGA 4I6JA 3U4TA 3UX4A 5CCLA 2AXVA 2RG8A 3FU0A 5DBKA 3T5XA 5ANRA 2GRLA 3MGBA 1VDYA 2OOEA 2WB2A 2IOSA 2MRIA 2XCBA 1KT0A 3PNLB 3PUJA 3FTVA 4L23A 5KCMA 3T5VA 2CHWA 3LVRE 3O4ZA 2VTBA 2WXRA 1Z6TA 1HE8A 4UI9J 2OVFA 2P58C 3MZLB 4H7YA 2NC9A 1E7VA 2M63A 4JHKA 3CHOA 5FQ4A 4B8CB 1UG3A 3RRNB 4CDMA 3PRZA 4ACLA 4ACKA 3FTXA 1HXIA 4WNFA 3S2AA 3QWPA 4L2YA 5EX3A 2PZIA 5G2NA 2X6HA 4UWLA 5AYWD 1FVFA 1A17A 3SBTB 2PM7A 1QZ2A 4APFA 3C98A 2IONA 5FTPA 5BPPA 2A5UA 4ATGA 3Q49B 3K9IA 4UI9K 4UWGA 5D0QD 4GYYA 2R59A 5KJMA 5AIJA 3BG0B 2UWJG 1E7UA 5FZQA 2J4BA 3CKBA 5CMWA 4AM9A 1NZNA 2WQ6A 4L7TA 3LCAA 3CSTA 4UI9C 3FULA 3AU4A 2I9CA 5CCMA 1HF8A 1GW6A 3T8MA 4B8AA 5KJNA 2UY1A 4I17A 2YNQA 2WXMA 1PC2A 2CFZA 4G1TA 3RRUA 1FVHA 3FUHA 3I4RB 2VQ2A 3KS2A 3QAQA 5LCWJ 3APCA 4I2WA 4JPSA 4ANVA 1MHQA 3LEWA 4U04A 3RJVA 4FC8A 4DLQA 4CGWA 3ASFA 4IULA 3RK6A 2VSNA 3EIQC 3PVLA 4ANXA 3OXLA 2Y4UA 2KZTA 4RG6A 3SGHA 4BTAA 3GZSA 4Q96A 5JJ7A 2WMNA 2BUGA 3IKOB 2XRZA 4N5CA 4N39A 5G04J 4KT6B 3ASDA 4JL0A 4FP7A 3FUMA 4BWRA 2KCLA 3FH8A 3RO3A 4ABNA 3QDNA 2X6KA 4C0EA 4EQFA 3S7JA 5KJKA 3CEQA 4NRHB 4F3VA 5BUZA 4KBQA 2GRMA 2DCPA 1P5QA 3D9LA 4G23A 4MS6A 3CVYA 2XEVA 4HXIA 2WQHA 4PS3A 4WNEA 4CDNA 2YQ8A 2XHEA 3QNKA 1IQUA 1HG2A 2HM8A 4DLOA 3TAXA 5DIZA 5LCWC 5FT9A 4OVVA 3LY8A 1H6KA 3IEGA 4I1OB 2AW6A 1HO8A 1QQEA 4XI0A 2ONDA 5A23A 1OWMA 1L5JA 2IJGX 3Q4AB 2ILRA 4EBAA 5BV1A 1ZU2A 4N2SA 3PH0C 3TJPA 3HDXA 3SBSA 3ESKA 1X5BA 2PM6A 3JCKC 1PY1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VSY A;  4N3B A;  3FP3 A;  4BT9 A;  4HOT A;  3S7D A;  2AVP A;  4GCO A;  2WPV A;  5G04 C;  4YVO A;  2HYZ A;  2VGX B;  2VGY A;  4WND A;  1B89 A;  3FFL A;  2R5S A;  2XGO A;  3MV3 B;  1ELR A;  5A6C A;  3BEE A;  4NQ0 A;  5ARF A;  2FI7 A;  2YHC A;  5FZR A;  5HI7 A;  3ASG A;  3PE4 A;  5BNW A;  4Y6W A;  5EKQ D;  4HOU A;  4GZ6 A;  3Q47 B;  1FCH A;  4AIF A;  3Q15 A;  1W3B A;  1WAO 1;  3GZ1 A;  5M72 A;  4GCN A;  3ZGQ A;  4W9R A;  3CVN A;  2KCV A;  2Y4T A;  1KT1 A;  4GYO A;  3CVL A;  3ZHE B;  3UPV A;  3WXX A;  2UY1 B;  2LSV A;  3VTY A;  3CKC A;  2LNI A;  4N2Q A;  3HYM B;  2JLB A;  3U3W A;  4G26 A;  4BTB A;  3ZPJ A;  5A7D B;  1NA0 A;  4LEU A;  5EX0 A;  2E2E A;  3E4B A;  3MV2 B;  1KLX A;  3GW4 A;  4GA2 A;  4GZ5 A;  5FJY A;  2PL2 A;  2FBN A;  3ZFW A;  4U0U A;  2L6J A;  2J9Q A;  2FEZ A;  4HOS A;  4APO A;  5JJT A;  4XI9 A;  3N71 A;  3VTX A;  2XGM A;  4I9C A;  3ULQ A;  1ELW A;  4I9E A;  4YND A;  3LY7 A;  1YA0 A;  1OUV A;  4JA9 A;  4J8E A;  3S7B A;  3SF4 A;  1NA3 A;  3MA5 A;  2QFC A;  4AY6 A;  1Y8M A;  3AS4 A;  3ASH A;  4UQY A;  1IHG A;  5ARG A;  4GYW A;  3KD7 A;  5JJ6 A;  3RO2 A;  3RIB A;  3QWW A;  4AY5 A;  2KAT A;  2Q7F A;  2KCK A;  3KAE A;  4IN3 B;  3AS8 A;  2XCC A;  2XPI A;  4KXK B;  2FF4 A;  3RKV A;  5FZS A;  4O6F A;  3ZN3 A;  2IFU A;  5G05 J;  3CVQ A;  2HO1 A;  2C0L A;  4G25 A;  5CHE E;  3CK9 A;  3CK8 A;  4I2Z A;  4N3A A;  4GA1 A;  4HOQ A;  2PQN A;  4YVQ C;  4GZ3 A;  4JHR A;  3QOU A;  3MEK A;  2IF4 A;  2VYI A;  2GW1 A;  3UQ3 A;  3S7F A;  5BW8 C;  4U0Z A;  1ZBP A;  5G05 C;  3NF1 A;  2I6H A;  3ZHE A;  2PQR A;  3R9A B;  1E96 B;  3GYZ A;  3RU0 A;  3MKR A;  2XGS A;  3CK7 A;  4KYO B;  2DBA A;  4I1A A;  3CVP A;  2MHK A;  1TJC A;  3EDT B;  3FWV A;  3URZ A;  4HOR A;  3GZ2 A;  3AS5 A;  3PDN A;  4XIF A;  3UUX A;  2C0M A;  3LPZ A;  3Q5M A;  4CGV A;  3QWV A;  4GPK A;  1HZ4 A;  2C2L A;  4G24 A;  2FO7 A;  4H7X A;  2KC7 A;  4UQZ A;  3CV0 A;  4JA7 A;  2HR2 A;  3LYA A;  4U07 A;  5D0O D;  4BT8 A;  4N3C A;  2LSU A;  3LKU A;  3OXG A;  4J0U A;  3TGO A;  3SZ7 A;  2V5F A;  3LY9 A;  3QKY A;  4UQX A;  4B94 A;  4U0S A;  4ME2 A;  5HQ8 A;  1HH8 A;  1XNF A;  3PE3 A;  3O48 A;  5C1D A;  4Y6C A;  4WUY A;  2VGX A;  3OXF A;  4A1S A;  4RG9 A;  3JYS A;  4J8F A;  3TG5 A;  4J8D A;  1IYG A;  4G2V A;  5BT1 A;  4GA0 A;  3TG4 A;  4CDR A;  1WM5 A;  5KJL A;  4WNG A;  3U4T A;  5CCL A;  5DBK A;  2OOE A;  2XCB A;  1KT0 A;  4UI9 J;  2P58 C;  4H7Y A;  2NC9 A;  1HXI A;  4WNF A;  3QWP A;  5EX3 A;  2PZI A;  5AYW D;  1A17 A;  1QZ2 A;  5FTP A;  3Q49 B;  3K9I A;  4UI9 K;  5D0Q D;  4GYY A;  5KJM A;  2UWJ G;  5FZQ A;  3CKB A;  4AM9 A;  1NZN A;  3LCA A;  4UI9 C;  5CCM A;  5KJN A;  2UY1 A;  4I17 A;  1PC2 A;  4G1T A;  2VQ2 A;  3KS2 A;  5LCW J;  4I2W A;  4U04 A;  3RJV A;  4CGW A;  3ASF A;  2VSN A;  3OXL A;  2Y4U A;  4RG6 A;  4BTA A;  5JJ7 A;  2BUG A;  4N5C A;  4N39 A;  5G04 J;  3ASD A;  4JL0 A;  4BWR A;  2KCL A;  3RO3 A;  4ABN A;  3QDN A;  5KJK A;  4EQF A;  3S7J A;  3CEQ A;  4NRH B;  4F3V A;  4KBQ A;  4G23 A;  1P5Q A;  2XEV A;  2WQH A;  4WNE A;  2YQ8 A;  5LCW C;  3TAX A;  5DIZ A;  5FT9 A;  3LY8 A;  3IEG A;  4XI0 A;  1QQE A;  2OND A;  3Q4A B;  1ZU2 A;  4N2S A;  3ESK A; 
#chains in the Genus database with same CATH topology
 4DX2 A;  4BT9 A;  3S7D A;  4GCO A;  4Q94 A;  5KWD A;  4YVO A;  4BSX A;  5T3R A;  5E76 A;  4DX1 A;  4WAF A;  2LO6 A;  3SFX A;  4B0Z A;  3NZU A;  3FH7 A;  3FU6 A;  3QAR A;  4A55 A;  1N95 A;  3Q9N C;  3TWX A;  3SNX A;  4AVX A;  2R17 C;  2ZXW E;  2FI7 A;  1SVX A;  5FZR A;  5CED B;  5HI7 A;  1YCS B;  3BG1 B;  3PEV B;  4C0M A;  5HKP A;  3ABL E;  1DNP A;  4K5A B;  3DXK G;  4GZ6 A;  1K3Z D;  4AIF A;  4GTP A;  3IV0 A;  3E32 A;  4HBD A;  5LOZ A;  1MZC A;  4DI3 A;  1UJK A;  1SW6 A;  2QYJ A;  3UXG A;  4U8H A;  4JW1 A;  3EIJ A;  4GMJ A;  1HU3 A;  3RRM B;  2A5E A;  2LXL A;  1U2V G;  3FHE A;  4NIK A;  4ZHB A;  3VTY A;  4BFR A;  4BES A;  3Q75 A;  3FTU A;  4U8Y D;  3ZXS A;  4MLP A;  1H19 A;  2JLB A;  4BX8 A;  4HVB A;  2XEH A;  4TV3 A;  4TRQ A;  4E6H A;  2Y3A A;  4OVU A;  4K5B A;  3E4B A;  5LX8 A;  3SFZ A;  2I1J A;  1D8E A;  1KLX A;  3ONK A;  3GW4 A;  4GA2 A;  1SZA A;  2X3M A;  5FQ8 A;  5FJY A;  3IBE A;  3FUD A;  2PL2 A;  3UIP C;  2FBN A;  3ZFW A;  1H6O A;  4RVB A;  1S0P A;  2KM4 A;  3CIA A;  2BKK B;  3TWT A;  2FO1 E;  4A3T A;  3E37 A;  2X6I A;  4CZ2 D;  2F8X K;  4IYP A;  5EIB E;  4LCT A;  2J07 A;  1ELW A;  3CR3 A;  4YND A;  2OVB A;  3DSV A;  4FJZ A;  3SI5 A;  4JA9 A;  4LSZ E;  2B0O E;  3EUV A;  2MOW A;  1NA3 A;  3MA5 A;  5EIL A;  4RSY A;  3FDH A;  3C3O A;  3AS4 A;  5ANL A;  5ARG A;  2XEE A;  1V54 E;  3FU3 A;  3PZ4 A;  3L54 A;  3RO2 A;  1U3C A;  3ZYQ A;  2OEV A;  1RZ4 A;  1N4R A;  4ILH B;  2KCK A;  3CGH A;  2VJ8 A;  3AS8 A;  3PRE A;  2XCC A;  2IQC A;  3LVQ E;  1E90 A;  2FF4 A;  5AQB A;  1HS6 A;  2FUL A;  4PDX A;  5G05 J;  3G2S A;  4YDE A;  5FWQ A;  4GA1 A;  2CHZ A;  3FU5 A;  2AWI A;  3BUA A;  2ZGG A;  3UM1 A;  2IF4 A;  4C9B B;  4G8K A;  1QNF A;  3FUN A;  2WXN A;  3FEY A;  2MYO A;  4U0Z A;  3D9J A;  5G05 C;  3NF1 A;  5JHA A;  3SD5 A;  4CT0 A;  3D9K A;  2KZT B;  4BET A;  1DCQ A;  3FUE A;  4B93 B;  3GYZ A;  3FTW A;  3C3R A;  3TXN A;  4KYO B;  3Q73 A;  2ETC A;  2ETA A;  5EDS A;  2MHK A;  4HS2 A;  4GTO A;  1TJC A;  3ZNG A;  4HOR A;  5ENS D;  3D9H A;  3VLF A;  4Q69 A;  3CHR A;  4JEH A;  2C0M A;  2OV8 A;  1EPU A;  2JEK A;  3HIZ A;  3FH5 A;  3PEU B;  3CSF A;  4H7X A;  4PH4 B;  5CEA A;  2KC7 A;  1ZB1 A;  1IHB A;  4U7E B;  4BX9 A;  3DRA A;  4EZL A;  2WXJ A;  4HQD A;  3TGO A;  2Y1L E;  2V5F A;  3SHF A;  4URK A;  4UQX A;  4B94 A;  2VSX E;  3DSU A;  4ME2 A;  5HQ8 A;  4A3V A;  3B13 A;  5C1D A;  4A1S A;  4RG9 A;  3JYS A;  2L9B A;  1LF8 A;  3FTY A;  5BT1 A;  4MBG A;  4GA0 A;  4CDR A;  3UX4 A;  1FT2 A;  5JMN D;  3MGB A;  1VDY A;  1Z5S C;  4L23 A;  3PUJ A;  2XS1 A;  2CHW A;  3O4Z A;  3T8K A;  2EIM E;  3MZL B;  4H7Y A;  2NC9 A;  4B8C B;  1UG3 A;  5ENQ D;  4CDM A;  2V4H C;  2X6H A;  2IO2 C;  2QZA A;  3C98 A;  4ATG A;  4UWG A;  1H6P A;  5KJM A;  5AIJ A;  2Y69 E;  5CMW A;  1TN6 A;  3CST A;  3LCA A;  3AU4 A;  2JAB A;  2I9C A;  1GW6 A;  5KJN A;  4HRM B;  3AJI A;  1FVH A;  3I4R B;  4G8L A;  4OAU C;  4JPS A;  1MX2 A;  4DLQ A;  4LNU D;  3ASF A;  3DXM G;  4IUL A;  3PVL A;  3OXL A;  2KBX A;  4RG6 A;  4Q96 A;  5JJ7 A;  2WMN A;  2BUG A;  4N5C A;  5G04 J;  3ASD A;  4JL0 A;  3J5Q B;  4BWR A;  3DST A;  3FH8 A;  2P9P G;  2V5Q C;  2X6K A;  3CEQ A;  2GRM A;  4PS3 A;  2XHE A;  1TYQ G;  1IQU A;  1HO8 A;  1QQE A;  5A23 A;  1JCR A;  3Q4A B;  2ILR A;  4N2S A;  3W9F A;  3HDX A;  1X5B A;  2L6B A;  2ZIR A;  2OEW A;  4J8Y A;  5G04 C;  1N11 A;  3IXE A;  2IU1 A;  2H6G A;  2HYZ A;  3FY4 A;  4WWP A;  3AG4 E;  3G2V A;  2P2C P;  3AAA C;  3ZYM A;  2H6I A;  3FFL A;  1BU9 A;  4TUU A;  5CRV A;  2XPZ A;  4B89 A;  2R5S A;  3MV3 B;  1OWN A;  1ELR A;  5A6C A;  5ARF A;  2RFA A;  4OYS A;  2YHC A;  4X8Q A;  3PZD A;  2XZT G;  4CEM A;  4GML A;  1D8D A;  4DJA A;  4LRZ A;  2GRP B;  5BNW A;  3CVV A;  2EIK E;  3RAU A;  3Q47 B;  1BI7 B;  3FUJ A;  4I6G A;  3GZ1 A;  1N94 A;  4GCN A;  2L0I A;  2KCV A;  4U95 D;  3AG3 E;  3EU9 A;  4GYO A;  4UUC A;  4YDW A;  2J4D A;  2DZO A;  4F7A A;  3FTZ A;  3QK0 A;  3V2X A;  1E8Y A;  2LSV A;  3CKC A;  1NI1 A;  2LAI A;  4V3I A;  3G2U A;  5T4Y A;  4DUI A;  3QB2 A;  3MKQ A;  4BTB A;  4ATZ D;  4KMO A;  5AQ7 A;  4E85 A;  5A7D B;  2EIL E;  4TXP A;  1OCO E;  3ZRH A;  5ITZ F;  2IY0 C;  3MV2 B;  1SZ9 A;  3LDZ A;  3PUK A;  5FQ7 A;  3CQC B;  4FLB A;  3CHQ A;  3HG0 D;  4U0U A;  1Q2Z A;  2GRO B;  4O60 A;  4GZC A;  1JUQ A;  4HOS A;  4A63 B;  3B7T A;  4L2L A;  5JA4 D;  3VTX A;  2XQ0 A;  3ESL A;  4HLL A;  1UOH A;  4BY6 A;  1YA0 A;  1OUV A;  3UT7 A;  2WXI A;  3BU8 A;  1HX8 A;  2L0T B;  4I6E A;  2HE0 A;  4KZC A;  4F1P A;  1JWF A;  3P2B A;  1Y8M A;  2E0I A;  4J8S A;  4UQY A;  2J8S D;  3R7R A;  2BF0 X;  4GYW A;  3U66 A;  4FU3 A;  4L9P A;  1UW4 B;  4ILI A;  5JJ6 A;  3QWW A;  3QJZ A;  3SFY A;  2KAT A;  4DPR A;  3TWV A;  4NUR A;  4CRW A;  2VTB B;  4XKC A;  3UM0 A;  3KAE A;  4IN3 B;  5C2Y A;  4ILG A;  4KXK B;  1U3D A;  5B1A E;  4MRU A;  4DK5 A;  3UI2 A;  1ELK A;  1LTX A;  2HO1 A;  4PUC A;  4G25 A;  2WVI A;  3CQG B;  3CK9 A;  1V55 E;  2J09 A;  3Q79 A;  4HOQ A;  3D9N A;  1A5E A;  4YVQ C;  4GZ3 A;  4CCA A;  5EID A;  3LJN A;  3MEK A;  2GW1 A;  3R7Q A;  1G3N B;  5AEN A;  4GZD A;  3UQ3 A;  3UMV A;  2F0Y A;  2B6C A;  1S70 B;  3S7F A;  4O1P A;  1OXJ A;  4OAV B;  3MKQ B;  2I6H A;  3U64 A;  3ZEF A;  1TN7 A;  1HG5 A;  3ZHE A;  3RU0 A;  1NFI E;  3MKR A;  4AEZ C;  5KNG A;  3CK7 A;  2I1K A;  3ULE G;  1TNY A;  1KZP A;  3DSX A;  2ZU6 B;  4I1M A;  5ENP D;  3BQO A;  3FWV A;  3URZ A;  4KZ0 A;  3GZ2 A;  4BSZ B;  3UUX A;  3Q5M A;  3QWV A;  3UT8 A;  3E30 A;  4GPK A;  1HZ4 A;  4FJY A;  2XS8 A;  3TWQ A;  4GTR A;  4CT4 A;  2HR2 A;  4U07 A;  2QYU A;  4AP2 A;  3UM3 A;  4HNA D;  4N3C A;  3LKU A;  1DVP A;  1QYM A;  3L9T A;  3QKY A;  3KEZ A;  1WG0 A;  4HLE A;  3X2Q E;  1XNF A;  4FAD A;  4AV7 A;  3CHP A;  5D66 A;  2BED A;  2YIN A;  1MX6 A;  2H6F A;  5LP0 A;  2WQ7 A;  1IYG A;  4KVO A;  3G2W A;  5KJL A;  5CEC B;  4WNG A;  2RG8 A;  5DBK A;  5KBA A;  5ANR A;  5IY5 E;  2WB2 A;  3PZ3 A;  1BI8 B;  2MRI A;  3T5V A;  1N9A A;  5KCM A;  3B7B A;  3LVR E;  3NOC D;  4GTM A;  2AJA A;  1HE8 A;  2P58 C;  1E7V A;  2M63 A;  4JHK A;  3CHO A;  5FQ4 A;  2LUH A;  3PRZ A;  3NBN B;  4ACK A;  3S2A A;  5G2N A;  5AYW D;  1LD7 A;  3SBT B;  2PM7 A;  1QZ2 A;  2ION A;  1NL4 A;  4TUM A;  5FZQ A;  2J4B A;  3CKB A;  1NZN A;  2WQ6 A;  4L7T A;  2P9I G;  5CCM A;  4B8A A;  3EHR A;  4I17 A;  2YNQ A;  1PC2 A;  3RRU A;  3FUH A;  4I2W A;  4RQI A;  1MHQ A;  4U04 A;  3RJV A;  3EIQ C;  4ANX A;  4EHM A;  3SGH A;  3J5P A;  3GZS A;  2KCL A;  3RO3 A;  5KJK A;  4EQF A;  4LG6 A;  4NRH B;  2DCP A;  1P5Q A;  4MS6 A;  4HXI A;  4CDN A;  2YQ8 A;  5EN5 D;  5FT9 A;  4XI0 A;  2OND A;  1OWM A;  1L5J A;  4EBA A;  5BXU A;  3PH0 C;  3TJP A;  4HOT A;  2IOL A;  3CLJ A;  3C3Q A;  3DSS A;  5CBN A;  3TWS A;  3CVU A;  4GAA A;  1OWL A;  2VGY A;  3UT4 A;  3DBS A;  4WND A;  1B89 A;  3L16 A;  2RFM A;  2ZGD A;  2X6F A;  5EYP F;  3BEE A;  1OWO A;  5CBO A;  2P9L G;  2XZD G;  3EHQ A;  4U8V D;  4FHK A;  3PE4 A;  4AOF A;  2A4Z A;  4Y6W A;  3D9P A;  4DX7 D;  2GRN B;  4HRN A;  3Q15 A;  4K5C A;  5M72 A;  3D9O A;  3ZGQ A;  1K8K G;  3CVN A;  4GTS A;  4YDY A;  4F53 A;  1S64 A;  2Y4T A;  3SQV A;  3JUE A;  1TNB A;  2LXM A;  1EYH A;  3WXX A;  1E8Z A;  3U9W A;  3JXJ A;  4C48 B;  3MJW A;  2LNI A;  4N2Q A;  2RKK A;  3EHM A;  3D9I A;  4G26 A;  4U96 D;  3ZIM A;  4O1O A;  3ZPJ A;  3DPY A;  2DVW A;  1NA0 A;  5EX0 A;  2E2E A;  3V2O A;  3IHY A;  4EPZ A;  1BD8 A;  4GZ5 A;  4WWO A;  5AAO A;  4RLY A;  4EEC A;  4DX6 D;  5LFA A;  2LAH A;  5J90 A;  4EZJ A;  3AG1 E;  3B95 A;  3EU5 A;  3PZ1 A;  2DIW A;  1JWG A;  5CMY A;  2XGM A;  3ULQ A;  1Y6I A;  2QC9 A;  3FUK A;  1Z3X A;  2V4L A;  4F1S A;  4J8E A;  3UKU G;  3S7B A;  3SF4 A;  5CER B;  4BEP A;  4AY6 A;  5B1B E;  2ETB A;  2EIN E;  3KD7 A;  3ISM C;  3FUF A;  4JZY A;  3RIB A;  1OWP A;  4PS7 A;  5AQ9 A;  2Q7F A;  1INZ A;  2XPI A;  3NZS A;  3HXB A;  3IHV A;  3HXE A;  2P9U G;  3RKV A;  4EZK A;  1H2V C;  3ZN3 A;  2IFU A;  2C0L A;  3RSE G;  5CHE E;  5BXO A;  3L13 A;  4XE0 A;  3CK8 A;  3D3M A;  4N3A A;  4DRX E;  3FUI A;  2PQN A;  2CFU A;  3E33 A;  4FLH A;  3QOU A;  3D9M A;  2NYJ A;  4LNB A;  1H0A A;  2BTD A;  2CG2 A;  4A1G A;  5JHB A;  4AJW A;  3ZUV B;  1FT1 A;  3HXF A;  4KVM A;  3TWU A;  3ZVV A;  3R9A B;  2J08 A;  1K1A A;  1E8X A;  3I5P A;  2BKG A;  4J7W A;  3CHM A;  3DPD A;  2DBA A;  4JB8 P;  2X6J A;  3EDT B;  3EJN A;  2XPY A;  2OCC E;  3L22 A;  3OTN A;  3PDN A;  4IRU A;  3JUI A;  2XEN A;  3B7R L;  3DEO A;  1JPL A;  3LXU X;  5T8I A;  2GRQ B;  1O1S A;  4XZ4 A;  2FO7 A;  4UQZ A;  3CV0 A;  4ANW A;  2P9K G;  4U63 A;  4UWK A;  5J08 A;  3I4G A;  3LYA A;  5B3S E;  2F8Y A;  4BT8 A;  2LSU A;  3FTS A;  1N0R A;  2IO3 C;  1BLX B;  2P9N G;  3OXG A;  1YYH A;  2WM9 A;  2PNN A;  2RD0 A;  4HI9 A;  4UWF A;  4HRL A;  3LY9 A;  4XKB A;  3ENE A;  3V79 K;  3Q9U C;  3PE3 A;  3DWL G;  2VGX A;  3OXF A;  4WUY A;  2WXP A;  1EDU A;  3UM2 A;  4J8F A;  5EYL A;  4J8D A;  2P9S G;  3PNT B;  2WXQ A;  5G55 A;  3VLE A;  1WM5 A;  3G2T A;  3ULY A;  3U4T A;  2VGE A;  2AXV A;  3HXD A;  2IOS A;  1SA4 A;  2XCB A;  1KT0 A;  3PNL B;  3FTV A;  1QBQ A;  1N4Q A;  4GTQ A;  1K1B A;  4UI9 J;  2OVF A;  4ACL A;  3FTX A;  3QWP A;  2PZI A;  3TWR A;  1A17 A;  3L82 A;  4APF A;  1O5M A;  5FTP A;  3K9I A;  4GYY A;  3ABM E;  3T9K A;  4UI9 C;  3FUL A;  1HF8 A;  4M7C A;  2UY1 A;  4GTV A;  2WXM A;  2CFZ A;  2VQ2 A;  3KS2 A;  5LCW J;  4ANV A;  3RK6 A;  2KZT A;  4BTA A;  3IKO B;  4KT6 B;  4TXQ A;  4ZFH A;  4FP7 A;  4ABN A;  3QDN A;  5BUZ A;  4KBQ A;  3D9L A;  3CVY A;  2XEV A;  2WQH A;  1AWC B;  1D9S A;  2R2L A;  3QNK A;  3ZXP A;  2HM8 A;  4DLO A;  3TAX A;  5DIZ A;  5LCW C;  4OVV A;  4LNG A;  2AW6 A;  2IJG X;  3ESK A;  1TR4 A;  3DSW A;  3JCK C;  4HB5 A;  1PY1 A;  2VSY A;  4N3B A;  3FP3 A;  1JCS A;  2AVP A;  2R02 A;  1N4S A;  1PAQ A;  3SO8 A;  2WPV A;  4JVS A;  3APF A;  1XGW A;  2I2O A;  2VGX B;  1E8W A;  5E75 A;  4CYM D;  3JQ0 A;  2WXO A;  2AXU A;  2XGO A;  4P29 A;  1N54 A;  3C5R A;  2GGF A;  3KSQ A;  1H2U A;  2H6H A;  4NQ0 A;  4TXR A;  4HI8 A;  3ASG A;  4JEU A;  1IQR A;  4MKT A;  5EKQ D;  1WY6 A;  4HFG A;  4HOU A;  4UWH A;  1FCH A;  3ML9 A;  4K03 A;  1UJJ A;  1W3B A;  1LD8 A;  1WAO 1;  1O1T A;  3NQP A;  2EQX A;  3AU5 A;  4LER A;  4W9R A;  2DZN A;  3HVE A;  3L08 A;  1KT1 A;  1N4P A;  2DYR E;  3CVL A;  3ZHE B;  2CG3 A;  3MCX A;  1X81 A;  3UPV A;  2GRR B;  1MYO A;  3V30 A;  1MJ0 A;  3HRA A;  2UY1 B;  1DC2 A;  3L17 A;  3TXM A;  2AXZ A;  4BER A;  2J49 A;  2NXP A;  3HYM B;  4GB9 A;  5AQA A;  3U3W A;  5ENT D;  4D10 C;  4QQI A;  2XRY A;  1TJF A;  4NAC A;  2R05 A;  4LEU A;  3AG2 E;  3CVW A;  5FIN A;  1WDY A;  4JC8 A;  2Y0B G;  4GMR A;  3L6A A;  5BV0 A;  4WWN A;  2WXG A;  2IEJ A;  3ABK E;  3HHM A;  2L6J A;  4K0R A;  3APD A;  4ANU A;  4L1B A;  2J9Q A;  2FEZ A;  4APO A;  5JJT A;  1SQM A;  4XI9 A;  3N71 A;  2F37 A;  4I9C A;  1IXV A;  2VSO E;  4I9E A;  4PS8 A;  3TL5 A;  3LY7 A;  1TEZ A;  3ZKJ A;  1N52 A;  1DCE A;  1SA5 A;  4GTT A;  5ENN A;  1FPP A;  2QFC A;  1UN9 A;  1S63 A;  3ASH A;  1IHG A;  1RW2 A;  2WXK A;  4AXH A;  3MYV A;  3B7U X;  3PZ2 A;  4AY5 A;  1AP7 A;  3ZYL A;  1OY3 D;  3PS6 A;  5KNH D;  2YHE A;  4EBA G;  3B7S A;  5H7P A;  1EF1 C;  4FA6 A;  5FZS A;  4O6F A;  4YDO A;  2KXP C;  3CVQ A;  4GU5 A;  4M3O A;  4QFV A;  3HVE B;  4XX5 A;  1MQS A;  3JQ1 A;  4FHJ A;  4I2Z A;  1O1R A;  4I43 A;  4JHR A;  2V0P A;  1MX4 A;  2VYI A;  4J6I A;  3VLD A;  3ASN E;  3ZU7 B;  2WXF A;  2WXH A;  1OCR E;  1BPO A;  3NOG D;  5BW8 C;  1KPS B;  1ZBP A;  2QY7 A;  3OAW A;  2EIJ E;  1UN8 A;  1TN8 A;  2PQR A;  5FQ6 A;  4FUL A;  1E96 B;  3UIO C;  3JXI A;  2CHX A;  2XGS A;  3E34 A;  4I1A A;  1OCZ E;  3CVP A;  4LUN U;  3EHN A;  3ONL A;  3ZW3 A;  5HS0 A;  3I3N A;  3AS5 A;  4F6R D;  1TNU A;  4XIF A;  4CGV A;  3LPZ A;  3P1U A;  3LJ3 A;  3ML8 A;  1TNZ A;  2C2L A;  4N5Q A;  3Q78 A;  4G24 A;  3UTM A;  3FEX A;  3CVX A;  2X38 A;  4JA7 A;  3NAW A;  3QC1 A;  3W9G A;  5D0O D;  1H2T C;  4R7L A;  1OCC E;  3LS8 A;  1NP7 A;  1HFA A;  4J0U A;  1JCQ A;  3SZ7 A;  4Z68 A;  2NSZ A;  3MX3 A;  1IKN D;  4G11 A;  3SY2 A;  5AJL A;  5AJD A;  3KSL A;  4U0S A;  3CHS A;  1HH8 A;  4JXT A;  3TWW A;  3O48 A;  4Y6C A;  4JHJ A;  3ZYK A;  3Q7F A;  4DX5 D;  3TG5 A;  2V8S E;  2WMO A;  4DI4 A;  5ENR D;  4G2V A;  2WXL A;  3TG4 A;  1Z3Y A;  5CRU A;  4I6J A;  1N0Q A;  2ZIS A;  5CCL A;  3FU0 A;  3T5X A;  2GRL A;  5HRY A;  3HXC A;  2OOE A;  3C72 A;  5D2M C;  2VTB A;  2WXR A;  1Z6T A;  1KZO A;  3F6Q A;  2R03 A;  3RRN B;  3NB2 A;  1HXI A;  4WNF A;  4L2Y A;  5EX3 A;  5AAR A;  4UWL A;  1FVF A;  1OT8 A;  5BPP A;  4JD2 G;  2A5U A;  3Q7A A;  3Q49 B;  4XEI G;  4UI9 K;  5D0Q D;  2R59 A;  3BG0 B;  2UWJ G;  3UIN C;  1E7U A;  1TNO A;  4AM9 A;  3UKR G;  3T8M A;  3KEA A;  3R9M A;  4G1T A;  3QAQ A;  3APC A;  3LEW A;  5FIO A;  4FC8 A;  4CGW A;  4GPM A;  1YMP A;  2VSN A;  2Y4U A;  2XRZ A;  4N39 A;  3FUM A;  2DYS E;  3ASO E;  4C0E A;  3S7J A;  5ENO D;  4F3V A;  3WG7 E;  4G23 A;  3V31 A;  5AN8 A;  4WNE A;  2DWZ A;  1HG2 A;  3LY8 A;  1H6K A;  3IEG A;  4I1O B;  5BV1 A;  1ZU2 A;  3SBS A;  2PM6 A;  3DEP A; 
#chains in the Genus database with same CATH homology
 2VSY A;  4N3B A;  3FP3 A;  4BT9 A;  4HOT A;  3S7D A;  2AVP A;  2IOL A;  4GCO A;  1PAQ A;  2WPV A;  5G04 C;  3CLJ A;  4JVS A;  4Q94 A;  4YVO A;  3APF A;  2IU1 A;  4BSX A;  2HYZ A;  3FY4 A;  5T3R A;  4WWP A;  1XGW A;  2I2O A;  5E76 A;  2VGX B;  3CVU A;  4GAA A;  1OWL A;  2LO6 A;  1E8W A;  3G2V A;  4WAF A;  2VGY A;  3ZYM A;  3UT4 A;  4B0Z A;  3DBS A;  4WND A;  1B89 A;  3FFL A;  5E75 A;  3NZU A;  4TUU A;  3L16 A;  3FH7 A;  2XPZ A;  3FU6 A;  3QAR A;  4A55 A;  3JQ0 A;  4B89 A;  2R5S A;  2WXO A;  2AXU A;  2XGO A;  3MV3 B;  1OWN A;  4P29 A;  3SNX A;  1N54 A;  4AVX A;  1ELR A;  2GGF A;  2R17 C;  2X6F A;  5A6C A;  1H2U A;  3BEE A;  1OWO A;  4NQ0 A;  5ARF A;  2FI7 A;  4OYS A;  2YHC A;  5FZR A;  3PZD A;  5HI7 A;  3ASG A;  4CEM A;  4GML A;  4JEU A;  3BG1 B;  4FHK A;  4DJA A;  3PE4 A;  4LRZ A;  4AOF A;  1IQR A;  2A4Z A;  5BNW A;  3CVV A;  4MKT A;  4Y6W A;  3PEV B;  5EKQ D;  3D9P A;  1WY6 A;  4C0M A;  4HFG A;  4HOU A;  4UWH A;  1DNP A;  4GZ6 A;  3Q47 B;  1FCH A;  3ML9 A;  4K03 A;  4AIF A;  3FUJ A;  3IV0 A;  1UJJ A;  4I6G A;  5LOZ A;  4DI3 A;  3Q15 A;  1W3B A;  1WAO 1;  1UJK A;  3GZ1 A;  3NQP A;  5M72 A;  3D9O A;  4GCN A;  2EQX A;  3AU5 A;  3ZGQ A;  4LER A;  2L0I A;  4W9R A;  4U8H A;  4JW1 A;  3CVN A;  2KCV A;  4F53 A;  3HVE A;  3L08 A;  2Y4T A;  3EIJ A;  4GMJ A;  1HU3 A;  1KT1 A;  4GYO A;  3RRM B;  3CVL A;  2J4D A;  3ZHE B;  2CG3 A;  3MCX A;  1EYH A;  4F7A A;  3FTZ A;  3UPV A;  3QK0 A;  3FHE A;  3WXX A;  1E8Z A;  1E8Y A;  3U9W A;  2UY1 B;  2LSV A;  3VTY A;  4BFR A;  3MJW A;  3CKC A;  3L17 A;  2LNI A;  3TXM A;  4N2Q A;  2LAI A;  2AXZ A;  4V3I A;  2J49 A;  3FTU A;  2NXP A;  3HYM B;  3ZXS A;  3G2U A;  4MLP A;  5T4Y A;  3EHM A;  1H19 A;  2JLB A;  4GB9 A;  3U3W A;  4BX8 A;  4D10 C;  4HVB A;  3D9I A;  3QB2 A;  3MKQ A;  4G26 A;  2XRY A;  3ZIM A;  1TJF A;  3ZPJ A;  4NAC A;  4BTB A;  4KMO A;  4TV3 A;  4E85 A;  5A7D B;  4TRQ A;  4E6H A;  1NA0 A;  4LEU A;  2Y3A A;  4OVU A;  3ZRH A;  5EX0 A;  3CVW A;  2E2E A;  3E4B A;  5LX8 A;  3SFZ A;  3IHY A;  3MV2 B;  4EPZ A;  2I1J A;  1SZ9 A;  1KLX A;  3ONK A;  3GW4 A;  4GA2 A;  4JC8 A;  1SZA A;  2X3M A;  3LDZ A;  3PUK A;  5FQ8 A;  5FQ7 A;  4GZ5 A;  5FJY A;  4WWO A;  3IBE A;  3L6A A;  3FUD A;  2PL2 A;  3CQC B;  4EEC A;  2FBN A;  4FLB A;  3ZFW A;  3CHQ A;  4WWN A;  5BV0 A;  2WXG A;  3HHM A;  4U0U A;  2L6J A;  5LFA A;  2LAH A;  4K0R A;  4RVB A;  1S0P A;  2KM4 A;  3CIA A;  3APD A;  4GZC A;  4ANU A;  4EZJ A;  4L1B A;  5J90 A;  1JUQ A;  2J9Q A;  2FEZ A;  4HOS A;  4APO A;  2DIW A;  5JJT A;  4A3T A;  1SQM A;  2X6I A;  4XI9 A;  1JWG A;  5CMY A;  3B7T A;  3N71 A;  4L2L A;  3VTX A;  2XGM A;  2XQ0 A;  4IYP A;  4I9C A;  3ULQ A;  2VSO E;  3ESL A;  1Y6I A;  4LCT A;  2J07 A;  1ELW A;  3CR3 A;  4I9E A;  4PS8 A;  3TL5 A;  4YND A;  2OVB A;  3FUK A;  1Z3X A;  4FJZ A;  3LY7 A;  4BY6 A;  1YA0 A;  1OUV A;  3SI5 A;  2V4L A;  1TEZ A;  4JA9 A;  4F1S A;  4J8E A;  3UT7 A;  2WXI A;  1N52 A;  2MOW A;  3S7B A;  3SF4 A;  1HX8 A;  2L0T B;  5ENN A;  1NA3 A;  4I6E A;  3MA5 A;  4KZC A;  2QFC A;  4AY6 A;  4RSY A;  3FDH A;  1JWF A;  3P2B A;  1UN9 A;  1Y8M A;  2E0I A;  4J8S A;  3AS4 A;  3ASH A;  4UQY A;  1IHG A;  5ANL A;  5ARG A;  2WXK A;  3FU3 A;  3R7R A;  2BF0 X;  4GYW A;  3KD7 A;  3U66 A;  4FU3 A;  1UW4 B;  3FUF A;  4ILI A;  5JJ6 A;  4AXH A;  3L54 A;  3MYV A;  3RO2 A;  3B7U X;  1U3C A;  4JZY A;  3RIB A;  3ZYQ A;  1OWP A;  3QWW A;  3QJZ A;  4AY5 A;  2KAT A;  4PS7 A;  4DPR A;  4NUR A;  2Q7F A;  4CRW A;  2VTB B;  4ILH B;  4XKC A;  2KCK A;  1INZ A;  3KAE A;  4IN3 B;  3CGH A;  3ZYL A;  2VJ8 A;  3AS8 A;  3PRE A;  2XCC A;  3PS6 A;  2YHE A;  4EBA G;  2XPI A;  5C2Y A;  3NZS A;  4ILG A;  2IQC A;  3B7S A;  3LVQ E;  3IHV A;  1E90 A;  4KXK B;  1U3D A;  1EF1 C;  2FF4 A;  4FA6 A;  3RKV A;  4EZK A;  1HS6 A;  5FZS A;  1H2V C;  4O6F A;  2FUL A;  3ZN3 A;  4MRU A;  4PDX A;  2IFU A;  5G05 J;  4DK5 A;  3CVQ A;  1ELK A;  3G2S A;  2HO1 A;  4GU5 A;  2C0L A;  4PUC A;  4G25 A;  5CHE E;  2WVI A;  3CQG B;  3L13 A;  4M3O A;  4QFV A;  3CK9 A;  3HVE B;  1MQS A;  4XE0 A;  4XX5 A;  3JQ1 A;  3CK8 A;  3D3M A;  2J09 A;  4FHJ A;  4I2Z A;  4GA1 A;  4N3A A;  4HOQ A;  5FWQ A;  2CHZ A;  4I43 A;  3FUI A;  3D9N A;  2PQN A;  3FU5 A;  2CFU A;  4GZ3 A;  4YVQ C;  4FLH A;  2AWI A;  4JHR A;  4CCA A;  3QOU A;  3MEK A;  2IF4 A;  2V0P A;  2VYI A;  3D9M A;  4C9B B;  1H0A A;  2GW1 A;  4J6I A;  3VLD A;  1QNF A;  3FUN A;  2WXF A;  2WXH A;  3R7Q A;  5AEN A;  2BTD A;  4GZD A;  1BPO A;  2WXN A;  3UQ3 A;  3UMV A;  3FEY A;  2CG2 A;  3S7F A;  5BW8 C;  4U0Z A;  4A1G A;  1ZBP A;  3D9J A;  2QY7 A;  5JHB A;  5G05 C;  3NF1 A;  4AJW A;  3OAW A;  5JHA A;  1UN8 A;  3MKQ B;  3SD5 A;  4CT0 A;  2I6H A;  3D9K A;  3U64 A;  3ZEF A;  1HG5 A;  3ZHE A;  4KVM A;  2KZT B;  2PQR A;  5FQ6 A;  3ZVV A;  4FUL A;  3FUE A;  3R9A B;  1E96 B;  3GYZ A;  3RU0 A;  3FTW A;  2J08 A;  3MKR A;  2CHX A;  1E8X A;  2XGS A;  3I5P A;  3TXN A;  4AEZ C;  3CK7 A;  3CHM A;  4KYO B;  2I1K A;  3DPD A;  2DBA A;  5EDS A;  4I1A A;  3CVP A;  4LUN U;  2MHK A;  2X6J A;  2ZU6 B;  3EHN A;  3ONL A;  4HS2 A;  4I1M A;  1TJC A;  3EDT B;  3FWV A;  3EJN A;  2XPY A;  3URZ A;  3ZW3 A;  4HOR A;  4KZ0 A;  3GZ2 A;  3I3N A;  3L22 A;  3AS5 A;  3VLF A;  4Q69 A;  3OTN A;  3PDN A;  4IRU A;  3JUI A;  4XIF A;  3CHR A;  3B7R L;  4JEH A;  3UUX A;  2C0M A;  3LPZ A;  3Q5M A;  4CGV A;  2OV8 A;  3P1U A;  3QWV A;  3UT8 A;  3LJ3 A;  1JPL A;  3ML8 A;  1EPU A;  4GPK A;  2JEK A;  3LXU X;  5T8I A;  1HZ4 A;  3HIZ A;  3FH5 A;  4FJY A;  2C2L A;  4G24 A;  3FEX A;  4XZ4 A;  2FO7 A;  3PEU B;  3CSF A;  4H7X A;  4PH4 B;  2KC7 A;  4UQZ A;  3CV0 A;  2X38 A;  4JA7 A;  3CVX A;  4CT4 A;  4ANW A;  4U63 A;  3QC1 A;  4UWK A;  2HR2 A;  5J08 A;  3I4G A;  3LYA A;  4U07 A;  5D0O D;  4BX9 A;  4EZL A;  4AP2 A;  2WXJ A;  4BT8 A;  4N3C A;  1H2T C;  2LSU A;  3FTS A;  4R7L A;  3LS8 A;  3LKU A;  1DVP A;  1NP7 A;  1HFA A;  3OXG A;  4J0U A;  2WM9 A;  3SZ7 A;  2RD0 A;  3TGO A;  2NSZ A;  4UWF A;  2V5F A;  3MX3 A;  4G11 A;  3SHF A;  5AJL A;  3LY9 A;  3QKY A;  4URK A;  4XKB A;  3ENE A;  5AJD A;  3KEZ A;  4UQX A;  4B94 A;  2VSX E;  4U0S A;  3CHS A;  4HLE A;  4ME2 A;  5HQ8 A;  1HH8 A;  1XNF A;  4JXT A;  3PE3 A;  4A3V A;  4AV7 A;  4FAD A;  3O48 A;  3B13 A;  5C1D A;  3CHP A;  4Y6C A;  4WUY A;  2VGX A;  3OXF A;  4JHJ A;  3ZYK A;  4A1S A;  4RG9 A;  2WXP A;  1EDU A;  3JYS A;  2YIN A;  2L9B A;  4J8F A;  3TG5 A;  5LP0 A;  2V8S E;  4J8D A;  1LF8 A;  2WMO A;  2WQ7 A;  4DI4 A;  3FTY A;  1IYG A;  4G2V A;  4KVO A;  3G2W A;  5BT1 A;  2WXL A;  3PNT B;  2WXQ A;  5G55 A;  4GA0 A;  3TG4 A;  3VLE A;  1Z3Y A;  1WM5 A;  4CDR A;  5KJL A;  3G2T A;  4WNG A;  4I6J A;  3U4T A;  3UX4 A;  5CCL A;  2AXV A;  2RG8 A;  3FU0 A;  5DBK A;  3T5X A;  5ANR A;  2GRL A;  3MGB A;  1VDY A;  2OOE A;  2WB2 A;  2IOS A;  2MRI A;  2XCB A;  1KT0 A;  3PNL B;  3PUJ A;  3FTV A;  4L23 A;  5KCM A;  3T5V A;  2CHW A;  3LVR E;  3O4Z A;  2VTB A;  2WXR A;  1Z6T A;  1HE8 A;  4UI9 J;  2OVF A;  2P58 C;  3MZL B;  4H7Y A;  2NC9 A;  1E7V A;  2M63 A;  4JHK A;  3CHO A;  5FQ4 A;  4B8C B;  1UG3 A;  3RRN B;  4CDM A;  3PRZ A;  4ACL A;  4ACK A;  3FTX A;  1HXI A;  4WNF A;  3S2A A;  3QWP A;  4L2Y A;  5EX3 A;  2PZI A;  5G2N A;  2X6H A;  4UWL A;  5AYW D;  1FVF A;  1A17 A;  3SBT B;  2PM7 A;  1QZ2 A;  4APF A;  3C98 A;  2ION A;  5FTP A;  5BPP A;  2A5U A;  4ATG A;  3Q49 B;  3K9I A;  4UI9 K;  4UWG A;  5D0Q D;  4GYY A;  2R59 A;  5KJM A;  5AIJ A;  3BG0 B;  2UWJ G;  1E7U A;  5FZQ A;  2J4B A;  3CKB A;  5CMW A;  4AM9 A;  1NZN A;  2WQ6 A;  4L7T A;  3LCA A;  3CST A;  4UI9 C;  3FUL A;  3AU4 A;  2I9C A;  5CCM A;  1HF8 A;  1GW6 A;  3T8M A;  4B8A A;  5KJN A;  2UY1 A;  4I17 A;  2YNQ A;  2WXM A;  1PC2 A;  2CFZ A;  4G1T A;  3RRU A;  1FVH A;  3FUH A;  3I4R B;  2VQ2 A;  3KS2 A;  3QAQ A;  5LCW J;  3APC A;  4I2W A;  4JPS A;  4ANV A;  1MHQ A;  3LEW A;  4U04 A;  3RJV A;  4FC8 A;  4DLQ A;  4CGW A;  3ASF A;  4IUL A;  3RK6 A;  2VSN A;  3EIQ C;  3PVL A;  4ANX A;  3OXL A;  2Y4U A;  2KZT A;  4RG6 A;  3SGH A;  4BTA A;  3GZS A;  4Q96 A;  5JJ7 A;  2WMN A;  2BUG A;  3IKO B;  2XRZ A;  4N5C A;  4N39 A;  5G04 J;  4KT6 B;  3ASD A;  4JL0 A;  4FP7 A;  3FUM A;  4BWR A;  2KCL A;  3FH8 A;  3RO3 A;  4ABN A;  3QDN A;  2X6K A;  4C0E A;  4EQF A;  3S7J A;  5KJK A;  3CEQ A;  4NRH B;  4F3V A;  5BUZ A;  4KBQ A;  2GRM A;  2DCP A;  1P5Q A;  3D9L A;  4G23 A;  4MS6 A;  3CVY A;  2XEV A;  4HXI A;  2WQH A;  4PS3 A;  4WNE A;  4CDN A;  2YQ8 A;  2XHE A;  3QNK A;  1IQU A;  1HG2 A;  2HM8 A;  4DLO A;  3TAX A;  5DIZ A;  5LCW C;  5FT9 A;  4OVV A;  3LY8 A;  1H6K A;  3IEG A;  4I1O B;  2AW6 A;  1HO8 A;  1QQE A;  4XI0 A;  2OND A;  5A23 A;  1OWM A;  1L5J A;  2IJG X;  3Q4A B;  2ILR A;  4EBA A;  5BV1 A;  1ZU2 A;  4N2S A;  3PH0 C;  3TJP A;  3HDX A;  3SBS A;  3ESK A;  1X5B A;  2PM6 A;  3JCK C;  1PY1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...