3CVLA

Structure of peroxisomal targeting signal 1 (pts1) binding domain of trypanosoma brucei peroxin 5 (tbpex5)complexed to t. brucei phosphofructokinase (pfk) pts1 peptide
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
317
structure length
294
Chain Sequence
TDYPFEANNPYMYHENPMEEGLSMLKLANLAEAALAFEAVCQAAPEREEAWRSLGLTQAENEKDGLAIIALNHARMLDPKDIAVHAALAVSHTNEHNANAALASLRAWLLSQPQYEQLFFFAAPNEYRECRTLLHAALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVGGTTPASREATRSMWDFFRMLLNVMNRPDLVELTYAQNVEPFAKEFGLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peroxisome targeting signal 1 receptor PEX5
publication title Structural Insights into the recognition of peroxisomal targeting signal 1 by Trypanosoma brucei peroxin 5.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Transport protein
total genus 116
structure length 294
sequence length 317
ec nomenclature
pdb deposition date 2008-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3cvlA00
4G26A 4NRHB 2LSUA 3QOUA 4I2WA 5EKQD 1OUVA 1B89A 1E96B 3R9AB 2UY1A 4AY5A 3U4TA 4GA0A 2XGSA 3KS2A 2Q7FA 2VYIA 3MA5A 3CKCA 4H7YA 4HORA 3CV0A 3N71A 1IYGA 1HH8A 2XGOA 1QQEA 4RG6A 1P5QA 2L6JA 3EDTB 3ASHA 4UI9J 4UQYA 2C0LA 4I2ZA 3RU0A 3HYMB 2PZIA 3UQ3A 4W9RA 2R5SA 3S7JA 3Q47B 5JJ7A 3VTYA 4N5CA 2HR2A 4A1SA 3LKUA 4GYOA 3ULQA 3CK7A 4U07A 5KJMA 2FF4A 3VTXA 4N3CA 2JLBA 4N2SA 3RKVA 4G1TA 2NC9A 5FZSA 4KXKB 1WAO1 4UI9C 4XI9A 4G23A 2YQ8A 3RJVA 4ME2A 4G25A 2FBNA 3LY9A 5KJKA 4GCNA 2KATA 2C0MA 5KJNA 2UWJG 5G04J 3CKBA 1KT0A 3AS8A 2YHCA 3GW4A 2XCCA 5FZQA 2C2LA 3QWPA 3URZA 3SZ7A 3TGOA 2IF4A 3ESKA 2E2EA 4G24A 3ZHEB 3MV3B 4F3VA 2PL2A 4GYWA 2DBAA 2FEZA 3LYAA 5CHEE 4GPKA 3PE3A 1HXIA 3CEQA 3S7FA 4Y6CA 4WNGA 5HQ8A 2Y4UA 5KJLA 4XI0A 4HOTA 2KC7A 4ABNA 4GYYA 5A7DB 4G2VA 4WUYA 4GA1A 4H7XA 3KD7A 3QWVA 4HOUA 3WXXA 1KT1A 2HO1A 3MKRA 4KYOB 4RG9A 2VGXB 4U0SA 2WPVA 2J9QA 1QZ2A 2XGMA 3LCAA 3ZGQA 3AS4A 3CVQA 3CVLA 5ARFA 4GA2A 2KCLA 2QFCA 2VSNA 3S7BA 4HOQA 3LY8A 3NF1A 2GW1A 5LCWJ 3CVNA 4WNEA 4CDRA 4GZ6A 4U0ZA 5AYWD 2AVPA 3UUXA 4Y6WA 2XEVA 2PQRA 4O6FA 4UQXA 4AIFA 4NQ0A 3QDNA 4CGVA 1A17A 4APOA 3TG4A 1FCHA 5FTPA 4N3BA 5EX3A 5HI7A 3GZ2A 1W3BA 3Q5MA 2XCBA 3ZN3A 4EQFA 3ASDA 5LCWC 3ZFWA 3BEEA 2LNIA 3K9IA 1Y8MA 4UI9K 3Q49B 3ZHEA 3TAXA 4GZ5A 3MV2B 5JJTA 4N2QA 4BTBA 1IHGA 3FP3A 4B94A 5FJYA 2KCVA 5A6CA 1ELWA 3S7DA 5JJ6A 4U0UA 5EX0A 5CCLA 4J8DA 2FO7A 4YNDA 1ZU2A 3RO2A 5G05J 2WQHA 3MEKA 4I9CA 5G04C 4LEUA 5M72A 5CCMA 2FI7A 5DBKA 4BT9A 2V5FA 5BW8C 3UPVA 3LPZA 4YVQC 3OXLA 2VSYA 3Q15A 2VGXA 5DIZA 1XNFA 4JA7A 2Y4TA 2PQNA 3Q4AB 4J8FA 4AM9A 2HYZA 3U3WA 3RIBA 4J0UA 1NA0A 5ARGA 3FWVA 1YA0A 1HZ4A 4UQZA 5G05C 5C1DA 2UY1B 4KBQA 3PE4A 5FZRA 3ASGA 2IFUA 3OXFA 1KLXA 3E4BA 3CK9A 4IN3B 2ONDA 3JYSA 3QWWA 4YVOA 1PC2A 2KCKA 2BUGA 3IEGA 4J8EA 4JL0A 4U04A 3QKYA 1NZNA 3GZ1A 2MHKA 3GYZA 2LSVA 4BT8A 4JA9A 1TJCA 3RO3A 3O48A 4I1AA 5D0QD 2VGYA 4AY6A 3AS5A 2OOEA 4BWRA 4WNDA 4I9EA 4GZ3A 5FT9A 4XIFA 5BNWA 4CGWA 4HOSA 2XPIA 4N3AA 3OXGA 1ZBPA 5D0OD 2I6HA 3ASFA 3SF4A 4WNFA 4GCOA 1ELRA 3FFLA 2VQ2A 3CK8A 4JHRA 4N39A 3TG5A 3PDNA 3ZPJA 5BT1A 3CVPA 4BTAA 2P58C 3KAEA 4I17A 1WM5A 3LY7A 1NA3A
chains in the Genus database with same CATH superfamily
4MLPA 5CMYA 2BKGA 5HRYA 1HF8A 3AU4A 3BG0B 1V54E 1TN6A 3KSQA 4MKTA 4B89A 1B89A 3SFYA 3TXMA 4DX5D 2VTBA 2WXGA 3PRZA 1XGWA 1EYHA 2WXMA 2XGSA 2EILE 4JEHA 2VYIA 5T8IA 3CKCA 3CV0A 5EN5D 2XS8A 2X3MA 4MBGA 4APFA 1P5QA 2DIWA 3CHOA 4UI9J 2F8YA 1OWOA 1D9SA 5CMWA 2PZIA 3UQ3A 2H6GA 3DEOA 3VTYA 3HDXA 1E8XA 1Z5SC 4ZHBA 1FVFA 1MJ0A 3V2OA 3ULQA 3SBTB 3ONKA 2IY0C 4U07A 1V55E 3NOCD 2MOWA 5A23A 3RKVA 1WG0A 4G1TA 2WXKA 4GTSA 3I4GA 3FTVA 1OWNA 2YQ8A 4G8LA 4JB8P 1SW6A 2BEDA 4C9BB 5T4YA 3V30A 5CEDB 4K0RA 3SI5A 1KT0A 3AS8A 4E85A 2CFUA 3FH5A 2VGEA 1HS6A 1Q2ZA 4HRMB 1MX6A 3GW4A 3FULA 3TWTA 1JCSA 5J08A 3G2UA 4FHKA 4ACKA 4N5QA 4JXTA 3URZA 3ESKA 3EU5A 1WDYA 4I6GA 2E2EA 4B0ZA 3Q75A 3MV3B 1TN8A 1EPUA 1PAQA 2DBAA 4CDMA 2B0OE 4GTOA 3FUHA 5CRVA 5ITZF 3NAWA 4GTPA 3ZYMA 3ZYLA 3TXNA 3CEQA 3CQGB 5KJLA 2EIME 2R05A 5LOZA 1N0QA 4ABNA 3JXIA 4H7XA 4HOUA 3C3OA 3L9TA 3Q9UC 2OEWA 4AP2A 4IYPA 3UT4A 3MKRA 5EIDA 4U0SA 4YDOA 5AJLA 2P9PG 4O1PA 5KBAA 2XGMA 3LCAA 3AS4A 3CVQA 3CSFA 5ARFA 3G2WA 2VSNA 4A63B 3E37A 4AV7A 4CT0A 4DPRA 2MYOA 4JZYA 4WNEA 4CDRA 3NB2A 5CEAA 4U0ZA 3FH8A 2WXPA 4ILIA 4Y6WA 5E76A 2DVWA 4O6FA 3QDNA 1A17A 3EHNA 4M7CA 3FUNA 3CLJA 1E8YA 5FWQA 5FTPA 1ZB1A 5EX3A 3GZ2A 3D3MA 3Q5MA 2WXJA 4FP7A 3ZN3A 3ASDA 3DSVA 2I1KA 2PNNA 3U9WA 3BG1B 5KWDA 3E32A 2WMOA 1IQRA 2DZNA 5B1BE 4B8AA 2XEHA 5JJTA 2DZOA 2L0TB 5FJYA 1N9AA 2KCVA 1OY3D 3FTWA 5CCLA 5BV1A 2FO7A 3MX3A 2R59A 5G05J 3HXEA 4KT6B 4TUMA 2HE0A 1UOHA 4URKA 5M72A 3HXCA 4J7WA 5CCMA 5DBKA 4BFRA 2DCPA 3TWXA 3UM0A 3UPVA 3LJ3A 3LPZA 2VSOE 1DVPA 4OVVA 3JUIA 3OXLA 4J8SA 1MX4A 2ZXWE 1LD7A 1YYHA 1FT1A 4GTQA 2Y4TA 4J8FA 3MYVA 4ATGA 3D9KA 3V79K 1UW4B 3RIBA 4FJZA 1NA0A 1RZ4A 4O60A 1HZ4A 2LAIA 2J49A 2EINE 3VLDA 2WQ6A 2VTBB 3JQ0A 3PE4A 3CVWA 5D2MC 2XPZA 3OXFA 2JABA 1KZPA 4JVSA 3DSUA 2QYUA 4IN3B 4I1OB 2KCKA 4ANXA 3I5PA 1A5EA 1H2UA 5CRUA 5AIJA 4CZ2D 4JPSA 3T8MA 4JL0A 2OEVA 4U04A 5ENOD 3ESLA 3L08A 4KZCA 4U8YD 4BY6A 4U63A 1SZ9A 1NZNA 3TL5A 3GZ1A 4ATZD 2RKKA 2LSVA 5FINA 4JA9A 4Q69A 3SFXA 3JCKC 2VGYA 4AY6A 2GRNB 4BWRA 2L0IA 2YINA 4GZ3A 1JWGA 2GRRB 4CGWA 2XPIA 3EJNA 3D9NA 1ZBPA 5D0OD 3IHVA 4WNFA 1EF1C 4GCOA 3CHPA 3CK8A 1FVHA 4N39A 1FPPA 4YDWA 2X38A 1SZAA 3PEUB 3ZRHA 4U8VD 2J08A 5G2NA 3UX4A 3F6QA 1WM5A 3LY7A 2AXUA 2LSUA 1HG5A 3QOUA 4HI8A 1N11A 5HS0A 4HLLA 3FTSA 3ENEA 2UY1A 3MKQA 4AY5A 4GA0A 5CBOA 2HM8A 3DXMG 3BUAA 1O1SA 3B13A 3QK0A 4RVBA 4GTTA 2IEJA 2B6CA 1K1BA 4ZFHA 2J09A 3FH7A 4GZDA 2WXFA 3FU3A 1QYMA 3EU9A 1IYGA 3MJWA 1HH8A 2KZTB 3SQVA 3ZVVA 1MQSA 4LRZA 2C0LA 3RU0A 2IONA 1INZA 3Q47B 4N5CA 4A1SA 4B8CB 3LKUA 1JWFA 3UM1A 3DSSA 2PM7A 3UMVA 5KJMA 2WXLA 3AG4E 4N3CA 3MZLB 2EIJE 2JLBA 3JXJA 3R7RA 3U64A 3AAAC 2I2OA 3V31A 3RAUA 3PNTB 1YMPA 3B95A 2P9UG 4JHKA 4UI9C 2EIKE 3APCA 2GRPB 4G23A 2XQ0A 5FQ4A 1BI8B 1HO8A 3RJVA 1JPLA 4J6IA 2LUHA 4L1BA 4GCNA 3OTNA 5KJKA 3NQPA 4AJWA 3GZSA 2P9KG 5G04J 3ZYQA 2DYRE 5D66A 2YHCA 1TNBA 5FZQA 4HI9A 3Q7AA 3QAQA 4R7LA 3QC1A 5ENRD 3DRAA 3SZ7A 3TGOA 4UWKA 4CYMD 4BETA 4G24A 1BI7B 2R02A 3FUFA 4GYWA 4XKCA 3RSEG 2R17C 3DSWA 4OAUC 3LS8A 4FULA 4KMOA 3UKRG 2E0IA 1OT8A 3AU5A 3S7FA 5HQ8A 1SA4A 4HOTA 4PDXA 3R9MA 3ML8A 4GYYA 3PZ2A 1NL4A 5E75A 2QYJA 2GRQB 3WXXA 3SFZA 4FLBA 3PZ3A 4LG6A 3Q79A 2VSXE 2J07A 4GTVA 5B1AE 2P9NG 3D9MA 2A4ZA 5BUZA 5AN8A 1UJKA 2KCLA 3PREA 4A1GA 2WXIA 2Y0BG 4LSZE 4NIKA 1E8ZA 4JEUA 3NF1A 5LCWJ 3ISMC 4RQIA 4GZ6A 1UG3A 3B7RL 1RW2A 1SQMA 5AYWD 1G3NB 3KSLA 2QY7A 3NZUA 3UUXA 2ZISA 2ETBA 4WAFA 4NQ0A 4AIFA 3C98A 5ENTD 5C2YA 3BU8A 2P9IG 4K03A 1FCHA 3FDHA 2XCBA 1N4RA 4D10C 4AXHA 2LNIA 5FIOA 2CHXA 1Y8MA 1E90A 3EIQC 5JHAA 4QQIA 1U3DA 4N2QA 2GRMA 2WXQA 1TNYA 4HFGA 1Z3XA 3I4RB 1ELWA 2R2LA 4BERA 4UWFA 4PS7A 3LVQE 4EZLA 1OWPA 2KXPC 3ZKJA 4DUIA 2WM9A 4C48B 3FUEA 5BW8C 3HVEA 4UWLA 2L9BA 2KBXA 3T5VA 4XKBA 2V5QC 3QB2A 5LX8A 2VGXA 3D9LA 4JA7A 4FU3A 4L9PA 4XEIG 2VJ8A 3UI2A 4HS2A 4U96D 3NZSA 3T8KA 2LXLA 5EDSA 1N54A 4NACA 2YHEA 1YA0A 1ELKA 4X8QA 4UQZA 3C3RA 5G05C 5C1DA 2UY1B 3MKQB 4CRWA 2F37A 2H6FA 5FZRA 1KLXA 3CK9A 3ASNE 4V3IA 2V8SE 1NP7A 3ABKE 3L54A 3E30A 4YVOA 1PC2A 3E33A 4KVMA 2XPYA 1Z3YA 2BUGA 4EPZA 4L23A 5JA4D 1OWMA 3C72A 1KZOA 3MCXA 1K1AA 3HHMA 4LCTA 3NOGD 5AQAA 4L2YA 2IO2C 1H0AA 5KNGA 4EBAA 5AJDA 4FJYA 3NBNB 5ANRA 3SBSA 2WXNA 4WNDA 3RRNB 1HX8A 4XIFA 3SNXA 4N3AA 4JD2G 3OXGA 3ZNGA 3PVLA 1HE8A 5HKPA 2L6BA 1X81A 1U3CA 1ELRA 4ANVA 2LAHA 2GGFA 4JHRA 3EHQA 3ML9A 1PY1A 1TYQG 2R03A 1MX2A 4F1PA 3ZW3A 5FQ8A 2V4HC 3CVPA 2IOSA 4LUNU 4OAVB 2X6IA 4BTAA 2J8SD 3KAEA 3W9GA 1N95A 3PUJA 5JMND 1DCQA 4KVOA 5T3RA 3HIZA 2BTDA 2AW6A 4HQDA 4YDYA 3P1UA 1H6OA 1E96B 2ZU6B 3U4TA 3HRAA 2OVBA 4PS8A 4JC8A 4AOFA 2BF0X 2ILRA 2Q7FA 4HORA 3S2AA 2F8XK 1O1TA 4FHJA 1QQEA 4RG6A 2L6JA 3EDTB 3ASHA 3ZUVB 1HFAA 4I2ZA 4LNUD 1K8KG 1QNFA 4W9RA 3DBSA 4GZCA 3S7JA 5JJ7A 3O4ZA 3QJZA 3HXBA 4WWPA 4FADA 3FUIA 4M3OA 3CK7A 2FF4A 3VTXA 2LO6A 3HG0D 4N2SA 3SGHA 4FA6A 4JHJA 4HRNA 5BXOA 3UT8A 3D9PA 2NC9A 3PZ1A 3FUMA 3TWWA 3TWVA 1WAO1 3C5RA 3D9IA 5LFAA 5ENPD 3TWSA 4WWOA 3FTXA 2FBNA 2A5EA 3LY9A 1HU3A 2KATA 2XS1A 1JCRA 4BSZB 2DWZA 3HXFA 4UWGA 2C2LA 3IHYA 4BX8A 4EZKA 4F3VA 1N52A 2RD0A 1SA5A 3ABME 1H2VC 3LYAA 4HXIA 3UINC 5CHEE 4HRLA 1D8EA 1H6PA 2XRZA 1HXIA 1S63A 2XRYA 4NURA 4Y6CA 5BV0A 5ANLA 3FEYA 4XI0A 3X2QE 3PH0C 2QZAA 2KC7A 4G2VA 4WUYA 4GA1A 3KD7A 3CGHA 3CHSA 1KT1A 3HVEB 2Y1LE 3W9FA 4BEPA 2VGXB 2GROB 3FTUA 2J9QA 1AWCB 4QFVA 1QZ2A 3EHRA 4U7EB 4TXRA 3ZGQA 5ENSD 3CVLA 2A5UA 3J5PA 4GA2A 2IO3C 4XZ4A 3TWRA 3UTMA 4HOQA 1FT2A 3IBEA 3CVNA 1K3ZD 1MZCA 3APDA 3B7BA 4RLYA 2AVPA 4CCAA 4F1SA 2NXPA 4WWNA 2ZGGA 4LERA 4G8KA 4DLQA 4APOA 5B3SE 4XE0A 4CEMA 5BXUA 1MYOA 4DJAA 3KEAA 4EQFA 1OCCE 5LCWC 4GPMA 3ZFWA 2CHZA 3K9IA 5KCMA 2XZTG 4P29A 3D9HA 4UI9K 2WXRA 5EYPF 3ZHEA 3HXDA 1MHQA 3TAXA 3MV2B 4I1MA 4HBDA 3R7QA 5EYLA 3ULYA 2JEKA 1H2TC 2P2CP 4U0UA 3T9KA 3APFA 3D9OA 4DX1A 3D9JA 4J8DA 2I9CA 4YNDA 3CVXA 3QARA 4TXPA 5CBNA 2I1JA 1DNPA 2AWIA 4BT9A 1EDUA 4OVUA 4UUCA 3LXUX 1OCZE 4YVQC 2WXHA 2KM4A 3Q15A 4F53A 1XNFA 3FU6A 4J8YA 1LD8A 4E6HA 4DX2A 4TV3A 5JHBA 5ARGA 2CG2A 5FQ7A 3FWVA 2V4LA 1Y6IA 1BLXB 4KBQA 2X6KA 4TXQA 3DPDA 3JUEA 3ASGA 3PUKA 3FEXA 3L13A 3E4BA 3ZYKA 4BSXA 4G11A 4I6EA 2ONDA 3L22A 5FQ6A 3QWWA 5EIBE 1O1RA 1SVXA 3IEGA 3ZEFA 4J8EA 3DSTA 2NYJA 3QKYA 3TWQA 1N4SA 4DX6D 2MHKA 3JQ1A 1E7VA 4L2LA 3AG1E 4BT8A 3RO3A 3AG3E 3O48A 4I1AA 1WY6A 5D0QD 2CG3A 3AS5A 1N4QA 2OOEA 1U2VG 3FHEA 4BESA 1L5JA 4I9EA 4EBAG 2LXMA 5FT9A 3G2TA 5AARA 5BNWA 4HOSA 2BKKB 5H7PA 2ZGDA 3SF4A 2XENA 3FUDA 4Q96A 4LNBA 4GU5A 2X6FA 1NI1A 1O5MA 2XZDG 1NFIE 2IQCA 1TNZA 3TG5A 1X5BA 3P2BA 4PUCA 3PDNA 2RFAA 3FTYA 2EQXA 5ENQD 1OCOE 2FULA 4I17A 1NA3A 3PZ4A 4G26A 4NRHB 4I43A 4I2WA 3T5XA 2AXVA 5EKQD 2J4BA 1OUVA 4CT4A 5CECB 3R9AB 1TNOA 3C3QA 4A3VA 4BX9A 3PS6A 1TR4A 2KZTA 5AQ7A 1H6KA 2WVIA 3KS2A 4C0EA 1GW6A 2AJAA 3FUJA 3UIOC 2XEEA 3MA5A 4H7YA 4I6JA 3G2VA 4GTRA 3N71A 3L16A 4A55A 2XGOA 4XX5A 3BQOA 1OXJA 4GMLA 5AQBA 1IQUA 4UQYA 1OWLA 3CSTA 3HYMB 5KNHD 3TJPA 2R5SA 3EHMA 1DCEA 3IXEA 3SD5A 2HR2A 4K5CA 4GYOA 4HLEA 3PNLB 4GAAA 3PZDA 5G55A 2P9LG 1E7UA 3ZU7B 4FLHA 3CHQA 2Y3AA 1BPOA 3CR3A 3CIAA 3CQCB 2J4DA 1H19A 5FZSA 3E34A 2Y69E 4KXKB 2NSZA 4XI9A 4DRXE 2V0PA 4ME2A 3KEZA 4G25A 4EZJA 3DSXA 1KPSB 3PEVB 2C0MA 5KJNA 1HG2A 3QNKA 2MRIA 5BPPA 2UWJG 3CKBA 2X6JA 2XHEA 2M63A 3DEPA 1LF8A 4IULA 1VDYA 3ASOE 4EECA 3DXKG 4ANUA 2XCCA 3B7UX 4HNAD 3U66A 3QWPA 4L7TA 2IF4A 4GMRA 3ZHEB 3Q73A 2PL2A 3RRMB 3UIPC 2P9SG 2FEZA 2IU1A 1UN8A 2OCCE 5AENA 4GPKA 3DWLG 1JCQA 3PE3A 3UKUG 4WNGA 2Y4UA 3V2XA 2ETAA 4K5BA 4DI3A 5A7DB 4C0MA 3B7SA 3QWVA 4TRQA 1AP7A 4DK5A 3ABLE 2HO1A 2DYSE 4YDEA 3B7TA 1S0PA 3AG2E 3Q9NC 4KYOB 2RFMA 4ILGA 4RG9A 2WPVA 4ACLA 4B93B 2QFCA 3S7BA 3SO8A 4MS6A 4OYSA 5ENNA 3LY8A 1JUQA 2GW1A 1D8DA 5AQ9A 1S70B 3WG7E 3LEWA 5AAOA 4CDNA 1YCSB 2XEVA 2PQRA 4F6RD 4AEZC 4UQXA 4DX7D 3LVRE 3FY4A 4CGVA 3G2SA 3L82A 3FU5A 5EILA 3TG4A 1S64A 4A3TA 4N3BA 5HI7A 1W3BA 1Z6TA 1BU9A 4EHMA 3BEEA 2OV8A 3CVUA 4UWHA 3Q49B 4GZ5A 1IHBA 4Q94A 1IXVA 4MRUA 4BTBA 1IHGA 3FP3A 4U8HA 2CFZA 4B94A 2RG8A 5A6CA 1TEZA 1N4PA 4TUUA 3S7DA 3ZIMA 5JJ6A 5EX0A 3ULEG 4HVBA 4JW1A 4LNGA 1ZU2A 3RO2A 2WMNA 2WQHA 3MEKA 3LDZA 4I9CA 5G04C 1N94A 4LEUA 2FI7A 3OAWA 2PM6A 2V5FA 2OVFA 2WB2A 2H6HA 3ZXPA 2VSYA 3Q78A 1BD8A 3EIJA 5DIZA 4PH4B 3MGBA 2PQNA 3Q4AB 4GB9A 4AM9A 4DLOA 2HYZA 3U3WA 2WXOA 4J0UA 2F0YA 2CHWA 5IY5E 1OCRE 3L6AA 4ILHB 3IKOB 3J5QB 2QC9A 3IV0A 2IFUA 3L17A 3RK6A 2IOLA 3I3NA 3TWUA 4Z68A 5J90A 2AXZA 2GRLA 2ZIRA 3SY2A 2YNQA 3UM3A 3JYSA 4ANWA 3Q7FA 2IJGX 3CVYA 3DPYA 4PS3A 3VLEA 4RSYA 4FC8A 5LP0A 3UXGA 4GMJA 4IRUA 4O1OA 4AVXA 3EUVA 3CVVA 4GTMA 3VLFA 3GYZA 3CHRA 3SHFA 2ETCA 2WQ7A 1TNUA 4F7AA 5CERB 1UJJA 1TJCA 3LJNA 3FTZA 1TJFA 3AJIA 4U95D 4DI4A 2FO1E 4KZ0A 2I6HA 1LTXA 1TN7A 3CHMA 3ASFA 3UM2A 1IKND 2H6IA 1DC2A 4K5AB 3UT7A 3FU0A 3FFLA 2VQ2A 1N0RA 1UN9A 1QBQA 3ONLA 2X6HA 4HB5A 3ZPJA 3RRUA 3ZXSA 5BT1A 2P58C 3FUKA 1E8WA
chains in the Genus database with same CATH topology
4MLPA 5CMYA 3PUJA 2AXUA 4G26A 4NRHB 4KVOA 2LSUA 5T3RA 1HG5A 3QOUA 1HF8A 3AU4A 3HIZA 4I43A 4I2WA 3BG0B 3T5XA 3FTSA 2AXVA 5EKQD 2BTDA 3ENEA 2J4BA 1OUVA 2AW6A 4MKTA 4CT4A 4B89A 3P1UA 1B89A 1E96B 2ZU6B 3R9AB 3TXMA 2UY1A 3MKQA 4AY5A 2VTBA 2WXGA 3PRZA 4A3VA 3U4TA 4GA0A 2OVBA 1XGWA 4PS8A 1EYHA 2HM8A 2WXMA 4JC8A 4BX9A 3PS6A 4AOFA 2XGSA 3B13A 2BF0X 2KZTA 3QK0A 4RVBA 1H6KA 2WVIA 2ILRA 3KS2A 4C0EA 1GW6A 2Q7FA 3FUJA 4JEHA 2J09A 2VYIA 3FH7A 3MA5A 3CKCA 4GZDA 5T8IA 2WXFA 3FU3A 3G2VA 3CV0A 4H7YA 4I6JA 4HORA 3N71A 3L16A 3S2AA 1IYGA 3MJWA 1HH8A 2KZTB 4A55A 2XGOA 4XX5A 3ZVVA 1MQSA 2X3MA 4FHJA 1QQEA 4RG6A 4APFA 4GMLA 1P5QA 2L6JA 4LRZA 2DIWA 1IQUA 3EDTB 3ASHA 3CHOA 4UI9J 4UQYA 1HFAA 2C0LA 1OWLA 1OWOA 4I2ZA 3CSTA 3RU0A 5CMWA 3HYMB 2PZIA 3UQ3A 2IONA 1QNFA 4W9RA 3TJPA 3DBSA 1INZA 2R5SA 4GZCA 3S7JA 3Q47B 3EHMA 5JJ7A 3O4ZA 3VTYA 3HDXA 3QJZA 3SD5A 1E8XA 4N5CA 2HR2A 4A1SA 4B8CB 4WWPA 1FVFA 3LKUA 4GYOA 3FUIA 4FADA 1JWFA 4HLEA 4M3OA 3PNLB 3ULQA 3SBTB 3ONKA 4GAAA 3PZDA 5G55A 2PM7A 3CK7A 1E7UA 4U07A 3UMVA 5KJMA 2FF4A 2WXLA 4FLHA 2MOWA 3VTXA 4N3CA 3CHQA 3MZLB 2LO6A 2Y3AA 1BPOA 3CR3A 2JLBA 4N2SA 3R7RA 3SGHA 3CIAA 4FA6A 4JHJA 5A23A 3RKVA 3U64A 3CQCB 2I2OA 3UT8A 4G1TA 3D9PA 2NC9A 2J4DA 1H19A 2WXKA 3FUMA 5FZSA 3PNTB 4KXKB 3I4GA 1WAO1 3FTVA 4JHKA 2NSZA 4UI9C 4XI9A 3D9IA 3APCA 1OWNA 5LFAA 4G23A 2XQ0A 5FQ4A 2V0PA 2YQ8A 1HO8A 3RJVA 4ME2A 3KEZA 4G25A 4EZJA 4WWOA 1JPLA 3FTXA 4J6IA 2FBNA 3LY9A 4L1BA 4GCNA 3OTNA 5KJKA 1HU3A 3PEVB 2KATA 2C0MA 3NQPA 4AJWA 4C9BB 5T4YA 5KJNA 1HG2A 3GZSA 3QNKA 2MRIA 5BPPA 2UWJG 5G04J 3CKBA 3ZYQA 4K0RA 3SI5A 1KT0A 3AS8A 4E85A 2CFUA 2X6JA 2XHEA 3FH5A 2M63A 1LF8A 4IULA 1VDYA 2YHCA 1HS6A 4UWGA 4EECA 3GW4A 3FULA 2XCCA 3B7UX 4ANUA 5FZQA 5J08A 3G2UA 4FHKA 3QAQA 4R7LA 4ACKA 3QC1A 2C2LA 3U66A 4JXTA 3QWPA 3IHYA 3URZA 4L7TA 3SZ7A 2IF4A 3TGOA 4UWKA 3ESKA 4I6GA 2E2EA 4B0ZA 4G24A 3ZHEB 3MV3B 4BX8A 4EZKA 4F3VA 1N52A 2RD0A 1EPUA 1H2VC 1PAQA 3FUFA 2PL2A 4GYWA 4XKCA 2DBAA 3RRMB 4CDMA 2FEZA 2IU1A 3FUHA 3LYAA 2R17C 1UN8A 4HXIA 5CHEE 3LS8A 5AENA 4FULA 4GPKA 4KMOA 3ZYMA 3PE3A 2XRZA 3ZYLA 2E0IA 1HXIA 3TXNA 2XRYA 4NURA 3AU5A 3CEQA 3S7FA 4Y6CA 4WNGA 5BV0A 5HQ8A 2Y4UA 3CQGB 5KJLA 5LOZA 5ANLA 3FEYA 4XI0A 4HOTA 3PH0C 4PDXA 2KC7A 4ABNA 4DI3A 3ML8A 4GYYA 5A7DB 4G2VA 3B7SA 4C0MA 4WUYA 4GA1A 5E75A 4H7XA 3KD7A 3QWVA 4HOUA 3WXXA 3CGHA 4AP2A 3CHSA 1KT1A 4IYPA 3HVEB 4TRQA 3SFZA 4DK5A 4FLBA 2HO1A 3UT4A 3B7TA 1S0PA 3MKRA 4KYOB 4ILGA 4RG9A 2VGXB 4U0SA 2VSXE 2WPVA 3FTUA 2J9QA 5AJLA 2J07A 4QFVA 1QZ2A 3D9MA 4ACLA 2A4ZA 2XGMA 3LCAA 3ZGQA 5BUZA 3AS4A 3CVQA 2A5UA 3CVLA 3CSFA 5ARFA 1UJKA 4GA2A 2KCLA 2QFCA 3G2WA 2VSNA 3PREA 4XZ4A 4AV7A 4A1GA 3S7BA 2WXIA 4CT0A 4MS6A 4HOQA 4OYSA 4DPRA 5ENNA 1E8ZA 3IBEA 1JUQA 3LY8A 4JEUA 4JZYA 3NF1A 2GW1A 5LCWJ 3CVNA 4WNEA 4CDRA 4GZ6A 1UG3A 3B7RL 3APDA 1SQMA 4U0ZA 5AYWD 3FH8A 2QY7A 2AVPA 3NZUA 4CCAA 2WXPA 3LEWA 3UUXA 4CDNA 4ILIA 2NXPA 4F1SA 4Y6WA 4WWNA 5E76A 2XEVA 2PQRA 4O6FA 4AEZC 4UQXA 4AIFA 4WAFA 4NQ0A 3LVRE 3C98A 3QDNA 5C2YA 3FY4A 4LERA 4CGVA 3G2SA 1A17A 4DLQA 4APOA 3EHNA 3FU5A 3FUNA 4K03A 3CLJA 3TG4A 1FCHA 4XE0A 1E8YA 4CEMA 5FWQA 4A3TA 5FTPA 3FDHA 4N3BA 5EX3A 5HI7A 3GZ2A 4DJAA 1W3BA 3D3MA 1Z6TA 2WXJA 2XCBA 3Q5MA 4FP7A 3ZN3A 4EQFA 3ASDA 2I1KA 4D10C 5LCWC 3ZFWA 4AXHA 3BEEA 2OV8A 2CHZA 2LNIA 3K9IA 5KCMA 3U9WA 3BG1B 4P29A 2CHXA 3CVUA 4UWHA 1Y8MA 1E90A 3EIQC 2WXRA 3Q49B 4UI9K 3ZHEA 5JHAA 2WMOA 1IQRA 1MHQA 3TAXA 4GZ5A 4Q94A 4B8AA 1U3DA 3MV2B 5JJTA 4I1MA 4N2QA 4MRUA 4BTBA 2GRMA 1IHGA 2WXQA 3FP3A 3R7QA 4U8HA 2CFZA 4HFGA 1Z3XA 2JEKA 4B94A 2L0TB 5FJYA 2RG8A 2KCVA 5A6CA 3I4RB 1TEZA 1ELWA 1H2TC 4TUUA 3S7DA 3ZIMA 5JJ6A 4U0UA 5EX0A 3FTWA 3APFA 5CCLA 3D9OA 5BV1A 3D9JA 4UWFA 4J8DA 4HVBA 2FO7A 4PS7A 4JW1A 2I9CA 4YNDA 3MX3A 1ZU2A 2R59A 3LVQE 3RO2A 3CVXA 2WMNA 5G05J 4KT6B 2WQHA 3QARA 3MEKA 3LDZA 4EZLA 4I9CA 5G04C 1OWPA 2I1JA 4LEUA 4URKA 5M72A 1DNPA 5CCMA 2FI7A 5DBKA 4BFRA 2AWIA 4BT9A 2DCPA 3OAWA 1EDUA 4OVUA 2PM6A 2WM9A 2V5FA 2OVFA 3FUEA 5BW8C 3HVEA 3UPVA 3LJ3A 3LPZA 3LXUX 4UWLA 2WB2A 2L9BA 2VSOE 4YVQC 1DVPA 4OVVA 3T5VA 3JUIA 3OXLA 2VSYA 2WXHA 4J8SA 2KM4A 3Q15A 4XKBA 3QB2A 5LX8A 2VGXA 4F53A 3D9LA 1XNFA 3EIJA 5DIZA 4JA7A 4FU3A 4PH4B 2Y4TA 3MGBA 2PQNA 3FU6A 3Q4AB 3MYVA 2VJ8A 4J8FA 4GB9A 4AM9A 4HS2A 4E6HA 4ATGA 4DLOA 2HYZA 3NZSA 4TV3A 3U3WA 3D9KA 2WXOA 1N54A 5EDSA 1UW4B 3RIBA 4FJZA 5JHBA 4J0UA 1NA0A 4NACA 2YHEA 2CHWA 5ARGA 2CG2A 5FQ7A 3FWVA 2V4LA 1YA0A 1HZ4A 1ELKA 2LAIA 3L6AA 4UQZA 1Y6IA 2J49A 5G05C 3VLDA 2UY1B 3MKQB 4ILHB 5C1DA 4CRWA 2WQ6A 2VTBB 3JQ0A 4KBQA 3IKOB 3PE4A 2X6KA 5FZRA 3CVWA 3DPDA 3ASGA 3PUKA 3IV0A 2IFUA 2XPZA 3FEXA 3L17A 2IOLA 3I3NA 3RK6A 3OXFA 1KLXA 2AXZA 3L13A 2GRLA 3E4BA 5J90A 3CK9A 3ZYKA 4BSXA 2YNQA 4V3IA 4JVSA 2V8SE 4G11A 4I6EA 4IN3B 2ONDA 3JYSA 3L22A 1NP7A 3L54A 5FQ6A 3QWWA 4YVOA 4ANWA 1PC2A 4I1OB 2KCKA 2IJGX 4KVMA 4ANXA 2XPYA 3I5PA 1Z3YA 3CVYA 4PS3A 1H2UA 2BUGA 3VLEA 4RSYA 3IEGA 5AIJA 3ZEFA 4FC8A 4J8EA 4EPZA 5LP0A 4GMJA 4JPSA 4IRUA 4L23A 1OWMA 4AVXA 3T8MA 4JL0A 4U04A 3MCXA 3ESLA 3QKYA 3L08A 4KZCA 3CVVA 3HHMA 4LCTA 4BY6A 4U63A 1SZ9A 1NZNA 3TL5A 3GZ1A 3VLFA 2MHKA 3GYZA 3JQ1A 1E7VA 3CHRA 4L2LA 3SHFA 2WQ7A 2LSVA 4L2YA 4BT8A 4F7AA 4JA9A 1UJJA 1TJCA 1H0AA 4Q69A 4EBAA 5AJDA 3FTZA 4FJYA 1TJFA 3RO3A 3O48A 4I1AA 3JCKC 1WY6A 2VGYA 5D0QD 4AY6A 5ANRA 2CG3A 3AS5A 3SBSA 2OOEA 2WXNA 4BWRA 2L0IA 2YINA 3FHEA 4WNDA 3RRNB 1HX8A 1L5JA 4I9EA 4EBAG 4GZ3A 5FT9A 1JWGA 3G2TA 4XIFA 5BNWA 4DI4A 4CGWA 4HOSA 2XPIA 3SNXA 3EJNA 4N3AA 3OXGA 3D9NA 3PVLA 1HE8A 1ZBPA 4KZ0A 5D0OD 2I6HA 3CHMA 3ASFA 3SF4A 3FUDA 3IHVA 1U3CA 4Q96A 4WNFA 1EF1C 4GCOA 4GU5A 1ELRA 2X6FA 3CHPA 3FU0A 3FFLA 2LAHA 2VQ2A 3UT7A 2GGFA 3CK8A 4ANVA 4JHRA 1FVHA 3ML9A 1UN9A 1PY1A 4N39A 2IQCA 3ONLA 2X6HA 3TG5A 1X5BA 2X38A 1SZAA 3P2BA 4PUCA 3PEUB 3PDNA 5FQ8A 3ZPJA 3RRUA 3ZW3A 3ZXSA 3ZRHA 5BT1A 3CVPA 3FTYA 2IOSA 4LUNU 2EQXA 2X6IA 2FULA 4BTAA 2P58C 2J08A 5G2NA 3KAEA 3FUKA 3UX4A 4I17A 1WM5A 1E8WA 3LY7A 1NA3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G26 A;  4NRH B;  2LSU A;  3QOU A;  4I2W A;  5EKQ D;  1OUV A;  1B89 A;  1E96 B;  3R9A B;  2UY1 A;  4AY5 A;  3U4T A;  4GA0 A;  2XGS A;  3KS2 A;  2Q7F A;  2VYI A;  3MA5 A;  3CKC A;  4H7Y A;  4HOR A;  3CV0 A;  3N71 A;  1IYG A;  1HH8 A;  2XGO A;  1QQE A;  4RG6 A;  1P5Q A;  2L6J A;  3EDT B;  3ASH A;  4UI9 J;  4UQY A;  2C0L A;  4I2Z A;  3RU0 A;  3HYM B;  2PZI A;  3UQ3 A;  4W9R A;  2R5S A;  3S7J A;  3Q47 B;  5JJ7 A;  3VTY A;  4N5C A;  2HR2 A;  4A1S A;  3LKU A;  4GYO A;  3ULQ A;  3CK7 A;  4U07 A;  5KJM A;  2FF4 A;  3VTX A;  4N3C A;  2JLB A;  4N2S A;  3RKV A;  4G1T A;  2NC9 A;  5FZS A;  4KXK B;  1WAO 1;  4UI9 C;  4XI9 A;  4G23 A;  2YQ8 A;  3RJV A;  4ME2 A;  4G25 A;  2FBN A;  3LY9 A;  5KJK A;  4GCN A;  2KAT A;  2C0M A;  5KJN A;  2UWJ G;  5G04 J;  3CKB A;  1KT0 A;  3AS8 A;  2YHC A;  3GW4 A;  2XCC A;  5FZQ A;  2C2L A;  3QWP A;  3URZ A;  3SZ7 A;  3TGO A;  2IF4 A;  3ESK A;  2E2E A;  4G24 A;  3ZHE B;  3MV3 B;  4F3V A;  2PL2 A;  4GYW A;  2DBA A;  2FEZ A;  3LYA A;  5CHE E;  4GPK A;  3PE3 A;  1HXI A;  3CEQ A;  3S7F A;  4Y6C A;  4WNG A;  5HQ8 A;  2Y4U A;  5KJL A;  4XI0 A;  4HOT A;  2KC7 A;  4ABN A;  4GYY A;  5A7D B;  4G2V A;  4WUY A;  4GA1 A;  4H7X A;  3KD7 A;  3QWV A;  4HOU A;  3WXX A;  1KT1 A;  2HO1 A;  3MKR A;  4KYO B;  4RG9 A;  2VGX B;  4U0S A;  2WPV A;  2J9Q A;  1QZ2 A;  2XGM A;  3LCA A;  3ZGQ A;  3AS4 A;  3CVQ A;  3CVL A;  5ARF A;  4GA2 A;  2KCL A;  2QFC A;  2VSN A;  3S7B A;  4HOQ A;  3LY8 A;  3NF1 A;  2GW1 A;  5LCW J;  3CVN A;  4WNE A;  4CDR A;  4GZ6 A;  4U0Z A;  5AYW D;  2AVP A;  3UUX A;  4Y6W A;  2XEV A;  2PQR A;  4O6F A;  4UQX A;  4AIF A;  4NQ0 A;  3QDN A;  4CGV A;  1A17 A;  4APO A;  3TG4 A;  1FCH A;  5FTP A;  4N3B A;  5EX3 A;  5HI7 A;  3GZ2 A;  1W3B A;  3Q5M A;  2XCB A;  3ZN3 A;  4EQF A;  3ASD A;  5LCW C;  3ZFW A;  3BEE A;  2LNI A;  3K9I A;  1Y8M A;  4UI9 K;  3Q49 B;  3ZHE A;  3TAX A;  4GZ5 A;  3MV2 B;  5JJT A;  4N2Q A;  4BTB A;  1IHG A;  3FP3 A;  4B94 A;  5FJY A;  2KCV A;  5A6C A;  1ELW A;  3S7D A;  5JJ6 A;  4U0U A;  5EX0 A;  5CCL A;  4J8D A;  2FO7 A;  4YND A;  1ZU2 A;  3RO2 A;  5G05 J;  2WQH A;  3MEK A;  4I9C A;  5G04 C;  4LEU A;  5M72 A;  5CCM A;  2FI7 A;  5DBK A;  4BT9 A;  2V5F A;  5BW8 C;  3UPV A;  3LPZ A;  4YVQ C;  3OXL A;  2VSY A;  3Q15 A;  2VGX A;  5DIZ A;  1XNF A;  4JA7 A;  2Y4T A;  2PQN A;  3Q4A B;  4J8F A;  4AM9 A;  2HYZ A;  3U3W A;  3RIB A;  4J0U A;  1NA0 A;  5ARG A;  3FWV A;  1YA0 A;  1HZ4 A;  4UQZ A;  5G05 C;  5C1D A;  2UY1 B;  4KBQ A;  3PE4 A;  5FZR A;  3ASG A;  2IFU A;  3OXF A;  1KLX A;  3E4B A;  3CK9 A;  4IN3 B;  2OND A;  3JYS A;  3QWW A;  4YVO A;  1PC2 A;  2KCK A;  2BUG A;  3IEG A;  4J8E A;  4JL0 A;  4U04 A;  3QKY A;  1NZN A;  3GZ1 A;  2MHK A;  3GYZ A;  2LSV A;  4BT8 A;  4JA9 A;  1TJC A;  3RO3 A;  3O48 A;  4I1A A;  5D0Q D;  2VGY A;  4AY6 A;  3AS5 A;  2OOE A;  4BWR A;  4WND A;  4I9E A;  4GZ3 A;  5FT9 A;  4XIF A;  5BNW A;  4CGW A;  4HOS A;  2XPI A;  4N3A A;  3OXG A;  1ZBP A;  5D0O D;  2I6H A;  3ASF A;  3SF4 A;  4WNF A;  4GCO A;  1ELR A;  3FFL A;  2VQ2 A;  3CK8 A;  4JHR A;  4N39 A;  3TG5 A;  3PDN A;  3ZPJ A;  5BT1 A;  3CVP A;  4BTA A;  2P58 C;  3KAE A;  4I17 A;  1WM5 A;  3LY7 A;  1NA3 A; 
#chains in the Genus database with same CATH topology
 4MLP A;  5CMY A;  2BKG A;  5HRY A;  1HF8 A;  3AU4 A;  3BG0 B;  1V54 E;  1TN6 A;  3KSQ A;  4MKT A;  4B89 A;  1B89 A;  3SFY A;  3TXM A;  4DX5 D;  2VTB A;  2WXG A;  3PRZ A;  1XGW A;  1EYH A;  2WXM A;  2XGS A;  2EIL E;  4JEH A;  2VYI A;  5T8I A;  3CKC A;  3CV0 A;  5EN5 D;  2XS8 A;  2X3M A;  4MBG A;  4APF A;  1P5Q A;  2DIW A;  3CHO A;  4UI9 J;  2F8Y A;  1OWO A;  1D9S A;  5CMW A;  2PZI A;  3UQ3 A;  2H6G A;  3DEO A;  3VTY A;  3HDX A;  1E8X A;  1Z5S C;  4ZHB A;  1FVF A;  1MJ0 A;  3V2O A;  3ULQ A;  3SBT B;  3ONK A;  2IY0 C;  4U07 A;  1V55 E;  3NOC D;  2MOW A;  5A23 A;  3RKV A;  1WG0 A;  4G1T A;  2WXK A;  4GTS A;  3I4G A;  3FTV A;  1OWN A;  2YQ8 A;  4G8L A;  4JB8 P;  1SW6 A;  2BED A;  4C9B B;  5T4Y A;  3V30 A;  5CED B;  4K0R A;  3SI5 A;  1KT0 A;  3AS8 A;  4E85 A;  2CFU A;  3FH5 A;  2VGE A;  1HS6 A;  1Q2Z A;  4HRM B;  1MX6 A;  3GW4 A;  3FUL A;  3TWT A;  1JCS A;  5J08 A;  3G2U A;  4FHK A;  4ACK A;  4N5Q A;  4JXT A;  3URZ A;  3ESK A;  3EU5 A;  1WDY A;  4I6G A;  2E2E A;  4B0Z A;  3Q75 A;  3MV3 B;  1TN8 A;  1EPU A;  1PAQ A;  2DBA A;  4CDM A;  2B0O E;  4GTO A;  3FUH A;  5CRV A;  5ITZ F;  3NAW A;  4GTP A;  3ZYM A;  3ZYL A;  3TXN A;  3CEQ A;  3CQG B;  5KJL A;  2EIM E;  2R05 A;  5LOZ A;  1N0Q A;  4ABN A;  3JXI A;  4H7X A;  4HOU A;  3C3O A;  3L9T A;  3Q9U C;  2OEW A;  4AP2 A;  4IYP A;  3UT4 A;  3MKR A;  5EID A;  4U0S A;  4YDO A;  5AJL A;  2P9P G;  4O1P A;  5KBA A;  2XGM A;  3LCA A;  3AS4 A;  3CVQ A;  3CSF A;  5ARF A;  3G2W A;  2VSN A;  4A63 B;  3E37 A;  4AV7 A;  4CT0 A;  4DPR A;  2MYO A;  4JZY A;  4WNE A;  4CDR A;  3NB2 A;  5CEA A;  4U0Z A;  3FH8 A;  2WXP A;  4ILI A;  4Y6W A;  5E76 A;  2DVW A;  4O6F A;  3QDN A;  1A17 A;  3EHN A;  4M7C A;  3FUN A;  3CLJ A;  1E8Y A;  5FWQ A;  5FTP A;  1ZB1 A;  5EX3 A;  3GZ2 A;  3D3M A;  3Q5M A;  2WXJ A;  4FP7 A;  3ZN3 A;  3ASD A;  3DSV A;  2I1K A;  2PNN A;  3U9W A;  3BG1 B;  5KWD A;  3E32 A;  2WMO A;  1IQR A;  2DZN A;  5B1B E;  4B8A A;  2XEH A;  5JJT A;  2DZO A;  2L0T B;  5FJY A;  1N9A A;  2KCV A;  1OY3 D;  3FTW A;  5CCL A;  5BV1 A;  2FO7 A;  3MX3 A;  2R59 A;  5G05 J;  3HXE A;  4KT6 B;  4TUM A;  2HE0 A;  1UOH A;  4URK A;  5M72 A;  3HXC A;  4J7W A;  5CCM A;  5DBK A;  4BFR A;  2DCP A;  3TWX A;  3UM0 A;  3UPV A;  3LJ3 A;  3LPZ A;  2VSO E;  1DVP A;  4OVV A;  3JUI A;  3OXL A;  4J8S A;  1MX4 A;  2ZXW E;  1LD7 A;  1YYH A;  1FT1 A;  4GTQ A;  2Y4T A;  4J8F A;  3MYV A;  4ATG A;  3D9K A;  3V79 K;  1UW4 B;  3RIB A;  4FJZ A;  1NA0 A;  1RZ4 A;  4O60 A;  1HZ4 A;  2LAI A;  2J49 A;  2EIN E;  3VLD A;  2WQ6 A;  2VTB B;  3JQ0 A;  3PE4 A;  3CVW A;  5D2M C;  2XPZ A;  3OXF A;  2JAB A;  1KZP A;  4JVS A;  3DSU A;  2QYU A;  4IN3 B;  4I1O B;  2KCK A;  4ANX A;  3I5P A;  1A5E A;  1H2U A;  5CRU A;  5AIJ A;  4CZ2 D;  4JPS A;  3T8M A;  4JL0 A;  2OEV A;  4U04 A;  5ENO D;  3ESL A;  3L08 A;  4KZC A;  4U8Y D;  4BY6 A;  4U63 A;  1SZ9 A;  1NZN A;  3TL5 A;  3GZ1 A;  4ATZ D;  2RKK A;  2LSV A;  5FIN A;  4JA9 A;  4Q69 A;  3SFX A;  3JCK C;  2VGY A;  4AY6 A;  2GRN B;  4BWR A;  2L0I A;  2YIN A;  4GZ3 A;  1JWG A;  2GRR B;  4CGW A;  2XPI A;  3EJN A;  3D9N A;  1ZBP A;  5D0O D;  3IHV A;  4WNF A;  1EF1 C;  4GCO A;  3CHP A;  3CK8 A;  1FVH A;  4N39 A;  1FPP A;  4YDW A;  2X38 A;  1SZA A;  3PEU B;  3ZRH A;  4U8V D;  2J08 A;  5G2N A;  3UX4 A;  3F6Q A;  1WM5 A;  3LY7 A;  2AXU A;  2LSU A;  1HG5 A;  3QOU A;  4HI8 A;  1N11 A;  5HS0 A;  4HLL A;  3FTS A;  3ENE A;  2UY1 A;  3MKQ A;  4AY5 A;  4GA0 A;  5CBO A;  2HM8 A;  3DXM G;  3BUA A;  1O1S A;  3B13 A;  3QK0 A;  4RVB A;  4GTT A;  2IEJ A;  2B6C A;  1K1B A;  4ZFH A;  2J09 A;  3FH7 A;  4GZD A;  2WXF A;  3FU3 A;  1QYM A;  3EU9 A;  1IYG A;  3MJW A;  1HH8 A;  2KZT B;  3SQV A;  3ZVV A;  1MQS A;  4LRZ A;  2C0L A;  3RU0 A;  2ION A;  1INZ A;  3Q47 B;  4N5C A;  4A1S A;  4B8C B;  3LKU A;  1JWF A;  3UM1 A;  3DSS A;  2PM7 A;  3UMV A;  5KJM A;  2WXL A;  3AG4 E;  4N3C A;  3MZL B;  2EIJ E;  2JLB A;  3JXJ A;  3R7R A;  3U64 A;  3AAA C;  2I2O A;  3V31 A;  3RAU A;  3PNT B;  1YMP A;  3B95 A;  2P9U G;  4JHK A;  4UI9 C;  2EIK E;  3APC A;  2GRP B;  4G23 A;  2XQ0 A;  5FQ4 A;  1BI8 B;  1HO8 A;  3RJV A;  1JPL A;  4J6I A;  2LUH A;  4L1B A;  4GCN A;  3OTN A;  5KJK A;  3NQP A;  4AJW A;  3GZS A;  2P9K G;  5G04 J;  3ZYQ A;  2DYR E;  5D66 A;  2YHC A;  1TNB A;  5FZQ A;  4HI9 A;  3Q7A A;  3QAQ A;  4R7L A;  3QC1 A;  5ENR D;  3DRA A;  3SZ7 A;  3TGO A;  4UWK A;  4CYM D;  4BET A;  4G24 A;  1BI7 B;  2R02 A;  3FUF A;  4GYW A;  4XKC A;  3RSE G;  2R17 C;  3DSW A;  4OAU C;  3LS8 A;  4FUL A;  4KMO A;  3UKR G;  2E0I A;  1OT8 A;  3AU5 A;  3S7F A;  5HQ8 A;  1SA4 A;  4HOT A;  4PDX A;  3R9M A;  3ML8 A;  4GYY A;  3PZ2 A;  1NL4 A;  5E75 A;  2QYJ A;  2GRQ B;  3WXX A;  3SFZ A;  4FLB A;  3PZ3 A;  4LG6 A;  3Q79 A;  2VSX E;  2J07 A;  4GTV A;  5B1A E;  2P9N G;  3D9M A;  2A4Z A;  5BUZ A;  5AN8 A;  1UJK A;  2KCL A;  3PRE A;  4A1G A;  2WXI A;  2Y0B G;  4LSZ E;  4NIK A;  1E8Z A;  4JEU A;  3NF1 A;  5LCW J;  3ISM C;  4RQI A;  4GZ6 A;  1UG3 A;  3B7R L;  1RW2 A;  1SQM A;  5AYW D;  1G3N B;  3KSL A;  2QY7 A;  3NZU A;  3UUX A;  2ZIS A;  2ETB A;  4WAF A;  4NQ0 A;  4AIF A;  3C98 A;  5ENT D;  5C2Y A;  3BU8 A;  2P9I G;  4K03 A;  1FCH A;  3FDH A;  2XCB A;  1N4R A;  4D10 C;  4AXH A;  2LNI A;  5FIO A;  2CHX A;  1Y8M A;  1E90 A;  3EIQ C;  5JHA A;  4QQI A;  1U3D A;  4N2Q A;  2GRM A;  2WXQ A;  1TNY A;  4HFG A;  1Z3X A;  3I4R B;  1ELW A;  2R2L A;  4BER A;  4UWF A;  4PS7 A;  3LVQ E;  4EZL A;  1OWP A;  2KXP C;  3ZKJ A;  4DUI A;  2WM9 A;  4C48 B;  3FUE A;  5BW8 C;  3HVE A;  4UWL A;  2L9B A;  2KBX A;  3T5V A;  4XKB A;  2V5Q C;  3QB2 A;  5LX8 A;  2VGX A;  3D9L A;  4JA7 A;  4FU3 A;  4L9P A;  4XEI G;  2VJ8 A;  3UI2 A;  4HS2 A;  4U96 D;  3NZS A;  3T8K A;  2LXL A;  5EDS A;  1N54 A;  4NAC A;  2YHE A;  1YA0 A;  1ELK A;  4X8Q A;  4UQZ A;  3C3R A;  5G05 C;  5C1D A;  2UY1 B;  3MKQ B;  4CRW A;  2F37 A;  2H6F A;  5FZR A;  1KLX A;  3CK9 A;  3ASN E;  4V3I A;  2V8S E;  1NP7 A;  3ABK E;  3L54 A;  3E30 A;  4YVO A;  1PC2 A;  3E33 A;  4KVM A;  2XPY A;  1Z3Y A;  2BUG A;  4EPZ A;  4L23 A;  5JA4 D;  1OWM A;  3C72 A;  1KZO A;  3MCX A;  1K1A A;  3HHM A;  4LCT A;  3NOG D;  5AQA A;  4L2Y A;  2IO2 C;  1H0A A;  5KNG A;  4EBA A;  5AJD A;  4FJY A;  3NBN B;  5ANR A;  3SBS A;  2WXN A;  4WND A;  3RRN B;  1HX8 A;  4XIF A;  3SNX A;  4N3A A;  4JD2 G;  3OXG A;  3ZNG A;  3PVL A;  1HE8 A;  5HKP A;  2L6B A;  1X81 A;  1U3C A;  1ELR A;  4ANV A;  2LAH A;  2GGF A;  4JHR A;  3EHQ A;  3ML9 A;  1PY1 A;  1TYQ G;  2R03 A;  1MX2 A;  4F1P A;  3ZW3 A;  5FQ8 A;  2V4H C;  3CVP A;  2IOS A;  4LUN U;  4OAV B;  2X6I A;  4BTA A;  2J8S D;  3KAE A;  3W9G A;  1N95 A;  3PUJ A;  5JMN D;  1DCQ A;  4KVO A;  5T3R A;  3HIZ A;  2BTD A;  2AW6 A;  4HQD A;  4YDY A;  3P1U A;  1H6O A;  1E96 B;  2ZU6 B;  3U4T A;  3HRA A;  2OVB A;  4PS8 A;  4JC8 A;  4AOF A;  2BF0 X;  2ILR A;  2Q7F A;  4HOR A;  3S2A A;  2F8X K;  1O1T A;  4FHJ A;  1QQE A;  4RG6 A;  2L6J A;  3EDT B;  3ASH A;  3ZUV B;  1HFA A;  4I2Z A;  4LNU D;  1K8K G;  1QNF A;  4W9R A;  3DBS A;  4GZC A;  3S7J A;  5JJ7 A;  3O4Z A;  3QJZ A;  3HXB A;  4WWP A;  4FAD A;  3FUI A;  4M3O A;  3CK7 A;  2FF4 A;  3VTX A;  2LO6 A;  3HG0 D;  4N2S A;  3SGH A;  4FA6 A;  4JHJ A;  4HRN A;  5BXO A;  3UT8 A;  3D9P A;  2NC9 A;  3PZ1 A;  3FUM A;  3TWW A;  3TWV A;  1WAO 1;  3C5R A;  3D9I A;  5LFA A;  5ENP D;  3TWS A;  4WWO A;  3FTX A;  2FBN A;  2A5E A;  3LY9 A;  1HU3 A;  2KAT A;  2XS1 A;  1JCR A;  4BSZ B;  2DWZ A;  3HXF A;  4UWG A;  2C2L A;  3IHY A;  4BX8 A;  4EZK A;  4F3V A;  1N52 A;  2RD0 A;  1SA5 A;  3ABM E;  1H2V C;  3LYA A;  4HXI A;  3UIN C;  5CHE E;  4HRL A;  1D8E A;  1H6P A;  2XRZ A;  1HXI A;  1S63 A;  2XRY A;  4NUR A;  4Y6C A;  5BV0 A;  5ANL A;  3FEY A;  4XI0 A;  3X2Q E;  3PH0 C;  2QZA A;  2KC7 A;  4G2V A;  4WUY A;  4GA1 A;  3KD7 A;  3CGH A;  3CHS A;  1KT1 A;  3HVE B;  2Y1L E;  3W9F A;  4BEP A;  2VGX B;  2GRO B;  3FTU A;  2J9Q A;  1AWC B;  4QFV A;  1QZ2 A;  3EHR A;  4U7E B;  4TXR A;  3ZGQ A;  5ENS D;  3CVL A;  2A5U A;  3J5P A;  4GA2 A;  2IO3 C;  4XZ4 A;  3TWR A;  3UTM A;  4HOQ A;  1FT2 A;  3IBE A;  3CVN A;  1K3Z D;  1MZC A;  3APD A;  3B7B A;  4RLY A;  2AVP A;  4CCA A;  4F1S A;  2NXP A;  4WWN A;  2ZGG A;  4LER A;  4G8K A;  4DLQ A;  4APO A;  5B3S E;  4XE0 A;  4CEM A;  5BXU A;  1MYO A;  4DJA A;  3KEA A;  4EQF A;  1OCC E;  5LCW C;  4GPM A;  3ZFW A;  2CHZ A;  3K9I A;  5KCM A;  2XZT G;  4P29 A;  3D9H A;  4UI9 K;  2WXR A;  5EYP F;  3ZHE A;  3HXD A;  1MHQ A;  3TAX A;  3MV2 B;  4I1M A;  4HBD A;  3R7Q A;  5EYL A;  3ULY A;  2JEK A;  1H2T C;  2P2C P;  4U0U A;  3T9K A;  3APF A;  3D9O A;  4DX1 A;  3D9J A;  4J8D A;  2I9C A;  4YND A;  3CVX A;  3QAR A;  4TXP A;  5CBN A;  2I1J A;  1DNP A;  2AWI A;  4BT9 A;  1EDU A;  4OVU A;  4UUC A;  3LXU X;  1OCZ E;  4YVQ C;  2WXH A;  2KM4 A;  3Q15 A;  4F53 A;  1XNF A;  3FU6 A;  4J8Y A;  1LD8 A;  4E6H A;  4DX2 A;  4TV3 A;  5JHB A;  5ARG A;  2CG2 A;  5FQ7 A;  3FWV A;  2V4L A;  1Y6I A;  1BLX B;  4KBQ A;  2X6K A;  4TXQ A;  3DPD A;  3JUE A;  3ASG A;  3PUK A;  3FEX A;  3L13 A;  3E4B A;  3ZYK A;  4BSX A;  4G11 A;  4I6E A;  2OND A;  3L22 A;  5FQ6 A;  3QWW A;  5EIB E;  1O1R A;  1SVX A;  3IEG A;  3ZEF A;  4J8E A;  3DST A;  2NYJ A;  3QKY A;  3TWQ A;  1N4S A;  4DX6 D;  2MHK A;  3JQ1 A;  1E7V A;  4L2L A;  3AG1 E;  4BT8 A;  3RO3 A;  3AG3 E;  3O48 A;  4I1A A;  1WY6 A;  5D0Q D;  2CG3 A;  3AS5 A;  1N4Q A;  2OOE A;  1U2V G;  3FHE A;  4BES A;  1L5J A;  4I9E A;  4EBA G;  2LXM A;  5FT9 A;  3G2T A;  5AAR A;  5BNW A;  4HOS A;  2BKK B;  5H7P A;  2ZGD A;  3SF4 A;  2XEN A;  3FUD A;  4Q96 A;  4LNB A;  4GU5 A;  2X6F A;  1NI1 A;  1O5M A;  2XZD G;  1NFI E;  2IQC A;  1TNZ A;  3TG5 A;  1X5B A;  3P2B A;  4PUC A;  3PDN A;  2RFA A;  3FTY A;  2EQX A;  5ENQ D;  1OCO E;  2FUL A;  4I17 A;  1NA3 A;  3PZ4 A;  4G26 A;  4NRH B;  4I43 A;  4I2W A;  3T5X A;  2AXV A;  5EKQ D;  2J4B A;  1OUV A;  4CT4 A;  5CEC B;  3R9A B;  1TNO A;  3C3Q A;  4A3V A;  4BX9 A;  3PS6 A;  1TR4 A;  2KZT A;  5AQ7 A;  1H6K A;  2WVI A;  3KS2 A;  4C0E A;  1GW6 A;  2AJA A;  3FUJ A;  3UIO C;  2XEE A;  3MA5 A;  4H7Y A;  4I6J A;  3G2V A;  4GTR A;  3N71 A;  3L16 A;  4A55 A;  2XGO A;  4XX5 A;  3BQO A;  1OXJ A;  4GML A;  5AQB A;  1IQU A;  4UQY A;  1OWL A;  3CST A;  3HYM B;  5KNH D;  3TJP A;  2R5S A;  3EHM A;  1DCE A;  3IXE A;  3SD5 A;  2HR2 A;  4K5C A;  4GYO A;  4HLE A;  3PNL B;  4GAA A;  3PZD A;  5G55 A;  2P9L G;  1E7U A;  3ZU7 B;  4FLH A;  3CHQ A;  2Y3A A;  1BPO A;  3CR3 A;  3CIA A;  3CQC B;  2J4D A;  1H19 A;  5FZS A;  3E34 A;  2Y69 E;  4KXK B;  2NSZ A;  4XI9 A;  4DRX E;  2V0P A;  4ME2 A;  3KEZ A;  4G25 A;  4EZJ A;  3DSX A;  1KPS B;  3PEV B;  2C0M A;  5KJN A;  1HG2 A;  3QNK A;  2MRI A;  5BPP A;  2UWJ G;  3CKB A;  2X6J A;  2XHE A;  2M63 A;  3DEP A;  1LF8 A;  4IUL A;  1VDY A;  3ASO E;  4EEC A;  3DXK G;  4ANU A;  2XCC A;  3B7U X;  4HNA D;  3U66 A;  3QWP A;  4L7T A;  2IF4 A;  4GMR A;  3ZHE B;  3Q73 A;  2PL2 A;  3RRM B;  3UIP C;  2P9S G;  2FEZ A;  2IU1 A;  1UN8 A;  2OCC E;  5AEN A;  4GPK A;  3DWL G;  1JCQ A;  3PE3 A;  3UKU G;  4WNG A;  2Y4U A;  3V2X A;  2ETA A;  4K5B A;  4DI3 A;  5A7D B;  4C0M A;  3B7S A;  3QWV A;  4TRQ A;  1AP7 A;  4DK5 A;  3ABL E;  2HO1 A;  2DYS E;  4YDE A;  3B7T A;  1S0P A;  3AG2 E;  3Q9N C;  4KYO B;  2RFM A;  4ILG A;  4RG9 A;  2WPV A;  4ACL A;  4B93 B;  2QFC A;  3S7B A;  3SO8 A;  4MS6 A;  4OYS A;  5ENN A;  3LY8 A;  1JUQ A;  2GW1 A;  1D8D A;  5AQ9 A;  1S70 B;  3WG7 E;  3LEW A;  5AAO A;  4CDN A;  1YCS B;  2XEV A;  2PQR A;  4F6R D;  4AEZ C;  4UQX A;  4DX7 D;  3LVR E;  3FY4 A;  4CGV A;  3G2S A;  3L82 A;  3FU5 A;  5EIL A;  3TG4 A;  1S64 A;  4A3T A;  4N3B A;  5HI7 A;  1W3B A;  1Z6T A;  1BU9 A;  4EHM A;  3BEE A;  2OV8 A;  3CVU A;  4UWH A;  3Q49 B;  4GZ5 A;  1IHB A;  4Q94 A;  1IXV A;  4MRU A;  4BTB A;  1IHG A;  3FP3 A;  4U8H A;  2CFZ A;  4B94 A;  2RG8 A;  5A6C A;  1TEZ A;  1N4P A;  4TUU A;  3S7D A;  3ZIM A;  5JJ6 A;  5EX0 A;  3ULE G;  4HVB A;  4JW1 A;  4LNG A;  1ZU2 A;  3RO2 A;  2WMN A;  2WQH A;  3MEK A;  3LDZ A;  4I9C A;  5G04 C;  1N94 A;  4LEU A;  2FI7 A;  3OAW A;  2PM6 A;  2V5F A;  2OVF A;  2WB2 A;  2H6H A;  3ZXP A;  2VSY A;  3Q78 A;  1BD8 A;  3EIJ A;  5DIZ A;  4PH4 B;  3MGB A;  2PQN A;  3Q4A B;  4GB9 A;  4AM9 A;  4DLO A;  2HYZ A;  3U3W A;  2WXO A;  4J0U A;  2F0Y A;  2CHW A;  5IY5 E;  1OCR E;  3L6A A;  4ILH B;  3IKO B;  3J5Q B;  2QC9 A;  3IV0 A;  2IFU A;  3L17 A;  3RK6 A;  2IOL A;  3I3N A;  3TWU A;  4Z68 A;  5J90 A;  2AXZ A;  2GRL A;  2ZIR A;  3SY2 A;  2YNQ A;  3UM3 A;  3JYS A;  4ANW A;  3Q7F A;  2IJG X;  3CVY A;  3DPY A;  4PS3 A;  3VLE A;  4RSY A;  4FC8 A;  5LP0 A;  3UXG A;  4GMJ A;  4IRU A;  4O1O A;  4AVX A;  3EUV A;  3CVV A;  4GTM A;  3VLF A;  3GYZ A;  3CHR A;  3SHF A;  2ETC A;  2WQ7 A;  1TNU A;  4F7A A;  5CER B;  1UJJ A;  1TJC A;  3LJN A;  3FTZ A;  1TJF A;  3AJI A;  4U95 D;  4DI4 A;  2FO1 E;  4KZ0 A;  2I6H A;  1LTX A;  1TN7 A;  3CHM A;  3ASF A;  3UM2 A;  1IKN D;  2H6I A;  1DC2 A;  4K5A B;  3UT7 A;  3FU0 A;  3FFL A;  2VQ2 A;  1N0R A;  1UN9 A;  1QBQ A;  3ONL A;  2X6H A;  4HB5 A;  3ZPJ A;  3RRU A;  3ZXS A;  5BT1 A;  2P58 C;  3FUK A;  1E8W A; 
#chains in the Genus database with same CATH homology
 4MLP A;  5CMY A;  3PUJ A;  2AXU A;  4G26 A;  4NRH B;  4KVO A;  2LSU A;  5T3R A;  1HG5 A;  3QOU A;  1HF8 A;  3AU4 A;  3HIZ A;  4I43 A;  4I2W A;  3BG0 B;  3T5X A;  3FTS A;  2AXV A;  5EKQ D;  2BTD A;  3ENE A;  2J4B A;  1OUV A;  2AW6 A;  4MKT A;  4CT4 A;  4B89 A;  3P1U A;  1B89 A;  1E96 B;  2ZU6 B;  3R9A B;  3TXM A;  2UY1 A;  3MKQ A;  4AY5 A;  2VTB A;  2WXG A;  3PRZ A;  4A3V A;  3U4T A;  4GA0 A;  2OVB A;  1XGW A;  4PS8 A;  1EYH A;  2HM8 A;  2WXM A;  4JC8 A;  4BX9 A;  3PS6 A;  4AOF A;  2XGS A;  3B13 A;  2BF0 X;  2KZT A;  3QK0 A;  4RVB A;  1H6K A;  2WVI A;  2ILR A;  3KS2 A;  4C0E A;  1GW6 A;  2Q7F A;  3FUJ A;  4JEH A;  2J09 A;  2VYI A;  3FH7 A;  3MA5 A;  3CKC A;  4GZD A;  5T8I A;  2WXF A;  3FU3 A;  3G2V A;  3CV0 A;  4H7Y A;  4I6J A;  4HOR A;  3N71 A;  3L16 A;  3S2A A;  1IYG A;  3MJW A;  1HH8 A;  2KZT B;  4A55 A;  2XGO A;  4XX5 A;  3ZVV A;  1MQS A;  2X3M A;  4FHJ A;  1QQE A;  4RG6 A;  4APF A;  4GML A;  1P5Q A;  2L6J A;  4LRZ A;  2DIW A;  1IQU A;  3EDT B;  3ASH A;  3CHO A;  4UI9 J;  4UQY A;  1HFA A;  2C0L A;  1OWL A;  1OWO A;  4I2Z A;  3CST A;  3RU0 A;  5CMW A;  3HYM B;  2PZI A;  3UQ3 A;  2ION A;  1QNF A;  4W9R A;  3TJP A;  3DBS A;  1INZ A;  2R5S A;  4GZC A;  3S7J A;  3Q47 B;  3EHM A;  5JJ7 A;  3O4Z A;  3VTY A;  3HDX A;  3QJZ A;  3SD5 A;  1E8X A;  4N5C A;  2HR2 A;  4A1S A;  4B8C B;  4WWP A;  1FVF A;  3LKU A;  4GYO A;  3FUI A;  4FAD A;  1JWF A;  4HLE A;  4M3O A;  3PNL B;  3ULQ A;  3SBT B;  3ONK A;  4GAA A;  3PZD A;  5G55 A;  2PM7 A;  3CK7 A;  1E7U A;  4U07 A;  3UMV A;  5KJM A;  2FF4 A;  2WXL A;  4FLH A;  2MOW A;  3VTX A;  4N3C A;  3CHQ A;  3MZL B;  2LO6 A;  2Y3A A;  1BPO A;  3CR3 A;  2JLB A;  4N2S A;  3R7R A;  3SGH A;  3CIA A;  4FA6 A;  4JHJ A;  5A23 A;  3RKV A;  3U64 A;  3CQC B;  2I2O A;  3UT8 A;  4G1T A;  3D9P A;  2NC9 A;  2J4D A;  1H19 A;  2WXK A;  3FUM A;  5FZS A;  3PNT B;  4KXK B;  3I4G A;  1WAO 1;  3FTV A;  4JHK A;  2NSZ A;  4UI9 C;  4XI9 A;  3D9I A;  3APC A;  1OWN A;  5LFA A;  4G23 A;  2XQ0 A;  5FQ4 A;  2V0P A;  2YQ8 A;  1HO8 A;  3RJV A;  4ME2 A;  3KEZ A;  4G25 A;  4EZJ A;  4WWO A;  1JPL A;  3FTX A;  4J6I A;  2FBN A;  3LY9 A;  4L1B A;  4GCN A;  3OTN A;  5KJK A;  1HU3 A;  3PEV B;  2KAT A;  2C0M A;  3NQP A;  4AJW A;  4C9B B;  5T4Y A;  5KJN A;  1HG2 A;  3GZS A;  3QNK A;  2MRI A;  5BPP A;  2UWJ G;  5G04 J;  3CKB A;  3ZYQ A;  4K0R A;  3SI5 A;  1KT0 A;  3AS8 A;  4E85 A;  2CFU A;  2X6J A;  2XHE A;  3FH5 A;  2M63 A;  1LF8 A;  4IUL A;  1VDY A;  2YHC A;  1HS6 A;  4UWG A;  4EEC A;  3GW4 A;  3FUL A;  2XCC A;  3B7U X;  4ANU A;  5FZQ A;  5J08 A;  3G2U A;  4FHK A;  3QAQ A;  4R7L A;  4ACK A;  3QC1 A;  2C2L A;  3U66 A;  4JXT A;  3QWP A;  3IHY A;  3URZ A;  4L7T A;  3SZ7 A;  2IF4 A;  3TGO A;  4UWK A;  3ESK A;  4I6G A;  2E2E A;  4B0Z A;  4G24 A;  3ZHE B;  3MV3 B;  4BX8 A;  4EZK A;  4F3V A;  1N52 A;  2RD0 A;  1EPU A;  1H2V C;  1PAQ A;  3FUF A;  2PL2 A;  4GYW A;  4XKC A;  2DBA A;  3RRM B;  4CDM A;  2FEZ A;  2IU1 A;  3FUH A;  3LYA A;  2R17 C;  1UN8 A;  4HXI A;  5CHE E;  3LS8 A;  5AEN A;  4FUL A;  4GPK A;  4KMO A;  3ZYM A;  3PE3 A;  2XRZ A;  3ZYL A;  2E0I A;  1HXI A;  3TXN A;  2XRY A;  4NUR A;  3AU5 A;  3CEQ A;  3S7F A;  4Y6C A;  4WNG A;  5BV0 A;  5HQ8 A;  2Y4U A;  3CQG B;  5KJL A;  5LOZ A;  5ANL A;  3FEY A;  4XI0 A;  4HOT A;  3PH0 C;  4PDX A;  2KC7 A;  4ABN A;  4DI3 A;  3ML8 A;  4GYY A;  5A7D B;  4G2V A;  3B7S A;  4C0M A;  4WUY A;  4GA1 A;  5E75 A;  4H7X A;  3KD7 A;  3QWV A;  4HOU A;  3WXX A;  3CGH A;  4AP2 A;  3CHS A;  1KT1 A;  4IYP A;  3HVE B;  4TRQ A;  3SFZ A;  4DK5 A;  4FLB A;  2HO1 A;  3UT4 A;  3B7T A;  1S0P A;  3MKR A;  4KYO B;  4ILG A;  4RG9 A;  2VGX B;  4U0S A;  2VSX E;  2WPV A;  3FTU A;  2J9Q A;  5AJL A;  2J07 A;  4QFV A;  1QZ2 A;  3D9M A;  4ACL A;  2A4Z A;  2XGM A;  3LCA A;  3ZGQ A;  5BUZ A;  3AS4 A;  3CVQ A;  2A5U A;  3CVL A;  3CSF A;  5ARF A;  1UJK A;  4GA2 A;  2KCL A;  2QFC A;  3G2W A;  2VSN A;  3PRE A;  4XZ4 A;  4AV7 A;  4A1G A;  3S7B A;  2WXI A;  4CT0 A;  4MS6 A;  4HOQ A;  4OYS A;  4DPR A;  5ENN A;  1E8Z A;  3IBE A;  1JUQ A;  3LY8 A;  4JEU A;  4JZY A;  3NF1 A;  2GW1 A;  5LCW J;  3CVN A;  4WNE A;  4CDR A;  4GZ6 A;  1UG3 A;  3B7R L;  3APD A;  1SQM A;  4U0Z A;  5AYW D;  3FH8 A;  2QY7 A;  2AVP A;  3NZU A;  4CCA A;  2WXP A;  3LEW A;  3UUX A;  4CDN A;  4ILI A;  2NXP A;  4F1S A;  4Y6W A;  4WWN A;  5E76 A;  2XEV A;  2PQR A;  4O6F A;  4AEZ C;  4UQX A;  4AIF A;  4WAF A;  4NQ0 A;  3LVR E;  3C98 A;  3QDN A;  5C2Y A;  3FY4 A;  4LER A;  4CGV A;  3G2S A;  1A17 A;  4DLQ A;  4APO A;  3EHN A;  3FU5 A;  3FUN A;  4K03 A;  3CLJ A;  3TG4 A;  1FCH A;  4XE0 A;  1E8Y A;  4CEM A;  5FWQ A;  4A3T A;  5FTP A;  3FDH A;  4N3B A;  5EX3 A;  5HI7 A;  3GZ2 A;  4DJA A;  1W3B A;  3D3M A;  1Z6T A;  2WXJ A;  2XCB A;  3Q5M A;  4FP7 A;  3ZN3 A;  4EQF A;  3ASD A;  2I1K A;  4D10 C;  5LCW C;  3ZFW A;  4AXH A;  3BEE A;  2OV8 A;  2CHZ A;  2LNI A;  3K9I A;  5KCM A;  3U9W A;  3BG1 B;  4P29 A;  2CHX A;  3CVU A;  4UWH A;  1Y8M A;  1E90 A;  3EIQ C;  2WXR A;  3Q49 B;  4UI9 K;  3ZHE A;  5JHA A;  2WMO A;  1IQR A;  1MHQ A;  3TAX A;  4GZ5 A;  4Q94 A;  4B8A A;  1U3D A;  3MV2 B;  5JJT A;  4I1M A;  4N2Q A;  4MRU A;  4BTB A;  2GRM A;  1IHG A;  2WXQ A;  3FP3 A;  3R7Q A;  4U8H A;  2CFZ A;  4HFG A;  1Z3X A;  2JEK A;  4B94 A;  2L0T B;  5FJY A;  2RG8 A;  2KCV A;  5A6C A;  3I4R B;  1TEZ A;  1ELW A;  1H2T C;  4TUU A;  3S7D A;  3ZIM A;  5JJ6 A;  4U0U A;  5EX0 A;  3FTW A;  3APF A;  5CCL A;  3D9O A;  5BV1 A;  3D9J A;  4UWF A;  4J8D A;  4HVB A;  2FO7 A;  4PS7 A;  4JW1 A;  2I9C A;  4YND A;  3MX3 A;  1ZU2 A;  2R59 A;  3LVQ E;  3RO2 A;  3CVX A;  2WMN A;  5G05 J;  4KT6 B;  2WQH A;  3QAR A;  3MEK A;  3LDZ A;  4EZL A;  4I9C A;  5G04 C;  1OWP A;  2I1J A;  4LEU A;  4URK A;  5M72 A;  1DNP A;  5CCM A;  2FI7 A;  5DBK A;  4BFR A;  2AWI A;  4BT9 A;  2DCP A;  3OAW A;  1EDU A;  4OVU A;  2PM6 A;  2WM9 A;  2V5F A;  2OVF A;  3FUE A;  5BW8 C;  3HVE A;  3UPV A;  3LJ3 A;  3LPZ A;  3LXU X;  4UWL A;  2WB2 A;  2L9B A;  2VSO E;  4YVQ C;  1DVP A;  4OVV A;  3T5V A;  3JUI A;  3OXL A;  2VSY A;  2WXH A;  4J8S A;  2KM4 A;  3Q15 A;  4XKB A;  3QB2 A;  5LX8 A;  2VGX A;  4F53 A;  3D9L A;  1XNF A;  3EIJ A;  5DIZ A;  4JA7 A;  4FU3 A;  4PH4 B;  2Y4T A;  3MGB A;  2PQN A;  3FU6 A;  3Q4A B;  3MYV A;  2VJ8 A;  4J8F A;  4GB9 A;  4AM9 A;  4HS2 A;  4E6H A;  4ATG A;  4DLO A;  2HYZ A;  3NZS A;  4TV3 A;  3U3W A;  3D9K A;  2WXO A;  1N54 A;  5EDS A;  1UW4 B;  3RIB A;  4FJZ A;  5JHB A;  4J0U A;  1NA0 A;  4NAC A;  2YHE A;  2CHW A;  5ARG A;  2CG2 A;  5FQ7 A;  3FWV A;  2V4L A;  1YA0 A;  1HZ4 A;  1ELK A;  2LAI A;  3L6A A;  4UQZ A;  1Y6I A;  2J49 A;  5G05 C;  3VLD A;  2UY1 B;  3MKQ B;  4ILH B;  5C1D A;  4CRW A;  2WQ6 A;  2VTB B;  3JQ0 A;  4KBQ A;  3IKO B;  3PE4 A;  2X6K A;  5FZR A;  3CVW A;  3DPD A;  3ASG A;  3PUK A;  3IV0 A;  2IFU A;  2XPZ A;  3FEX A;  3L17 A;  2IOL A;  3I3N A;  3RK6 A;  3OXF A;  1KLX A;  2AXZ A;  3L13 A;  2GRL A;  3E4B A;  5J90 A;  3CK9 A;  3ZYK A;  4BSX A;  2YNQ A;  4V3I A;  4JVS A;  2V8S E;  4G11 A;  4I6E A;  4IN3 B;  2OND A;  3JYS A;  3L22 A;  1NP7 A;  3L54 A;  5FQ6 A;  3QWW A;  4YVO A;  4ANW A;  1PC2 A;  4I1O B;  2KCK A;  2IJG X;  4KVM A;  4ANX A;  2XPY A;  3I5P A;  1Z3Y A;  3CVY A;  4PS3 A;  1H2U A;  2BUG A;  3VLE A;  4RSY A;  3IEG A;  5AIJ A;  3ZEF A;  4FC8 A;  4J8E A;  4EPZ A;  5LP0 A;  4GMJ A;  4JPS A;  4IRU A;  4L23 A;  1OWM A;  4AVX A;  3T8M A;  4JL0 A;  4U04 A;  3MCX A;  3ESL A;  3QKY A;  3L08 A;  4KZC A;  3CVV A;  3HHM A;  4LCT A;  4BY6 A;  4U63 A;  1SZ9 A;  1NZN A;  3TL5 A;  3GZ1 A;  3VLF A;  2MHK A;  3GYZ A;  3JQ1 A;  1E7V A;  3CHR A;  4L2L A;  3SHF A;  2WQ7 A;  2LSV A;  4L2Y A;  4BT8 A;  4F7A A;  4JA9 A;  1UJJ A;  1TJC A;  1H0A A;  4Q69 A;  4EBA A;  5AJD A;  3FTZ A;  4FJY A;  1TJF A;  3RO3 A;  3O48 A;  4I1A A;  3JCK C;  1WY6 A;  2VGY A;  5D0Q D;  4AY6 A;  5ANR A;  2CG3 A;  3AS5 A;  3SBS A;  2OOE A;  2WXN A;  4BWR A;  2L0I A;  2YIN A;  3FHE A;  4WND A;  3RRN B;  1HX8 A;  1L5J A;  4I9E A;  4EBA G;  4GZ3 A;  5FT9 A;  1JWG A;  3G2T A;  4XIF A;  5BNW A;  4DI4 A;  4CGW A;  4HOS A;  2XPI A;  3SNX A;  3EJN A;  4N3A A;  3OXG A;  3D9N A;  3PVL A;  1HE8 A;  1ZBP A;  4KZ0 A;  5D0O D;  2I6H A;  3CHM A;  3ASF A;  3SF4 A;  3FUD A;  3IHV A;  1U3C A;  4Q96 A;  4WNF A;  1EF1 C;  4GCO A;  4GU5 A;  1ELR A;  2X6F A;  3CHP A;  3FU0 A;  3FFL A;  2LAH A;  2VQ2 A;  3UT7 A;  2GGF A;  3CK8 A;  4ANV A;  4JHR A;  1FVH A;  3ML9 A;  1UN9 A;  1PY1 A;  4N39 A;  2IQC A;  3ONL A;  2X6H A;  3TG5 A;  1X5B A;  2X38 A;  1SZA A;  3P2B A;  4PUC A;  3PEU B;  3PDN A;  5FQ8 A;  3ZPJ A;  3RRU A;  3ZW3 A;  3ZXS A;  3ZRH A;  5BT1 A;  3CVP A;  3FTY A;  2IOS A;  4LUN U;  2EQX A;  2X6I A;  2FUL A;  4BTA A;  2P58 C;  2J08 A;  5G2N A;  3KAE A;  3FUK A;  3UX4 A;  4I17 A;  1WM5 A;  1E8W A;  3LY7 A;  1NA3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...