3CVZA

Structural insights into the molecular organization of the s-layer from clostridium difficile
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
248
structure length
248
Chain Sequence
TTGTQGYTVVKNDWKKAVKQLQDGLKDNSIGKITVSFNDGVVGEVAPKSANKKADRDAAAEKLYNLVNTQLDKLGDGDYVDFSVDYNLENKIITNQADAEAIVTKLNSLNEKTLIDIATKDTFGMVSKTQDSEGKNVAATKALKVKDVATFGLKSGGSEDTGYVVEMKAGAVEDKYGKVGDSTAGIAINLPSTGLEYAGKGTTIDFNKTLKVDVTGGSTPSAVAVSGFVTKDDTDLAKSGTINVRVIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-layer protein
publication title Structural insights into the molecular organization of the S-layer from Clostridium difficile
pubmed doi rcsb
source organism Clostridium difficile
molecule tags Structural protein
total genus 61
structure length 248
sequence length 248
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-04-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.290 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3cvzA01
3CVZA
chains in the Genus database with same CATH superfamily
4YBZB 4UFZA 3SE7A 4YY3H 2YZGA 4IWYA 4ZOLF 2FB9A 2WB1A 5FPOA 1Y1VA 1JX4A 3T5JA 4O4HF 5D1OA 2ASJA 2WB1E 1HNXH 5KG4A 4ED3A 3RV4A 5C8YF 3TIGA 5FD6A 5L1IA 3GIIA 1V9PA 5JUMA 2C2RA 1KC7A 3OUUA 4J9RA 1TWFA 4EFBA 4A3BG 1VS0A 3E5NA 5CA0F 3H4BA 3LP8A 5IYCG 2ALZA 4A3FG 2YCHA 3HXLA 1IOVA 3KTMA 4BY1G 5JVDF 1V51A 3H20A 1XDNA 1UC8A 1T36A 3MWEA 2YYAA 4ECVA 3RAXA 4MTDA 2YL2A 1TWHA 4ZI7F 5L9XA 2JA6A 5LMUH 4DR6H 4QJFA 5KT5A 2PVPA 3BG5A 4MA5A 3RJ0A 1B6SA 4O4IF 1N34H 1WSCA 2YS6A 4ZHQF 4PWQA 2V4QA 2RF4A 3PO3G 3GIQA 2DZDA 3C0FB 4ECTA 1WR2A 4MAMA 2R92A 2E5LH 4JI8H 3I4MG 4MV6A 3RB3A 3N42B 4O3NA 5F9LA 4MV3A 4JI2H 2FPIB 3GTKA 3K5IA 5KG0A 2R8GA 1ZHSA 2ZDHA 3EPGA 4HYKA 1Y14B 3PW4A 1S0OA 5HBRB 2FK3A 2W9BA 4O4LF 3RTXA 4FBTA 1HR0H 5DLFA 3VPCA 2HGSA 3PO2G 1V4YA 1JKJB 4YR2A 1XNRH 3K3PA 4R7RA 3J7AK 2UXDH 2R93A 5DQHA 4FS2A 2UUBH 1OWTA 4CC6A 4RNOA 3GQCA 3R23A 3LMLA 5KG7A 4Q44A 4QWCA 3QZ7A 2XC9A 4YR3A 2W6OA 4DR3H 1BNCA 4YAKB 4TV8F 3TQTA 3CQZA 4JI7H 1FVIA 3GILA 2PN1A 4R8UA 4UCVA 2RDJA 4F4WA 3M4IA 4GLXA 4IZOA 1ZETA 4X64H 1RK5A 4Q45A 3KHRA 4BY7G 3RAQA 2W71A 4JV1A 2JA5A 4DR7H 2R8IA 1CS0A 1JXLA 4RB2C 3T1HH 1XMQH 2VUGA 3T1YH 4I7HA 2GLTA 4GC6A 5L1KA 4YAJB 4K0KH 2XD4A 4LMYA 5KFSA 4FU0A 1Z2PX 4A3EG 2BR0A 4QW9A 4EBDA 2V9WA 2ZJTA 3OHAA 1B6RA 1CE8A 3Q2OA 3HOVG 2VPQA 5BR8H 4NXNH 4LH7A 2XCAA 1J5EH 2R87A 1DV1A 5HV6A 2OH2A 1W96A 1KJJA 1VKZA 4LH6A 3JRXA 3G6XA 2WE6A 2W6ZA 1M6VA 1GSOA 3GIJA 3RV3A 4EYIB 2W6QA 3Q8QB 3MWDA 4RB3C 5C4XG 5KFKA 3HBLA 5KG2A 4DLKA 2OLSA 4JI1H 2R7MA 1W93A 3KAKA 4QWDA 2CW8A 3MR3A 5F9NA 3KHHA 4JI0H 5BPHA 2VR1A 2DWCA 2UXCH 3H4DA 5BPFA 2W7OA 1AUVA 3KHLA 3BJYA 1N48A 1HNZH 3HOZG 2GPSA 5KFZA 4AYBE 3RB4A 5C1PA 4ECQA 5KFVA 1JIHA 1X9NA 1TA8A 2W9CA 5EWGA 5DG7A 2RGVA 4UCSA 5BMVF 3T5KA 2C2DA 2BQUA 2RGRA 2JEIA 4QWBA 4FM9A 1KJ9A 2XGQA 1I3QA 4DV0H 4EG0A 4IRCA 5K2MA 5C5JA 5LL6b 3N43B 2NU8B 1N32H 4A93G 1E4GT 4LSXA 1RJPA 5KG6A 3JSLA 1SFOA 2UVVA 4YR0A 4I50F 2WDTA 4C5AA 4QW8A 3GIMA 2M05A 3RBEA 2UVWA 2YU9A 3N44B 2Q2UA 2P0AA 3PVXA 4O3OA 3RUPA 5KFNA 2J9GA 4DV1H 1ZQ7A 4YJ3F 5H80A 4GKJH 3F8NA 3CVZA 2J6UA 4B3RH 5KKNB 1FJGH 1T3NA 5KFIA 4J9PA 1JDEA 4J9SA 2E2HA 4O3SA 3HKZA 2VA3A 1S68A 2C22A 1PX2A 2FLLA 2IBKA 4O3RA 5D1OB 1S0MA 2RDIA 3G6VA 3HKZE 5KT2A 4EGJA 3AYHB 1I7LA 1GO3E 2VOBA 3GLKA 4IR1A 4XZ3B 1BJTA 4JI4H 4EEQA 4LSAA 4EBEA 1N33H 2I8CA 1K1SA 1S9FA 4UCRA 4J9NA 5IYZF 1BXRA 3OUZA 5KFUA 5A2QW 1AN7A 3GIDA 1RK6A 3GTOA 2KSWA 3TINA 4XYMB 5EZYF 2VA2A 4RU9A 4ED7A 1DV2A 1C3OA 1VAJA 3RF2A 3IG0A 4F50A 3KHGA 3TIIA 3Q8PB 3KALA 1JDBB 3JRWA 3JZIA 1N56A 4IR9A 2VUMG 2I80A 2C35B 4HQ6A 4DL7A 5EWEA 2FK2A 4J9OA 4RNNA 4UCTA 4IRKA 1S03G 2PMZA 5KG1A 5CB4F 1RYSA 1FKAH 3WO1A 2W9AA 3N8DA 5I47A 2PMZE 4HR7A 1I6UA 3Q8RB 2XCPA 2R6FA 4RNMA 3HOXG 1M0WA 4A3MG 2ATLA 4DR5H 2AQ4A 1KBLA 2JEFA 5KFMA 3I12A 4DL4A 3GTLA 4MV7A 5EOYA 3J80W 3K3VA 1KEEA 2UU9H 2J6SA 2W9BB 5KFQA 2VQFH 1GLVA 3BQ0A 1IOWA 1XMOH 2UUCH 4XX0B 2CZGA 4RB1A 4ECXA 5IWAH 3ETJA 5KT4A 4IAJA 3L4KA 2NVXA 2Y0SA 1I50A 3MJFA 4MV1A 4MTEA 3V6HA 2W6MA 3LWBA 5LXTF 2Y0SE 2NUAB 3U9SA 4TQSA 4LF4H 2ZDQA 3RFCA 4B3SH 1TAEA 3GIKA 5LOVF 4A3DG 2W7PA 3PZPA 4ECSA 3RB6A 4NXMH 4JI5H 3OSNA 3RIZA 3KXYT 2FP4B 2DIKA 1ULZA 5LP6F 3L2PA 1KJQA 1VBHA 2NU6B 4MV8A 3Q1KA 3FDSA 4IWXA 4R8UB 5IP7G 3GV8B 3ORQA 3L4JA 2W8KA 1IBMH 5KT3A 3R5XA 3QZ8A 2AGOA 2DPJA 2JEGA 2UUAH 3H3VH 4M9UA 4RZQA 3MFHA 2C00A 5KFHA 4J9LA 3RGZA 4Q8FA 2W6NA 1L2ZA 4O3PA 5DG9A 4U7CA 2O03A 3PN1A 4F4YA 4UCUA 4Q43A 4FBUA 4I4TF 5FPRA 2UXBH 4ECZA 2FKLA 2WTFA 3K5HA 4DL6A 2V59A 1T94A 3H40A 4BBRG 1EYZA 1O75A 5DLGA 4RUAA 5CA1F 3DF7A 2V4RA 2YZMA 1C30A 1N36H 5D1PA 5IYBG 4ED8A 2CW7A 2HVSA 5LYJF 3UFXB 2IMWP 4O2AF 4LF8H 2R8JA 4JV5H 3JSNA 4J9QA 5KFBA 3H0GG 1TWCA 3IN5A 4AQYH 1K1QA 1IBLH 1E4EB 2R93G 2E2IA 1PK8A 4O2BF 3MWMA 1M0TA 2FMAA 5KFLA 5JH7F 2VQEH 4ECWA 2BQRA 3RBDA 1GSHA 3VPDA 4UCOA 4X65H 4JV2A 4LF5H 4A3CG 1S10A 4F4XA 2VQDA 4X62H 4EYHB 2VUMA 1WCMG 3PW7A 4YP3A 2YS7A 1TWAA 4EGQA 3BA8A 3BABA 4MV4A 3V4SA 5FLXW 2R7ZG 1SCUB 4C2MA 5KFTA 4LF9H 2R84A 4JUZA 5L1LA 3MR5A 2V58A 5FD5A 4I55F 2FPGB 4A3JG 4L1KA 4LFAH 4C5BA 2IP4A 1DIKA 1GSAA 1GYFA 4GC7A 4PDBA 2QK4A 4DUYH 4RZRA 5C1OA 4JI6H 2FK1A 2R7NA 3I4NG 2AGPA 2CQYA 4RAZA 4DV4H 5KFYA 4J9KA 4C5CA 3PW5A 2ASDA 2QYZA 3KAJA 2AGQA 2J6TA 2JA8G 3PW0A 2NU7B 3PR4A 4ED0A 2MCTA 1EUCB 2W6PA 2UVRA 3J81W 4E4TA 5LMNH 3PW2A 1EUDB 2UVUA 5T14A 5KFPA 1K83A 5KFRA 1XNQH 1DGSA 5IP9G 1SEIA 3GTPA 1UNNC 5DGAA 4BXXG 1M7JA 2I87A 3T5LA 2C2EA 2FPPB 2DLNA 4NLGA 2IA6A 4WBNF 3M9OB 3GTMA 4QIWA 5C3EG 1IBKH 5J2TF 2R8KA 4MA0A 5KFGA 4B3TH 4WD3A 5DG8A 4QIWE 2FE3A 1B04A 1RYRA 3BAAA 4TQRA 3G8CA 1Y1WG 3ORRA 4EFEA 4J0MA 3Q8SB 2JEJA 4RAYA 1E4FT 4X66H 2V5AA 5DQGA 1CQIB 3NGDA 2HHHH 4YHHH 5IT9W 2YRWA 2HVRA 1S97A 5LA6F 4A3GG 2HVQA 1RJQA 4Y8VB 2B63G 4DL2A 3TQ1A 1A9XA 1MZBA 2BQ3A 5KG3A 3FKIG 3R5FA 2X0SA 5KX5F 2JA7G 4A3LG 1SYXB 2XIGA 3T5HA 2CKZB 2ZDGA 4KHPH 4BBSG 2R7LA 1Z2NX 5JVLA 5KG5A 2GPWA 5DQIA 3GTQA 4ED1A 1TWGA 2W57A 2R8HA 1BGWA 1KJIA 2DPIA 5GONF 3UQ8A 4DUZH 4DV6H 1B33N 4O3QA 2ZM6H 3SI8A 2AU0A 4A2BA 5FLMG 1Y1VG 4TUYF 3R5HA 3H0GA 4DV5H 4LFBH 5D8DA 5KFWA 2SCUB 3N6XA 4F4ZA 4Q0YA 2NU9B 3MR6A 5IYDG 1HNWH 4JYAH 1JLLB 1A0IA 4DR2H 4RUCA 2FLPA 2NVYA 5JQWA 2W8LA 4A3IG 5KFAA 2YZNA 3OTOH 4DV2H 3JAMW 4ECYA 2WYOA 4ED6A 3HOUG 4G3IA 2R86A 1RJRA 1WCMA 3BQ2A 1S0NA 1AUXA 3G6YA 3FMAA 4BWSC 4TV9F 4ETSA 4ED2A 4GKKH 3N41B 4IHJF 4HNUA 4JI3H 2OWOA 2R7ZA 3BQ1A 4B3MH 3WNZA 3EPIA 2FLNA 5EWFA 2JA6G 4DL5A 3MFIA 5KT6A 1UC9A 2FJZA 3N40P 4YJ2F 3HOYG 3GTGA 5KFDA 4Q8EA 3GTJA 4A2AA 4ECUA 2HJWA 3RB0A 3GV7B 5DGBA 2R92G 3M9MB 3BA9A 4IRDA 4HNTA 2Q2TA 5KFFA 1ZHQA 3OSPA 2R7KA 4OX9H 1R9TA 4ECRA 5KT7A 4DR4H 4XYLB 4RB0A 1Z2OX 3VMMA 2YRXA 4JV0A 2VPSA 4DV3H 4MV9A 1I94H 1GGOA 4DL3A 4APMA 4CC5A 5KFXA 4DR1H 2WAQA 3GV5B 3U9TA 5EDWA 4ME6A 2XGPA 4YB8B 2XCLA 4YQWA 2WAQE 2W70A 1VBGA 4EBCA 5KFCA 4QWEA 5KFEA 3PR5B 4QWAA 5CAEB 3VPBA 2C28A 5KFJA 2R85A 5FJ8G 4LFCH 1I7NA 1WH2A 1E4EA 3RGXA 4FS1A 2YW2A 4HNVA 2F4VH 4EEYA 4M7EA 5KFOA 3EYYA 3V6JA 4AYBA 1Y1WA 5J2UF 1P8LA 2W9CB 1EZ1A 4A3KG 1EHIA 3HB9A 5C44G 3HOWG 4DV7H 5L1JA 2ASLA 4LF7H 2R82A 1CQJB 3V4ZA 3GIPA 4LF6H 2B63A 4J9MA 3M9NB 2JA5G 1KJ8A 3V6KA 3FKIA 3ETHA 3QFFA 3WO0A 2PBZA 4U6PA 3OHBA 4ZQIA 2JA7A 3MR2A
chains in the Genus database with same CATH topology
4EFEA 4J0MA 4LF4H 4RAYA 1E4FT 1TAEA 4UFZA 4X66H 4B3SH 4YY3H 4RB3C 2HHHH 4YHHH 5IT9W 2HVRA 4NXMH 4JI5H 4JI1H 3KAKA 3RIZA 4JI0H 2CW8A 2HVQA 3KXYT 5FPOA 5D1OA 2UXCH 3L2PA 1HNZH 1HNXH 1MZBA 5FD6A 3L4JA 1IBMH 1V9PA 2UUAH 1SYXB 2XIGA 4RZQA 1X9NA 1TA8A 4EFBA 4KHPH 1VS0A 1Z2NX 2RGVA 4UCSA 2RGRA 3RGZA 2W57A 1BGWA 4FM9A 2YCHA 3HXLA 4DV0H 1L2ZA 4DUZH 3UQ8A 4DV6H 2ZM6H 3H20A 1XDNA 2O03A 3PN1A 5LL6b 4A2BA 4UCUA 3N43B 4MTDA 4LFBH 5FPRA 4DV5H 1N32H 2UXBH 1E4GT 3N6XA 4LSXA 4Q0YA 5LMUH 1HNWH 4DR6H 4JYAH 3JSLA 1O75A 1A0IA 4DR2H 3RJ0A 1N34H 3OTOH 2WDTA 3DF7A 4DV2H 3JAMW 2WYOA 1N36H 3N44B 3C0FB 2Q2UA 5D1PA 4JV5H 2CW7A 2HVSA 2E5LH 4JI8H 4LF8H 4DV1H 3JSNA 3FMAA 4BWSC 4ETSA 4GKJH 3N42B 3F8NA 4GKKH 3CVZA 3N41B 4JI3H 4B3RH 2OWOA 4JI2H 1FJGH 4B3MH 4AQYH 1IBLH 1ZHSA 3MWMA 1M0TA 3RTXA 3N40P 1S68A 1HR0H 2VQEH 5D1OB 4LF5H 2HGSA 4UCOA 4X65H 1XNRH 4A2AA 2VOBA 4X62H 4JI4H 1BJTA 4R7RA 3J7AK 4EEQA 3BA9A 4LSAA 2Q2TA 1N33H 2UUBH 2UXDH 1ZHQA 4UCRA 4CC6A 4OX9H 3BA8A 3BABA 5FLXW 4DR4H 3LMLA 5A2QW 1AN7A 4RB0A 4LF9H 5FD5A 1Z2OX 2KSWA 4DR3H 2VPSA 4DV3H 4MV9A 1I94H 4LFAH 3RF2A 4APMA 3IG0A 4CC5A 4DR1H 1GYFA 4JI7H 1FVIA 4PDBA 3KALA 4UCVA 4DUYH 4JI6H 3M4IA 4GLXA 4X64H 4RAZA 4DV4H 4UCTA 4LFCH 1S03G 1WH2A 4DR7H 3KAJA 3RGXA 1FKAH 2MCTA 4RB2C 3T1HH 3J81W 2F4VH 1XMQH 4M7EA 5LMNH 2VUGA 1I6UA 3T1YH 1M0WA 4I7HA 3EYYA 4DR5H 1P8LA 4MV7A 5EOYA 3J80W 3K3VA 1XNQH 4K0KH 1DGSA 2UU9H 4LMYA 2VQFH 4DV7H 1SEIA 1XMOH 1Z2PX 2UUCH 4LF7H 4RB1A 4LF6H 2ZJTA 5IWAH 4IAJA 3L4KA 5BR8H 1IBKH 4LH7A 1J5EH 4MTEA 4NXNH 4B3TH 4LH6A 2FE3A 1B04A 2WE6A 3BAAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CVZ A; 
#chains in the Genus database with same CATH topology
 4YBZ B;  4UFZ A;  3SE7 A;  4YY3 H;  2YZG A;  4IWY A;  4ZOL F;  2FB9 A;  2WB1 A;  5FPO A;  1Y1V A;  1JX4 A;  3T5J A;  4O4H F;  5D1O A;  2ASJ A;  2WB1 E;  1HNX H;  5KG4 A;  4ED3 A;  3RV4 A;  5C8Y F;  3TIG A;  5FD6 A;  5L1I A;  3GII A;  1V9P A;  5JUM A;  2C2R A;  1KC7 A;  3OUU A;  4J9R A;  1TWF A;  4EFB A;  4A3B G;  1VS0 A;  3E5N A;  5CA0 F;  3H4B A;  3LP8 A;  5IYC G;  2ALZ A;  4A3F G;  2YCH A;  3HXL A;  1IOV A;  3KTM A;  4BY1 G;  5JVD F;  1V51 A;  3H20 A;  1XDN A;  1UC8 A;  1T36 A;  3MWE A;  2YYA A;  4ECV A;  3RAX A;  4MTD A;  2YL2 A;  1TWH A;  4ZI7 F;  5L9X A;  2JA6 A;  5LMU H;  4DR6 H;  4QJF A;  5KT5 A;  2PVP A;  3BG5 A;  4MA5 A;  3RJ0 A;  1B6S A;  4O4I F;  1N34 H;  1WSC A;  2YS6 A;  4ZHQ F;  4PWQ A;  2V4Q A;  2RF4 A;  3PO3 G;  3GIQ A;  2DZD A;  3C0F B;  4ECT A;  1WR2 A;  4MAM A;  2R92 A;  2E5L H;  4JI8 H;  3I4M G;  4MV6 A;  3RB3 A;  3N42 B;  4O3N A;  5F9L A;  4MV3 A;  4JI2 H;  2FPI B;  3GTK A;  3K5I A;  5KG0 A;  2R8G A;  1ZHS A;  2ZDH A;  3EPG A;  4HYK A;  1Y14 B;  3PW4 A;  1S0O A;  5HBR B;  2FK3 A;  2W9B A;  4O4L F;  3RTX A;  4FBT A;  1HR0 H;  5DLF A;  3VPC A;  2HGS A;  3PO2 G;  1V4Y A;  1JKJ B;  4YR2 A;  1XNR H;  3K3P A;  4R7R A;  3J7A K;  2UXD H;  2R93 A;  5DQH A;  4FS2 A;  2UUB H;  1OWT A;  4CC6 A;  4RNO A;  3GQC A;  3R23 A;  3LML A;  5KG7 A;  4Q44 A;  4QWC A;  3QZ7 A;  2XC9 A;  4YR3 A;  2W6O A;  4DR3 H;  1BNC A;  4YAK B;  4TV8 F;  3TQT A;  3CQZ A;  4JI7 H;  1FVI A;  3GIL A;  2PN1 A;  4R8U A;  4UCV A;  2RDJ A;  4F4W A;  3M4I A;  4GLX A;  4IZO A;  1ZET A;  4X64 H;  1RK5 A;  4Q45 A;  3KHR A;  4BY7 G;  3RAQ A;  2W71 A;  4JV1 A;  2JA5 A;  4DR7 H;  2R8I A;  1CS0 A;  1JXL A;  4RB2 C;  3T1H H;  1XMQ H;  2VUG A;  3T1Y H;  4I7H A;  2GLT A;  4GC6 A;  5L1K A;  4YAJ B;  4K0K H;  2XD4 A;  4LMY A;  5KFS A;  4FU0 A;  1Z2P X;  4A3E G;  2BR0 A;  4QW9 A;  4EBD A;  2V9W A;  2ZJT A;  3OHA A;  1B6R A;  1CE8 A;  3Q2O A;  3HOV G;  2VPQ A;  5BR8 H;  4NXN H;  4LH7 A;  2XCA A;  1J5E H;  2R87 A;  1DV1 A;  5HV6 A;  2OH2 A;  1W96 A;  1KJJ A;  1VKZ A;  4LH6 A;  3JRX A;  3G6X A;  2WE6 A;  2W6Z A;  1M6V A;  1GSO A;  3GIJ A;  3RV3 A;  4EYI B;  2W6Q A;  3Q8Q B;  3MWD A;  4RB3 C;  5C4X G;  5KFK A;  3HBL A;  5KG2 A;  4DLK A;  2OLS A;  4JI1 H;  2R7M A;  1W93 A;  3KAK A;  4QWD A;  2CW8 A;  3MR3 A;  5F9N A;  3KHH A;  4JI0 H;  5BPH A;  2VR1 A;  2DWC A;  2UXC H;  3H4D A;  5BPF A;  2W7O A;  1AUV A;  3KHL A;  3BJY A;  1N48 A;  1HNZ H;  3HOZ G;  2GPS A;  5KFZ A;  4AYB E;  3RB4 A;  5C1P A;  4ECQ A;  5KFV A;  1JIH A;  1X9N A;  1TA8 A;  2W9C A;  5EWG A;  5DG7 A;  2RGV A;  4UCS A;  5BMV F;  3T5K A;  2C2D A;  2BQU A;  2RGR A;  2JEI A;  4QWB A;  4FM9 A;  1KJ9 A;  2XGQ A;  1I3Q A;  4DV0 H;  4EG0 A;  4IRC A;  5K2M A;  5C5J A;  5LL6 b;  3N43 B;  2NU8 B;  1N32 H;  4A93 G;  1E4G T;  4LSX A;  1RJP A;  5KG6 A;  3JSL A;  1SFO A;  2UVV A;  4YR0 A;  4I50 F;  2WDT A;  4C5A A;  4QW8 A;  3GIM A;  2M05 A;  3RBE A;  2UVW A;  2YU9 A;  3N44 B;  2Q2U A;  2P0A A;  3PVX A;  4O3O A;  3RUP A;  5KFN A;  2J9G A;  4DV1 H;  1ZQ7 A;  4YJ3 F;  5H80 A;  4GKJ H;  3F8N A;  3CVZ A;  2J6U A;  4B3R H;  5KKN B;  1FJG H;  1T3N A;  5KFI A;  4J9P A;  1JDE A;  4J9S A;  2E2H A;  4O3S A;  3HKZ A;  2VA3 A;  1S68 A;  2C22 A;  1PX2 A;  2FLL A;  2IBK A;  4O3R A;  5D1O B;  1S0M A;  2RDI A;  3G6V A;  3HKZ E;  5KT2 A;  4EGJ A;  3AYH B;  1I7L A;  1GO3 E;  2VOB A;  3GLK A;  4IR1 A;  4XZ3 B;  1BJT A;  4JI4 H;  4EEQ A;  4LSA A;  4EBE A;  1N33 H;  2I8C A;  1K1S A;  1S9F A;  4UCR A;  4J9N A;  5IYZ F;  1BXR A;  3OUZ A;  5KFU A;  5A2Q W;  1AN7 A;  3GID A;  1RK6 A;  3GTO A;  2KSW A;  3TIN A;  4XYM B;  5EZY F;  2VA2 A;  4RU9 A;  4ED7 A;  1DV2 A;  1C3O A;  1VAJ A;  3RF2 A;  3IG0 A;  4F50 A;  3KHG A;  3TII A;  3Q8P B;  3KAL A;  1JDB B;  3JRW A;  3JZI A;  1N56 A;  4IR9 A;  2VUM G;  2I80 A;  2C35 B;  4HQ6 A;  4DL7 A;  5EWE A;  2FK2 A;  4J9O A;  4RNN A;  4UCT A;  4IRK A;  1S03 G;  2PMZ A;  5KG1 A;  5CB4 F;  1RYS A;  1FKA H;  3WO1 A;  2W9A A;  3N8D A;  5I47 A;  2PMZ E;  4HR7 A;  1I6U A;  3Q8R B;  2XCP A;  2R6F A;  4RNM A;  3HOX G;  1M0W A;  4A3M G;  2ATL A;  4DR5 H;  2AQ4 A;  1KBL A;  2JEF A;  5KFM A;  3I12 A;  4DL4 A;  3GTL A;  4MV7 A;  5EOY A;  3J80 W;  3K3V A;  1KEE A;  2UU9 H;  2J6S A;  2W9B B;  5KFQ A;  2VQF H;  1GLV A;  3BQ0 A;  1IOW A;  1XMO H;  2UUC H;  4XX0 B;  2CZG A;  4RB1 A;  4ECX A;  5IWA H;  3ETJ A;  5KT4 A;  4IAJ A;  3L4K A;  2NVX A;  2Y0S A;  1I50 A;  3MJF A;  4MV1 A;  4MTE A;  3V6H A;  2W6M A;  3LWB A;  5LXT F;  2Y0S E;  2NUA B;  3U9S A;  4TQS A;  4LF4 H;  2ZDQ A;  3RFC A;  4B3S H;  1TAE A;  3GIK A;  5LOV F;  4A3D G;  2W7P A;  3PZP A;  4ECS A;  3RB6 A;  4NXM H;  4JI5 H;  3OSN A;  3RIZ A;  3KXY T;  2FP4 B;  2DIK A;  1ULZ A;  5LP6 F;  3L2P A;  1KJQ A;  1VBH A;  2NU6 B;  4MV8 A;  3Q1K A;  3FDS A;  4IWX A;  4R8U B;  5IP7 G;  3GV8 B;  3ORQ A;  3L4J A;  2W8K A;  1IBM H;  5KT3 A;  3R5X A;  3QZ8 A;  2AGO A;  2DPJ A;  2JEG A;  2UUA H;  3H3V H;  4M9U A;  4RZQ A;  3MFH A;  2C00 A;  5KFH A;  4J9L A;  3RGZ A;  4Q8F A;  2W6N A;  1L2Z A;  4O3P A;  5DG9 A;  4U7C A;  2O03 A;  3PN1 A;  4F4Y A;  4UCU A;  4Q43 A;  4FBU A;  4I4T F;  5FPR A;  2UXB H;  4ECZ A;  2FKL A;  2WTF A;  3K5H A;  4DL6 A;  2V59 A;  1T94 A;  3H40 A;  4BBR G;  1EYZ A;  1O75 A;  5DLG A;  4RUA A;  5CA1 F;  3DF7 A;  2V4R A;  2YZM A;  1C30 A;  1N36 H;  5D1P A;  5IYB G;  4ED8 A;  2CW7 A;  2HVS A;  5LYJ F;  3UFX B;  2IMW P;  4O2A F;  4LF8 H;  2R8J A;  4JV5 H;  3JSN A;  4J9Q A;  5KFB A;  3H0G G;  1TWC A;  3IN5 A;  4AQY H;  1K1Q A;  1IBL H;  1E4E B;  2R93 G;  2E2I A;  1PK8 A;  4O2B F;  3MWM A;  1M0T A;  2FMA A;  5KFL A;  5JH7 F;  2VQE H;  4ECW A;  2BQR A;  3RBD A;  1GSH A;  3VPD A;  4UCO A;  4X65 H;  4JV2 A;  4LF5 H;  4A3C G;  1S10 A;  4F4X A;  2VQD A;  4X62 H;  4EYH B;  2VUM A;  1WCM G;  3PW7 A;  4YP3 A;  2YS7 A;  1TWA A;  4EGQ A;  3BA8 A;  3BAB A;  4MV4 A;  3V4S A;  5FLX W;  2R7Z G;  1SCU B;  4C2M A;  5KFT A;  4LF9 H;  2R84 A;  4JUZ A;  5L1L A;  3MR5 A;  2V58 A;  5FD5 A;  4I55 F;  2FPG B;  4A3J G;  4L1K A;  4LFA H;  4C5B A;  2IP4 A;  1DIK A;  1GSA A;  1GYF A;  4GC7 A;  4PDB A;  2QK4 A;  4DUY H;  4RZR A;  5C1O A;  4JI6 H;  2FK1 A;  2R7N A;  3I4N G;  2AGP A;  2CQY A;  4RAZ A;  4DV4 H;  5KFY A;  4J9K A;  4C5C A;  3PW5 A;  2ASD A;  2QYZ A;  3KAJ A;  2AGQ A;  2J6T A;  2JA8 G;  3PW0 A;  2NU7 B;  3PR4 A;  4ED0 A;  2MCT A;  1EUC B;  2W6P A;  2UVR A;  3J81 W;  4E4T A;  5LMN H;  3PW2 A;  1EUD B;  2UVU A;  5T14 A;  5KFP A;  1K83 A;  5KFR A;  1XNQ H;  1DGS A;  5IP9 G;  1SEI A;  3GTP A;  1UNN C;  5DGA A;  4BXX G;  1M7J A;  2I87 A;  3T5L A;  2C2E A;  2FPP B;  2DLN A;  4NLG A;  2IA6 A;  4WBN F;  3M9O B;  3GTM A;  4QIW A;  5C3E G;  1IBK H;  5J2T F;  2R8K A;  4MA0 A;  5KFG A;  4B3T H;  4WD3 A;  5DG8 A;  4QIW E;  2FE3 A;  1B04 A;  1RYR A;  3BAA A;  4TQR A;  3G8C A;  1Y1W G;  3ORR A;  4EFE A;  4J0M A;  3Q8S B;  2JEJ A;  4RAY A;  1E4F T;  4X66 H;  2V5A A;  5DQG A;  1CQI B;  3NGD A;  2HHH H;  4YHH H;  5IT9 W;  2YRW A;  2HVR A;  1S97 A;  5LA6 F;  4A3G G;  2HVQ A;  1RJQ A;  4Y8V B;  2B63 G;  4DL2 A;  3TQ1 A;  1A9X A;  1MZB A;  2BQ3 A;  5KG3 A;  3FKI G;  3R5F A;  2X0S A;  5KX5 F;  2JA7 G;  4A3L G;  1SYX B;  2XIG A;  3T5H A;  2CKZ B;  2ZDG A;  4KHP H;  4BBS G;  2R7L A;  1Z2N X;  5JVL A;  5KG5 A;  2GPW A;  5DQI A;  3GTQ A;  4ED1 A;  1TWG A;  2W57 A;  2R8H A;  1BGW A;  1KJI A;  2DPI A;  5GON F;  3UQ8 A;  4DUZ H;  4DV6 H;  1B33 N;  4O3Q A;  2ZM6 H;  3SI8 A;  2AU0 A;  4A2B A;  5FLM G;  1Y1V G;  4TUY F;  3R5H A;  3H0G A;  4DV5 H;  4LFB H;  5D8D A;  5KFW A;  2SCU B;  3N6X A;  4F4Z A;  4Q0Y A;  2NU9 B;  3MR6 A;  5IYD G;  1HNW H;  4JYA H;  1JLL B;  1A0I A;  4DR2 H;  4RUC A;  2FLP A;  2NVY A;  5JQW A;  2W8L A;  4A3I G;  5KFA A;  2YZN A;  3OTO H;  4DV2 H;  3JAM W;  4ECY A;  2WYO A;  4ED6 A;  3HOU G;  4G3I A;  2R86 A;  1RJR A;  1WCM A;  3BQ2 A;  1S0N A;  1AUX A;  3G6Y A;  3FMA A;  4BWS C;  4TV9 F;  4ETS A;  4ED2 A;  4GKK H;  3N41 B;  4IHJ F;  4HNU A;  4JI3 H;  2OWO A;  2R7Z A;  3BQ1 A;  4B3M H;  3WNZ A;  3EPI A;  2FLN A;  5EWF A;  2JA6 G;  4DL5 A;  3MFI A;  5KT6 A;  1UC9 A;  2FJZ A;  3N40 P;  4YJ2 F;  3HOY G;  3GTG A;  5KFD A;  4Q8E A;  3GTJ A;  4A2A A;  4ECU A;  2HJW A;  3RB0 A;  3GV7 B;  5DGB A;  2R92 G;  3M9M B;  3BA9 A;  4IRD A;  4HNT A;  2Q2T A;  5KFF A;  1ZHQ A;  3OSP A;  2R7K A;  4OX9 H;  1R9T A;  4ECR A;  5KT7 A;  4DR4 H;  4XYL B;  4RB0 A;  1Z2O X;  3VMM A;  2YRX A;  4JV0 A;  2VPS A;  4DV3 H;  4MV9 A;  1I94 H;  1GGO A;  4DL3 A;  4APM A;  4CC5 A;  5KFX A;  4DR1 H;  2WAQ A;  3GV5 B;  3U9T A;  5EDW A;  4ME6 A;  2XGP A;  4YB8 B;  2XCL A;  4YQW A;  2WAQ E;  2W70 A;  1VBG A;  4EBC A;  5KFC A;  4QWE A;  5KFE A;  3PR5 B;  4QWA A;  5CAE B;  3VPB A;  2C28 A;  5KFJ A;  2R85 A;  5FJ8 G;  4LFC H;  1I7N A;  1WH2 A;  1E4E A;  3RGX A;  4FS1 A;  2YW2 A;  4HNV A;  2F4V H;  4EEY A;  4M7E A;  5KFO A;  3EYY A;  3V6J A;  4AYB A;  1Y1W A;  5J2U F;  1P8L A;  2W9C B;  1EZ1 A;  4A3K G;  1EHI A;  3HB9 A;  5C44 G;  3HOW G;  4DV7 H;  5L1J A;  2ASL A;  4LF7 H;  2R82 A;  1CQJ B;  3V4Z A;  3GIP A;  4LF6 H;  2B63 A;  4J9M A;  3M9N B;  2JA5 G;  1KJ8 A;  3V6K A;  3FKI A;  3ETH A;  3QFF A;  3WO0 A;  2PBZ A;  4U6P A;  3OHB A;  4ZQI A;  2JA7 A;  3MR2 A; 
#chains in the Genus database with same CATH homology
 4EFE A;  4J0M A;  4LF4 H;  4RAY A;  1E4F T;  1TAE A;  4UFZ A;  4X66 H;  4B3S H;  4YY3 H;  4RB3 C;  2HHH H;  4YHH H;  5IT9 W;  2HVR A;  4NXM H;  4JI5 H;  4JI1 H;  3KAK A;  3RIZ A;  4JI0 H;  2CW8 A;  2HVQ A;  3KXY T;  5FPO A;  5D1O A;  2UXC H;  3L2P A;  1HNZ H;  1HNX H;  1MZB A;  5FD6 A;  3L4J A;  1IBM H;  1V9P A;  2UUA H;  1SYX B;  2XIG A;  4RZQ A;  1X9N A;  1TA8 A;  4EFB A;  4KHP H;  1VS0 A;  1Z2N X;  2RGV A;  4UCS A;  2RGR A;  3RGZ A;  2W57 A;  1BGW A;  4FM9 A;  2YCH A;  3HXL A;  4DV0 H;  1L2Z A;  4DUZ H;  3UQ8 A;  4DV6 H;  2ZM6 H;  3H20 A;  1XDN A;  2O03 A;  3PN1 A;  5LL6 b;  4A2B A;  4UCU A;  3N43 B;  4MTD A;  4LFB H;  5FPR A;  4DV5 H;  1N32 H;  2UXB H;  1E4G T;  3N6X A;  4LSX A;  4Q0Y A;  5LMU H;  1HNW H;  4DR6 H;  4JYA H;  3JSL A;  1O75 A;  1A0I A;  4DR2 H;  3RJ0 A;  1N34 H;  3OTO H;  2WDT A;  3DF7 A;  4DV2 H;  3JAM W;  2WYO A;  1N36 H;  3N44 B;  3C0F B;  2Q2U A;  5D1P A;  4JV5 H;  2CW7 A;  2HVS A;  2E5L H;  4JI8 H;  4LF8 H;  4DV1 H;  3JSN A;  3FMA A;  4BWS C;  4ETS A;  4GKJ H;  3N42 B;  3F8N A;  4GKK H;  3CVZ A;  3N41 B;  4JI3 H;  4B3R H;  2OWO A;  4JI2 H;  1FJG H;  4B3M H;  4AQY H;  1IBL H;  1ZHS A;  3MWM A;  1M0T A;  3RTX A;  3N40 P;  1S68 A;  1HR0 H;  2VQE H;  5D1O B;  4LF5 H;  2HGS A;  4UCO A;  4X65 H;  1XNR H;  4A2A A;  2VOB A;  4X62 H;  4JI4 H;  1BJT A;  4R7R A;  3J7A K;  4EEQ A;  3BA9 A;  4LSA A;  2Q2T A;  1N33 H;  2UUB H;  2UXD H;  1ZHQ A;  4UCR A;  4CC6 A;  4OX9 H;  3BA8 A;  3BAB A;  5FLX W;  4DR4 H;  3LML A;  5A2Q W;  1AN7 A;  4RB0 A;  4LF9 H;  5FD5 A;  1Z2O X;  2KSW A;  4DR3 H;  2VPS A;  4DV3 H;  4MV9 A;  1I94 H;  4LFA H;  3RF2 A;  4APM A;  3IG0 A;  4CC5 A;  4DR1 H;  1GYF A;  4JI7 H;  1FVI A;  4PDB A;  3KAL A;  4UCV A;  4DUY H;  4JI6 H;  3M4I A;  4GLX A;  4X64 H;  4RAZ A;  4DV4 H;  4UCT A;  4LFC H;  1S03 G;  1WH2 A;  4DR7 H;  3KAJ A;  3RGX A;  1FKA H;  2MCT A;  4RB2 C;  3T1H H;  3J81 W;  2F4V H;  1XMQ H;  4M7E A;  5LMN H;  2VUG A;  1I6U A;  3T1Y H;  1M0W A;  4I7H A;  3EYY A;  4DR5 H;  1P8L A;  4MV7 A;  5EOY A;  3J80 W;  3K3V A;  1XNQ H;  4K0K H;  1DGS A;  2UU9 H;  4LMY A;  2VQF H;  4DV7 H;  1SEI A;  1XMO H;  1Z2P X;  2UUC H;  4LF7 H;  4RB1 A;  4LF6 H;  2ZJT A;  5IWA H;  4IAJ A;  3L4K A;  5BR8 H;  1IBK H;  4LH7 A;  1J5E H;  4MTE A;  4NXN H;  4B3T H;  4LH6 A;  2FE3 A;  1B04 A;  2WE6 A;  3BAA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...