3CVZA

Structural insights into the molecular organization of the s-layer from clostridium difficile
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
248
structure length
248
Chain Sequence
TTGTQGYTVVKNDWKKAVKQLQDGLKDNSIGKITVSFNDGVVGEVAPKSANKKADRDAAAEKLYNLVNTQLDKLGDGDYVDFSVDYNLENKIITNQADAEAIVTKLNSLNEKTLIDIATKDTFGMVSKTQDSEGKNVAATKALKVKDVATFGLKSGGSEDTGYVVEMKAGAVEDKYGKVGDSTAGIAINLPSTGLEYAGKGTTIDFNKTLKVDVTGGSTPSAVAVSGFVTKDDTDLAKSGTINVRVIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the molecular organization of the S-layer from Clostridium difficile
pubmed doi rcsb
source organism Clostridium difficile
molecule tags Structural protein
molecule keywords S-layer protein
total genus 61
structure length 248
sequence length 248
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-04-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.290 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3cvzA01
3CVZA
chains in the Genus database with same CATH superfamily
2VQDA 1GYFA 5JQWA 4BY7G 4YAJB 4IHJF 3OUZA 4PWQA 5BPHA 1S0OA 5KFWA 3WNZA 2ASDA 4WD3A 2MCTA 1GSHA 3I4NG 2W8LA 2VUMG 3EYYA 4RU9A 2W6NA 4CC6A 4FM9A 3PW5A 4O2AF 3RTXA 1HNZH 4MA5A 2WB1E 5F9NA 5KT2A 2FJZA 2NUAB 5C3EG 4GC6A 4X62H 2YS7A 4QJFA 5LA6F 2IA6A 1UNNC 5LXTF 3IG0A 3K3PA 3G6XA 4R7RA 3TINA 2DPIA 1RK5A 3ORQA 4J0MA 4X66H 5L1IA 4F4YA 2R84A 2BQ3A 4MV7A 2R7NA 3H4DA 4ECUA 1KEEA 5BPFA 2VUMA 2DZDA 1DIKA 5CB4F 3R5FA 3RBEA 4A3LG 3LP8A 3H40A 2NVXA 2C00A 4OX9H 3BA8A 2R7ZA 1N33H 3T1HH 3GTKA 3JRWA 3GV7B 1IOVA 2PVPA 5FD6A 3QZ7A 3RB0A 3AYHB 5KFZA 1E4FT 2FP4B 4IZOA 4MV6A 2XD4A 2W7PA 4NXMH 4EEQA 5KKNB 3Q8PB 3CQZA 3I12A 3V6KA 4YJ2F 4TUYF 4IRDA 4TV9F 4YAKB 3RBDA 4Q43A 3RGZA 5KFRA 4C5CA 1TWFA 2PMZA 1V51A 2R8GA 4GKJH 3G8CA 3KAJA 3VPCA 5KFHA 4O3NA 4DLKA 4RB0A 3PVXA 2CW8A 4HNTA 2W70A 1JLLB 3EPIA 2PN1A 5FLXW 2E2HA 3GIDA 3RGXA 4B3RH 1JDBB 2W6QA 3M4IA 4JUZA 5KFXA 4C5BA 3KHHA 1Z2NX 2FE3A 4RAZA 5LL6b 2UXCH 1Y1WA 4YR0A 3T5HA 3HB9A 2I87A 5L1KA 3TQ1A 5H80A 2BQUA 4I55F 2R8KA 1AUXA 4RB2C 2JA6G 4XX0B 2HVRA 5JH7F 1WCMA 4RB1A 3PZPA 3PW0A 1I94H 4UCUA 2RGRA 2OH2A 4B3MH 1GSOA 1AUVA 3MFHA 3U9SA 2NU8B 4LFBH 4ZOLF 5KFEA 4ECTA 5LOVF 1JDEA 1XNQH 1IBKH 2SCUB 5IYBG 5JVDF 4DR2H 4DL4A 1KJ9A 1TWAA 4ED3A 3RFCA 3ORRA 3MWDA 4A3KG 3J80W 2ZDGA 2Y0SE 2XGQA 2C2EA 2YL2A 4TQSA 4KHPH 1RJQA 4YBZB 2CW7A 4YR2A 5EZYF 3FMAA 4UCVA 4QIWE 5J2UF 4DV2H 4QWDA 2YW2A 1GGOA 2W6OA 3GLKA 3PW2A 2AGOA 1N36H 2VPSA 3LWBA 2J6UA 2UUCH 4JV2A 3N40P 4J9MA 3H0GG 4K0KH 4ECXA 2C28A 1VS0A 1S68A 2R8HA 3PN1A 2W9CB 3SI8A 3ETHA 4Q8EA 4ED1A 2JA5G 5KFYA 4O3QA 2IMWP 4I7HA 4HNUA 4JI3H 2V5AA 3CVZA 2E2IA 3I4MG 1S10A 3L4KA 1RYRA 1WCMG 2QK4A 3NGDA 5KG3A 1KJQA 2R7MA 5FD5A 2XC9A 2Q2UA 4MA0A 5L9XA 4MV3A 2JA7A 2JA6A 1E4GT 4ECYA 4ED8A 1V4YA 2FK2A 2VQEH 3HOWG 4L1KA 3HKZA 3GIQA 5KT4A 1Y1WG 3GTPA 2VPQA 1VKZA 3HKZE 2FPGB 3MWMA 5BR8H 2NU7B 4UCOA 3OTOH 1S9FA 4A2AA 4M9UA 5KFJA 5T14A 4RNMA 4RB3C 4APMA 3PW7A 3TQTA 1CS0A 4RZQA 1TWGA 1P8LA 5KG2A 3BJYA 2NU9B 4JI5H 2YYAA 2PMZE 4XYMB 5FLMG 4DL7A 5JUMA 2BR0A 3T1YH 3MR5A 1XNRH 2VQFH 1E4EB 4LF8H 2R92G 1Y1VG 4WBNF 4ZHQF 4ED2A 5KG5A 1GO3E 2GPWA 4MTDA 5IYDG 2AQ4A 3RAQA 4O4IF 1HNXH 5DGAA 1Z2PX 2UXDH 4ECWA 4BWSC 2FPIB 2UVUA 2GLTA 4RAYA 3K5IA 3M9MB 4AQYH 4FS2A 4LF6H 2JEFA 1T94A 1B33N 1M0TA 4DV5H 3DF7A 5IWAH 2R7ZG 5IP9G 3J81W 1E4EA 2FK1A 3JZIA 3PR4A 4HR7A 3IN5A 3V6HA 3VPBA 4EBEA 5HV6A 3PW4A 1FJGH 3M9NB 3MJFA 3Q8SB 4J9NA 5KT7A 4X64H 4J9LA 1XMQH 1B04A 1ZHQA 1I7NA 3HOVG 1CQJB 4F4XA 1A9XA 1DV2A 4EEYA 2HJWA 2VR1A 4DL3A 3H4BA 4LSAA 4TQRA 1SYXB 2CKZB 3OHBA 4EBDA 2C35B 3BQ0A 2W9AA 4JI4H 4J9SA 1CQIB 3RB3A 2WYOA 3GIIA 4JI8H 2FPPB 3H3VH 4O2BF 1O75A 3GTJA 2HGSA 5DG9A 5KFMA 4A3GG 1T36A 5KFGA 5EWGA 3GIJA 4TV8F 3HOUG 5A2QW 5D1OA 4U7CA 2C22A 2I8CA 1M6VA 2FMAA 1Y1VA 3KXYT 2W9BA 2YU9A 2R92A 3RB4A 1XMOH 4FBUA 3KHLA 3FKIG 5DQGA 2F4VH 5KFCA 1JXLA 5KFSA 1V9PA 1JKJB 1M7JA 5I47A 2W7OA 2YRWA 3BA9A 1N32H 4Y8VB 1SCUB 4DR4H 2V4RA 4A3JG 2CQYA 2RDIA 2AGQA 4Q8FA 4I4TF 1L2ZA 5C4XG 3QZ8A 3KHRA 4GC7A 4DV1H 3BABA 1I6UA 3H20A 5IP7G 3R5HA 4XZ3B 3OHAA 4O4HF 1RJRA 5C1PA 2UUBH 3RIZA 2DIKA 2V4QA 4MV1A 2C2RA 3R23A 2Q2TA 1HNWH 5K2MA 1KC7A 4R8UB 3HBLA 5KFFA 1TWHA 2R86A 3GIPA 4LF7H 5FJ8G 2V58A 2GPSA 2JA7G 5KT5A 3GV5B 3RV3A 4QWBA 5DG7A 1K1QA 3MWEA 2BQRA 4QW9A 4IR9A 3UQ8A 4F50A 4DV3H 2R7KA 4YJ3F 4AYBE 1RYSA 3MR2A 5CA1F 2W6MA 3RB6A 2QYZA 1Y14B 1RK6A 5KT6A 1PX2A 4RNNA 1C30A 3K5HA 1KJIA 4DR5H 4LF9H 4A3DG 2R93G 4ETSA 2ATLA 2RF4A 2FK3A 2FB9A 4RUAA 1JIHA 2NVYA 1M0WA 4HYKA 4A2BA 5KT3A 2HVSA 1X9NA 4EGQA 4IAJA 2R7LA 1C3OA 2YRXA 4BBRG 4J9OA 3H0GA 5DLGA 4O4LF 2YZMA 3GIMA 4LSXA 3F8NA 5KFBA 3G6YA 4M7EA 3OSNA 2X0SA 4DR1H 3PO3G 1EHIA 3V4SA 4B3SH 1XDNA 2I80A 2B63A 5KX5F 1KBLA 4JI7H 1KJ8A 4O3RA 1VBHA 5HBRB 4DR6H 1GLVA 4YR3A 1UC9A 2JEIA 4O3PA 2Y0SA 3E5NA 1A0IA 4Q45A 1TAEA 3N41B 3GQCA 2ASJA 5EOYA 1BGWA 5KG4A 2W9BB 3R5XA 2R6FA 3Q8RB 1BXRA 1EUDB 3HXLA 5KFPA 2FLLA 5DG8A 4J9RA 1EUCB 3N42B 4LF5H 1DGSA 2B63G 3FDSA 4MAMA 2IP4A 4EBCA 2R8JA 2WDTA 4ECVA 4DL5A 4ME6A 2UU9H 2UXBH 1BNCA 1K1SA 1SEIA 3MFIA 2WB1A 2ZJTA 3T5LA 1N48A 4FBTA 1S0MA 2C2DA 2OWOA 2DPJA 4QW8A 1B6SA 2XCPA 1TWCA 3LMLA 5IYZF 3U9TA 3RJ0A 3GILA 4O3SA 2W6PA 4G3IA 2YCHA 1JX4A 1TA8A 4ZI7F 5KFUA 1DV1A 2YZNA 3OUUA 4A3FG 1J5EH 4CC5A 2FLNA 2XCAA 4IRKA 4JV5H 5DQHA 3L4JA 1IOWA 4E4TA 4HNVA 4IRCA 5KFOA 4DUZH 5KFDA 3K3VA 4BXXG 3JSNA 4ED0A 1RJPA 5KFVA 4YP3A 4A3MG 5GONF 4EG0A 2UVRA 4F4ZA 4BBSG 1KJJA 3JRXA 4DUYH 4A3EG 2VA2A 1MZBA 3M9OB 2W6ZA 2ALZA 4NLGA 2AU0A 4EYHB 5EWFA 4GLXA 1EYZA 1ULZA 1ZHSA 5D8DA 4DR3H 4NXNH 3GIKA 2VA3A 3HOZG 1WSCA 3HOYG 5KFIA 3HOXG 5LYJF 2P0AA 3KHGA 2UUAH 4MV8A 5IT9W 2HVQA 4I50F 4ZQIA 1UC8A 4DV0H 3T5KA 5EWEA 2FKLA 4MTEA 5KFKA 4ECSA 3N43B 1I7LA 2J9GA 4ECRA 1VBGA 4QWEA 4ED7A 4IWXA 3FKIA 4DV4H 5C8YF 4UCTA 5CA0F 4ED6A 1AN7A 2CZGA 1S97A 3RAXA 2XCLA 5KFNA 4IR1A 3J7AK 5D1OB 3C0FB 5KG6A 1WR2A 3V6JA 1W93A 3Q2OA 2YZGA 4JI2H 3N6XA 4FU0A 3VPDA 1ZETA 5BMVF 2AGPA 4AYBA 4FS1A 2VUGA 1BJTA 4DV6H 2J6TA 4A93G 4C5AA 1R9TA 3GTQA 5KG1A 3RUPA 2W8KA 4ECQA 3TIIA 2KSWA 3V4ZA 4A3IG 4UCSA 3PO2G 2ASLA 4MV9A 5F9LA 4YY3H 4O3OA 1N56A 5C1OA 3OSPA 1ZQ7A 4UCRA 3Q1KA 2ZDHA 2M05A 4LH6A 2YS6A 5KFTA 3WO0A 3RV4A 1FKAH 4A3CG 1B6RA 1GSAA 3GV8B 4GKKH 1CE8A 1K83A 1VAJA 2XIGA 3BQ2A 3QFFA 3WO1A 4YQWA 2R8IA 2HHHH 1IBMH 3N44B 5CAEB 1WH2A 5C44G 4QIWA 4JI0H 2V59A 3TIGA 5LP6F 3RF2A 4JV1A 4Q0YA 5KG0A 4LF4H 4UFZA 1Z2OX 4IWYA 4LFAH 2R82A 3EPGA 4PDBA 4Q44A 5KFAA 3KAKA 1T3NA 5KG7A 2V9WA 4BY1G 2W57A 3GTLA 3N8DA 3SE7A 1HR0H 4QWCA 4J9QA 4R8UA 2XGPA 4C2MA 5FPRA 4B3TH 5LMNH 4RNOA 1W96A 3T5JA 4U6PA 4XYLB 2W71A 3PR5B 2DWCA 5DQIA 2R87A 5D1PA 3JAMW 4LFCH 2W9CA 3BQ1A 4DR7H 4RUCA 4JYAH 1SFOA 3KALA 5KFLA 2R85A 2WE6A 2ZDQA 2JEGA 4YB8B 5FPOA 1N34H 1IBLH 2NU6B 4YHHH 4X65H 2R93A 4EFBA 5JVLA 4DL6A 2UVVA 5J2TF 5IYCG 4RZRA 5DLFA 4JI1H 4DV7H 4J9PA 4EFEA 4EGJA 5L1JA 4LMYA 2FLPA 1PK8A 3Q8QB 2OLSA 1FVIA 4QWAA 5L1LA 2UVWA 3GTMA 3GTOA 3GTGA 2JA5A 2JEJA 2RDJA 4MV4A 4A3BG 4ECZA 3KTMA 3VMMA 5EDWA 3BG5A 4HQ6A 4JI6H 5DGBA 3MR6A 3ETJA 2O03A 3MR3A 2IBKA 2WAQA 2ZM6H 2PBZA 2WAQE 1OWTA 3JSLA 4EYIB 2JA8G 2DLNA 5LMUH 3UFXB 4JV0A 2WTFA 1I50A 5C5JA 3G6VA 1S0NA 4LH7A 1I3QA 5KFQA 4DL2A 2RGVA 2VOBA 4F4WA 2J6SA 2E5LH 1EZ1A 3L2PA 3BAAA 4J9KA 1S03G
chains in the Genus database with same CATH topology
1L2ZA 1GYFA 1N36H 4DV1H 2VPSA 3BABA 4DV4H 4UCTA 1I6UA 2UUCH 1AN7A 3H20A 3N40P 4K0KH 3J7AK 5D1OB 3C0FB 2UUBH 1VS0A 1S68A 3RIZA 3PN1A 2Q2TA 2MCTA 1HNWH 4JI2H 3EYYA 3N6XA 4CC6A 4FM9A 4LF7H 3RTXA 2VUGA 1BJTA 4I7HA 4DV6H 1HNZH 4JI3H 3CVZA 4X62H 3L4KA 3UQ8A 3IG0A 4DV3H 2KSWA 2Q2UA 4UCSA 4R7RA 5FD5A 4MV9A 4DR5H 4J0MA 4X66H 4YY3H 4LF9H 1E4GT 4MV7A 4ETSA 2VQEH 1M0WA 4UCRA 4A2BA 2HVSA 1X9NA 4IAJA 4LH6A 4OX9H 3MWMA 3BA8A 1FKAH 5BR8H 1N33H 4GKKH 3T1HH 4UCOA 3OTOH 2XIGA 4A2AA 4LSXA 2HHHH 3F8NA 4RB3C 4APMA 3N44B 4M7EA 5FD6A 4DR1H 1IBMH 1WH2A 4RZQA 4B3SH 1XDNA 4JI0H 1E4FT 4JI7H 1P8LA 3RF2A 4DR6H 4Q0YA 4NXMH 4LF4H 4UFZA 1Z2OX 4EEQA 4JI5H 4LFAH 4PDBA 3KAKA 3T1YH 1XNRH 2W57A 1A0IA 2VQFH 1TAEA 3N41B 5EOYA 1BGWA 1HR0H 4LF8H 3RGZA 5FPRA 4B3TH 5LMNH 4MTDA 1HNXH 3HXLA 4GKJH 3N42B 1Z2PX 1DGSA 3KAJA 4LF5H 2UXDH 4BWSC 2WDTA 5D1PA 4RB0A 3JAMW 4LFCH 4RAYA 4AQYH 2UU9H 4LF6H 2CW8A 4DR7H 1SEIA 4JYAH 2UXBH 2ZJTA 3KALA 1M0TA 4DV5H 3DF7A 5IWAH 5FLXW 2OWOA 2WE6A 3RGXA 3J81W 4B3RH 3M4IA 3LMLA 3RJ0A 5FPOA 1N34H 1IBLH 1Z2NX 2FE3A 4RAZA 5LL6b 1FJGH 2UXCH 2YCHA 4YHHH 4X65H 1TA8A 4X64H 1XMQH 1B04A 1ZHQA 4EFBA 2E5LH 4RB2C 1J5EH 4CC5A 2HVRA 4JI1H 4LSAA 4DV7H 1SYXB 4JV5H 4EFEA 3L4JA 4RB1A 4LMYA 1I94H 1FVIA 4UCUA 4JI4H 4DUZH 2RGRA 3K3VA 3JSNA 2WYOA 4JI8H 4B3MH 1O75A 2HGSA 4LFBH 4JI6H 5A2QW 1XNQH 1IBKH 5D1OA 2O03A 4DUYH 4DR2H 1MZBA 3KXYT 2ZM6H 3J80W 1ZHSA 3JSLA 4GLXA 1XMOH 4DR3H 4NXNH 5LMUH 2F4VH 4KHPH 2CW7A 2UUAH 1V9PA 5IT9W 2HVQA 3FMAA 4LH7A 2RGVA 2VOBA 3BA9A 4UCVA 1N32H 4DV0H 4DR4H 4DV2H 4MTEA 3L2PA 3BAAA 3N43B 1S03G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CVZ A; 
#chains in the Genus database with same CATH topology
 2VQD A;  1GYF A;  5JQW A;  4BY7 G;  4YAJ B;  4IHJ F;  3OUZ A;  4PWQ A;  5BPH A;  1S0O A;  5KFW A;  3WNZ A;  2ASD A;  4WD3 A;  2MCT A;  1GSH A;  3I4N G;  2W8L A;  2VUM G;  3EYY A;  4RU9 A;  2W6N A;  4CC6 A;  4FM9 A;  3PW5 A;  4O2A F;  3RTX A;  1HNZ H;  4MA5 A;  2WB1 E;  5F9N A;  5KT2 A;  2FJZ A;  2NUA B;  5C3E G;  4GC6 A;  4X62 H;  2YS7 A;  4QJF A;  5LA6 F;  2IA6 A;  1UNN C;  5LXT F;  3IG0 A;  3K3P A;  3G6X A;  4R7R A;  3TIN A;  2DPI A;  1RK5 A;  3ORQ A;  4J0M A;  4X66 H;  5L1I A;  4F4Y A;  2R84 A;  2BQ3 A;  4MV7 A;  2R7N A;  3H4D A;  4ECU A;  1KEE A;  5BPF A;  2VUM A;  2DZD A;  1DIK A;  5CB4 F;  3R5F A;  3RBE A;  4A3L G;  3LP8 A;  3H40 A;  2NVX A;  2C00 A;  4OX9 H;  3BA8 A;  2R7Z A;  1N33 H;  3T1H H;  3GTK A;  3JRW A;  3GV7 B;  1IOV A;  2PVP A;  5FD6 A;  3QZ7 A;  3RB0 A;  3AYH B;  5KFZ A;  1E4F T;  2FP4 B;  4IZO A;  4MV6 A;  2XD4 A;  2W7P A;  4NXM H;  4EEQ A;  5KKN B;  3Q8P B;  3CQZ A;  3I12 A;  3V6K A;  4YJ2 F;  4TUY F;  4IRD A;  4TV9 F;  4YAK B;  3RBD A;  4Q43 A;  3RGZ A;  5KFR A;  4C5C A;  1TWF A;  2PMZ A;  1V51 A;  2R8G A;  4GKJ H;  3G8C A;  3KAJ A;  3VPC A;  5KFH A;  4O3N A;  4DLK A;  4RB0 A;  3PVX A;  2CW8 A;  4HNT A;  2W70 A;  1JLL B;  3EPI A;  2PN1 A;  5FLX W;  2E2H A;  3GID A;  3RGX A;  4B3R H;  1JDB B;  2W6Q A;  3M4I A;  4JUZ A;  5KFX A;  4C5B A;  3KHH A;  1Z2N X;  2FE3 A;  4RAZ A;  5LL6 b;  2UXC H;  1Y1W A;  4YR0 A;  3T5H A;  3HB9 A;  2I87 A;  5L1K A;  3TQ1 A;  5H80 A;  2BQU A;  4I55 F;  2R8K A;  1AUX A;  4RB2 C;  2JA6 G;  4XX0 B;  2HVR A;  5JH7 F;  1WCM A;  4RB1 A;  3PZP A;  3PW0 A;  1I94 H;  4UCU A;  2RGR A;  2OH2 A;  4B3M H;  1GSO A;  1AUV A;  3MFH A;  3U9S A;  2NU8 B;  4LFB H;  4ZOL F;  5KFE A;  4ECT A;  5LOV F;  1JDE A;  1XNQ H;  1IBK H;  2SCU B;  5IYB G;  5JVD F;  4DR2 H;  4DL4 A;  1KJ9 A;  1TWA A;  4ED3 A;  3RFC A;  3ORR A;  3MWD A;  4A3K G;  3J80 W;  2ZDG A;  2Y0S E;  2XGQ A;  2C2E A;  2YL2 A;  4TQS A;  4KHP H;  1RJQ A;  4YBZ B;  2CW7 A;  4YR2 A;  5EZY F;  3FMA A;  4UCV A;  4QIW E;  5J2U F;  4DV2 H;  4QWD A;  2YW2 A;  1GGO A;  2W6O A;  3GLK A;  3PW2 A;  2AGO A;  1N36 H;  2VPS A;  3LWB A;  2J6U A;  2UUC H;  4JV2 A;  3N40 P;  4J9M A;  3H0G G;  4K0K H;  4ECX A;  2C28 A;  1VS0 A;  1S68 A;  2R8H A;  3PN1 A;  2W9C B;  3SI8 A;  3ETH A;  4Q8E A;  4ED1 A;  2JA5 G;  5KFY A;  4O3Q A;  2IMW P;  4I7H A;  4HNU A;  4JI3 H;  2V5A A;  3CVZ A;  2E2I A;  3I4M G;  1S10 A;  3L4K A;  1RYR A;  1WCM G;  2QK4 A;  3NGD A;  5KG3 A;  1KJQ A;  2R7M A;  5FD5 A;  2XC9 A;  2Q2U A;  4MA0 A;  5L9X A;  4MV3 A;  2JA7 A;  2JA6 A;  1E4G T;  4ECY A;  4ED8 A;  1V4Y A;  2FK2 A;  2VQE H;  3HOW G;  4L1K A;  3HKZ A;  3GIQ A;  5KT4 A;  1Y1W G;  3GTP A;  2VPQ A;  1VKZ A;  3HKZ E;  2FPG B;  3MWM A;  5BR8 H;  2NU7 B;  4UCO A;  3OTO H;  1S9F A;  4A2A A;  4M9U A;  5KFJ A;  5T14 A;  4RNM A;  4RB3 C;  4APM A;  3PW7 A;  3TQT A;  1CS0 A;  4RZQ A;  1TWG A;  1P8L A;  5KG2 A;  3BJY A;  2NU9 B;  4JI5 H;  2YYA A;  2PMZ E;  4XYM B;  5FLM G;  4DL7 A;  5JUM A;  2BR0 A;  3T1Y H;  3MR5 A;  1XNR H;  2VQF H;  1E4E B;  4LF8 H;  2R92 G;  1Y1V G;  4WBN F;  4ZHQ F;  4ED2 A;  5KG5 A;  1GO3 E;  2GPW A;  4MTD A;  5IYD G;  2AQ4 A;  3RAQ A;  4O4I F;  1HNX H;  5DGA A;  1Z2P X;  2UXD H;  4ECW A;  4BWS C;  2FPI B;  2UVU A;  2GLT A;  4RAY A;  3K5I A;  3M9M B;  4AQY H;  4FS2 A;  4LF6 H;  2JEF A;  1T94 A;  1B33 N;  1M0T A;  4DV5 H;  3DF7 A;  5IWA H;  2R7Z G;  5IP9 G;  3J81 W;  1E4E A;  2FK1 A;  3JZI A;  3PR4 A;  4HR7 A;  3IN5 A;  3V6H A;  3VPB A;  4EBE A;  5HV6 A;  3PW4 A;  1FJG H;  3M9N B;  3MJF A;  3Q8S B;  4J9N A;  5KT7 A;  4X64 H;  4J9L A;  1XMQ H;  1B04 A;  1ZHQ A;  1I7N A;  3HOV G;  1CQJ B;  4F4X A;  1A9X A;  1DV2 A;  4EEY A;  2HJW A;  2VR1 A;  4DL3 A;  3H4B A;  4LSA A;  4TQR A;  1SYX B;  2CKZ B;  3OHB A;  4EBD A;  2C35 B;  3BQ0 A;  2W9A A;  4JI4 H;  4J9S A;  1CQI B;  3RB3 A;  2WYO A;  3GII A;  4JI8 H;  2FPP B;  3H3V H;  4O2B F;  1O75 A;  3GTJ A;  2HGS A;  5DG9 A;  5KFM A;  4A3G G;  1T36 A;  5KFG A;  5EWG A;  3GIJ A;  4TV8 F;  3HOU G;  5A2Q W;  5D1O A;  4U7C A;  2C22 A;  2I8C A;  1M6V A;  2FMA A;  1Y1V A;  3KXY T;  2W9B A;  2YU9 A;  2R92 A;  3RB4 A;  1XMO H;  4FBU A;  3KHL A;  3FKI G;  5DQG A;  2F4V H;  5KFC A;  1JXL A;  5KFS A;  1V9P A;  1JKJ B;  1M7J A;  5I47 A;  2W7O A;  2YRW A;  3BA9 A;  1N32 H;  4Y8V B;  1SCU B;  4DR4 H;  2V4R A;  4A3J G;  2CQY A;  2RDI A;  2AGQ A;  4Q8F A;  4I4T F;  1L2Z A;  5C4X G;  3QZ8 A;  3KHR A;  4GC7 A;  4DV1 H;  3BAB A;  1I6U A;  3H20 A;  5IP7 G;  3R5H A;  4XZ3 B;  3OHA A;  4O4H F;  1RJR A;  5C1P A;  2UUB H;  3RIZ A;  2DIK A;  2V4Q A;  4MV1 A;  2C2R A;  3R23 A;  2Q2T A;  1HNW H;  5K2M A;  1KC7 A;  4R8U B;  3HBL A;  5KFF A;  1TWH A;  2R86 A;  3GIP A;  4LF7 H;  5FJ8 G;  2V58 A;  2GPS A;  2JA7 G;  5KT5 A;  3GV5 B;  3RV3 A;  4QWB A;  5DG7 A;  1K1Q A;  3MWE A;  2BQR A;  4QW9 A;  4IR9 A;  3UQ8 A;  4F50 A;  4DV3 H;  2R7K A;  4YJ3 F;  4AYB E;  1RYS A;  3MR2 A;  5CA1 F;  2W6M A;  3RB6 A;  2QYZ A;  1Y14 B;  1RK6 A;  5KT6 A;  1PX2 A;  4RNN A;  1C30 A;  3K5H A;  1KJI A;  4DR5 H;  4LF9 H;  4A3D G;  2R93 G;  4ETS A;  2ATL A;  2RF4 A;  2FK3 A;  2FB9 A;  4RUA A;  1JIH A;  2NVY A;  1M0W A;  4HYK A;  4A2B A;  5KT3 A;  2HVS A;  1X9N A;  4EGQ A;  4IAJ A;  2R7L A;  1C3O A;  2YRX A;  4BBR G;  4J9O A;  3H0G A;  5DLG A;  4O4L F;  2YZM A;  3GIM A;  4LSX A;  3F8N A;  5KFB A;  3G6Y A;  4M7E A;  3OSN A;  2X0S A;  4DR1 H;  3PO3 G;  1EHI A;  3V4S A;  4B3S H;  1XDN A;  2I80 A;  2B63 A;  5KX5 F;  1KBL A;  4JI7 H;  1KJ8 A;  4O3R A;  1VBH A;  5HBR B;  4DR6 H;  1GLV A;  4YR3 A;  1UC9 A;  2JEI A;  4O3P A;  2Y0S A;  3E5N A;  1A0I A;  4Q45 A;  1TAE A;  3N41 B;  3GQC A;  2ASJ A;  5EOY A;  1BGW A;  5KG4 A;  2W9B B;  3R5X A;  2R6F A;  3Q8R B;  1BXR A;  1EUD B;  3HXL A;  5KFP A;  2FLL A;  5DG8 A;  4J9R A;  1EUC B;  3N42 B;  4LF5 H;  1DGS A;  2B63 G;  3FDS A;  4MAM A;  2IP4 A;  4EBC A;  2R8J A;  2WDT A;  4ECV A;  4DL5 A;  4ME6 A;  2UU9 H;  2UXB H;  1BNC A;  1K1S A;  1SEI A;  3MFI A;  2WB1 A;  2ZJT A;  3T5L A;  1N48 A;  4FBT A;  1S0M A;  2C2D A;  2OWO A;  2DPJ A;  4QW8 A;  1B6S A;  2XCP A;  1TWC A;  3LML A;  5IYZ F;  3U9T A;  3RJ0 A;  3GIL A;  4O3S A;  2W6P A;  4G3I A;  2YCH A;  1JX4 A;  1TA8 A;  4ZI7 F;  5KFU A;  1DV1 A;  2YZN A;  3OUU A;  4A3F G;  1J5E H;  4CC5 A;  2FLN A;  2XCA A;  4IRK A;  4JV5 H;  5DQH A;  3L4J A;  1IOW A;  4E4T A;  4HNV A;  4IRC A;  5KFO A;  4DUZ H;  5KFD A;  3K3V A;  4BXX G;  3JSN A;  4ED0 A;  1RJP A;  5KFV A;  4YP3 A;  4A3M G;  5GON F;  4EG0 A;  2UVR A;  4F4Z A;  4BBS G;  1KJJ A;  3JRX A;  4DUY H;  4A3E G;  2VA2 A;  1MZB A;  3M9O B;  2W6Z A;  2ALZ A;  4NLG A;  2AU0 A;  4EYH B;  5EWF A;  4GLX A;  1EYZ A;  1ULZ A;  1ZHS A;  5D8D A;  4DR3 H;  4NXN H;  3GIK A;  2VA3 A;  3HOZ G;  1WSC A;  3HOY G;  5KFI A;  3HOX G;  5LYJ F;  2P0A A;  3KHG A;  2UUA H;  4MV8 A;  5IT9 W;  2HVQ A;  4I50 F;  4ZQI A;  1UC8 A;  4DV0 H;  3T5K A;  5EWE A;  2FKL A;  4MTE A;  5KFK A;  4ECS A;  3N43 B;  1I7L A;  2J9G A;  4ECR A;  1VBG A;  4QWE A;  4ED7 A;  4IWX A;  3FKI A;  4DV4 H;  5C8Y F;  4UCT A;  5CA0 F;  4ED6 A;  1AN7 A;  2CZG A;  1S97 A;  3RAX A;  2XCL A;  5KFN A;  4IR1 A;  3J7A K;  5D1O B;  3C0F B;  5KG6 A;  1WR2 A;  3V6J A;  1W93 A;  3Q2O A;  2YZG A;  4JI2 H;  3N6X A;  4FU0 A;  3VPD A;  1ZET A;  5BMV F;  2AGP A;  4AYB A;  4FS1 A;  2VUG A;  1BJT A;  4DV6 H;  2J6T A;  4A93 G;  4C5A A;  1R9T A;  3GTQ A;  5KG1 A;  3RUP A;  2W8K A;  4ECQ A;  3TII A;  2KSW A;  3V4Z A;  4A3I G;  4UCS A;  3PO2 G;  2ASL A;  4MV9 A;  5F9L A;  4YY3 H;  4O3O A;  1N56 A;  5C1O A;  3OSP A;  1ZQ7 A;  4UCR A;  3Q1K A;  2ZDH A;  2M05 A;  4LH6 A;  2YS6 A;  5KFT A;  3WO0 A;  3RV4 A;  1FKA H;  4A3C G;  1B6R A;  1GSA A;  3GV8 B;  4GKK H;  1CE8 A;  1K83 A;  1VAJ A;  2XIG A;  3BQ2 A;  3QFF A;  3WO1 A;  4YQW A;  2R8I A;  2HHH H;  1IBM H;  3N44 B;  5CAE B;  1WH2 A;  5C44 G;  4QIW A;  4JI0 H;  2V59 A;  3TIG A;  5LP6 F;  3RF2 A;  4JV1 A;  4Q0Y A;  5KG0 A;  4LF4 H;  4UFZ A;  1Z2O X;  4IWY A;  4LFA H;  2R82 A;  3EPG A;  4PDB A;  4Q44 A;  5KFA A;  3KAK A;  1T3N A;  5KG7 A;  2V9W A;  4BY1 G;  2W57 A;  3GTL A;  3N8D A;  3SE7 A;  1HR0 H;  4QWC A;  4J9Q A;  4R8U A;  2XGP A;  4C2M A;  5FPR A;  4B3T H;  5LMN H;  4RNO A;  1W96 A;  3T5J A;  4U6P A;  4XYL B;  2W71 A;  3PR5 B;  2DWC A;  5DQI A;  2R87 A;  5D1P A;  3JAM W;  4LFC H;  2W9C A;  3BQ1 A;  4DR7 H;  4RUC A;  4JYA H;  1SFO A;  3KAL A;  5KFL A;  2R85 A;  2WE6 A;  2ZDQ A;  2JEG A;  4YB8 B;  5FPO A;  1N34 H;  1IBL H;  2NU6 B;  4YHH H;  4X65 H;  2R93 A;  4EFB A;  5JVL A;  4DL6 A;  2UVV A;  5J2T F;  5IYC G;  4RZR A;  5DLF A;  4JI1 H;  4DV7 H;  4J9P A;  4EFE A;  4EGJ A;  5L1J A;  4LMY A;  2FLP A;  1PK8 A;  3Q8Q B;  2OLS A;  1FVI A;  4QWA A;  5L1L A;  2UVW A;  3GTM A;  3GTO A;  3GTG A;  2JA5 A;  2JEJ A;  2RDJ A;  4MV4 A;  4A3B G;  4ECZ A;  3KTM A;  3VMM A;  5EDW A;  3BG5 A;  4HQ6 A;  4JI6 H;  5DGB A;  3MR6 A;  3ETJ A;  2O03 A;  3MR3 A;  2IBK A;  2WAQ A;  2ZM6 H;  2PBZ A;  2WAQ E;  1OWT A;  3JSL A;  4EYI B;  2JA8 G;  2DLN A;  5LMU H;  3UFX B;  4JV0 A;  2WTF A;  1I50 A;  5C5J A;  3G6V A;  1S0N A;  4LH7 A;  1I3Q A;  5KFQ A;  4DL2 A;  2RGV A;  2VOB A;  4F4W A;  2J6S A;  2E5L H;  1EZ1 A;  3L2P A;  3BAA A;  4J9K A;  1S03 G; 
#chains in the Genus database with same CATH homology
 1L2Z A;  1GYF A;  1N36 H;  4DV1 H;  2VPS A;  3BAB A;  4DV4 H;  4UCT A;  1I6U A;  2UUC H;  1AN7 A;  3H20 A;  3N40 P;  4K0K H;  3J7A K;  5D1O B;  3C0F B;  2UUB H;  1VS0 A;  1S68 A;  3RIZ A;  3PN1 A;  2Q2T A;  2MCT A;  1HNW H;  4JI2 H;  3EYY A;  3N6X A;  4CC6 A;  4FM9 A;  4LF7 H;  3RTX A;  2VUG A;  1BJT A;  4I7H A;  4DV6 H;  1HNZ H;  4JI3 H;  3CVZ A;  4X62 H;  3L4K A;  3UQ8 A;  3IG0 A;  4DV3 H;  2KSW A;  2Q2U A;  4UCS A;  4R7R A;  5FD5 A;  4MV9 A;  4DR5 H;  4J0M A;  4X66 H;  4YY3 H;  4LF9 H;  1E4G T;  4MV7 A;  4ETS A;  2VQE H;  1M0W A;  4UCR A;  4A2B A;  2HVS A;  1X9N A;  4IAJ A;  4LH6 A;  4OX9 H;  3MWM A;  3BA8 A;  1FKA H;  5BR8 H;  1N33 H;  4GKK H;  3T1H H;  4UCO A;  3OTO H;  2XIG A;  4A2A A;  4LSX A;  2HHH H;  3F8N A;  4RB3 C;  4APM A;  3N44 B;  4M7E A;  5FD6 A;  4DR1 H;  1IBM H;  1WH2 A;  4RZQ A;  4B3S H;  1XDN A;  4JI0 H;  1E4F T;  4JI7 H;  1P8L A;  3RF2 A;  4DR6 H;  4Q0Y A;  4NXM H;  4LF4 H;  4UFZ A;  1Z2O X;  4EEQ A;  4JI5 H;  4LFA H;  4PDB A;  3KAK A;  3T1Y H;  1XNR H;  2W57 A;  1A0I A;  2VQF H;  1TAE A;  3N41 B;  5EOY A;  1BGW A;  1HR0 H;  4LF8 H;  3RGZ A;  5FPR A;  4B3T H;  5LMN H;  4MTD A;  1HNX H;  3HXL A;  4GKJ H;  3N42 B;  1Z2P X;  1DGS A;  3KAJ A;  4LF5 H;  2UXD H;  4BWS C;  2WDT A;  5D1P A;  4RB0 A;  3JAM W;  4LFC H;  4RAY A;  4AQY H;  2UU9 H;  4LF6 H;  2CW8 A;  4DR7 H;  1SEI A;  4JYA H;  2UXB H;  2ZJT A;  3KAL A;  1M0T A;  4DV5 H;  3DF7 A;  5IWA H;  5FLX W;  2OWO A;  2WE6 A;  3RGX A;  3J81 W;  4B3R H;  3M4I A;  3LML A;  3RJ0 A;  5FPO A;  1N34 H;  1IBL H;  1Z2N X;  2FE3 A;  4RAZ A;  5LL6 b;  1FJG H;  2UXC H;  2YCH A;  4YHH H;  4X65 H;  1TA8 A;  4X64 H;  1XMQ H;  1B04 A;  1ZHQ A;  4EFB A;  2E5L H;  4RB2 C;  1J5E H;  4CC5 A;  2HVR A;  4JI1 H;  4LSA A;  4DV7 H;  1SYX B;  4JV5 H;  4EFE A;  3L4J A;  4RB1 A;  4LMY A;  1I94 H;  1FVI A;  4UCU A;  4JI4 H;  4DUZ H;  2RGR A;  3K3V A;  3JSN A;  2WYO A;  4JI8 H;  4B3M H;  1O75 A;  2HGS A;  4LFB H;  4JI6 H;  5A2Q W;  1XNQ H;  1IBK H;  5D1O A;  2O03 A;  4DUY H;  4DR2 H;  1MZB A;  3KXY T;  2ZM6 H;  3J80 W;  1ZHS A;  3JSL A;  4GLX A;  1XMO H;  4DR3 H;  4NXN H;  5LMU H;  2F4V H;  4KHP H;  2CW7 A;  2UUA H;  1V9P A;  5IT9 W;  2HVQ A;  3FMA A;  4LH7 A;  2RGV A;  2VOB A;  3BA9 A;  4UCV A;  1N32 H;  4DV0 H;  4DR4 H;  4DV2 H;  4MTE A;  3L2P A;  3BAA A;  3N43 B;  1S03 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...