3CVZA

Structural insights into the molecular organization of the s-layer from clostridium difficile
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
248
structure length
248
Chain Sequence
TTGTQGYTVVKNDWKKAVKQLQDGLKDNSIGKITVSFNDGVVGEVAPKSANKKADRDAAAEKLYNLVNTQLDKLGDGDYVDFSVDYNLENKIITNQADAEAIVTKLNSLNEKTLIDIATKDTFGMVSKTQDSEGKNVAATKALKVKDVATFGLKSGGSEDTGYVVEMKAGAVEDKYGKVGDSTAGIAINLPSTGLEYAGKGTTIDFNKTLKVDVTGGSTPSAVAVSGFVTKDDTDLAKSGTINVRVIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the molecular organization of the S-layer from Clostridium difficile
pubmed doi rcsb
source organism Clostridium difficile
molecule tags Structural protein
molecule keywords S-layer protein
total genus 61
structure length 248
sequence length 248
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-04-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.290 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3cvzA01
3CVZA
chains in the Genus database with same CATH superfamily
2Y0SA 2VPSA 1WCMA 4LSXA 1ZETA 2R82A 2I80A 5KFHA 4RAZA 5JVDF 1RYSA 1IBKH 3GV5B 4HNVA 5IYDG 3J81W 1XMOH 2W6PA 5BPFA 4XZ3B 3RAXA 2V4RA 4UFZA 2GLTA 3RB3A 5EZYF 4DR2H 5JH7F 4EGQA 4A3MG 1RJRA 1B33N 2W9BA 3V6JA 1S10A 1DIKA 3M4IA 2DZDA 2ZJTA 2YW2A 2VUGA 4F50A 5DGAA 2ASDA 4DR7H 2R86A 3L2PA 2RGVA 1CE8A 1X9NA 1GYFA 4XYMB 4DR5H 4ZQIA 3MWDA 4GC6A 2QK4A 2FE3A 3LWBA 4JI5H 1UC9A 3RGZA 4MTEA 4G3IA 2W8LA 1R9TA 3F8NA 3CQZA 2FP4B 4EBCA 5DQGA 4A3LG 2CKZB 4UCUA 4KHPH 2F4VH 2JA6G 4JUZA 1XNQH 1TWCA 4DR6H 5LMUH 3J80W 4MV8A 1S03G 3Q2OA 2NU9B 3HBLA 4YQWA 3GTJA 4LF7H 3PR5B 2DWCA 3IG0A 1UNNC 4X62H 3GIJA 4EEQA 4DR4H 1S0MA 4JI3H 4FU0A 4R8UA 2W71A 2R93A 5KFNA 2XGPA 4DR1H 4IRKA 3N44B 2NUAB 5FLXW 2R8KA 4RB3C 3GLKA 2R87A 4ECTA 2DLNA 4ETSA 2AU0A 5L1JA 5KG4A 2YRXA 2JEFA 1B6RA 1J5EH 3V6KA 4BY7G 2JA5A 2ATLA 4JI0H 1TAEA 4DV3H 2J9GA 4EBEA 4I50F 5BPHA 4RB1A 3HOWG 2CQYA 5KFIA 4J9NA 4ED6A 4OX9H 4LF9H 2GPSA 3N6XA 4J9OA 3HOZG 4EBDA 3G6VA 1KJIA 5FPOA 4IR9A 2UUBH 4UCSA 5LMNH 1O75A 1T94A 2M05A 2NU6B 5C1OA 1CS0A 3M9MB 3KTMA 4ME6A 4M7EA 4I7HA 4EYIB 3BQ0A 4C5AA 1XMQH 4ECQA 3MFIA 2VQEH 5KFQA 4DL6A 4B3MH 3Q8SB 3I4MG 4MA5A 5C44G 3PZPA 3HOUG 2ASJA 3NGDA 4RU9A 1E4GT 2PBZA 5IYCG 2C28A 3Q8QB 2HVQA 2B63A 1EZ1A 3OUUA 1I3QA 2FK3A 3H4BA 3RBEA 1PX2A 4IRDA 2WAQE 3TIGA 5KG6A 1WSCA 4ZHQF 5BR8H 4YR0A 2OH2A 5KFZA 2W57A 3R23A 4JV1A 4APMA 4QWEA 2AGQA 5JUMA 4JV2A 2R7ZG 2Q2UA 4E4TA 1EHIA 2IP4A 4YB8B 4YBZB 1RK5A 2VPQA 3RV4A 4HR7A 4A93G 2WE6A 4HYKA 3PN1A 2R7MA 2W6QA 2W7PA 2E5LH 4GC7A 4QW8A 2HVSA 2JEJA 5KFAA 1EUCB 5T14A 1DV1A 4FS1A 5EOYA 2WB1A 3TQTA 4DV1H 2JA5G 3Q1KA 4RAYA 2YU9A 4EG0A 2VUMG 5KFTA 3SE7A 1KEEA 2NVYA 4DL7A 2OWOA 4DV4H 3ETJA 1HNWH 3BQ2A 4O3QA 1MZBA 5LP6F 5LL6b 3MR6A 3PW4A 4R7RA 3GTOA 4BWSC 5KFJA 4DR3H 4HNUA 2FLLA 4FBTA 2PN1A 1FKAH 4RNOA 4ED1A 4O4LF 3KHHA 4BBRG 5DLGA 1RJPA 2I87A 2W9CA 4ECRA 2IBKA 4LH6A 2W6ZA 3BABA 3KXYT 5KFDA 2YRWA 4QIWA 1JKJB 4TV9F 3V6HA 4YAJB 2W6NA 5BMVF 3JSNA 2VQFH 2FPGB 4MTDA 2UUAH 2AGOA 4LFCH 4PDBA 3GTPA 2C22A 1OWTA 3LMLA 3BA9A 4JI8H 3I12A 5KFGA 4Y8VB 3L4KA 5CA1F 3AYHB 1KC7A 3UQ8A 2E2HA 4Q44A 1TA8A 5KFVA 5FJ8G 1M7JA 3G6YA 1SYXB 4GKJH 1GSHA 5CA0F 2ZDGA 2WB1E 4YY3H 1AN7A 3WNZA 1JIHA 3KHGA 1N33H 4BBSG 5LXTF 3HOYG 5KT6A 2V9WA 1N36H 3H20A 5KFLA 4CC6A 5L9XA 3E5NA 2FLNA 1JLLB 5KFPA 4JI6H 4F4ZA 4A3IG 2FKLA 2R7LA 2XCLA 2UUCH 4MA0A 2VUMA 1WCMG 1ZHSA 4RB0A 5KT2A 2HJWA 1WR2A 4BY1G 4I4TF 5D1OA 2CW8A 2XD4A 5K2MA 1E4EB 2ZDQA 4TV8F 2BR0A 4C5CA 4YAKB 3KHRA 1I6UA 4ZI7F 3VMMA 2NU7B 2W6MA 1HR0H 4YR3A 3M9OB 3N43B 1N34H 2V58A 3GTQA 2J6SA 5DG7A 1VAJA 4RNMA 2FMAA 4TUYF 4F4XA 4A3CG 3GIPA 2FJZA 4QW9A 4LFBH 3PO3G 1GSOA 1Z2OX 4O3OA 4DV2H 2I8CA 3GIMA 2NVXA 3OSNA 1CQJB 3M9NB 4NXMH 5JQWA 1BGWA 2FK1A 4YHHH 3TQ1A 5GONF 4AQYH 2VQDA 4ED8A 1Y1WG 1CQIB 2YZNA 1B04A 4IAJA 4MV7A 5FLMG 2QYZA 3N40P 4DV5H 2R8IA 4ECSA 2C2DA 5HBRB 2RGRA 1A9XA 4F4WA 2RF4A 4ECXA 4O3SA 3T5HA 4A2BA 3T5KA 1KJ8A 5CAEB 3GIIA 1XNRH 3I4NG 5KT7A 2C00A 4LF6H 3GIDA 4DLKA 3TINA 1ZQ7A 1E4FT 3K5IA 3GIKA 1BXRA 3FKIG 3ORRA 4J0MA 4MAMA 4JV5H 4Q43A 2R92G 3H3VH 1VKZA 3H0GG 2V5AA 4DV6H 4ECUA 3BAAA 3H40A 5EWEA 1K83A 1FVIA 2IMWP 5KFMA 3RB4A 1RJQA 3VPCA 5IP9G 5C8YF 4RNNA 5KX5F 3RGXA 4IRCA 2B63G 1N32H 3FDSA 3IN5A 1M6VA 4J9SA 4DL3A 3GTMA 3K3VA 2C35B 4XX0B 2YS6A 1S0NA 3V4ZA 5EDWA 4L1KA 3RV3A 1JDBB 3JAMW 5F9NA 4QWAA 4Q8EA 4IZOA 4FS2A 1DV2A 2BQ3A 3BJYA 3N41B 5KFEA 1VBGA 2JA8G 2UVRA 5KFUA 2UVVA 3BQ1A 5DQHA 5KG7A 4A3KG 3HXLA 3GIQA 4DL2A 4B3SH 2HVRA 4WD3A 4LFAH 2UXBH 1Z2PX 5KG5A 4ECZA 1PK8A 3C0FB 2R6FA 2JEGA 3MWEA 3VPDA 2YL2A 1UC8A 1ZHQA 3RIZA 5DQIA 2XCAA 4J9LA 3RFCA 3KAKA 2W9CB 2CW7A 4MV6A 4QJFA 4R8UB 4RUCA 2Q2TA 4QWBA 2E2IA 3R5XA 2JA7A 5IT9W 1DGSA 5KKNB 2KSWA 1B6SA 3U9SA 5KT5A 4A3BG 1VS0A 1S68A 2UVUA 5LOVF 3RTXA 2UVWA 3V4SA 5L1IA 4U7CA 1IOWA 4QWDA 3KHLA 2YYAA 4TQSA 3N42B 3BA8A 3SI8A 4IWXA 4ED2A 5DGBA 5EWFA 1BNCA 5A2QW 2WAQA 3T5JA 3PO2G 1Z2NX 2WYOA 4X65H 4A3DG 4AYBE 1N48A 3OUZA 3HOXG 4HNTA 2JEIA 2UU9H 3H0GA 3PR4A 4IR1A 4AYBA 3FKIA 4LH7A 5KG0A 3KAJA 3GTLA 3FMAA 4J9RA 3EPGA 4PWQA 4J9KA 5J2TF 1Y1VA 4MV1A 4F4YA 1WH2A 5KFKA 1GSAA 5HV6A 1JDEA 1I7NA 2R85A 1KJJA 5KFBA 4C2MA 5KFFA 2R84A 2W9AA 4GKKH 3RBDA 3WO1A 2R7ZA 1C30A 4O2AF 5C1PA 2PVPA 4O3NA 2FK2A 4WBNF 2FPPB 4EFBA 4LSAA 4QWCA 4LF5H 1T36A 5FPRA 5IWAH 4J9PA 1AUVA 1JXLA 3HOVG 2J6TA 1BJTA 3HKZE 3RF2A 5KT3A 4O2BF 4TQRA 3LP8A 3U9TA 5DG9A 5I47A 3MWMA 2BQUA 1RYRA 3R5FA 2R8HA 1GGOA 4O3RA 3UFXB 1SEIA 4ECYA 1Y14B 1V4YA 2YS7A 5IP7G 2C2RA 1IBMH 4DL4A 3CVZA 2AGPA 4X64H 1SCUB 4ED0A 3PVXA 3G6XA 4ECWA 1I94H 2FLPA 2W70A 3K3PA 1ULZA 3QFFA 4DV0H 3RB6A 1FJGH 3MR2A 3L4JA 5KFXA 2VOBA 3PW7A 4LF4H 4UCVA 4FM9A 4A3FG 4B3RH 2UXDH 5KFOA 3JSLA 3PW2A 4C5BA 1T3NA 5C5JA 2P0AA 4B3TH 2WTFA 3N8DA 3EPIA 2SCUB 1IOVA 4DUZH 4XYLB 3H4DA 4DUYH 2DIKA 3PW0A 5D1PA 5IYZF 4JI1H 4A3JG 4RZQA 2ASLA 4BXXG 2O03A 2V4QA 3ETHA 2R8JA 1Y1WA 4K0KH 1I7LA 4YJ3F 1A0IA 2R7KA 3PW5A 4A3GG 1P8LA 1E4EA 4ZOLF 2X0SA 4CC5A 5KT4A 2R7NA 4HQ6A 4GLXA 4EGJA 3GV7B 4ED7A 4JV0A 3MFHA 2ZM6H 4YP3A 2J6UA 2XGQA 4NLGA 2VA2A 2JA7G 1S9FA 3QZ7A 4O4IF 1AUXA 4Q45A 1W93A 1I50A 2BQRA 5L1LA 1KJQA 1GO3E 2W6OA 2VA3A 3MJFA 3JRWA 4QIWE 4YJ2F 1M0TA 3RAQA 5LYJF 3K5HA 3DF7A 3ORQA 3GQCA 4MV9A 2VR1A 4EEYA 4O4HF 2FB9A 5FD5A 2IA6A 2PMZA 4ECVA 5IYBG 2JA6A 4Q8FA 3T5LA 2WDTA 1GLVA 2ZDHA 2C2EA 3QZ8A 4X66H 3OSPA 2PMZE 1TWFA 3VPBA 2XCPA 5L1KA 4EFEA 3GILA 4LMYA 1Y1VG 5KG1A 1C3OA 2YCHA 3HB9A 4UCRA 2W8KA 4EYHB 3T1YH 5KFRA 4J9MA 5KG2A 1S0OA 3GV8B 1SFOA 1M0WA 2Y0SE 4MV3A 3TIIA 4A3EG 1K1SA 2R92A 5EWGA 4RUAA 3Q8RB 4DV7H 3R5HA 5D8DA 3JRXA 3G8CA 3EYYA 3OTOH 4JI4H 1S97A 2XIGA 5FD6A 3GTKA 4UCOA 5DG8A 1V51A 4JI2H 1K1QA 4MV4A 4DL5A 2OLSA 4M9UA 4RB2C 2R8GA 3MR3A 5KFWA 2HGSA 2FPIB 4IHJF 3WO0A 2V59A 2DPIA 4LF8H 4JYAH 2CZGA 4JI7H 1L2ZA 2GPWA 3KALA 4U6PA 5DLFA 1KBLA 3J7AK 1IBLH 2XC9A 3MR5A 1V9PA 3OHBA 4J9QA 4O3PA 5H80A 3RUPA 4UCTA 5J2UF 3OHAA 1EUDB 1EYZA 3Q8PB 4Q0YA 2R93G 5CB4F 5JVLA 1RK6A 1N56A 4IWYA 1XDNA 1W96A 4RZRA 4I55F 2W9BB 2NU8B 1TWGA 3T1HH 2ALZA 1KJ9A 2RDIA 2YZMA 1JX4A 5KFYA 3RJ0A 5KFSA 2MCTA 3BG5A 4ED3A 5C3EG 1HNZH 1TWHA 4A2AA 3GTGA 3RB0A 5KG3A 1TWAA 5C4XG 1VBHA 2W7OA 4NXNH 2HHHH 4YR2A 4FBUA 5F9LA 2UXCH 3HKZA 5LA6F 2YZGA 3JZIA 5D1OB 2AQ4A 5KFCA 2DPJA 2RDJA 1HNXH
chains in the Genus database with same CATH topology
2VOBA 2VPSA 4LF4H 4UCVA 4FM9A 1XNRH 4LSXA 4LF6H 4B3RH 2UXDH 3JSLA 4RAZA 1E4FT 1IBKH 2WE6A 4J0MA 3J81W 4JV5H 1XMOH 3PN1A 4B3TH 4DV6H 2E5LH 3BAAA 2HVSA 4DUZH 1FVIA 4UFZA 5EOYA 4DV1H 4RAYA 4DUYH 4DR2H 5D1PA 2OWOA 4JI1H 3RGXA 4RZQA 4DV4H 1N32H 2O03A 1HNWH 3M4IA 1MZBA 5LL6b 4K0KH 3K3VA 4R7RA 2ZJTA 2VUGA 1A0IA 4BWSC 4DR7H 4DR3H 1P8LA 3L2PA 2RGVA 4CC5A 3JAMW 4GLXA 1X9NA 1GYFA 1FKAH 4DR5H 2ZM6H 3N41B 2FE3A 4JI5H 3RGZA 4MTEA 3HXLA 3F8NA 4LH6A 4B3SH 2HVRA 4LFAH 1M0TA 3BABA 3KXYT 2UXBH 1Z2PX 4UCUA 3C0FB 4KHPH 3DF7A 2F4VH 1XNQH 2Q2TA 1ZHQA 4MV9A 3RIZA 5LMUH 3J80W 4B3MH 1S03G 3KAKA 4DR6H 2CW7A 5IT9W 3JSNA 5FD5A 2VQFH 4MTDA 1DGSA 2UUAH 4LF7H 4LFCH 4PDBA 2KSWA 3IG0A 4X62H 3LMLA 2WDTA 3BA9A 1VS0A 4JI8H 1S68A 4EEQA 4DR4H 4X66H 4JI3H 3RTXA 3L4KA 3UQ8A 4DR1H 1TA8A 3N42B 3N44B 3BA8A 1SYXB 4EFEA 4GKJH 5FLXW 4RB3C 4LMYA 5A2QW 4ETSA 4UCRA 2YCHA 4YY3H 1Z2NX 3T1YH 1AN7A 2WYOA 4X65H 1N33H 1J5EH 2UU9H 1M0WA 4JI0H 1TAEA 1N36H 3H20A 4DV3H 4DV7H 4CC6A 4RB1A 4LH7A 4JI4H 3EYYA 3KAJA 3OTOH 4JI6H 2XIGA 3FMAA 5FD6A 4OX9H 4UCOA 2UUCH 4JI2H 4LF9H 3N6XA 1ZHSA 4RB0A 1WH2A 1FJGH 4RB2C 5D1OA 2CW8A 2HGSA 5FPOA 4GKKH 2UUBH 4UCSA 4JYAH 1I6UA 4LF8H 5LMNH 1L2ZA 1HR0H 1O75A 4JI7H 3KALA 3N43B 1N34H 3J7AK 1IBLH 4EFBA 4M7EA 4LSAA 4LF5H 1V9PA 5FPRA 4I7HA 5IWAH 4UCTA 1BJTA 3RF2A 4LFBH 1XMQH 2VQEH 4Q0YA 1Z2OX 4DV2H 1XDNA 3MWMA 3T1HH 1HNXH 3RJ0A 1SEIA 2MCTA 1E4GT 4NXMH 1BGWA 1IBMH 2HVQA 4YHHH 4AQYH 1HNZH 4A2AA 4IAJA 4MV7A 1B04A 3CVZA 3N40P 4X64H 4DV5H 4NXNH 5BR8H 2HHHH 2UXCH 1I94H 2RGRA 2W57A 5D1OB 4APMA 4DV0H 2Q2UA 4A2BA 3L4JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CVZ A; 
#chains in the Genus database with same CATH topology
 2Y0S A;  2VPS A;  1WCM A;  4LSX A;  1ZET A;  2R82 A;  2I80 A;  5KFH A;  4RAZ A;  5JVD F;  1RYS A;  1IBK H;  3GV5 B;  4HNV A;  5IYD G;  3J81 W;  1XMO H;  2W6P A;  5BPF A;  4XZ3 B;  3RAX A;  2V4R A;  4UFZ A;  2GLT A;  3RB3 A;  5EZY F;  4DR2 H;  5JH7 F;  4EGQ A;  4A3M G;  1RJR A;  1B33 N;  2W9B A;  3V6J A;  1S10 A;  1DIK A;  3M4I A;  2DZD A;  2ZJT A;  2YW2 A;  2VUG A;  4F50 A;  5DGA A;  2ASD A;  4DR7 H;  2R86 A;  3L2P A;  2RGV A;  1CE8 A;  1X9N A;  1GYF A;  4XYM B;  4DR5 H;  4ZQI A;  3MWD A;  4GC6 A;  2QK4 A;  2FE3 A;  3LWB A;  4JI5 H;  1UC9 A;  3RGZ A;  4MTE A;  4G3I A;  2W8L A;  1R9T A;  3F8N A;  3CQZ A;  2FP4 B;  4EBC A;  5DQG A;  4A3L G;  2CKZ B;  4UCU A;  4KHP H;  2F4V H;  2JA6 G;  4JUZ A;  1XNQ H;  1TWC A;  4DR6 H;  5LMU H;  3J80 W;  4MV8 A;  1S03 G;  3Q2O A;  2NU9 B;  3HBL A;  4YQW A;  3GTJ A;  4LF7 H;  3PR5 B;  2DWC A;  3IG0 A;  1UNN C;  4X62 H;  3GIJ A;  4EEQ A;  4DR4 H;  1S0M A;  4JI3 H;  4FU0 A;  4R8U A;  2W71 A;  2R93 A;  5KFN A;  2XGP A;  4DR1 H;  4IRK A;  3N44 B;  2NUA B;  5FLX W;  2R8K A;  4RB3 C;  3GLK A;  2R87 A;  4ECT A;  2DLN A;  4ETS A;  2AU0 A;  5L1J A;  5KG4 A;  2YRX A;  2JEF A;  1B6R A;  1J5E H;  3V6K A;  4BY7 G;  2JA5 A;  2ATL A;  4JI0 H;  1TAE A;  4DV3 H;  2J9G A;  4EBE A;  4I50 F;  5BPH A;  4RB1 A;  3HOW G;  2CQY A;  5KFI A;  4J9N A;  4ED6 A;  4OX9 H;  4LF9 H;  2GPS A;  3N6X A;  4J9O A;  3HOZ G;  4EBD A;  3G6V A;  1KJI A;  5FPO A;  4IR9 A;  2UUB H;  4UCS A;  5LMN H;  1O75 A;  1T94 A;  2M05 A;  2NU6 B;  5C1O A;  1CS0 A;  3M9M B;  3KTM A;  4ME6 A;  4M7E A;  4I7H A;  4EYI B;  3BQ0 A;  4C5A A;  1XMQ H;  4ECQ A;  3MFI A;  2VQE H;  5KFQ A;  4DL6 A;  4B3M H;  3Q8S B;  3I4M G;  4MA5 A;  5C44 G;  3PZP A;  3HOU G;  2ASJ A;  3NGD A;  4RU9 A;  1E4G T;  2PBZ A;  5IYC G;  2C28 A;  3Q8Q B;  2HVQ A;  2B63 A;  1EZ1 A;  3OUU A;  1I3Q A;  2FK3 A;  3H4B A;  3RBE A;  1PX2 A;  4IRD A;  2WAQ E;  3TIG A;  5KG6 A;  1WSC A;  4ZHQ F;  5BR8 H;  4YR0 A;  2OH2 A;  5KFZ A;  2W57 A;  3R23 A;  4JV1 A;  4APM A;  4QWE A;  2AGQ A;  5JUM A;  4JV2 A;  2R7Z G;  2Q2U A;  4E4T A;  1EHI A;  2IP4 A;  4YB8 B;  4YBZ B;  1RK5 A;  2VPQ A;  3RV4 A;  4HR7 A;  4A93 G;  2WE6 A;  4HYK A;  3PN1 A;  2R7M A;  2W6Q A;  2W7P A;  2E5L H;  4GC7 A;  4QW8 A;  2HVS A;  2JEJ A;  5KFA A;  1EUC B;  5T14 A;  1DV1 A;  4FS1 A;  5EOY A;  2WB1 A;  3TQT A;  4DV1 H;  2JA5 G;  3Q1K A;  4RAY A;  2YU9 A;  4EG0 A;  2VUM G;  5KFT A;  3SE7 A;  1KEE A;  2NVY A;  4DL7 A;  2OWO A;  4DV4 H;  3ETJ A;  1HNW H;  3BQ2 A;  4O3Q A;  1MZB A;  5LP6 F;  5LL6 b;  3MR6 A;  3PW4 A;  4R7R A;  3GTO A;  4BWS C;  5KFJ A;  4DR3 H;  4HNU A;  2FLL A;  4FBT A;  2PN1 A;  1FKA H;  4RNO A;  4ED1 A;  4O4L F;  3KHH A;  4BBR G;  5DLG A;  1RJP A;  2I87 A;  2W9C A;  4ECR A;  2IBK A;  4LH6 A;  2W6Z A;  3BAB A;  3KXY T;  5KFD A;  2YRW A;  4QIW A;  1JKJ B;  4TV9 F;  3V6H A;  4YAJ B;  2W6N A;  5BMV F;  3JSN A;  2VQF H;  2FPG B;  4MTD A;  2UUA H;  2AGO A;  4LFC H;  4PDB A;  3GTP A;  2C22 A;  1OWT A;  3LML A;  3BA9 A;  4JI8 H;  3I12 A;  5KFG A;  4Y8V B;  3L4K A;  5CA1 F;  3AYH B;  1KC7 A;  3UQ8 A;  2E2H A;  4Q44 A;  1TA8 A;  5KFV A;  5FJ8 G;  1M7J A;  3G6Y A;  1SYX B;  4GKJ H;  1GSH A;  5CA0 F;  2ZDG A;  2WB1 E;  4YY3 H;  1AN7 A;  3WNZ A;  1JIH A;  3KHG A;  1N33 H;  4BBS G;  5LXT F;  3HOY G;  5KT6 A;  2V9W A;  1N36 H;  3H20 A;  5KFL A;  4CC6 A;  5L9X A;  3E5N A;  2FLN A;  1JLL B;  5KFP A;  4JI6 H;  4F4Z A;  4A3I G;  2FKL A;  2R7L A;  2XCL A;  2UUC H;  4MA0 A;  2VUM A;  1WCM G;  1ZHS A;  4RB0 A;  5KT2 A;  2HJW A;  1WR2 A;  4BY1 G;  4I4T F;  5D1O A;  2CW8 A;  2XD4 A;  5K2M A;  1E4E B;  2ZDQ A;  4TV8 F;  2BR0 A;  4C5C A;  4YAK B;  3KHR A;  1I6U A;  4ZI7 F;  3VMM A;  2NU7 B;  2W6M A;  1HR0 H;  4YR3 A;  3M9O B;  3N43 B;  1N34 H;  2V58 A;  3GTQ A;  2J6S A;  5DG7 A;  1VAJ A;  4RNM A;  2FMA A;  4TUY F;  4F4X A;  4A3C G;  3GIP A;  2FJZ A;  4QW9 A;  4LFB H;  3PO3 G;  1GSO A;  1Z2O X;  4O3O A;  4DV2 H;  2I8C A;  3GIM A;  2NVX A;  3OSN A;  1CQJ B;  3M9N B;  4NXM H;  5JQW A;  1BGW A;  2FK1 A;  4YHH H;  3TQ1 A;  5GON F;  4AQY H;  2VQD A;  4ED8 A;  1Y1W G;  1CQI B;  2YZN A;  1B04 A;  4IAJ A;  4MV7 A;  5FLM G;  2QYZ A;  3N40 P;  4DV5 H;  2R8I A;  4ECS A;  2C2D A;  5HBR B;  2RGR A;  1A9X A;  4F4W A;  2RF4 A;  4ECX A;  4O3S A;  3T5H A;  4A2B A;  3T5K A;  1KJ8 A;  5CAE B;  3GII A;  1XNR H;  3I4N G;  5KT7 A;  2C00 A;  4LF6 H;  3GID A;  4DLK A;  3TIN A;  1ZQ7 A;  1E4F T;  3K5I A;  3GIK A;  1BXR A;  3FKI G;  3ORR A;  4J0M A;  4MAM A;  4JV5 H;  4Q43 A;  2R92 G;  3H3V H;  1VKZ A;  3H0G G;  2V5A A;  4DV6 H;  4ECU A;  3BAA A;  3H40 A;  5EWE A;  1K83 A;  1FVI A;  2IMW P;  5KFM A;  3RB4 A;  1RJQ A;  3VPC A;  5IP9 G;  5C8Y F;  4RNN A;  5KX5 F;  3RGX A;  4IRC A;  2B63 G;  1N32 H;  3FDS A;  3IN5 A;  1M6V A;  4J9S A;  4DL3 A;  3GTM A;  3K3V A;  2C35 B;  4XX0 B;  2YS6 A;  1S0N A;  3V4Z A;  5EDW A;  4L1K A;  3RV3 A;  1JDB B;  3JAM W;  5F9N A;  4QWA A;  4Q8E A;  4IZO A;  4FS2 A;  1DV2 A;  2BQ3 A;  3BJY A;  3N41 B;  5KFE A;  1VBG A;  2JA8 G;  2UVR A;  5KFU A;  2UVV A;  3BQ1 A;  5DQH A;  5KG7 A;  4A3K G;  3HXL A;  3GIQ A;  4DL2 A;  4B3S H;  2HVR A;  4WD3 A;  4LFA H;  2UXB H;  1Z2P X;  5KG5 A;  4ECZ A;  1PK8 A;  3C0F B;  2R6F A;  2JEG A;  3MWE A;  3VPD A;  2YL2 A;  1UC8 A;  1ZHQ A;  3RIZ A;  5DQI A;  2XCA A;  4J9L A;  3RFC A;  3KAK A;  2W9C B;  2CW7 A;  4MV6 A;  4QJF A;  4R8U B;  4RUC A;  2Q2T A;  4QWB A;  2E2I A;  3R5X A;  2JA7 A;  5IT9 W;  1DGS A;  5KKN B;  2KSW A;  1B6S A;  3U9S A;  5KT5 A;  4A3B G;  1VS0 A;  1S68 A;  2UVU A;  5LOV F;  3RTX A;  2UVW A;  3V4S A;  5L1I A;  4U7C A;  1IOW A;  4QWD A;  3KHL A;  2YYA A;  4TQS A;  3N42 B;  3BA8 A;  3SI8 A;  4IWX A;  4ED2 A;  5DGB A;  5EWF A;  1BNC A;  5A2Q W;  2WAQ A;  3T5J A;  3PO2 G;  1Z2N X;  2WYO A;  4X65 H;  4A3D G;  4AYB E;  1N48 A;  3OUZ A;  3HOX G;  4HNT A;  2JEI A;  2UU9 H;  3H0G A;  3PR4 A;  4IR1 A;  4AYB A;  3FKI A;  4LH7 A;  5KG0 A;  3KAJ A;  3GTL A;  3FMA A;  4J9R A;  3EPG A;  4PWQ A;  4J9K A;  5J2T F;  1Y1V A;  4MV1 A;  4F4Y A;  1WH2 A;  5KFK A;  1GSA A;  5HV6 A;  1JDE A;  1I7N A;  2R85 A;  1KJJ A;  5KFB A;  4C2M A;  5KFF A;  2R84 A;  2W9A A;  4GKK H;  3RBD A;  3WO1 A;  2R7Z A;  1C30 A;  4O2A F;  5C1P A;  2PVP A;  4O3N A;  2FK2 A;  4WBN F;  2FPP B;  4EFB A;  4LSA A;  4QWC A;  4LF5 H;  1T36 A;  5FPR A;  5IWA H;  4J9P A;  1AUV A;  1JXL A;  3HOV G;  2J6T A;  1BJT A;  3HKZ E;  3RF2 A;  5KT3 A;  4O2B F;  4TQR A;  3LP8 A;  3U9T A;  5DG9 A;  5I47 A;  3MWM A;  2BQU A;  1RYR A;  3R5F A;  2R8H A;  1GGO A;  4O3R A;  3UFX B;  1SEI A;  4ECY A;  1Y14 B;  1V4Y A;  2YS7 A;  5IP7 G;  2C2R A;  1IBM H;  4DL4 A;  3CVZ A;  2AGP A;  4X64 H;  1SCU B;  4ED0 A;  3PVX A;  3G6X A;  4ECW A;  1I94 H;  2FLP A;  2W70 A;  3K3P A;  1ULZ A;  3QFF A;  4DV0 H;  3RB6 A;  1FJG H;  3MR2 A;  3L4J A;  5KFX A;  2VOB A;  3PW7 A;  4LF4 H;  4UCV A;  4FM9 A;  4A3F G;  4B3R H;  2UXD H;  5KFO A;  3JSL A;  3PW2 A;  4C5B A;  1T3N A;  5C5J A;  2P0A A;  4B3T H;  2WTF A;  3N8D A;  3EPI A;  2SCU B;  1IOV A;  4DUZ H;  4XYL B;  3H4D A;  4DUY H;  2DIK A;  3PW0 A;  5D1P A;  5IYZ F;  4JI1 H;  4A3J G;  4RZQ A;  2ASL A;  4BXX G;  2O03 A;  2V4Q A;  3ETH A;  2R8J A;  1Y1W A;  4K0K H;  1I7L A;  4YJ3 F;  1A0I A;  2R7K A;  3PW5 A;  4A3G G;  1P8L A;  1E4E A;  4ZOL F;  2X0S A;  4CC5 A;  5KT4 A;  2R7N A;  4HQ6 A;  4GLX A;  4EGJ A;  3GV7 B;  4ED7 A;  4JV0 A;  3MFH A;  2ZM6 H;  4YP3 A;  2J6U A;  2XGQ A;  4NLG A;  2VA2 A;  2JA7 G;  1S9F A;  3QZ7 A;  4O4I F;  1AUX A;  4Q45 A;  1W93 A;  1I50 A;  2BQR A;  5L1L A;  1KJQ A;  1GO3 E;  2W6O A;  2VA3 A;  3MJF A;  3JRW A;  4QIW E;  4YJ2 F;  1M0T A;  3RAQ A;  5LYJ F;  3K5H A;  3DF7 A;  3ORQ A;  3GQC A;  4MV9 A;  2VR1 A;  4EEY A;  4O4H F;  2FB9 A;  5FD5 A;  2IA6 A;  2PMZ A;  4ECV A;  5IYB G;  2JA6 A;  4Q8F A;  3T5L A;  2WDT A;  1GLV A;  2ZDH A;  2C2E A;  3QZ8 A;  4X66 H;  3OSP A;  2PMZ E;  1TWF A;  3VPB A;  2XCP A;  5L1K A;  4EFE A;  3GIL A;  4LMY A;  1Y1V G;  5KG1 A;  1C3O A;  2YCH A;  3HB9 A;  4UCR A;  2W8K A;  4EYH B;  3T1Y H;  5KFR A;  4J9M A;  5KG2 A;  1S0O A;  3GV8 B;  1SFO A;  1M0W A;  2Y0S E;  4MV3 A;  3TII A;  4A3E G;  1K1S A;  2R92 A;  5EWG A;  4RUA A;  3Q8R B;  4DV7 H;  3R5H A;  5D8D A;  3JRX A;  3G8C A;  3EYY A;  3OTO H;  4JI4 H;  1S97 A;  2XIG A;  5FD6 A;  3GTK A;  4UCO A;  5DG8 A;  1V51 A;  4JI2 H;  1K1Q A;  4MV4 A;  4DL5 A;  2OLS A;  4M9U A;  4RB2 C;  2R8G A;  3MR3 A;  5KFW A;  2HGS A;  2FPI B;  4IHJ F;  3WO0 A;  2V59 A;  2DPI A;  4LF8 H;  4JYA H;  2CZG A;  4JI7 H;  1L2Z A;  2GPW A;  3KAL A;  4U6P A;  5DLF A;  1KBL A;  3J7A K;  1IBL H;  2XC9 A;  3MR5 A;  1V9P A;  3OHB A;  4J9Q A;  4O3P A;  5H80 A;  3RUP A;  4UCT A;  5J2U F;  3OHA A;  1EUD B;  1EYZ A;  3Q8P B;  4Q0Y A;  2R93 G;  5CB4 F;  5JVL A;  1RK6 A;  1N56 A;  4IWY A;  1XDN A;  1W96 A;  4RZR A;  4I55 F;  2W9B B;  2NU8 B;  1TWG A;  3T1H H;  2ALZ A;  1KJ9 A;  2RDI A;  2YZM A;  1JX4 A;  5KFY A;  3RJ0 A;  5KFS A;  2MCT A;  3BG5 A;  4ED3 A;  5C3E G;  1HNZ H;  1TWH A;  4A2A A;  3GTG A;  3RB0 A;  5KG3 A;  1TWA A;  5C4X G;  1VBH A;  2W7O A;  4NXN H;  2HHH H;  4YR2 A;  4FBU A;  5F9L A;  2UXC H;  3HKZ A;  5LA6 F;  2YZG A;  3JZI A;  5D1O B;  2AQ4 A;  5KFC A;  2DPJ A;  2RDJ A;  1HNX H; 
#chains in the Genus database with same CATH homology
 2VOB A;  2VPS A;  4LF4 H;  4UCV A;  4FM9 A;  1XNR H;  4LSX A;  4LF6 H;  4B3R H;  2UXD H;  3JSL A;  4RAZ A;  1E4F T;  1IBK H;  2WE6 A;  4J0M A;  3J81 W;  4JV5 H;  1XMO H;  3PN1 A;  4B3T H;  4DV6 H;  2E5L H;  3BAA A;  2HVS A;  4DUZ H;  1FVI A;  4UFZ A;  5EOY A;  4DV1 H;  4RAY A;  4DUY H;  4DR2 H;  5D1P A;  2OWO A;  4JI1 H;  3RGX A;  4RZQ A;  4DV4 H;  1N32 H;  2O03 A;  1HNW H;  3M4I A;  1MZB A;  5LL6 b;  4K0K H;  3K3V A;  4R7R A;  2ZJT A;  2VUG A;  1A0I A;  4BWS C;  4DR7 H;  4DR3 H;  1P8L A;  3L2P A;  2RGV A;  4CC5 A;  3JAM W;  4GLX A;  1X9N A;  1GYF A;  1FKA H;  4DR5 H;  2ZM6 H;  3N41 B;  2FE3 A;  4JI5 H;  3RGZ A;  4MTE A;  3HXL A;  3F8N A;  4LH6 A;  4B3S H;  2HVR A;  4LFA H;  1M0T A;  3BAB A;  3KXY T;  2UXB H;  1Z2P X;  4UCU A;  3C0F B;  4KHP H;  3DF7 A;  2F4V H;  1XNQ H;  2Q2T A;  1ZHQ A;  4MV9 A;  3RIZ A;  5LMU H;  3J80 W;  4B3M H;  1S03 G;  3KAK A;  4DR6 H;  2CW7 A;  5IT9 W;  3JSN A;  5FD5 A;  2VQF H;  4MTD A;  1DGS A;  2UUA H;  4LF7 H;  4LFC H;  4PDB A;  2KSW A;  3IG0 A;  4X62 H;  3LML A;  2WDT A;  3BA9 A;  1VS0 A;  4JI8 H;  1S68 A;  4EEQ A;  4DR4 H;  4X66 H;  4JI3 H;  3RTX A;  3L4K A;  3UQ8 A;  4DR1 H;  1TA8 A;  3N42 B;  3N44 B;  3BA8 A;  1SYX B;  4EFE A;  4GKJ H;  5FLX W;  4RB3 C;  4LMY A;  5A2Q W;  4ETS A;  4UCR A;  2YCH A;  4YY3 H;  1Z2N X;  3T1Y H;  1AN7 A;  2WYO A;  4X65 H;  1N33 H;  1J5E H;  2UU9 H;  1M0W A;  4JI0 H;  1TAE A;  1N36 H;  3H20 A;  4DV3 H;  4DV7 H;  4CC6 A;  4RB1 A;  4LH7 A;  4JI4 H;  3EYY A;  3KAJ A;  3OTO H;  4JI6 H;  2XIG A;  3FMA A;  5FD6 A;  4OX9 H;  4UCO A;  2UUC H;  4JI2 H;  4LF9 H;  3N6X A;  1ZHS A;  4RB0 A;  1WH2 A;  1FJG H;  4RB2 C;  5D1O A;  2CW8 A;  2HGS A;  5FPO A;  4GKK H;  2UUB H;  4UCS A;  4JYA H;  1I6U A;  4LF8 H;  5LMN H;  1L2Z A;  1HR0 H;  1O75 A;  4JI7 H;  3KAL A;  3N43 B;  1N34 H;  3J7A K;  1IBL H;  4EFB A;  4M7E A;  4LSA A;  4LF5 H;  1V9P A;  5FPR A;  4I7H A;  5IWA H;  4UCT A;  1BJT A;  3RF2 A;  4LFB H;  1XMQ H;  2VQE H;  4Q0Y A;  1Z2O X;  4DV2 H;  1XDN A;  3MWM A;  3T1H H;  1HNX H;  3RJ0 A;  1SEI A;  2MCT A;  1E4G T;  4NXM H;  1BGW A;  1IBM H;  2HVQ A;  4YHH H;  4AQY H;  1HNZ H;  4A2A A;  4IAJ A;  4MV7 A;  1B04 A;  3CVZ A;  3N40 P;  4X64 H;  4DV5 H;  4NXN H;  5BR8 H;  2HHH H;  2UXC H;  1I94 H;  2RGR A;  2W57 A;  5D1O B;  4APM A;  4DV0 H;  2Q2U A;  4A2B A;  3L4J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...