3CVZA

Structural insights into the molecular organization of the s-layer from clostridium difficile
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
248
structure length
248
Chain Sequence
b'TTGTQGYTVVKNDWKKAVKQLQDGLKDNSIGKITVSFNDGVVGEVAPKSANKKADRDAAAEKLYNLVNTQLDKLGDGDYVDFSVDYNLENKIITNQADAEAIVTKLNSLNEKTLIDIATKDTFGMVSKTQDSEGKNVAATKALKVKDVATFGLKSGGSEDTGYVVEMKAGAVEDKYGKVGDSTAGIAINLPSTGLEYAGKGTTIDFNKTLKVDVTGGSTPSAVAVSGFVTKDDTDLAKSGTINVRVIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-layer protein
publication title Structural insights into the molecular organization of the S-layer from Clostridium difficile
pubmed doi rcsb
source organism Clostridium difficile
molecule tags Structural protein
total genus 61
structure length 248
sequence length 248
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-04-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.290 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3cvzA01
3CVZA
chains in the Genus database with same CATH superfamily
3N8DA 2YZMA 1E4FT 2ALZA 4J9KA 2R87A 4IAJA 3JAMW 5KFOA 4X64H 3PR5B 3JRWA 3M9OB 2VA2A 4KHPH 4ECQA 4TV8F 5C4XG 1HNZH 5EWEA 4JI1H 2JEJA 1KJIA 2JA5A 2R7NA 2ATLA 5KFNA 3G6XA 4A93G 2IA6A 4QW9A 1XMOH 2JA5G 1TWGA 2CW7A 2W6MA 4LFBH 5CA0F 1K83A 5BMVF 2UUBH 2J6UA 5KG6A 1AUXA 1TWFA 2GLTA 1S0NA 2PVPA 2QK4A 2R8IA 3HOUG 4DR2H 5DGBA 2I80A 4HYKA 2UXBH 3RGXA 3AYHB 4QIWA 4I4TF 3HOYG 2Y0SA 4MV9A 2NU9B 5KT5A 4C5AA 3KAJA 3JSLA 2W6QA 4RZQA 1N34H 2WTFA 5KT4A 4DR7H 5KFIA 4J9LA 2MCTA 3N40P 3GV7B 2W6OA 5GONF 2R82A 5D1OB 5EWGA 1S03G 2R7ZA 5KFCA 4U7CA 1GSAA 2XGQA 3MR2A 3TIIA 3CVZA 3M9NB 2UVRA 1I7NA 2R7ZG 4XX0B 1EYZA 5KG5A 1GGOA 4FM9A 2JA8G 2W9CB 4LF9H 1IOVA 5LXTF 4DR4H 4TV9F 2Q2UA 5KFAA 2RDJA 3RV3A 2JEGA 1L2ZA 3TIGA 2ASDA 2NU7B 2FK2A 4F50A 5JQWA 3T1HH 4EBDA 5EZYF 2FPIB 4JV1A 4JI8H 3PO2G 4RNOA 4YP3A 1DIKA 3HOZG 2YU9A 5LP6F 3KHHA 4EBCA 2FKLA 1X9NA 4C5CA 1HNXH 2R86A 4WBNF 5EWFA 4DV1H 2NVYA 4UCRA 3GTJA 2BQRA 4JI4H 4F4YA 4MV3A 4LF8H 3CQZA 5DQGA 1GO3E 1T94A 3R5FA 4RB1A 3JSNA 4GLXA 4QWAA 2UVWA 3GV5B 1VAJA 4A2BA 3PW0A 4R8UA 4DV3H 2ZM6H 1IOWA 3LWBA 5DLFA 2NU8B 1I6UA 4O3QA 4J9SA 1S0MA 2P0AA 4EBEA 1WCMA 4UCUA 1DV1A 1M7JA 4XYLB 2PMZE 3FMAA 3RIZA 3Q8QB 2IBKA 3K3VA 2JA6A 1WCMG 1TA8A 5DLGA 2AQ4A 2FPPB 5CAEB 4YAKB 4RNMA 1S0OA 2WE6A 3J7AK 2JA6G 3PW2A 4O2AF 4BY1G 2ZDQA 5T14A 2OLSA 3GTKA 1RJQA 4U6PA 1JDEA 2ZDHA 4F4WA 5KFUA 1ZHQA 2C2RA 4UCOA 2I87A 4ED7A 4AYBE 1PX2A 4RNNA 2UVUA 4NXMH 3N41B 2VUGA 1Y1VA 5KX5F 5KG2A 3R5HA 2RDIA 5KFGA 3BA8A 1ZQ7A 3F8NA 5KFHA 5DG8A 1Y1VG 4ECWA 2UVVA 4FS1A 1UNNC 3MFHA 4LF5H 4ECSA 3RF2A 3RTXA 3QZ7A 4A2AA 2E2IA 3HB9A 1RJPA 3ORQA 1XNRH 5IWAH 4ED3A 3GTPA 2B63A 4A3CG 4J9OA 1JDBB 4HQ6A 5HBRB 2KSWA 4QWCA 1J5EH 4BBRG 4B3MH 4MTEA 3NGDA 2AU0A 2WDTA 2B63G 5KFQA 1HNWH 2XGPA 4DV6H 5K2MA 3OUZA 4Q0YA 1CE8A 4OX9H 2W9BA 4IRDA 1P8LA 3UQ8A 3GIIA 3I4MG 5L1LA 1PK8A 4PDBA 1B04A 4C2MA 2VUMA 4FBUA 5KT3A 3T5JA 2DWCA 4A3MG 1Z2PX 4J9QA 2CKZB 2YZGA 1S10A 5EOYA 2UXCH 2VUMG 2W57A 4I50F 3PR4A 5BPHA 1I3QA 4ZI7F 1Z2NX 5DGAA 5C8YF 4X65H 3J80W 1JKJB 4MV7A 5KFSA 3MR3A 3QZ8A 1GLVA 4EGJA 2R93G 4QJFA 3L4KA 2YRXA 4JI7H 1KJJA 2YS7A 4MV8A 4DLKA 4PWQA 3RGZA 2XC9A 2F4VH 4A3JG 2JEIA 5KFJA 5D8DA 5KFXA 5KT7A 4YJ3F 1T36A 2W7PA 4DL5A 1E4GT 3JZIA 4DL7A 4L1KA 4EYHB 2R8KA 2W8LA 3BJYA 2J6SA 2W8KA 4AQYH 2R8GA 4HR7A 1S97A 4A3BG 4EYIB 4HNVA 4RB0A 3GTGA 4QWEA 5DQIA 3RB0A 5FLMG 5KT2A 4X66H 5F9NA 3Q1KA 3PN1A 4QIWE 2W71A 1SFOA 2R7LA 2FLNA 3V4ZA 2W70A 3TQTA 2JEFA 1CQJB 2Q2TA 5LMUH 2Y0SE 1TWCA 2NU6B 4A3IG 2J6TA 4XZ3B 3KHGA 4GKKH 4O3PA 3L4JA 4J0MA 2R7MA 1BJTA 5JVDF 1I94H 4GC6A 4IZOA 3KALA 1R9TA 4EFBA 1RK5A 2YL2A 2YRWA 3MR6A 1TWAA 4YB8B 5HV6A 3IN5A 4MAMA 5CB4F 4DV7H 3HKZA 2VR1A 3LMLA 4EGQA 5C44G 2FLLA 3GTLA 2AGQA 5JUMA 4TUYF 4JI6H 5KFZA 4ME6A 2FE3A 4I55F 4ED0A 1WR2A 3N43B 3QFFA 5KG7A 2HVQA 4QWDA 4DR1H 2DPIA 4CC6A 4F4XA 2ASLA 4EEQA 5KKNB 5DQHA 4A3FG 4DR5H 2FK3A 5FLXW 4FU0A 4Q44A 2PN1A 3RV4A 3KHRA 2CQYA 2V5AA 2SCUB 5FPRA 1RYRA 4ECXA 4B3SH 5IP7G 5EDWA 2W6NA 1UC8A 1GSHA 4BY7G 3VPDA 1Y1WA 3KTMA 3VPBA 3BA9A 3H40A 2XCPA 3H4DA 4ECTA 2FPGB 2R6FA 4UFZA 3T5LA 4APMA 1AUVA 1Y1WG 4Y8VB 3OUUA 1V9PA 4QW8A 5BR8H 4ECYA 4DR6H 5CA1F 4O4IF 3FKIA 1TWHA 3EPIA 1UC9A 4DUZH 3E5NA 3DF7A 4J9NA 3VPCA 1B6SA 1EHIA 4MV6A 3LP8A 4DV4H 3FKIG 4B3TH 3V6KA 3PO3G 5BPFA 1B6RA 5H80A 2OWOA 1CQIB 4O3OA 1BNCA 3UFXB 2RGVA 3OTOH 2JA7A 3PZPA 3Q8PB 3RUPA 3Q2OA 2JA7G 3TQ1A 3PVXA 2DLNA 4ZQIA 4HNUA 5IYDG 2WB1E 4YAJB 3G6VA 2HVRA 4BBSG 2PBZA 1N36H 5L1KA 3GTQA 4MTDA 4XYMB 3OHBA 2ASJA 4NLGA 3SE7A 4RB3C 2YS6A 2YYAA 4A3DG 1HR0H 2WAQE 4RUAA 3RJ0A 5KFKA 1VBGA 4ECVA 1RK6A 1N56A 3V4SA 2RF4A 2XIGA 1KC7A 2V9WA 2FB9A 2VQEH 4F4ZA 1XDNA 4AYBA 5C5JA 4MA5A 4MA0A 3PW7A 3I12A 2AGOA 4IR1A 3GIMA 3HOWG 3RFCA 2YCHA 3HBLA 1W96A 4LMYA 2C00A 3K5HA 3ETHA 1GSOA 2R92A 5IP9G 3OHAA 4UCVA 1RJRA 2R92G 4HNTA 1FKAH 4O4HF 4IHJF 3M9MB 1EUDB 5LA6F 1IBLH 2V58A 1TAEA 2UUCH 3MWDA 4YHHH 3GIQA 2HJWA 5KFEA 3MFIA 4Q45A 3BAAA 2YZNA 2HGSA 5KFWA 4FS2A 4DL4A 4R7RA 2W6ZA 2VPSA 5LL6b 1I50A 4FBTA 3RB3A 3GTMA 4ECZA 4DL6A 3H0GA 3G6YA 2R93A 2VQFH 4R8UB 2R85A 1Z2OX 1S9FA 3H20A 1SYXB 3H0GG 4YR0A 4TQSA 2C2EA 4WD3A 1KJ8A 4O3RA 3HOXG 1VBHA 2ZDGA 1CS0A 4TQRA 3BQ1A 4JI5H 2NVXA 5KFLA 2QYZA 4LSXA 4JUZA 3WO0A 1M6VA 4RUCA 2W6PA 2HHHH 3K5IA 4O4LF 4ZHQF 3ORRA 1JX4A 2FK1A 3R5XA 4YQWA 3VMMA 3MWMA 2NUAB 5KFTA 1C30A 2C35B 1MZBA 2DZDA 2CW8A 1JIHA 1AN7A 3U9SA 5C1PA 5KG1A 4EG0A 3R23A 5L1JA 2VQDA 1FJGH 1XNQH 4ED2A 1OWTA 1VS0A 4LSAA 1KJQA 4IWYA 2C2DA 1K1QA 3BG5A 4UCTA 5KFRA 4CC5A 2FMAA 3WO1A 4DV5H 3OSNA 2V4RA 1ULZA 5JH7F 5I47A 1A0IA 2E5LH 3I4NG 2DPJA 2YW2A 4J9MA 3RAXA 3RAQA 4JV2A 2IMWP 2R84A 4NXNH 4BXXG 1SEIA 3GTOA 1O75A 4ED6A 3TINA 2GPSA 2VA3A 1RYSA 1N32H 4BWSC 4I7HA 2ZJTA 4GKJH 5LOVF 5FD6A 1EZ1A 4IRKA 4O2BF 5IYCG 4J9RA 1IBMH 4M7EA 5F9LA 2FP4B 3N44B 4RB2C 3GIPA 3GIJA 1S68A 3HKZE 1WSCA 3N42B 3MR5A 4LH7A 5IYBG 4B3RH 1BGWA 2W9BB 2XD4A 4ECRA 4ETSA 4RAZA 3SI8A 1DV2A 2O03A 5LYJF 1E4EA 2FLPA 1KJ9A 2J9GA 3J81W 5KG3A 3ETJA 1A9XA 3RB6A 1ZHSA 1I7LA 1M0WA 5L9XA 3Q8SB 1C3OA 4C5BA 2VPQA 3EYYA 2R8JA 1FVIA 1W93A 4A3KG 3PW5A 4A3GG 2BQUA 1SCUB 1N48A 3H4BA 3BQ2A 4E4TA 5KFVA 4YY3H 4YJ2F 3C0FB 4DV2H 2BR0A 4EFEA 5J2TF 3GV8B 4O3SA 3GIKA 1BXRA 2FJZA 2R7KA 5IYZF 4ED1A 1V51A 3PW4A 4YR2A 3RBDA 4Q8EA 2RGRA 4K0KH 3K3PA 4YR3A 5J2UF 5KG0A 5KG4A 1GYFA 1WH2A 3FDSA 3V6JA 4IWXA 4UCSA 4RZRA 3T1YH 2DIKA 2M05A 3RB4A 4DR3H 1T3NA 2BQ3A 4JV0A 5KFBA 5LMNH 2WYOA 1ZETA 5KFMA 3L2PA 2C28A 4JI3H 2PMZA 3KHLA 2XCLA 1N33H 2GPWA 1K1SA 2X0SA 2V59A 4MV1A 3KXYT 5A2QW 2R8HA 4J9PA 4EEYA 5DG7A 2C22A 3MJFA 3JRXA 4O3NA 4GC7A 3T5HA 1XMQH 1M0TA 1VKZA 4LF4H 4Q43A 3HOVG 3BQ0A 2W7OA 2UUAH 5KFDA 3IG0A 2WB1A 3GILA 4DV0H 1Y14B 3M4IA 5L1IA 5IT9W 5C1OA 1JXLA 4JI0H 3GLKA 3V6HA 4MV4A 4YBZB 5D1PA 4QWBA 4JYAH 1EUCB 3H3VH 3GIDA 4M9UA 2WAQA 4RAYA 5KFYA 2E2HA 1IBKH 3N6XA 4A3EG 3EPGA 3BABA 2UU9H 3GQCA 2CZGA 2IP4A 4LH6A 5D1OA 5FPOA 2VOBA 3G8CA 2HVSA 4DL3A 3U9TA 4DUYH 4IRCA 4JI2H 5KFFA 1E4EB 4IR9A 3T5KA 2UXDH 1DGSA 3MWEA 3KAKA 4ECUA 5C3EG 4LFCH 3HXLA 4LF6H 4LFAH 2I8CA 5FD5A 4G3IA 4ED8A 1B33N 2W9CA 3Q8RB 4JV5H 3WNZA 1KEEA 4ZOLF 2W9AA 2V4QA 2OH2A 2XCAA 5KT6A 4LF7H 3RBEA 2AGPA 1KBLA 4A3LG 5FJ8G 1V4YA 1JLLB 4X62H 5KFPA 4RU9A 4DL2A 5JVLA 5DG9A 4Q8FA 3OSPA
chains in the Genus database with same CATH topology
4BWSC 3BA8A 3BA9A 3F8NA 1E4FT 4I7HA 4UFZA 4APMA 2ZJTA 4IAJA 3JAMW 4X64H 4KHPH 4GKJH 5FD6A 1V9PA 5BR8H 1HNZH 4DR6H 4LF5H 4JI1H 3RF2A 3RTXA 1IBMH 4M7EA 4A2AA 3N44B 4RB2C 4DUZH 3DF7A 1XNRH 1S68A 5IWAH 3N42B 4DV4H 4LH7A 1XMOH 4B3TH 4B3RH 1BGWA 2CW7A 4LFBH 4ETSA 4RAZA 2OWOA 2KSWA 1J5EH 4B3MH 2O03A 3OTOH 2RGVA 4MTEA 2WDTA 2UUBH 1HNWH 3J81W 4DV6H 1ZHSA 4Q0YA 1M0WA 2HVRA 4OX9H 1N36H 3EYYA 4MTDA 1FVIA 1P8LA 3UQ8A 4DR2H 4PDBA 1B04A 4RB3C 2UXBH 3RGXA 1HR0H 3RJ0A 1Z2PX 2UXCH 5EOYA 4YY3H 4MV9A 3C0FB 2W57A 4DV2H 2XIGA 3JSLA 3KAJA 4EFEA 4RZQA 1N34H 4DR7H 1Z2NX 2VQEH 4X65H 1XDNA 2MCTA 3N40P 3J80W 2RGRA 4MV7A 4K0KH 1S03G 5D1OB 3L4KA 4JI7H 2YCHA 4LMYA 1GYFA 1WH2A 3CVZA 3RGZA 2F4VH 4UCSA 3T1YH 4DR3H 4UCVA 4FM9A 5LMNH 2WYOA 1FKAH 1E4GT 4LF9H 3L2PA 4JI3H 4DR4H 2Q2UA 1IBLH 2UUCH 1TAEA 4AQYH 4YHHH 1N33H 1L2ZA 3BAAA 3T1HH 4RB0A 2HGSA 3KXYT 5A2QW 4R7RA 4X66H 2VPSA 5LL6b 4JI8H 3PN1A 1XMQH 1M0TA 4LF4H 1X9NA 2UUAH 2Q2TA 1HNXH 5LMUH 2VQFH 3IG0A 4DV1H 4DV0H 4UCRA 3M4IA 5IT9W 4JI4H 1Z2OX 4LF8H 4GKKH 4JI0H 3H20A 1SYXB 3L4JA 5D1PA 4JYAH 4J0MA 4RB1A 1BJTA 1I94H 3JSNA 4GLXA 4JI5H 4RAYA 3KALA 4LSXA 3N6XA 4A2BA 1IBKH 3BABA 4DV3H 2UU9H 4EFBA 2HHHH 4LH6A 5D1OA 2ZM6H 5FPOA 2VOBA 2HVSA 4DUYH 4DV7H 4JI2H 1I6UA 3LMLA 2UXDH 3MWMA 1DGSA 4UCUA 3KAKA 4JI6H 4LFCH 3HXLA 1MZBA 4LF6H 2CW8A 4LFAH 3FMAA 1AN7A 2FE3A 3RIZA 3K3VA 5FD5A 3N43B 1FJGH 1TA8A 2HVQA 4DR1H 1XNQH 1VS0A 4CC6A 4LSAA 2WE6A 3J7AK 4JV5H 4UCTA 4EEQA 4CC5A 2E5LH 4DV5H 4DR5H 4LF7H 5FLXW 1A0IA 1ZHQA 4UCOA 4NXNH 5FPRA 4X62H 4NXMH 4B3SH 1SEIA 3N41B 1O75A 2VUGA 1N32H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CVZ A; 
#chains in the Genus database with same CATH topology
 3N8D A;  2YZM A;  1E4F T;  2ALZ A;  4J9K A;  2R87 A;  4IAJ A;  3JAM W;  5KFO A;  4X64 H;  3PR5 B;  3JRW A;  3M9O B;  2VA2 A;  4KHP H;  4ECQ A;  4TV8 F;  5C4X G;  1HNZ H;  5EWE A;  4JI1 H;  2JEJ A;  1KJI A;  2JA5 A;  2R7N A;  2ATL A;  5KFN A;  3G6X A;  4A93 G;  2IA6 A;  4QW9 A;  1XMO H;  2JA5 G;  1TWG A;  2CW7 A;  2W6M A;  4LFB H;  5CA0 F;  1K83 A;  5BMV F;  2UUB H;  2J6U A;  5KG6 A;  1AUX A;  1TWF A;  2GLT A;  1S0N A;  2PVP A;  2QK4 A;  2R8I A;  3HOU G;  4DR2 H;  5DGB A;  2I80 A;  4HYK A;  2UXB H;  3RGX A;  3AYH B;  4QIW A;  4I4T F;  3HOY G;  2Y0S A;  4MV9 A;  2NU9 B;  5KT5 A;  4C5A A;  3KAJ A;  3JSL A;  2W6Q A;  4RZQ A;  1N34 H;  2WTF A;  5KT4 A;  4DR7 H;  5KFI A;  4J9L A;  2MCT A;  3N40 P;  3GV7 B;  2W6O A;  5GON F;  2R82 A;  5D1O B;  5EWG A;  1S03 G;  2R7Z A;  5KFC A;  4U7C A;  1GSA A;  2XGQ A;  3MR2 A;  3TII A;  3CVZ A;  3M9N B;  2UVR A;  1I7N A;  2R7Z G;  4XX0 B;  1EYZ A;  5KG5 A;  1GGO A;  4FM9 A;  2JA8 G;  2W9C B;  4LF9 H;  1IOV A;  5LXT F;  4DR4 H;  4TV9 F;  2Q2U A;  5KFA A;  2RDJ A;  3RV3 A;  2JEG A;  1L2Z A;  3TIG A;  2ASD A;  2NU7 B;  2FK2 A;  4F50 A;  5JQW A;  3T1H H;  4EBD A;  5EZY F;  2FPI B;  4JV1 A;  4JI8 H;  3PO2 G;  4RNO A;  4YP3 A;  1DIK A;  3HOZ G;  2YU9 A;  5LP6 F;  3KHH A;  4EBC A;  2FKL A;  1X9N A;  4C5C A;  1HNX H;  2R86 A;  4WBN F;  5EWF A;  4DV1 H;  2NVY A;  4UCR A;  3GTJ A;  2BQR A;  4JI4 H;  4F4Y A;  4MV3 A;  4LF8 H;  3CQZ A;  5DQG A;  1GO3 E;  1T94 A;  3R5F A;  4RB1 A;  3JSN A;  4GLX A;  4QWA A;  2UVW A;  3GV5 B;  1VAJ A;  4A2B A;  3PW0 A;  4R8U A;  4DV3 H;  2ZM6 H;  1IOW A;  3LWB A;  5DLF A;  2NU8 B;  1I6U A;  4O3Q A;  4J9S A;  1S0M A;  2P0A A;  4EBE A;  1WCM A;  4UCU A;  1DV1 A;  1M7J A;  4XYL B;  2PMZ E;  3FMA A;  3RIZ A;  3Q8Q B;  2IBK A;  3K3V A;  2JA6 A;  1WCM G;  1TA8 A;  5DLG A;  2AQ4 A;  2FPP B;  5CAE B;  4YAK B;  4RNM A;  1S0O A;  2WE6 A;  3J7A K;  2JA6 G;  3PW2 A;  4O2A F;  4BY1 G;  2ZDQ A;  5T14 A;  2OLS A;  3GTK A;  1RJQ A;  4U6P A;  1JDE A;  2ZDH A;  4F4W A;  5KFU A;  1ZHQ A;  2C2R A;  4UCO A;  2I87 A;  4ED7 A;  4AYB E;  1PX2 A;  4RNN A;  2UVU A;  4NXM H;  3N41 B;  2VUG A;  1Y1V A;  5KX5 F;  5KG2 A;  3R5H A;  2RDI A;  5KFG A;  3BA8 A;  1ZQ7 A;  3F8N A;  5KFH A;  5DG8 A;  1Y1V G;  4ECW A;  2UVV A;  4FS1 A;  1UNN C;  3MFH A;  4LF5 H;  4ECS A;  3RF2 A;  3RTX A;  3QZ7 A;  4A2A A;  2E2I A;  3HB9 A;  1RJP A;  3ORQ A;  1XNR H;  5IWA H;  4ED3 A;  3GTP A;  2B63 A;  4A3C G;  4J9O A;  1JDB B;  4HQ6 A;  5HBR B;  2KSW A;  4QWC A;  1J5E H;  4BBR G;  4B3M H;  4MTE A;  3NGD A;  2AU0 A;  2WDT A;  2B63 G;  5KFQ A;  1HNW H;  2XGP A;  4DV6 H;  5K2M A;  3OUZ A;  4Q0Y A;  1CE8 A;  4OX9 H;  2W9B A;  4IRD A;  1P8L A;  3UQ8 A;  3GII A;  3I4M G;  5L1L A;  1PK8 A;  4PDB A;  1B04 A;  4C2M A;  2VUM A;  4FBU A;  5KT3 A;  3T5J A;  2DWC A;  4A3M G;  1Z2P X;  4J9Q A;  2CKZ B;  2YZG A;  1S10 A;  5EOY A;  2UXC H;  2VUM G;  2W57 A;  4I50 F;  3PR4 A;  5BPH A;  1I3Q A;  4ZI7 F;  1Z2N X;  5DGA A;  5C8Y F;  4X65 H;  3J80 W;  1JKJ B;  4MV7 A;  5KFS A;  3MR3 A;  3QZ8 A;  1GLV A;  4EGJ A;  2R93 G;  4QJF A;  3L4K A;  2YRX A;  4JI7 H;  1KJJ A;  2YS7 A;  4MV8 A;  4DLK A;  4PWQ A;  3RGZ A;  2XC9 A;  2F4V H;  4A3J G;  2JEI A;  5KFJ A;  5D8D A;  5KFX A;  5KT7 A;  4YJ3 F;  1T36 A;  2W7P A;  4DL5 A;  1E4G T;  3JZI A;  4DL7 A;  4L1K A;  4EYH B;  2R8K A;  2W8L A;  3BJY A;  2J6S A;  2W8K A;  4AQY H;  2R8G A;  4HR7 A;  1S97 A;  4A3B G;  4EYI B;  4HNV A;  4RB0 A;  3GTG A;  4QWE A;  5DQI A;  3RB0 A;  5FLM G;  5KT2 A;  4X66 H;  5F9N A;  3Q1K A;  3PN1 A;  4QIW E;  2W71 A;  1SFO A;  2R7L A;  2FLN A;  3V4Z A;  2W70 A;  3TQT A;  2JEF A;  1CQJ B;  2Q2T A;  5LMU H;  2Y0S E;  1TWC A;  2NU6 B;  4A3I G;  2J6T A;  4XZ3 B;  3KHG A;  4GKK H;  4O3P A;  3L4J A;  4J0M A;  2R7M A;  1BJT A;  5JVD F;  1I94 H;  4GC6 A;  4IZO A;  3KAL A;  1R9T A;  4EFB A;  1RK5 A;  2YL2 A;  2YRW A;  3MR6 A;  1TWA A;  4YB8 B;  5HV6 A;  3IN5 A;  4MAM A;  5CB4 F;  4DV7 H;  3HKZ A;  2VR1 A;  3LML A;  4EGQ A;  5C44 G;  2FLL A;  3GTL A;  2AGQ A;  5JUM A;  4TUY F;  4JI6 H;  5KFZ A;  4ME6 A;  2FE3 A;  4I55 F;  4ED0 A;  1WR2 A;  3N43 B;  3QFF A;  5KG7 A;  2HVQ A;  4QWD A;  4DR1 H;  2DPI A;  4CC6 A;  4F4X A;  2ASL A;  4EEQ A;  5KKN B;  5DQH A;  4A3F G;  4DR5 H;  2FK3 A;  5FLX W;  4FU0 A;  4Q44 A;  2PN1 A;  3RV4 A;  3KHR A;  2CQY A;  2V5A A;  2SCU B;  5FPR A;  1RYR A;  4ECX A;  4B3S H;  5IP7 G;  5EDW A;  2W6N A;  1UC8 A;  1GSH A;  4BY7 G;  3VPD A;  1Y1W A;  3KTM A;  3VPB A;  3BA9 A;  3H40 A;  2XCP A;  3H4D A;  4ECT A;  2FPG B;  2R6F A;  4UFZ A;  3T5L A;  4APM A;  1AUV A;  1Y1W G;  4Y8V B;  3OUU A;  1V9P A;  4QW8 A;  5BR8 H;  4ECY A;  4DR6 H;  5CA1 F;  4O4I F;  3FKI A;  1TWH A;  3EPI A;  1UC9 A;  4DUZ H;  3E5N A;  3DF7 A;  4J9N A;  3VPC A;  1B6S A;  1EHI A;  4MV6 A;  3LP8 A;  4DV4 H;  3FKI G;  4B3T H;  3V6K A;  3PO3 G;  5BPF A;  1B6R A;  5H80 A;  2OWO A;  1CQI B;  4O3O A;  1BNC A;  3UFX B;  2RGV A;  3OTO H;  2JA7 A;  3PZP A;  3Q8P B;  3RUP A;  3Q2O A;  2JA7 G;  3TQ1 A;  3PVX A;  2DLN A;  4ZQI A;  4HNU A;  5IYD G;  2WB1 E;  4YAJ B;  3G6V A;  2HVR A;  4BBS G;  2PBZ A;  1N36 H;  5L1K A;  3GTQ A;  4MTD A;  4XYM B;  3OHB A;  2ASJ A;  4NLG A;  3SE7 A;  4RB3 C;  2YS6 A;  2YYA A;  4A3D G;  1HR0 H;  2WAQ E;  4RUA A;  3RJ0 A;  5KFK A;  1VBG A;  4ECV A;  1RK6 A;  1N56 A;  3V4S A;  2RF4 A;  2XIG A;  1KC7 A;  2V9W A;  2FB9 A;  2VQE H;  4F4Z A;  1XDN A;  4AYB A;  5C5J A;  4MA5 A;  4MA0 A;  3PW7 A;  3I12 A;  2AGO A;  4IR1 A;  3GIM A;  3HOW G;  3RFC A;  2YCH A;  3HBL A;  1W96 A;  4LMY A;  2C00 A;  3K5H A;  3ETH A;  1GSO A;  2R92 A;  5IP9 G;  3OHA A;  4UCV A;  1RJR A;  2R92 G;  4HNT A;  1FKA H;  4O4H F;  4IHJ F;  3M9M B;  1EUD B;  5LA6 F;  1IBL H;  2V58 A;  1TAE A;  2UUC H;  3MWD A;  4YHH H;  3GIQ A;  2HJW A;  5KFE A;  3MFI A;  4Q45 A;  3BAA A;  2YZN A;  2HGS A;  5KFW A;  4FS2 A;  4DL4 A;  4R7R A;  2W6Z A;  2VPS A;  5LL6 b;  1I50 A;  4FBT A;  3RB3 A;  3GTM A;  4ECZ A;  4DL6 A;  3H0G A;  3G6Y A;  2R93 A;  2VQF H;  4R8U B;  2R85 A;  1Z2O X;  1S9F A;  3H20 A;  1SYX B;  3H0G G;  4YR0 A;  4TQS A;  2C2E A;  4WD3 A;  1KJ8 A;  4O3R A;  3HOX G;  1VBH A;  2ZDG A;  1CS0 A;  4TQR A;  3BQ1 A;  4JI5 H;  2NVX A;  5KFL A;  2QYZ A;  4LSX A;  4JUZ A;  3WO0 A;  1M6V A;  4RUC A;  2W6P A;  2HHH H;  3K5I A;  4O4L F;  4ZHQ F;  3ORR A;  1JX4 A;  2FK1 A;  3R5X A;  4YQW A;  3VMM A;  3MWM A;  2NUA B;  5KFT A;  1C30 A;  2C35 B;  1MZB A;  2DZD A;  2CW8 A;  1JIH A;  1AN7 A;  3U9S A;  5C1P A;  5KG1 A;  4EG0 A;  3R23 A;  5L1J A;  2VQD A;  1FJG H;  1XNQ H;  4ED2 A;  1OWT A;  1VS0 A;  4LSA A;  1KJQ A;  4IWY A;  2C2D A;  1K1Q A;  3BG5 A;  4UCT A;  5KFR A;  4CC5 A;  2FMA A;  3WO1 A;  4DV5 H;  3OSN A;  2V4R A;  1ULZ A;  5JH7 F;  5I47 A;  1A0I A;  2E5L H;  3I4N G;  2DPJ A;  2YW2 A;  4J9M A;  3RAX A;  3RAQ A;  4JV2 A;  2IMW P;  2R84 A;  4NXN H;  4BXX G;  1SEI A;  3GTO A;  1O75 A;  4ED6 A;  3TIN A;  2GPS A;  2VA3 A;  1RYS A;  1N32 H;  4BWS C;  4I7H A;  2ZJT A;  4GKJ H;  5LOV F;  5FD6 A;  1EZ1 A;  4IRK A;  4O2B F;  5IYC G;  4J9R A;  1IBM H;  4M7E A;  5F9L A;  2FP4 B;  3N44 B;  4RB2 C;  3GIP A;  3GIJ A;  1S68 A;  3HKZ E;  1WSC A;  3N42 B;  3MR5 A;  4LH7 A;  5IYB G;  4B3R H;  1BGW A;  2W9B B;  2XD4 A;  4ECR A;  4ETS A;  4RAZ A;  3SI8 A;  1DV2 A;  2O03 A;  5LYJ F;  1E4E A;  2FLP A;  1KJ9 A;  2J9G A;  3J81 W;  5KG3 A;  3ETJ A;  1A9X A;  3RB6 A;  1ZHS A;  1I7L A;  1M0W A;  5L9X A;  3Q8S B;  1C3O A;  4C5B A;  2VPQ A;  3EYY A;  2R8J A;  1FVI A;  1W93 A;  4A3K G;  3PW5 A;  4A3G G;  2BQU A;  1SCU B;  1N48 A;  3H4B A;  3BQ2 A;  4E4T A;  5KFV A;  4YY3 H;  4YJ2 F;  3C0F B;  4DV2 H;  2BR0 A;  4EFE A;  5J2T F;  3GV8 B;  4O3S A;  3GIK A;  1BXR A;  2FJZ A;  2R7K A;  5IYZ F;  4ED1 A;  1V51 A;  3PW4 A;  4YR2 A;  3RBD A;  4Q8E A;  2RGR A;  4K0K H;  3K3P A;  4YR3 A;  5J2U F;  5KG0 A;  5KG4 A;  1GYF A;  1WH2 A;  3FDS A;  3V6J A;  4IWX A;  4UCS A;  4RZR A;  3T1Y H;  2DIK A;  2M05 A;  3RB4 A;  4DR3 H;  1T3N A;  2BQ3 A;  4JV0 A;  5KFB A;  5LMN H;  2WYO A;  1ZET A;  5KFM A;  3L2P A;  2C28 A;  4JI3 H;  2PMZ A;  3KHL A;  2XCL A;  1N33 H;  2GPW A;  1K1S A;  2X0S A;  2V59 A;  4MV1 A;  3KXY T;  5A2Q W;  2R8H A;  4J9P A;  4EEY A;  5DG7 A;  2C22 A;  3MJF A;  3JRX A;  4O3N A;  4GC7 A;  3T5H A;  1XMQ H;  1M0T A;  1VKZ A;  4LF4 H;  4Q43 A;  3HOV G;  3BQ0 A;  2W7O A;  2UUA H;  5KFD A;  3IG0 A;  2WB1 A;  3GIL A;  4DV0 H;  1Y14 B;  3M4I A;  5L1I A;  5IT9 W;  5C1O A;  1JXL A;  4JI0 H;  3GLK A;  3V6H A;  4MV4 A;  4YBZ B;  5D1P A;  4QWB A;  4JYA H;  1EUC B;  3H3V H;  3GID A;  4M9U A;  2WAQ A;  4RAY A;  5KFY A;  2E2H A;  1IBK H;  3N6X A;  4A3E G;  3EPG A;  3BAB A;  2UU9 H;  3GQC A;  2CZG A;  2IP4 A;  4LH6 A;  5D1O A;  5FPO A;  2VOB A;  3G8C A;  2HVS A;  4DL3 A;  3U9T A;  4DUY H;  4IRC A;  4JI2 H;  5KFF A;  1E4E B;  4IR9 A;  3T5K A;  2UXD H;  1DGS A;  3MWE A;  3KAK A;  4ECU A;  5C3E G;  4LFC H;  3HXL A;  4LF6 H;  4LFA H;  2I8C A;  5FD5 A;  4G3I A;  4ED8 A;  1B33 N;  2W9C A;  3Q8R B;  4JV5 H;  3WNZ A;  1KEE A;  4ZOL F;  2W9A A;  2V4Q A;  2OH2 A;  2XCA A;  5KT6 A;  4LF7 H;  3RBE A;  2AGP A;  1KBL A;  4A3L G;  5FJ8 G;  1V4Y A;  1JLL B;  4X62 H;  5KFP A;  4RU9 A;  4DL2 A;  5JVL A;  5DG9 A;  4Q8F A;  3OSP A; 
#chains in the Genus database with same CATH homology
 4BWS C;  3BA8 A;  3BA9 A;  3F8N A;  1E4F T;  4I7H A;  4UFZ A;  4APM A;  2ZJT A;  4IAJ A;  3JAM W;  4X64 H;  4KHP H;  4GKJ H;  5FD6 A;  1V9P A;  5BR8 H;  1HNZ H;  4DR6 H;  4LF5 H;  4JI1 H;  3RF2 A;  3RTX A;  1IBM H;  4M7E A;  4A2A A;  3N44 B;  4RB2 C;  4DUZ H;  3DF7 A;  1XNR H;  1S68 A;  5IWA H;  3N42 B;  4DV4 H;  4LH7 A;  1XMO H;  4B3T H;  4B3R H;  1BGW A;  2CW7 A;  4LFB H;  4ETS A;  4RAZ A;  2OWO A;  2KSW A;  1J5E H;  4B3M H;  2O03 A;  3OTO H;  2RGV A;  4MTE A;  2WDT A;  2UUB H;  1HNW H;  3J81 W;  4DV6 H;  1ZHS A;  4Q0Y A;  1M0W A;  2HVR A;  4OX9 H;  1N36 H;  3EYY A;  4MTD A;  1FVI A;  1P8L A;  3UQ8 A;  4DR2 H;  4PDB A;  1B04 A;  4RB3 C;  2UXB H;  3RGX A;  1HR0 H;  3RJ0 A;  1Z2P X;  2UXC H;  5EOY A;  4YY3 H;  4MV9 A;  3C0F B;  2W57 A;  4DV2 H;  2XIG A;  3JSL A;  3KAJ A;  4EFE A;  4RZQ A;  1N34 H;  4DR7 H;  1Z2N X;  2VQE H;  4X65 H;  1XDN A;  2MCT A;  3N40 P;  3J80 W;  2RGR A;  4MV7 A;  4K0K H;  1S03 G;  5D1O B;  3L4K A;  4JI7 H;  2YCH A;  4LMY A;  1GYF A;  1WH2 A;  3CVZ A;  3RGZ A;  2F4V H;  4UCS A;  3T1Y H;  4DR3 H;  4UCV A;  4FM9 A;  5LMN H;  2WYO A;  1FKA H;  1E4G T;  4LF9 H;  3L2P A;  4JI3 H;  4DR4 H;  2Q2U A;  1IBL H;  2UUC H;  1TAE A;  4AQY H;  4YHH H;  1N33 H;  1L2Z A;  3BAA A;  3T1H H;  4RB0 A;  2HGS A;  3KXY T;  5A2Q W;  4R7R A;  4X66 H;  2VPS A;  5LL6 b;  4JI8 H;  3PN1 A;  1XMQ H;  1M0T A;  4LF4 H;  1X9N A;  2UUA H;  2Q2T A;  1HNX H;  5LMU H;  2VQF H;  3IG0 A;  4DV1 H;  4DV0 H;  4UCR A;  3M4I A;  5IT9 W;  4JI4 H;  1Z2O X;  4LF8 H;  4GKK H;  4JI0 H;  3H20 A;  1SYX B;  3L4J A;  5D1P A;  4JYA H;  4J0M A;  4RB1 A;  1BJT A;  1I94 H;  3JSN A;  4GLX A;  4JI5 H;  4RAY A;  3KAL A;  4LSX A;  3N6X A;  4A2B A;  1IBK H;  3BAB A;  4DV3 H;  2UU9 H;  4EFB A;  2HHH H;  4LH6 A;  5D1O A;  2ZM6 H;  5FPO A;  2VOB A;  2HVS A;  4DUY H;  4DV7 H;  4JI2 H;  1I6U A;  3LML A;  2UXD H;  3MWM A;  1DGS A;  4UCU A;  3KAK A;  4JI6 H;  4LFC H;  3HXL A;  1MZB A;  4LF6 H;  2CW8 A;  4LFA H;  3FMA A;  1AN7 A;  2FE3 A;  3RIZ A;  3K3V A;  5FD5 A;  3N43 B;  1FJG H;  1TA8 A;  2HVQ A;  4DR1 H;  1XNQ H;  1VS0 A;  4CC6 A;  4LSA A;  2WE6 A;  3J7A K;  4JV5 H;  4UCT A;  4EEQ A;  4CC5 A;  2E5L H;  4DV5 H;  4DR5 H;  4LF7 H;  5FLX W;  1A0I A;  1ZHQ A;  4UCO A;  4NXN H;  5FPR A;  4X62 H;  4NXM H;  4B3S H;  1SEI A;  3N41 B;  1O75 A;  2VUG A;  1N32 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...