3CWAA

Crystal structure of an alka host/guest complex 8oxoguanine:cytosine base pair
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
282
structure length
282
Chain Sequence
MYTLNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIVNGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPEYICFPTPQRLAAADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDYLIKQRFPGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQPDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-3-methyladenine glycosylase 2
publication title Structure of the E. coli DNA Glycosylase AlkA Bound to the Ends of Duplex DNA: A System for the Structure Determination of Lesion-Containing DNA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 94
structure length 282
sequence length 282
chains with identical sequence B, C, D
ec nomenclature ec 3.2.2.21: DNA-3-methyladenine glycosylase II.
pdb deposition date 2008-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
A PF06029 AlkA_N AlkA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 3cwaA02
1.10.1670.10 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 3cwaA03
3.30.310.20 Alpha Beta 2-Layer Sandwich TATA-Binding Protein DNA-3-methyladenine glycosylase AlkA, N-terminal domain 3cwaA01
1NKUA 4UNFA 2I5WA 1EBMA 1WEGA 1PU6A 1N39A 1HU0A 4YPHA 3CVSA 2OFKA 3FSPA 2NOZA 3N5NX 1NGNA 1LWWA 1YQKA 2JHNA 1YQMA 4UOBA 4EA5A 1VRLA 4EJYA 3CWSA 4EVVA 4E9FA 1XG7A 2YG9A 4E9GA 4EW4A 1MUDA 1RRQA 1KQJA 3F10A 5CHZA 2NOLA 1PU7A 3G0QA 1MPGA 1WEFA 1MUYA 4B23A 1LWYA 2NOBA 4OFAA 4OFEA 4AI5A 1YQRA 1P7MA 2JG6A 3N0UA 1KG3A 3FHFA 4YPRA 4AI4A 1FN7A 5AN4A 1XQOA 3I0WA 1KG7A 4B21A 5KN9A 3KTUA 3OH6A 4EA4A 1ORPA 1P59A 3S6IA 3CVTA 1MUNA 5DPKA 3OH9A 1LMZA 5KN8A 4EW0A 1KG5A 4OFHA 2H56A 2NOFA 3CWAA 1KEAA 1M3QA 4E9EA 3F0ZA 4HSBA 2ABKA 3OGDA 2YG8A 2OFIA 2JHJA 3I0XA 1DIZA 1RRSA 3KNTA 1YQLA 4E9HA 3IHOA 1ORNA 3D4VA 4DK9A 1N3CA 1PU8A 1PVSA 2NOHA 4PIIA 2NOEA 4AIAA 1KG2A 3FHGA 1XQPA 4B22A 4B24A 1M3HA 1N3AA 1KG4A 3CWTA 4YOQA 4EJZA 1WEIA 1KG6A 1LWVA 1KO9A 2NOIA 3IH7A 3CW7A 2XHIA 3CWUA
chains in the Genus database with same CATH superfamily
3EAYA 3L2UA 3OYKA 2I5WA 2NVMA 1EBMA 1Q9UA 3S3NA 1K2YX 5BMNA 4WXAA 1QNEA 1LWWA 1VTOA 2JHNA 3OYAA 1TBPA 3OSEA 2HL8A 2O3OA 2H5AX 2YG9A 4Q11A 1AISA 1C4GA 2HL9A 4IKFA 2NOLA 2QRDA 1PU7A 1MPGA 1KYFA 1C9BB 4OFAA 1CDWA 4EAIA 4OFEA 1PZDA 1YQRA 3ENOC 3LCNA 1FN7A 2G30A 1KYUA 2JPSA 1MP9A 3OYIA 4B21A 4EALA 2V9JA 5DPKA 1P5DX 3S3MA 4EW0A 1R4XA 3OSMA 2H56A 2QREA 1QTSA 3N89A 1KY6A 1KEAA 2D0BA 3F0ZA 3I3WA 4I8OA 1VKLA 3OGDA 5KL0A 2D0CA 1U84A 3OYJA 1YQLA 3OLPA 4BE1A 4D7QA 4E9HA 3IHOA 1ORNA 2MJ7A 2QR1A 1KYDA 3OS1A 1KG2A 4B24A 1TUOA 1NH2A 4YOQA 3OYBA 3ENCA 1PCMX 1WJWA 4QG5A 3NA5A 1P5GX 3DPUA 5BMPA 1PU6A 1VOLB 1NGMA 3KRMA 1VTLE 3RSMA 3PDKA 2NOZA 3VW4A 2W03A 2V8QA 1YTFA 1C47A 4EJYA 4EVVA 4E9FA 3OYDA 2DKCA 1QN9A 4E9GA 1MUDA 1UT4A 1QN4A 1KQJA 5FROA 3H1ZA 5JMVD 3OYCA 3G0QA 1NVPA 3OCIA 4B23A 3L2VA 3VN5A 3DPTA 2R5XA 2IV8A 3RPJA 4E7JA 4HJHA 3I0WA 3KTUA 3C04A 4EA4A 1ORPA 1QN5A 3S6IA 1K35A 1MUNA 2LAEA 4BJUA 3OS0A 1LMZA 4EAGA 3TE5A 1KG5A 2OOYA 4NZGA 4E9EA 4PY5A 4E7LA 4HSBA 1B9KA 2EHBD 1DIZA 4BACA 1RRSA 5HSHA 2V92A 2DKAA 2NOHA 4PIIA 2NOEA 4DULA 1XQPA 2FKMX 3R2XC 1N3AA 4EJZA 1KG6A 1LWVA 1KO9A 2NOIA 3CW7A 2YA3A 2YH5A 3OYHA 1EUVA 3BKQX 4UNFA 1QNCA 1QNBA 3L2WA 4BDYA 1N39A 4ZTFA 1HU0A 5EPCA 4RODB 3CVSA 2FKFA 1YQKA 1QNAA 1YQMA 4EA5A 3CWSA 1D3UA 1PCZA 1XG7A 2DKDA 3OY9A 2NLVA 3F10A 2HKPA 5CHZA 2QRCA 1WEFA 2OOXA 4ROCB 5FRNA 3OYMA 4AI5A 1TGHA 1JDYA 5IYDP 2JG6A 3OC3C 5IYCP 4AI4A 2HZSA 3HS8A 5AN4A 1RM1A 4ZTJA 3TDHA 3L2QA 3OH6A 4C7PA 2Z0FA 1P59A 3L2RA 4E7KA 3CVTA 2FUVA 1QTPA 3OH9A 2JOIA 1QN8A 1QN7A 5KN8A 1XSZA 4IL8A 1V5SA 4OFHA 2NOFA 3CWAA 1M5Q1 3OS2A 1M3QA 2NWVA 3ULXA 3OYLA 2OFIA 2JHJA 3I0XA 1WQAA 3KNTA 1UL7A 3D4VA 3OYFA 1N3CA 3OYGA 1PU8A 4AIAA 1PCJX 1KY7A 3FHGA 4B22A 3S3OA 1M3HA 1E42A 3HS9A 1KG4A 3NNQA 3CWUA 4BDZA 4BE0A 2F7LA 1VOKA 1NKUA 1WEGA 2Y8QA 1JFIC 4E7IA 4EAJA 2W04A 4YPHA 2OFKA 3FSPA 2PWWA 3N5NX 1NGNA 3OYEA 1TBAB 2HZMA 4UOBA 1VRLA 2QLVA 1QN3A 1T6AA 3OSTA 4EW4A 1RRQA 5IYBP 4BE2A 1W80A 4E7HA 2H4LX 1MUYA 1LWYA 2NOBA 4MRQA 4WX8A 4ROEB 4EAKA 1P7MA 3N0UA 1KG3A 3FHFA 1LXTA 4YPRA 4B0AA 1XQOA 2V75A 3D7QA 1KG7A 5JN5A 5KN9A 2Z8UA 1YTBA 3T4NA 2JPIA 4WZSD 2ZFDB 4CFFA 1QN6A 3ASMA 3UW2A 2FGTA 5F9CA 2MZ8A 2ABKA 1J3MA 5FRMA 4TPSA 2YG8A 3EIKA 3SNSA 1KFQA 3PMGA 4DK9A 1PVSA 2D0AA 2VJ0A 1UT7A 3OYNA 3CWTA 1WEIA 4D7RA 3IH7A 2Y8LA 1KFIA 2XHIA 2IV9A
chains in the Genus database with same CATH topology
1NKUA 4UNFA 2I5WA 1EBMA 1WEGA 1PU6A 1N39A 1HU0A 4YPHA 3CVSA 2OFKA 3FSPA 2NOZA 3N5NX 1NGNA 1LWWA 1YQKA 2JHNA 1YQMA 4UOBA 4EA5A 1VRLA 4EJYA 3CWSA 4EVVA 4E9FA 1XG7A 2YG9A 4E9GA 4EW4A 1MUDA 1RRQA 1KQJA 3F10A 5CHZA 2NOLA 1PU7A 3G0QA 1MPGA 1WEFA 1MUYA 4B23A 1LWYA 2NOBA 4OFAA 4OFEA 4AI5A 1YQRA 1P7MA 2JG6A 3N0UA 1KG3A 3FHFA 4YPRA 4AI4A 1FN7A 5AN4A 1XQOA 3I0WA 1KG7A 4B21A 5KN9A 3KTUA 3OH6A 4EA4A 1ORPA 1P59A 3S6IA 3CVTA 1MUNA 5DPKA 3OH9A 1LMZA 5KN8A 4EW0A 1KG5A 4OFHA 2H56A 2NOFA 3CWAA 1KEAA 1M3QA 4E9EA 3F0ZA 4HSBA 2ABKA 3OGDA 2YG8A 2OFIA 2JHJA 3I0XA 1DIZA 1RRSA 3KNTA 1YQLA 4E9HA 3IHOA 1ORNA 3D4VA 4DK9A 1N3CA 1PU8A 1PVSA 2NOHA 4PIIA 2NOEA 4AIAA 1KG2A 3FHGA 1XQPA 4B22A 4B24A 1M3HA 1N3AA 1KG4A 3CWTA 4YOQA 4EJZA 1WEIA 1KG6A 1LWVA 1KO9A 2NOIA 3IH7A 3CW7A 2XHIA 3CWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NKU A;  4UNF A;  2I5W A;  1EBM A;  1WEG A;  1PU6 A;  1N39 A;  1HU0 A;  4YPH A;  3CVS A;  2OFK A;  3FSP A;  2NOZ A;  3N5N X;  1NGN A;  1LWW A;  1YQK A;  2JHN A;  1YQM A;  4UOB A;  4EA5 A;  1VRL A;  4EJY A;  3CWS A;  4EVV A;  4E9F A;  1XG7 A;  2YG9 A;  4E9G A;  4EW4 A;  1MUD A;  1RRQ A;  1KQJ A;  3F10 A;  5CHZ A;  2NOL A;  1PU7 A;  3G0Q A;  1MPG A;  1WEF A;  1MUY A;  4B23 A;  1LWY A;  2NOB A;  4OFA A;  4OFE A;  4AI5 A;  1YQR A;  1P7M A;  2JG6 A;  3N0U A;  1KG3 A;  3FHF A;  4YPR A;  4AI4 A;  1FN7 A;  5AN4 A;  1XQO A;  3I0W A;  1KG7 A;  4B21 A;  5KN9 A;  3KTU A;  3OH6 A;  4EA4 A;  1ORP A;  1P59 A;  3S6I A;  3CVT A;  1MUN A;  5DPK A;  3OH9 A;  1LMZ A;  5KN8 A;  4EW0 A;  1KG5 A;  4OFH A;  2H56 A;  2NOF A;  3CWA A;  1KEA A;  1M3Q A;  4E9E A;  3F0Z A;  4HSB A;  2ABK A;  3OGD A;  2YG8 A;  2OFI A;  2JHJ A;  3I0X A;  1DIZ A;  1RRS A;  3KNT A;  1YQL A;  4E9H A;  3IHO A;  1ORN A;  3D4V A;  4DK9 A;  1N3C A;  1PU8 A;  1PVS A;  2NOH A;  4PII A;  2NOE A;  4AIA A;  1KG2 A;  3FHG A;  1XQP A;  4B22 A;  4B24 A;  1M3H A;  1N3A A;  1KG4 A;  3CWT A;  4YOQ A;  4EJZ A;  1WEI A;  1KG6 A;  1LWV A;  1KO9 A;  2NOI A;  3IH7 A;  3CW7 A;  2XHI A;  3CWU A; 
#chains in the Genus database with same CATH topology
 3EAY A;  3L2U A;  3OYK A;  2I5W A;  2NVM A;  1EBM A;  1Q9U A;  3S3N A;  1K2Y X;  5BMN A;  4WXA A;  1QNE A;  1LWW A;  1VTO A;  2JHN A;  3OYA A;  1TBP A;  3OSE A;  2HL8 A;  2O3O A;  2H5A X;  2YG9 A;  4Q11 A;  1AIS A;  1C4G A;  2HL9 A;  4IKF A;  2NOL A;  2QRD A;  1PU7 A;  1MPG A;  1KYF A;  1C9B B;  4OFA A;  1CDW A;  4EAI A;  4OFE A;  1PZD A;  1YQR A;  3ENO C;  3LCN A;  1FN7 A;  2G30 A;  1KYU A;  2JPS A;  1MP9 A;  3OYI A;  4B21 A;  4EAL A;  2V9J A;  5DPK A;  1P5D X;  3S3M A;  4EW0 A;  1R4X A;  3OSM A;  2H56 A;  2QRE A;  1QTS A;  3N89 A;  1KY6 A;  1KEA A;  2D0B A;  3F0Z A;  3I3W A;  4I8O A;  1VKL A;  3OGD A;  5KL0 A;  2D0C A;  1U84 A;  3OYJ A;  1YQL A;  3OLP A;  4BE1 A;  4D7Q A;  4E9H A;  3IHO A;  1ORN A;  2MJ7 A;  2QR1 A;  1KYD A;  3OS1 A;  1KG2 A;  4B24 A;  1TUO A;  1NH2 A;  4YOQ A;  3OYB A;  3ENC A;  1PCM X;  1WJW A;  4QG5 A;  3NA5 A;  1P5G X;  3DPU A;  5BMP A;  1PU6 A;  1VOL B;  1NGM A;  3KRM A;  1VTL E;  3RSM A;  3PDK A;  2NOZ A;  3VW4 A;  2W03 A;  2V8Q A;  1YTF A;  1C47 A;  4EJY A;  4EVV A;  4E9F A;  3OYD A;  2DKC A;  1QN9 A;  4E9G A;  1MUD A;  1UT4 A;  1QN4 A;  1KQJ A;  5FRO A;  3H1Z A;  5JMV D;  3OYC A;  3G0Q A;  1NVP A;  3OCI A;  4B23 A;  3L2V A;  3VN5 A;  3DPT A;  2R5X A;  2IV8 A;  3RPJ A;  4E7J A;  4HJH A;  3I0W A;  3KTU A;  3C04 A;  4EA4 A;  1ORP A;  1QN5 A;  3S6I A;  1K35 A;  1MUN A;  2LAE A;  4BJU A;  3OS0 A;  1LMZ A;  4EAG A;  3TE5 A;  1KG5 A;  2OOY A;  4NZG A;  4E9E A;  4PY5 A;  4E7L A;  4HSB A;  1B9K A;  2EHB D;  1DIZ A;  4BAC A;  1RRS A;  5HSH A;  2V92 A;  2DKA A;  2NOH A;  4PII A;  2NOE A;  4DUL A;  1XQP A;  2FKM X;  3R2X C;  1N3A A;  4EJZ A;  1KG6 A;  1LWV A;  1KO9 A;  2NOI A;  3CW7 A;  2YA3 A;  2YH5 A;  3OYH A;  1EUV A;  3BKQ X;  4UNF A;  1QNC A;  1QNB A;  3L2W A;  4BDY A;  1N39 A;  4ZTF A;  1HU0 A;  5EPC A;  4ROD B;  3CVS A;  2FKF A;  1YQK A;  1QNA A;  1YQM A;  4EA5 A;  3CWS A;  1D3U A;  1PCZ A;  1XG7 A;  2DKD A;  3OY9 A;  2NLV A;  3F10 A;  2HKP A;  5CHZ A;  2QRC A;  1WEF A;  2OOX A;  4ROC B;  5FRN A;  3OYM A;  4AI5 A;  1TGH A;  1JDY A;  5IYD P;  2JG6 A;  3OC3 C;  5IYC P;  4AI4 A;  2HZS A;  3HS8 A;  5AN4 A;  1RM1 A;  4ZTJ A;  3TDH A;  3L2Q A;  3OH6 A;  4C7P A;  2Z0F A;  1P59 A;  3L2R A;  4E7K A;  3CVT A;  2FUV A;  1QTP A;  3OH9 A;  2JOI A;  1QN8 A;  1QN7 A;  5KN8 A;  1XSZ A;  4IL8 A;  1V5S A;  4OFH A;  2NOF A;  3CWA A;  1M5Q 1;  3OS2 A;  1M3Q A;  2NWV A;  3ULX A;  3OYL A;  2OFI A;  2JHJ A;  3I0X A;  1WQA A;  3KNT A;  1UL7 A;  3D4V A;  3OYF A;  1N3C A;  3OYG A;  1PU8 A;  4AIA A;  1PCJ X;  1KY7 A;  3FHG A;  4B22 A;  3S3O A;  1M3H A;  1E42 A;  3HS9 A;  1KG4 A;  3NNQ A;  3CWU A;  4BDZ A;  4BE0 A;  2F7L A;  1VOK A;  1NKU A;  1WEG A;  2Y8Q A;  1JFI C;  4E7I A;  4EAJ A;  2W04 A;  4YPH A;  2OFK A;  3FSP A;  2PWW A;  3N5N X;  1NGN A;  3OYE A;  1TBA B;  2HZM A;  4UOB A;  1VRL A;  2QLV A;  1QN3 A;  1T6A A;  3OST A;  4EW4 A;  1RRQ A;  5IYB P;  4BE2 A;  1W80 A;  4E7H A;  2H4L X;  1MUY A;  1LWY A;  2NOB A;  4MRQ A;  4WX8 A;  4ROE B;  4EAK A;  1P7M A;  3N0U A;  1KG3 A;  3FHF A;  1LXT A;  4YPR A;  4B0A A;  1XQO A;  2V75 A;  3D7Q A;  1KG7 A;  5JN5 A;  5KN9 A;  2Z8U A;  1YTB A;  3T4N A;  2JPI A;  4WZS D;  2ZFD B;  4CFF A;  1QN6 A;  3ASM A;  3UW2 A;  2FGT A;  5F9C A;  2MZ8 A;  2ABK A;  1J3M A;  5FRM A;  4TPS A;  2YG8 A;  3EIK A;  3SNS A;  1KFQ A;  3PMG A;  4DK9 A;  1PVS A;  2D0A A;  2VJ0 A;  1UT7 A;  3OYN A;  3CWT A;  1WEI A;  4D7R A;  3IH7 A;  2Y8L A;  1KFI A;  2XHI A;  2IV9 A; 
#chains in the Genus database with same CATH homology
 1NKU A;  4UNF A;  2I5W A;  1EBM A;  1WEG A;  1PU6 A;  1N39 A;  1HU0 A;  4YPH A;  3CVS A;  2OFK A;  3FSP A;  2NOZ A;  3N5N X;  1NGN A;  1LWW A;  1YQK A;  2JHN A;  1YQM A;  4UOB A;  4EA5 A;  1VRL A;  4EJY A;  3CWS A;  4EVV A;  4E9F A;  1XG7 A;  2YG9 A;  4E9G A;  4EW4 A;  1MUD A;  1RRQ A;  1KQJ A;  3F10 A;  5CHZ A;  2NOL A;  1PU7 A;  3G0Q A;  1MPG A;  1WEF A;  1MUY A;  4B23 A;  1LWY A;  2NOB A;  4OFA A;  4OFE A;  4AI5 A;  1YQR A;  1P7M A;  2JG6 A;  3N0U A;  1KG3 A;  3FHF A;  4YPR A;  4AI4 A;  1FN7 A;  5AN4 A;  1XQO A;  3I0W A;  1KG7 A;  4B21 A;  5KN9 A;  3KTU A;  3OH6 A;  4EA4 A;  1ORP A;  1P59 A;  3S6I A;  3CVT A;  1MUN A;  5DPK A;  3OH9 A;  1LMZ A;  5KN8 A;  4EW0 A;  1KG5 A;  4OFH A;  2H56 A;  2NOF A;  3CWA A;  1KEA A;  1M3Q A;  4E9E A;  3F0Z A;  4HSB A;  2ABK A;  3OGD A;  2YG8 A;  2OFI A;  2JHJ A;  3I0X A;  1DIZ A;  1RRS A;  3KNT A;  1YQL A;  4E9H A;  3IHO A;  1ORN A;  3D4V A;  4DK9 A;  1N3C A;  1PU8 A;  1PVS A;  2NOH A;  4PII A;  2NOE A;  4AIA A;  1KG2 A;  3FHG A;  1XQP A;  4B22 A;  4B24 A;  1M3H A;  1N3A A;  1KG4 A;  3CWT A;  4YOQ A;  4EJZ A;  1WEI A;  1KG6 A;  1LWV A;  1KO9 A;  2NOI A;  3IH7 A;  3CW7 A;  2XHI A;  3CWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...