3CWBD

Chicken cytochrome bc1 complex inhibited by an iodinated analogue of the polyketide crocacin-d
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of molecular modeling in the design of analogues of the fungicidal natural products crocacins A and D.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
total genus 65
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2008-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3cwbD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3cwbD02
2GB8B 1NTKD 3KHUA 1LMSA 4WQ7A 1DIIC 1C6RA 2ZZS1 1WEJF 1J3SA 1LFMA 1LC2A 3VYMA 1QL3A 3WFDC 3ZBMA 2PCCB 1YIQA 3A9FA 1CO6A 3SLEA 5C0ZA 1DVVA 1U75B 5CIBB 1M60A 5DFSA 4AAOA 1C7MA 1I8OA 3ZCFA 5AURA 1CCHA 1L9JC 4WQAA 4O1QA 1CTYA 1CCRA 5CIDB 4FAVA 1CSXA 1EB7A 3HQ7A 4UB6V 4Y5RA 2B11B 1C75A 2L91A 3WFBC 1IQCA 1HCMA 4QAOA 1NTZD 1DW1A 1SQXD 2OZ1A 1QYZA 2N9IA 1S6VB 1YICA 2AXTV 1KV9A 1BL9A 3PTZA 3TYIA 2FRCA 5KAFV 2CE1A 2D0SA 4PW9B 155CA 3MK7B 1QL4A 3ITKA 1N9CA 5E79V 2YQBA 1N15A 2GC4D 1IRVA 1CIEA 1ETPA 4H0KA 3A0BV 1CC5A 3H1KD 3A0HV 1AYGA 5TJHA 3FWLA 351CA 3M97X 1SQBD 5CIEB 2JQRA 3RN0A 2B4ZA 1P84D 1F1CA 1SQPD 3SJLA 1GQ1A 3DMIA 2ZOOA 1CRGA 3OCDB 3NBSA 2BH4X 1FOCA 1I6EA 2DGEA 1KB9D 1H33B 1KX2A 1DW2A 3VNWA 1H33A 1CSVA 2KS1A 4EDFA 1HZVA 3CWBD 1EZVD 5B5EV 4XYDB 4YE1A 3RLMA 1FI7A 2O3JA 1PP9D 1YEBA 1GU2A 1ZZHA 3HQ9A 1LC1A 1DVHA 2ORLA 1L0LD 3PHLA 3ZOYA 2CXBA 2BLFB 1CYCA 1CORA 1CRIA 2ZONG 1CIHA 2K9JB 4WQ9A 1RZ5A 1CSWA 5GTHV 4FA5A 1RZ6A 2KNCB 2Y0DA 2MTAC 1CTZA 1M6ZA 2C2CA 2DVHA 3PXSA 3O1YA 1PPJD 1WVEC 5EXQA 1DIQC 2L4DA 2RMZA 5B6QA 4FA9A 1HROA 5DJQB 3ZIYA 1KX7A 1H9XA 1HJ4A 4UB8V 4AANA 4N0KA 2N3YA 1CRYA 1CHIA 1OAEA 5KLVD 4L3HA 1RAPA 2FWLA 1KYOD 1CRHA 3CU4A 2AIUA 5DF5A 3TGUD 1VYDA 2N18B 1HRCA 1A56A 4K3IA 1NMLA 4NFGB 3JBTB 5TISV 5C9MA 3TF5A 2BH5X 1W2LA 5CIFB 1FI9A 1KYOW 2FYUD 2Y0EA 2Q3EA 1FJ0A 4P4QB 4GYDA 1E8EA 1NIRA 1GDVA 3NWVA 5KLIB 1HZUA 3ZOOA 5GTIV 1I55A 4V2KA 3OA8B 3L75D 3SWSA 1YNRA 2A06D 3ZOXA 1CHJA 1H31B 1C52A 3KZIV 3PRJA 1A2SA 2B12B 1COTA 2CA4B 2C1VA 1BE3D 1ZRTD 2CE0A 1CRJA 4H0JA 3RMZA 1JDLA 2ZBOA 1K3HA 2YIUB 1H32B 3CYTI 3CXHW 3WFCC 2FYNB 4Q5PA 4RJTA 2PCBB 1YTCA 3SVWA 3BCCD 2C1DA 2ZXYA 3CXHD 3WUIA 2PACA 3ORVA 2YK3A 4LJIA 5H2FV 3VMAA 1H9YA 5KAIV 3HQ8A 5B66V 5IY51 1L9BC 4EIEA 3PH2B 2V08A 1H1OA 3O5CA 4WQEA 2B0ZB 1MG2D 1C2RA 3L4OA 4RSZA 3L4MA 4EIFA 1OCDA 1HH7A 2BPBB 1NMIA 1FHBA 1FCDC 4WQDA 3L73D 3H1LD 1CRCA 1CSUA 2C1DB 2AI5A 2MHMA 1K3GA 4IL6V 3O20A 1HJ3A 3L72D 4J20A 2JWAA 1YCCA 1QKSA 3CP5A 1CHHA 1NTMD 1H31A 1YEAA 4AX3A 1MZ4A 2I8FA 1AKKA 1GJQA 2CA3B 1NU1D 2C9XB 4PJ0V 2Y0CA 4L1QA 4WQ8A 2YCCA 2LITA 4MU8A 1AOQA 1CEDA 2C8SA 1A8CA 1E29A 1CYJA 3PLNA 4AALA 1N90A 4FA4A 1E2RA 4KMGA 1U74B 3C2CA 3GW6A 2OZ1B 2QG4A 1M70A 1W5CT 2BCCD 1MG3D 1CXAA 3OCDA 4L3GA 1R0QA 2N3BA 3H1HD 4WQBA 3O0RC 3WFEC 1GKSA 2VHDA 1CYIA 1CXCA 1KB0A 2N18C 4EICA 4O1WA 5CIGB 3VRDA 1DW3A 4A7PA 3L70D 3GG2A 5CYTR 4U3FD 2QJPB 1LS9A 1FI3A 1HJ5A 1SQVD 2LIRA 3PXTA 3H1JD 1H32A 1RAQA 3WU2V 2RN0A 3CX5D 5KKZB 2N9JA 4PWAA 4JCGA 4FANA 1CTJA 1DT1A 1IRWA 1CNOA 1YFCA 1I5TA 3TDKA 3CX5W 1IZL0 2EXVA 2V07A 3X39A 4FB1A 2QJYB 1F1FA 1BGYD 1I6DA 4FA1A 2B10B 3PXWA 3RN1A 3SXTA 1I54A 1I8PA 3ZOWA 2N9YB 4GEDB 3MK7C 3L74D 1GIWA 2IBZD 4D6TD 5CICB 451CA 1C6SA 4EIDA 4WQCA 1QN2A 3OA8A 1AOFA 1BCCD 2BCNB 4DY9A 1DW0A 1IO3A 1N50A 1L0ND 3L71D 4AAMA 1NNOA 1CIGA 1KIBA 2XTSB 1CIFA 1C2NA 4PD4D 1SQQD 3DP5A 4XXLA 5CIHB 2GIWA 2JTIB 5DJQC 3WC8A 2GC7D 2QJKB 3H1ID 3NBTA 3HQ6A 1B7VA 1S5LV 2C1UA 3DR0A 2D0WA 1C6OA 2HV4A 2BGVX
chains in the Genus database with same CATH superfamily
1DIPA 1KQGB 2C9LY 5AVUB 2R3SA 1LFMA 2YXRB 1QL3A 3TSIA 3KZIH 4L76A 3H1KG 3A9FA 1CO6A 3HD7A 1U75B 3B5ND 2IBZG 1IJDB 1JEKA 4NPFX 2OYIC 1MZ9A 1AQTA 1KILD 2A45I 2K9YA 3EFFK 1S5LE 3LW5H 1AQ5A 4O1QA 1OIPA 1CCRA 3SWYA 3HE5B 1GU5A 5CIDB 4FAVA 2QA4P 4UB6V 1C75A 3KZIE 2N9IA 1YICA 2AXTV 1KV9A 1BL9A 2HYNA 1XTCC 3MZWB 3F89A 155CA 4N78D 4IFDK 2IPPA 3GF7A 2YQBA 2P10A 2N9BA 3A0BE 1IRVA 2ZXXA 1CC5A 3CMAP 1NTMJ 3BCCE 5TJHA 3FWLA 1KB9E 3H1JG 1P84D 1F1CA 3SJLA 1GQ1A 3B5NB 5B66E 1N2DC 2P58A 1FOSE 1SQQJ 2YMKA 3VNWA 3RL0D 2KXPB 1HZVA 5B5EE 3L74J 5B5EH 3RLMA 1YEBA 1KYOH 1ZZHA 3L70G 5H2FH 1DD3A 2E43A 1L0LD 5AW7B 2CXBA 2BLFB 1CYCA 1VQPP 1GW4A 1CRIA 2ZONG 3P8CD 5CMZA 2CPBA 5GTHV 1JY2P 1RZ6A 2KNCB 3EQ2A 3RK2B 3TNUB 2MTAC 1RQVA 3CXHH 2DVHA 3WUTA 3O1YA 4PV1C 1WVEC 3CCUP 2N1TC 2RMZA 3I5CA 1FZFA 1NTKE 1YITP 4GOFA 1HROA 3O8ZA 2HPCB 5DJQB 4EYYQ 5BVZA 1HJ4A 2N3YA 5KLVD 3AE6C 3NXSA 2FWLA 1VYDA 2WZ7A 1HRCA 2FYUE 4QMAA 1NMLA 4LC1A 2HFED 1JY2N 5KJ7C 3I56P 4P4QB 1K9MQ 1YJWP 1IC2A 2J59M 1NIRA 1JM0A 3LIDA 1EXJA 3NWVA 1HZUA 1SFCC 3ZDMA 1I55A 1R5SA 1YJ9P 1YNRA 2A06D 1NO4A 4C7NB 1C52A 1CI6A 2OQQA 3PRJA 3Q5SA 4C7NA 3OAKA 2C1VA 1FOSF 4Y28J 1BE3D 1CRJA 2AEJA 5KLVG 1NTME 2BASA 3V5BA 4I6MC 3M9HA 1H32B 3KXDA 3L74G 3RK3D 4EI2A 3L72J 4KT0J 2AEMA 3L70J 2JJLA 3WFCC 1LP1A 3AE4C 1HWTC 4KHXA 4IFMA 3SVWA 4WWIA 4I7ZC 4LJIA 5KAIV 3HQ8A 4YXDC 1AV1A 2IYPA 4K35A 1L9BC 1JTHB 3OJAB 3EFGA 2B0ZB 4JQ0D 5CBOA 2RH0A 3PP5A 1HH7A 3H1HG 1L0LJ 4H0LB 1HVVA 1KC8Q 4RESB 1NMIA 1FHBA 1BDCA 2XKMA 1FCDC 4WVZA 1CRCA 1CSUA 1NTKJ 1KFNA 1OVUA 2MHMA 4IL6V 1HJ3A 3L72D 3E1IA 1YCCA 2E76D 1FC2C 3FXEA 1ZN5A 1NU1D 1VQMP 4WQ8A 2HLOA 2LITA 1H88A 3L37A 4MU8A 3GLMA 3II6A 1OMIA 2H88C 1Y47A 3AE9C 2NPSA 3CCJP 2UWJE 1X0TA 1KYOI 4FA4A 4KMGA 1U74B 2JO1A 3GW6A 1GK4A 4C7RA 2E74C 2OYHC 2BCCD 3L74E 5CJ0A 1USEA 1VQNP 3L4FA 1FDIA 2N3BA 1YTZI 3AECC 3P8CE 3R4YA 2ZYDA 1LWUC 2C0WA 3M0DC 2KLVA 1VF5D 5KLVJ 4KJMA 3ABVC 3AEDC 3HD7C 3JCUE 3BATA 3QH9A 1LS9A 3BRTB 1L4AA 3HD7B 1SQBG 1EC5A 2WPRA 3WU2V 2ITAA 1LGHB 3BCCJ 3P7KA 1IFIA 4WY4C 4JCGA 3L36A 2XU6A 3H1JJ 2ZT9D 3S9OA 2KNCA 3D70A 3TNUA 1YFCA 3S4RA 1I5TA 3Q2YA 2C0XA 1NU1K 3CX5W 2PRRA 2YO2A 5CCGA 1N73A 3HE4A 3FWNA 1I6DA 2B10B 3PXWA 4H44C 2POHA 3L75J 3D71A 2RKLA 3HUSA 3BRVB 4D6TD 1YHQP 3AEFC 5CCGC 4DT0A 1AOFA 4PV1B 2BCNB 4DY9A 4PD4E 2MKVA 1L0ND 1N7SD 3L71D 5L8RJ 5APXA 2LXBA 1CIGA 1CIFA 1SQQD 1W5CE 1URQC 2O01J 5DJQC 1JY3P 2FXOA 3CC4P 2M5AA 2GC7D 2QJKB 3H1ID 3NBTA 2H89C 2R44A 2K9JA 4XFJA 2ZVNB 3H32A 4DOJA 1KTMA 4TT3H 2GB8B 1NTKD 1RQUA 2IFMA 1L0NK 2W6BA 1LMSA 1J3SA 4D6TJ 2FYZA 1BGYE 5C0ZA 4W7ZA 1M60A 1VDFA 1C7MA 1SFCB 2A45G 5AURA 1CCHA 1K05A 3CX5H 1JMMA 4OWFA 4OH8B 2C9NY 2KB7P 1D7MA 3G3ZA 1Q82Q 2B11B 4UB6E 1FDOA 3WFBC 1IQCA 5AVWB 2NPSC 2Q7CA 2J5UA 4O9BA 2AXTE 4IL6X 1S5LH 1QLED 3PTZA 1LTIC 3TYIA 1EDLA 2D0SA 1QL1A 2A45H 5KAFE 4PW9B 3MK7B 1VPCA 3M06A 1RHZB 1YI2P 5E79V 1N15A 1J2JB 2GC4D 1N73C 4H0KA 3A0BV 1SP4A 4OGQD 2BCCJ 1OVRA 1OXZA 3H1KD 1HGVA 1LTSC 2GUVA 3A0HV 3A0HH 1S72P 351CA 1JY3O 1LT9C 2B4ZA 2AXTH 2WSFJ 4Y99C 1SQPD 1H89A 1CRGA 1NTMG 1Y9BA 1EDKA 3NBSA 1I6EA 2DGEA 1NOHA 1H33B 1L0LE 1EQ7A 1OX3A 1FZCA 1SQVE 1H33A 1X79B 2KS1A 1LJ2A 2P2UA 3A7OA 1EZVD 5B5EV 4YE1A 2E76B 1FJPA 2O3JA 2E75B 1OFCX 3HQ9A 1LC1A 5DJTB 3F5HA 2E76C 1KQLA 4DJGA 2E42A 3RL0C 5EFWB 2B88A 1CIHA 3RL0B 1RZ5A 1NKZB 4K3AA 1CSWA 3V2QA 1SQXJ 1BCCG 3L73E 1FZEA 1SLQA 1YBKA 2C2CA 5AW6B 4LLHA 1YIJP 1EZVI 1DIQC 1N7SC 1BCCE 2AEFA 2OTKE 2OYHB 2YIUC 2WITA 1KX7A 1FJKA 1H9XA 5AVXB 4AANA 5KJ7A 1CRYA 1URQA 1X9VA 2YMYA 3V2NA 1CRHA 2WPVB 3VMXA 4YXWH 1H0TA 4YTPC 1USDA 1OW7A 3TK1A 2NPSD 1ZLLA 1NTZE 1J1DC 4ZKPA 1DEEG 4NFGB 2P67A 1J1EB 2M3EA 3TF5A 1VQ9P 1T8ZA 1FU1A 2FYUD 1L0NE 2Q3EA 4U3FG 2A06E 3H1IG 3AEAC 4GYDA 1Z56A 1QL2A 5DJUB 3R2PA 3H1KJ 2KUBA 3VYIA 5KLIB 1R5LA 5GTIV 2O1KA 5KLIC 3JC22 3SWSA 2QE7H 3KZIV 1AVYA 1RF0C 2JWDA 1A2SA 2B12B 1COTA 2WSCH 1HUCA 2J58A 1IFDA 1NTZK 1L2PA 3TGUJ 3VOPA 2ZBOA 2OGUA 5APUA 3FGAD 4B86A 1LTJA 5APTA 3IN6A 1TU3F 4PD4I 2HR3A 3IR9A 2KI7B 1NVOA 1A02F 4H13D 2FYNB 1NU1E 4OGQC 2B9BA 1NAFA 1YTCA 2Y9ZA 1A02J 2FYNC 2WSEJ 1ZP0C 2C1DA 2CK3H 3VN0A 3WUIA 2PACA 4H13C 3ORVA 5H2FV 4EOTA 1NJIQ 1VQ8P 3GF3A 1KILE 1SQXK 1T2KD 1VQ6P 3PH2B 2V08A 4R4MA 3O5CA 4EIFA 1C2RA 4RSZA 3L4MA 2JKVA 4HH2A 1JY3N 2Z4EA 3OW2O 2R5BA 1SQVK 1L0NJ 3O20A 3AE8C 3A5TA 4D6TG 3A3YB 3V6IA 4J20A 1QKSA 3CP5A 2Q3IA 1ZMEC 1NTMD 1H31A 1NKNA 1YEAA 1LTBC 2YKOA 3L72E 4ASVA 4WY4A 2XDJA 2E74B 3M91A 4PD4H 2FY8A 4PJ0V 2C9XB 4L1QA 3V4WA 2IZ1A 4DCKA 1E29A 4CPGA 1PPJE 1CYJA 4AALA 3O6QA 2Z5HA 1E2RA 4GDOA 2OZ1B 2YNYA 1MG3D 5GTHH 1KZUB 3WUVA 3H1HD 5CBNA 1M1KQ 2IYOA 3BASA 5APVA 3O0RC 4GODA 1CYIA 1N73B 4H44D 4PJ0E 4EICA 1SQBK 3M0AA 1LT9A 3VP8A 3CC2P 1RF0A 5CYTR 1SQPG 4U3FD 1SQVD 3PXTA 1H32A 5KKZC 1L4AD 1LTGC 2RN0A 1PZQA 3CX5D 2W6AA 5KKZB 4H0LC 2JDIH 4FANA 1DT1A 2M3BA 3BCCG 1IZL0 1DEBA 3D0WA 1EZVG 4EIJA 1URQD 3U1AA 3NTNA 1BGYD 2QM7A 2QSIA 3H25A 3JCUH 1I8PA 3AE7C 3AEEC 4GEDB 1NU1J 1G1JA 5CICB 451CA 3SFEC 4EIDA 2GUSA 1T3JA 1QN2A 3L75G 3OA8A 1BSNA 1BCCD 2DW3A 3VP9A 1IZNB 1IO3A 1OW8A 1AJYA 5APSA 2ZAEB 1KIBA 2ZFCA 4PD4D 3DP5A 5CIHB 1PGQA 3RGUA 2WSFH 1X22A 5KAIH 2KLUA 1RY3A 1SQXG 1S5LV 1K04A 2Y9YA 2A06G 1HTLC 3H1IE 1MFZA 2WT7B 2H7HA 3HE5A 1KV4A 1M1JB 1ZR4A 1WEJF 2FBWC 3CWBE 1CSBA 2FYUK 1PL5A 3ZBMA 2PCCB 2WSEH 4L74A 1YIQA 3SLEA 1DVVA 1J1EC 5TISH 3B71A 3H1HE 5CIBB 4GOEA 3G71P 1KORA 2W27A 3MGNA 4ASWA 1NYHA 4U7JA 4AAOA 2V7QJ 1I8OA 4H0LD 2XNDH 1JCDA 4N78E 3RK3C 4WY4B 1CTYA 1KFMA 3UIAA 5C39A 3KPEA 3WUUA 4H44B 1EB7A 1YQ3C 2FXMA 1PP9E 1UIIA 2L91A 2FFDB 2PAJA 4I1LA 1GL2D 2G3AA 1HCMA 4QAOA 3K5BA 1DW1A 1LP1B 2WWWA 2OZ1A 1QYZA 3KQGA 4YPCA 1QVFO 3SWKA 3B8EB 3HUSC 1VQKP 2FRCA 5KAFV 2CE1A 3S1KA 3RK2C 4HKZH 1QL4A 4IL6E 3B5NA 1N9CA 3MIWA 3CXHI 1ETPA 2WPQA 3SWFA 1SQBE 3H1LG 1URQB 3FXDA 1AYGA 1MV8A 3WMM0 3M97X 5CIEB 1NU1G 3L72G 3C8VA 3RN0A 3USSA 4AUWA 3DMIA 5K5GB 2ZOOA 3OCDB 5AVVB 4H13B 2E75C 4C46A 1SQPE 1LTAC 3VMZA 1LNQA 1SQQG 4EDFA 4GT1A 4TLFA 2ZT9B 2B87B 1G1IA 1H8AA 4XYDB 2I8DA 3FX0A 5M1BA 3L71E 2ORLA 4JBZA 3PHLA 3N7NA 3ZOYA 1PV3A 1AA0A 1CORA 1KILB 3L73G 1N7SB 5GTIE 1S2EA 5KLVE 4WQ9A 1Q86Q 3RL0g 1IFPA 2BCCE 4WY4D 1ZW0A 4BRYB 3PXSA 3CCLP 1L0NG 2VRSA 4BRYA 5EXQA 3LW5J 1NTZG 5CJ4A 1SFCA 2Z5IA 4N3YB 1U57A 4FA9A 1IFMA 2YXQB 4IL6H 4JYBA 1KYOE 1CZQA 4UB8V 3V2PA 1OAEA 2D2CB 1W2BO 1PGOA 3B5NC 5DF5A 1BGYG 1U7MA 2D2CC 4K3IA 1FZBA 1KMIZ 1CI6B 1IK7A 5AW2B 2BH5X 1W2LA 1KYOW 3VTPC 2Y0EA 3VMYA 1FJ0A 5H2FE 1OZHA 1VQLP 4OVNF 2OYIA 1KB9H 1GDVA 3ZOOA 1S1CX 4U3FE 2WVRA 3OA8B 3L75D 1XTGB 1SQBJ 1SQPJ 3ZOXA 1H31B 1SQQK 1JNMA 3E7KA 1CW5A 4H0JA 2CE0A 2M5AB 4OGQB 2WTYA 2MJZA 1OVVA 5APQA 1U7JA 1VQ4P 2P7JA 2QRXA 3A0BH 3M9BA 3CYTI 3C9IA 5AVZB 2ZYAA 3M0DA 3AE2C 2D2CD 3P32A 1OW6A 1FE6A 3MHVA 1RE3C 2YKQA 3CI9A 3BCCD 2CPSA 2ZXYA 3CXHD 2R5DA 3CC7P 3VMAA 1GL2A 2NRGA 1FZGA 1PP9J 5B66V 3E1RA 4EIEA 2R32A 1H1OA 3SSUA 4WQEA 1Q7YQ 3AEBC 4DZOA 1JB0J 4UB8E 2N1TD 3Q1MA 5AW0B 2BPBB 3RBZA 1NTKG 1HGZA 3P8MC 1VQ7P 1R8EA 4WQDA 3L73D 2M0BA 1NTMK 3H1HJ 3O6QB 2QJYC 2M8RA 4LGDE 1LT1A 1GDTA 1KN7A 3CWBJ 2JWAA 2OARA 3CXHE 2XNXA 2FYUJ 3RK3B 2NZ2A 4AX3A 1MZ4A 1JUNA 1AKKA 1GJQA 4XE5B 3H1IJ 2Y0CA 3JSVC 2IX7C 2YO3A 2Q9IA 3B4SA 2XZRA 2C8SA 4JYCA 1YTZT 2FFDC 1RE3A 3KDPB 5AW9B 3Q3DA 3HTKB 2KK7A 3N4XA 3C2CA 1PFIA 1T2KC 1M90Q 4L3GA 4R4LA 1S9KD 1M1JA 5KJ7D 3PJSK 1YQ4C 2WT7A 5TISE 3WFEC 2KZJA 2VHDA 1Q81Q 3HE4B 1ZV8A 2B87A 3H1LE 1KB0A 2N18C 4W7YA 4O1WA 2HPCA 3V2RA 3VRDA 2OYIB 3L70D 3IFMA 1LTJC 1HJ5A 2LIRA 3Q5RA 3H1JD 1GU4A 1RAQA 5APWA 2HG5D 1W2EA 1HJBA 2N9JA 4PWAA 2Q1KA 1CTJA 2YKPA 1IK9A 3TDKA 5E79E 1P84E 3MP7B 1IFJA 2V07A 1SQQE 3X39A 4FB1A 1QEXA 4FA1A 1GZLA 1QX8A 3SXTA 1GK6A 5AW8B 2N9YB 1BDDA 3G6EP 1GIWA 5GTIH 5AVTB 1C6SA 1G2CA 1KILC 2I1KA 2K88A 3M9QA 1N50A 2K1AA 4AAMA 2XTSB 4I2LC 1C2NA 4IOIH 2GIWA 3CWBG 2JEEA 2JTIB 1S4XA 1EZVE 1AVOA 4ZNCA 1VF5B 3I55P 2I1JA 2C1UA 3DR0A 2QIWA 2QM8A 1RF1A 4HJGH 2E75D 4NPEA 3D6ZA 4JF7A 2BGVX 3KHUA 2BEQD 1SQXE 4WQ7A 2H8PD 1DIIC 3QWOC 1C6RA 2ZZS1 3CCSP 3HD7D 1LC2A 4I7ZB 3VYMA 1T6AA 3WFDC 4Y99B 1FAVA 2KYVA 2B89A 5DFSA 2OYHA 1AFOA 3MD0A 3V4QA 1DX7A 3T97B 3SFDC 1JTHA 3H32B 4NPDA 3ZCFA 1KQFB 1L9JC 4MN4C 3CX5E 5KLVK 3H1LJ 4WQAA 1GMJA 1H0TB 2HODA 3H6PA 1N8RQ 2ZJSE 1CSXA 3CMEP 3HQ7A 4Y5RA 2V4HA 1Y8AA 1T3UA 1PPJG 5BU8B 2XV5A 2N1TB 3KYQA 1NTZD 1SQXD 1SQVG 1S6VB 3RBXA 3TGUE 2H43A 2G8YA 2O01N 1IFNA 2W8ZA 1SQPK 1LTTC 2BCCG 3ITKA 4BWNA 1Q2NA 4WB4A 2ZXEB 1CIEA 2IBZI 1PGPA 1NWQA 2IZ0A 1SQBD 2QJPC 1GD2E 2JQRA 4AYCA 4ZMDA 2ZT9C 1LWUA 3PH0A 2BH4X 1FOCA 1M1JC 4JPZB 3G9RA 1GTWA 2E74D 5KAIE 1J1DB 1KB9D 1KX2A 4ZKUA 2OTLP 1DW2A 1WMKA 1CSVA 2IFNA 3CWBD 3H1KE 1GL2C 3L35A 1FI7A 2FFDA 1PP9D 2KSJA 1GU2A 5CCHD 1DVHA 4HYTB 2O01H 1M57D 3WU2H 1JCCA 1BCCJ 2K9JB 1BGYJ 2Q5UA 4D6TE 4BXLA 3L71G 4FA5A 2Y0DA 3HRNA 1CTZA 1M6ZA 3L73J 2PP6A 5AVRB 2KP8A 3A0HE 1ZXGA 1E5WA 1PPJD 2L5GB 2L4DA 2QEXP 5B6QA 3HUSB 2JP3A 1S9KE 2W6JH 4N6JA 1RF1C 4GIFA 1UIXA 1LT9B 3ZIYA 3RK2D 1YJNP 3RK3E 1RF1B 4N0KA 1CHIA 1N86A 4L3HA 1SVFA 1RAPA 1KYOD 1EDIA 3CU4A 2AIUA 1VL2A 1DH3A 3BVHA 1ZR2A 3TGUD 1SQVJ 1M56D 2N18B 1ZRTE 1DD4A 4PJ0H 1A56A 2PFXA 2KZIA 4U3FJ 3JBTB 2QJKC 5BU5A 5TISV 5C9MA 5CIFB 1FI9A 3T97A 3A2AA 2KIKA 1E8EA 1FDMA 5GTHE 1BSHA 1LTJB 2ZVOB 5AW1B 3CL3D 2FXPA 2E5TA 1P84H 4M3LA 5E79H 5KTBA 1HF9A 4V2KA 3C1LA 2HODB 1JY2O 1CHJA 3IF4A 3NMDA 4PV1D 1KD1Q 2Q6QA 1FBMA 1L0LK 2P1JA 2AXCA 2CA4B 4RKUJ 1ZRTD 1YYCA 3RMZA 1JDLA 1NGMB 1K3HA 3LIEA 2YIUB 2GA1A 3MUDC 3TGUG 4RO0A 1M8OB 3U1CA 1K73Q 1FZCB 1S3JA 2NPSB 3CXHW 5CCHC 1FZCC 4Q5PA 4RJTA 4IFFA 2PCBB 1PIXA 2W83C 1LWUB 3CD6P 1VF5C 1KILA 3Q5PA 1PGJA 3AE1C 4WBAA 1HJ0A 2YK3A 1H9YA 1SFCD 5IY51 1BE3J 1NTZJ 2O1JA 1NTKK 1P84I 1RE4C 1MG2D 3L4OA 2LKMA 1PP9G 1OCDA 3CCRP 1MKMA 3AEGC 3CCQP 4XA4A 1VQOP 1KQSO 2N1TA 3H1LD 1FS0E 3HTKA 1L4AB 2C1DB 4W80A 2AI5A 1K3GA 2BEZF 3NFQA 1L4AC 1G2CB 2KOGA 1MFTA 5CHXA 5KAFH 2IDBA 3AE3C 5AW5B 2KSEA 3CX5I 1CHHA 3W67A 2KS1B 4UB8H 2WPSA 2IBZE 2I8FA 5AW4B 2K3RA 2CA3B 1NAYA 2WMMA 3TYYA 1FZAA 4Z1MH 2YCCA 2W90A 1EDJA 1AOQA 1CEDA 1X8YA 4UB6H 1A8CA 3CPWO 1WRGA 3WU2E 1OWAA 3PLNA 5AVSB 1L0LG 2QVAA 1WT6A 2V7QH 3W68A 1N90A 1GW3A 5AVYB 2QG4A 1M70A 2LXCB 4HB1A 3CCMP 1W5CT 1CXAA 2WSCJ 3OCDA 3MUDA 4AQRD 1R0QA 3L70E 2WQYC 1QGKB 4WQBA 5APYA 1GKSA 1CXCA 2E5YA 1HH0A 3L75E 1M7LA 4GKGA 5CIGB 1NH4A 3EWKA 1DW3A 4A7PA 3GG2A 2QJPB 1FI3A 4L75A 1JMBA 3CLQA 1RH5B 1JO5A 3H1JE 2FKWB 1K8AQ 1N7LA 1ZOYC 5AW3B 1IRWA 1CNOA 3OA7A 1BE3E 1S5LX 3CCEP 5AVQB 2EXVA 2ZYGA 2QJYB 1F1FA 1E79H 1Q90D 3AE5C 1VQ5P 1GL2B 3RN1A 5CCGD 1I54A 1BE3G 4L73A 2GM4A 2OTJP 3ZOWA 2R3CA 1IO4A 3MK7C 3L74D 2IBZD 1MUUA 1RE4A 2WSSH 3IAOA 5B66H 3GHGC 4WQCA 3GHGA 1DW0A 3GHGB 5CCHA 3U59A 1NNOA 2SPZA 1HBWA 1SS1A 1EXIA 1N7SA 2JR8A 4XXLA 1JOCA 3D6YA 3CCVP 2FYUG 3L71J 3G4SP 3WC8A 1NHLA 1KB9I 3HQ6A 2PGDA 3GMAA 2OYOA 1B7VA 3MTUE 2K37A 1QVGO 2D0WA 1C6OA 2LR2A 2HV4A
chains in the Genus database with same CATH topology
2GB8B 1NTKD 3KHUA 1LMSA 4WQ7A 1DIIC 1C6RA 2ZZS1 1WEJF 1J3SA 1LFMA 1LC2A 3VYMA 1QL3A 3WFDC 3ZBMA 2PCCB 1YIQA 3A9FA 1CO6A 3SLEA 5C0ZA 1DVVA 1U75B 5CIBB 1M60A 5DFSA 4AAOA 1C7MA 1I8OA 3ZCFA 5AURA 1CCHA 1L9JC 4WQAA 4O1QA 1CTYA 1CCRA 5CIDB 4FAVA 1CSXA 1EB7A 3HQ7A 4UB6V 4Y5RA 2B11B 1C75A 2L91A 3WFBC 1IQCA 1HCMA 4QAOA 1NTZD 1DW1A 1SQXD 2OZ1A 1QYZA 2N9IA 1S6VB 1YICA 2AXTV 1KV9A 1BL9A 3PTZA 3TYIA 2FRCA 5KAFV 2CE1A 2D0SA 4PW9B 155CA 3MK7B 1QL4A 3ITKA 1N9CA 5E79V 2YQBA 1N15A 2GC4D 1IRVA 1CIEA 1ETPA 4H0KA 3A0BV 1CC5A 3H1KD 3A0HV 1AYGA 5TJHA 3FWLA 351CA 3M97X 1SQBD 5CIEB 2JQRA 3RN0A 2B4ZA 1P84D 1F1CA 1SQPD 3SJLA 1GQ1A 3DMIA 2ZOOA 1CRGA 3OCDB 3NBSA 2BH4X 1FOCA 1I6EA 2DGEA 1KB9D 1H33B 1KX2A 1DW2A 3VNWA 1H33A 1CSVA 2KS1A 4EDFA 1HZVA 3CWBD 1EZVD 5B5EV 4XYDB 4YE1A 3RLMA 1FI7A 2O3JA 1PP9D 1YEBA 1GU2A 1ZZHA 3HQ9A 1LC1A 1DVHA 2ORLA 1L0LD 3PHLA 3ZOYA 2CXBA 2BLFB 1CYCA 1CORA 1CRIA 2ZONG 1CIHA 2K9JB 4WQ9A 1RZ5A 1CSWA 5GTHV 4FA5A 1RZ6A 2KNCB 2Y0DA 2MTAC 1CTZA 1M6ZA 2C2CA 2DVHA 3PXSA 3O1YA 1PPJD 1WVEC 5EXQA 1DIQC 2L4DA 2RMZA 5B6QA 4FA9A 1HROA 5DJQB 3ZIYA 1KX7A 1H9XA 1HJ4A 4UB8V 4AANA 4N0KA 2N3YA 1CRYA 1CHIA 1OAEA 5KLVD 4L3HA 1RAPA 2FWLA 1KYOD 1CRHA 3CU4A 2AIUA 5DF5A 3TGUD 1VYDA 2N18B 1HRCA 1A56A 4K3IA 1NMLA 4NFGB 3JBTB 5TISV 5C9MA 3TF5A 2BH5X 1W2LA 5CIFB 1FI9A 1KYOW 2FYUD 2Y0EA 2Q3EA 1FJ0A 4P4QB 4GYDA 1E8EA 1NIRA 1GDVA 3NWVA 5KLIB 1HZUA 3ZOOA 5GTIV 1I55A 4V2KA 3OA8B 3L75D 3SWSA 1YNRA 2A06D 3ZOXA 1CHJA 1H31B 1C52A 3KZIV 3PRJA 1A2SA 2B12B 1COTA 2CA4B 2C1VA 1BE3D 1ZRTD 2CE0A 1CRJA 4H0JA 3RMZA 1JDLA 2ZBOA 1K3HA 2YIUB 1H32B 3CYTI 3CXHW 3WFCC 2FYNB 4Q5PA 4RJTA 2PCBB 1YTCA 3SVWA 3BCCD 2C1DA 2ZXYA 3CXHD 3WUIA 2PACA 3ORVA 2YK3A 4LJIA 5H2FV 3VMAA 1H9YA 5KAIV 3HQ8A 5B66V 5IY51 1L9BC 4EIEA 3PH2B 2V08A 1H1OA 3O5CA 4WQEA 2B0ZB 1MG2D 1C2RA 3L4OA 4RSZA 3L4MA 4EIFA 1OCDA 1HH7A 2BPBB 1NMIA 1FHBA 1FCDC 4WQDA 3L73D 3H1LD 1CRCA 1CSUA 2C1DB 2AI5A 2MHMA 1K3GA 4IL6V 3O20A 1HJ3A 3L72D 4J20A 2JWAA 1YCCA 1QKSA 3CP5A 1CHHA 1NTMD 1H31A 1YEAA 4AX3A 1MZ4A 2I8FA 1AKKA 1GJQA 2CA3B 1NU1D 2C9XB 4PJ0V 2Y0CA 4L1QA 4WQ8A 2YCCA 2LITA 4MU8A 1AOQA 1CEDA 2C8SA 1A8CA 1E29A 1CYJA 3PLNA 4AALA 1N90A 4FA4A 1E2RA 4KMGA 1U74B 3C2CA 3GW6A 2OZ1B 2QG4A 1M70A 1W5CT 2BCCD 1MG3D 1CXAA 3OCDA 4L3GA 1R0QA 2N3BA 3H1HD 4WQBA 3O0RC 3WFEC 1GKSA 2VHDA 1CYIA 1CXCA 1KB0A 2N18C 4EICA 4O1WA 5CIGB 3VRDA 1DW3A 4A7PA 3L70D 3GG2A 5CYTR 4U3FD 2QJPB 1LS9A 1FI3A 1HJ5A 1SQVD 2LIRA 3PXTA 3H1JD 1H32A 1RAQA 3WU2V 2RN0A 3CX5D 5KKZB 2N9JA 4PWAA 4JCGA 4FANA 1CTJA 1DT1A 1IRWA 1CNOA 1YFCA 1I5TA 3TDKA 3CX5W 1IZL0 2EXVA 2V07A 3X39A 4FB1A 2QJYB 1F1FA 1BGYD 1I6DA 4FA1A 2B10B 3PXWA 3RN1A 3SXTA 1I54A 1I8PA 3ZOWA 2N9YB 4GEDB 3MK7C 3L74D 1GIWA 2IBZD 4D6TD 5CICB 451CA 1C6SA 4EIDA 4WQCA 1QN2A 3OA8A 1AOFA 1BCCD 2BCNB 4DY9A 1DW0A 1IO3A 1N50A 1L0ND 3L71D 4AAMA 1NNOA 1CIGA 1KIBA 2XTSB 1CIFA 1C2NA 4PD4D 1SQQD 3DP5A 4XXLA 5CIHB 2GIWA 2JTIB 5DJQC 3WC8A 2GC7D 2QJKB 3H1ID 3NBTA 3HQ6A 1B7VA 1S5LV 2C1UA 3DR0A 2D0WA 1C6OA 2HV4A 2BGVX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GB8 B;  1NTK D;  3KHU A;  1LMS A;  4WQ7 A;  1DII C;  1C6R A;  2ZZS 1;  1WEJ F;  1J3S A;  1LFM A;  1LC2 A;  3VYM A;  1QL3 A;  3WFD C;  3ZBM A;  2PCC B;  1YIQ A;  3A9F A;  1CO6 A;  3SLE A;  5C0Z A;  1DVV A;  1U75 B;  5CIB B;  1M60 A;  5DFS A;  4AAO A;  1C7M A;  1I8O A;  3ZCF A;  5AUR A;  1CCH A;  1L9J C;  4WQA A;  4O1Q A;  1CTY A;  1CCR A;  5CID B;  4FAV A;  1CSX A;  1EB7 A;  3HQ7 A;  4UB6 V;  4Y5R A;  2B11 B;  1C75 A;  2L91 A;  3WFB C;  1IQC A;  1HCM A;  4QAO A;  1NTZ D;  1DW1 A;  1SQX D;  2OZ1 A;  1QYZ A;  2N9I A;  1S6V B;  1YIC A;  2AXT V;  1KV9 A;  1BL9 A;  3PTZ A;  3TYI A;  2FRC A;  5KAF V;  2CE1 A;  2D0S A;  4PW9 B;  155C A;  3MK7 B;  1QL4 A;  3ITK A;  1N9C A;  5E79 V;  2YQB A;  1N15 A;  2GC4 D;  1IRV A;  1CIE A;  1ETP A;  4H0K A;  3A0B V;  1CC5 A;  3H1K D;  3A0H V;  1AYG A;  5TJH A;  3FWL A;  351C A;  3M97 X;  1SQB D;  5CIE B;  2JQR A;  3RN0 A;  2B4Z A;  1P84 D;  1F1C A;  1SQP D;  3SJL A;  1GQ1 A;  3DMI A;  2ZOO A;  1CRG A;  3OCD B;  3NBS A;  2BH4 X;  1FOC A;  1I6E A;  2DGE A;  1KB9 D;  1H33 B;  1KX2 A;  1DW2 A;  3VNW A;  1H33 A;  1CSV A;  2KS1 A;  4EDF A;  1HZV A;  3CWB D;  1EZV D;  5B5E V;  4XYD B;  4YE1 A;  3RLM A;  1FI7 A;  2O3J A;  1PP9 D;  1YEB A;  1GU2 A;  1ZZH A;  3HQ9 A;  1LC1 A;  1DVH A;  2ORL A;  1L0L D;  3PHL A;  3ZOY A;  2CXB A;  2BLF B;  1CYC A;  1COR A;  1CRI A;  2ZON G;  1CIH A;  2K9J B;  4WQ9 A;  1RZ5 A;  1CSW A;  5GTH V;  4FA5 A;  1RZ6 A;  2KNC B;  2Y0D A;  2MTA C;  1CTZ A;  1M6Z A;  2C2C A;  2DVH A;  3PXS A;  3O1Y A;  1PPJ D;  1WVE C;  5EXQ A;  1DIQ C;  2L4D A;  2RMZ A;  5B6Q A;  4FA9 A;  1HRO A;  5DJQ B;  3ZIY A;  1KX7 A;  1H9X A;  1HJ4 A;  4UB8 V;  4AAN A;  4N0K A;  2N3Y A;  1CRY A;  1CHI A;  1OAE A;  5KLV D;  4L3H A;  1RAP A;  2FWL A;  1KYO D;  1CRH A;  3CU4 A;  2AIU A;  5DF5 A;  3TGU D;  1VYD A;  2N18 B;  1HRC A;  1A56 A;  4K3I A;  1NML A;  4NFG B;  3JBT B;  5TIS V;  5C9M A;  3TF5 A;  2BH5 X;  1W2L A;  5CIF B;  1FI9 A;  1KYO W;  2FYU D;  2Y0E A;  2Q3E A;  1FJ0 A;  4P4Q B;  4GYD A;  1E8E A;  1NIR A;  1GDV A;  3NWV A;  5KLI B;  1HZU A;  3ZOO A;  5GTI V;  1I55 A;  4V2K A;  3OA8 B;  3L75 D;  3SWS A;  1YNR A;  2A06 D;  3ZOX A;  1CHJ A;  1H31 B;  1C52 A;  3KZI V;  3PRJ A;  1A2S A;  2B12 B;  1COT A;  2CA4 B;  2C1V A;  1BE3 D;  1ZRT D;  2CE0 A;  1CRJ A;  4H0J A;  3RMZ A;  1JDL A;  2ZBO A;  1K3H A;  2YIU B;  1H32 B;  3CYT I;  3CXH W;  3WFC C;  2FYN B;  4Q5P A;  4RJT A;  2PCB B;  1YTC A;  3SVW A;  3BCC D;  2C1D A;  2ZXY A;  3CXH D;  3WUI A;  2PAC A;  3ORV A;  2YK3 A;  4LJI A;  5H2F V;  3VMA A;  1H9Y A;  5KAI V;  3HQ8 A;  5B66 V;  5IY5 1;  1L9B C;  4EIE A;  3PH2 B;  2V08 A;  1H1O A;  3O5C A;  4WQE A;  2B0Z B;  1MG2 D;  1C2R A;  3L4O A;  4RSZ A;  3L4M A;  4EIF A;  1OCD A;  1HH7 A;  2BPB B;  1NMI A;  1FHB A;  1FCD C;  4WQD A;  3L73 D;  3H1L D;  1CRC A;  1CSU A;  2C1D B;  2AI5 A;  2MHM A;  1K3G A;  4IL6 V;  3O20 A;  1HJ3 A;  3L72 D;  4J20 A;  2JWA A;  1YCC A;  1QKS A;  3CP5 A;  1CHH A;  1NTM D;  1H31 A;  1YEA A;  4AX3 A;  1MZ4 A;  2I8F A;  1AKK A;  1GJQ A;  2CA3 B;  1NU1 D;  2C9X B;  4PJ0 V;  2Y0C A;  4L1Q A;  4WQ8 A;  2YCC A;  2LIT A;  4MU8 A;  1AOQ A;  1CED A;  2C8S A;  1A8C A;  1E29 A;  1CYJ A;  3PLN A;  4AAL A;  1N90 A;  4FA4 A;  1E2R A;  4KMG A;  1U74 B;  3C2C A;  3GW6 A;  2OZ1 B;  2QG4 A;  1M70 A;  1W5C T;  2BCC D;  1MG3 D;  1CXA A;  3OCD A;  4L3G A;  1R0Q A;  2N3B A;  3H1H D;  4WQB A;  3O0R C;  3WFE C;  1GKS A;  2VHD A;  1CYI A;  1CXC A;  1KB0 A;  2N18 C;  4EIC A;  4O1W A;  5CIG B;  3VRD A;  1DW3 A;  4A7P A;  3L70 D;  3GG2 A;  5CYT R;  4U3F D;  2QJP B;  1LS9 A;  1FI3 A;  1HJ5 A;  1SQV D;  2LIR A;  3PXT A;  3H1J D;  1H32 A;  1RAQ A;  3WU2 V;  2RN0 A;  3CX5 D;  5KKZ B;  2N9J A;  4PWA A;  4JCG A;  4FAN A;  1CTJ A;  1DT1 A;  1IRW A;  1CNO A;  1YFC A;  1I5T A;  3TDK A;  3CX5 W;  1IZL 0;  2EXV A;  2V07 A;  3X39 A;  4FB1 A;  2QJY B;  1F1F A;  1BGY D;  1I6D A;  4FA1 A;  2B10 B;  3PXW A;  3RN1 A;  3SXT A;  1I54 A;  1I8P A;  3ZOW A;  2N9Y B;  4GED B;  3MK7 C;  3L74 D;  1GIW A;  2IBZ D;  4D6T D;  5CIC B;  451C A;  1C6S A;  4EID A;  4WQC A;  1QN2 A;  3OA8 A;  1AOF A;  1BCC D;  2BCN B;  4DY9 A;  1DW0 A;  1IO3 A;  1N50 A;  1L0N D;  3L71 D;  4AAM A;  1NNO A;  1CIG A;  1KIB A;  2XTS B;  1CIF A;  1C2N A;  4PD4 D;  1SQQ D;  3DP5 A;  4XXL A;  5CIH B;  2GIW A;  2JTI B;  5DJQ C;  3WC8 A;  2GC7 D;  2QJK B;  3H1I D;  3NBT A;  3HQ6 A;  1B7V A;  1S5L V;  2C1U A;  3DR0 A;  2D0W A;  1C6O A;  2HV4 A;  2BGV X; 
#chains in the Genus database with same CATH topology
 1DIP A;  1KQG B;  2C9L Y;  5AVU B;  2R3S A;  1LFM A;  2YXR B;  1QL3 A;  3TSI A;  3KZI H;  4L76 A;  3H1K G;  3A9F A;  1CO6 A;  3HD7 A;  1U75 B;  3B5N D;  2IBZ G;  1IJD B;  1JEK A;  4NPF X;  2OYI C;  1MZ9 A;  1AQT A;  1KIL D;  2A45 I;  2K9Y A;  3EFF K;  1S5L E;  3LW5 H;  1AQ5 A;  4O1Q A;  1OIP A;  1CCR A;  3SWY A;  3HE5 B;  1GU5 A;  5CID B;  4FAV A;  2QA4 P;  4UB6 V;  1C75 A;  3KZI E;  2N9I A;  1YIC A;  2AXT V;  1KV9 A;  1BL9 A;  2HYN A;  1XTC C;  3MZW B;  3F89 A;  155C A;  4N78 D;  4IFD K;  2IPP A;  3GF7 A;  2YQB A;  2P10 A;  2N9B A;  3A0B E;  1IRV A;  2ZXX A;  1CC5 A;  3CMA P;  1NTM J;  3BCC E;  5TJH A;  3FWL A;  1KB9 E;  3H1J G;  1P84 D;  1F1C A;  3SJL A;  1GQ1 A;  3B5N B;  5B66 E;  1N2D C;  2P58 A;  1FOS E;  1SQQ J;  2YMK A;  3VNW A;  3RL0 D;  2KXP B;  1HZV A;  5B5E E;  3L74 J;  5B5E H;  3RLM A;  1YEB A;  1KYO H;  1ZZH A;  3L70 G;  5H2F H;  1DD3 A;  2E43 A;  1L0L D;  5AW7 B;  2CXB A;  2BLF B;  1CYC A;  1VQP P;  1GW4 A;  1CRI A;  2ZON G;  3P8C D;  5CMZ A;  2CPB A;  5GTH V;  1JY2 P;  1RZ6 A;  2KNC B;  3EQ2 A;  3RK2 B;  3TNU B;  2MTA C;  1RQV A;  3CXH H;  2DVH A;  3WUT A;  3O1Y A;  4PV1 C;  1WVE C;  3CCU P;  2N1T C;  2RMZ A;  3I5C A;  1FZF A;  1NTK E;  1YIT P;  4GOF A;  1HRO A;  3O8Z A;  2HPC B;  5DJQ B;  4EYY Q;  5BVZ A;  1HJ4 A;  2N3Y A;  5KLV D;  3AE6 C;  3NXS A;  2FWL A;  1VYD A;  2WZ7 A;  1HRC A;  2FYU E;  4QMA A;  1NML A;  4LC1 A;  2HFE D;  1JY2 N;  5KJ7 C;  3I56 P;  4P4Q B;  1K9M Q;  1YJW P;  1IC2 A;  2J59 M;  1NIR A;  1JM0 A;  3LID A;  1EXJ A;  3NWV A;  1HZU A;  1SFC C;  3ZDM A;  1I55 A;  1R5S A;  1YJ9 P;  1YNR A;  2A06 D;  1NO4 A;  4C7N B;  1C52 A;  1CI6 A;  2OQQ A;  3PRJ A;  3Q5S A;  4C7N A;  3OAK A;  2C1V A;  1FOS F;  4Y28 J;  1BE3 D;  1CRJ A;  2AEJ A;  5KLV G;  1NTM E;  2BAS A;  3V5B A;  4I6M C;  3M9H A;  1H32 B;  3KXD A;  3L74 G;  3RK3 D;  4EI2 A;  3L72 J;  4KT0 J;  2AEM A;  3L70 J;  2JJL A;  3WFC C;  1LP1 A;  3AE4 C;  1HWT C;  4KHX A;  4IFM A;  3SVW A;  4WWI A;  4I7Z C;  4LJI A;  5KAI V;  3HQ8 A;  4YXD C;  1AV1 A;  2IYP A;  4K35 A;  1L9B C;  1JTH B;  3OJA B;  3EFG A;  2B0Z B;  4JQ0 D;  5CBO A;  2RH0 A;  3PP5 A;  1HH7 A;  3H1H G;  1L0L J;  4H0L B;  1HVV A;  1KC8 Q;  4RES B;  1NMI A;  1FHB A;  1BDC A;  2XKM A;  1FCD C;  4WVZ A;  1CRC A;  1CSU A;  1NTK J;  1KFN A;  1OVU A;  2MHM A;  4IL6 V;  1HJ3 A;  3L72 D;  3E1I A;  1YCC A;  2E76 D;  1FC2 C;  3FXE A;  1ZN5 A;  1NU1 D;  1VQM P;  4WQ8 A;  2HLO A;  2LIT A;  1H88 A;  3L37 A;  4MU8 A;  3GLM A;  3II6 A;  1OMI A;  2H88 C;  1Y47 A;  3AE9 C;  2NPS A;  3CCJ P;  2UWJ E;  1X0T A;  1KYO I;  4FA4 A;  4KMG A;  1U74 B;  2JO1 A;  3GW6 A;  1GK4 A;  4C7R A;  2E74 C;  2OYH C;  2BCC D;  3L74 E;  5CJ0 A;  1USE A;  1VQN P;  3L4F A;  1FDI A;  2N3B A;  1YTZ I;  3AEC C;  3P8C E;  3R4Y A;  2ZYD A;  1LWU C;  2C0W A;  3M0D C;  2KLV A;  1VF5 D;  5KLV J;  4KJM A;  3ABV C;  3AED C;  3HD7 C;  3JCU E;  3BAT A;  3QH9 A;  1LS9 A;  3BRT B;  1L4A A;  3HD7 B;  1SQB G;  1EC5 A;  2WPR A;  3WU2 V;  2ITA A;  1LGH B;  3BCC J;  3P7K A;  1IFI A;  4WY4 C;  4JCG A;  3L36 A;  2XU6 A;  3H1J J;  2ZT9 D;  3S9O A;  2KNC A;  3D70 A;  3TNU A;  1YFC A;  3S4R A;  1I5T A;  3Q2Y A;  2C0X A;  1NU1 K;  3CX5 W;  2PRR A;  2YO2 A;  5CCG A;  1N73 A;  3HE4 A;  3FWN A;  1I6D A;  2B10 B;  3PXW A;  4H44 C;  2POH A;  3L75 J;  3D71 A;  2RKL A;  3HUS A;  3BRV B;  4D6T D;  1YHQ P;  3AEF C;  5CCG C;  4DT0 A;  1AOF A;  4PV1 B;  2BCN B;  4DY9 A;  4PD4 E;  2MKV A;  1L0N D;  1N7S D;  3L71 D;  5L8R J;  5APX A;  2LXB A;  1CIG A;  1CIF A;  1SQQ D;  1W5C E;  1URQ C;  2O01 J;  5DJQ C;  1JY3 P;  2FXO A;  3CC4 P;  2M5A A;  2GC7 D;  2QJK B;  3H1I D;  3NBT A;  2H89 C;  2R44 A;  2K9J A;  4XFJ A;  2ZVN B;  3H32 A;  4DOJ A;  1KTM A;  4TT3 H;  2GB8 B;  1NTK D;  1RQU A;  2IFM A;  1L0N K;  2W6B A;  1LMS A;  1J3S A;  4D6T J;  2FYZ A;  1BGY E;  5C0Z A;  4W7Z A;  1M60 A;  1VDF A;  1C7M A;  1SFC B;  2A45 G;  5AUR A;  1CCH A;  1K05 A;  3CX5 H;  1JMM A;  4OWF A;  4OH8 B;  2C9N Y;  2KB7 P;  1D7M A;  3G3Z A;  1Q82 Q;  2B11 B;  4UB6 E;  1FDO A;  3WFB C;  1IQC A;  5AVW B;  2NPS C;  2Q7C A;  2J5U A;  4O9B A;  2AXT E;  4IL6 X;  1S5L H;  1QLE D;  3PTZ A;  1LTI C;  3TYI A;  1EDL A;  2D0S A;  1QL1 A;  2A45 H;  5KAF E;  4PW9 B;  3MK7 B;  1VPC A;  3M06 A;  1RHZ B;  1YI2 P;  5E79 V;  1N15 A;  1J2J B;  2GC4 D;  1N73 C;  4H0K A;  3A0B V;  1SP4 A;  4OGQ D;  2BCC J;  1OVR A;  1OXZ A;  3H1K D;  1HGV A;  1LTS C;  2GUV A;  3A0H V;  3A0H H;  1S72 P;  351C A;  1JY3 O;  1LT9 C;  2B4Z A;  2AXT H;  2WSF J;  4Y99 C;  1SQP D;  1H89 A;  1CRG A;  1NTM G;  1Y9B A;  1EDK A;  3NBS A;  1I6E A;  2DGE A;  1NOH A;  1H33 B;  1L0L E;  1EQ7 A;  1OX3 A;  1FZC A;  1SQV E;  1H33 A;  1X79 B;  2KS1 A;  1LJ2 A;  2P2U A;  3A7O A;  1EZV D;  5B5E V;  4YE1 A;  2E76 B;  1FJP A;  2O3J A;  2E75 B;  1OFC X;  3HQ9 A;  1LC1 A;  5DJT B;  3F5H A;  2E76 C;  1KQL A;  4DJG A;  2E42 A;  3RL0 C;  5EFW B;  2B88 A;  1CIH A;  3RL0 B;  1RZ5 A;  1NKZ B;  4K3A A;  1CSW A;  3V2Q A;  1SQX J;  1BCC G;  3L73 E;  1FZE A;  1SLQ A;  1YBK A;  2C2C A;  5AW6 B;  4LLH A;  1YIJ P;  1EZV I;  1DIQ C;  1N7S C;  1BCC E;  2AEF A;  2OTK E;  2OYH B;  2YIU C;  2WIT A;  1KX7 A;  1FJK A;  1H9X A;  5AVX B;  4AAN A;  5KJ7 A;  1CRY A;  1URQ A;  1X9V A;  2YMY A;  3V2N A;  1CRH A;  2WPV B;  3VMX A;  4YXW H;  1H0T A;  4YTP C;  1USD A;  1OW7 A;  3TK1 A;  2NPS D;  1ZLL A;  1NTZ E;  1J1D C;  4ZKP A;  1DEE G;  4NFG B;  2P67 A;  1J1E B;  2M3E A;  3TF5 A;  1VQ9 P;  1T8Z A;  1FU1 A;  2FYU D;  1L0N E;  2Q3E A;  4U3F G;  2A06 E;  3H1I G;  3AEA C;  4GYD A;  1Z56 A;  1QL2 A;  5DJU B;  3R2P A;  3H1K J;  2KUB A;  3VYI A;  5KLI B;  1R5L A;  5GTI V;  2O1K A;  5KLI C;  3JC2 2;  3SWS A;  2QE7 H;  3KZI V;  1AVY A;  1RF0 C;  2JWD A;  1A2S A;  2B12 B;  1COT A;  2WSC H;  1HUC A;  2J58 A;  1IFD A;  1NTZ K;  1L2P A;  3TGU J;  3VOP A;  2ZBO A;  2OGU A;  5APU A;  3FGA D;  4B86 A;  1LTJ A;  5APT A;  3IN6 A;  1TU3 F;  4PD4 I;  2HR3 A;  3IR9 A;  2KI7 B;  1NVO A;  1A02 F;  4H13 D;  2FYN B;  1NU1 E;  4OGQ C;  2B9B A;  1NAF A;  1YTC A;  2Y9Z A;  1A02 J;  2FYN C;  2WSE J;  1ZP0 C;  2C1D A;  2CK3 H;  3VN0 A;  3WUI A;  2PAC A;  4H13 C;  3ORV A;  5H2F V;  4EOT A;  1NJI Q;  1VQ8 P;  3GF3 A;  1KIL E;  1SQX K;  1T2K D;  1VQ6 P;  3PH2 B;  2V08 A;  4R4M A;  3O5C A;  4EIF A;  1C2R A;  4RSZ A;  3L4M A;  2JKV A;  4HH2 A;  1JY3 N;  2Z4E A;  3OW2 O;  2R5B A;  1SQV K;  1L0N J;  3O20 A;  3AE8 C;  3A5T A;  4D6T G;  3A3Y B;  3V6I A;  4J20 A;  1QKS A;  3CP5 A;  2Q3I A;  1ZME C;  1NTM D;  1H31 A;  1NKN A;  1YEA A;  1LTB C;  2YKO A;  3L72 E;  4ASV A;  4WY4 A;  2XDJ A;  2E74 B;  3M91 A;  4PD4 H;  2FY8 A;  4PJ0 V;  2C9X B;  4L1Q A;  3V4W A;  2IZ1 A;  4DCK A;  1E29 A;  4CPG A;  1PPJ E;  1CYJ A;  4AAL A;  3O6Q A;  2Z5H A;  1E2R A;  4GDO A;  2OZ1 B;  2YNY A;  1MG3 D;  5GTH H;  1KZU B;  3WUV A;  3H1H D;  5CBN A;  1M1K Q;  2IYO A;  3BAS A;  5APV A;  3O0R C;  4GOD A;  1CYI A;  1N73 B;  4H44 D;  4PJ0 E;  4EIC A;  1SQB K;  3M0A A;  1LT9 A;  3VP8 A;  3CC2 P;  1RF0 A;  5CYT R;  1SQP G;  4U3F D;  1SQV D;  3PXT A;  1H32 A;  5KKZ C;  1L4A D;  1LTG C;  2RN0 A;  1PZQ A;  3CX5 D;  2W6A A;  5KKZ B;  4H0L C;  2JDI H;  4FAN A;  1DT1 A;  2M3B A;  3BCC G;  1IZL 0;  1DEB A;  3D0W A;  1EZV G;  4EIJ A;  1URQ D;  3U1A A;  3NTN A;  1BGY D;  2QM7 A;  2QSI A;  3H25 A;  3JCU H;  1I8P A;  3AE7 C;  3AEE C;  4GED B;  1NU1 J;  1G1J A;  5CIC B;  451C A;  3SFE C;  4EID A;  2GUS A;  1T3J A;  1QN2 A;  3L75 G;  3OA8 A;  1BSN A;  1BCC D;  2DW3 A;  3VP9 A;  1IZN B;  1IO3 A;  1OW8 A;  1AJY A;  5APS A;  2ZAE B;  1KIB A;  2ZFC A;  4PD4 D;  3DP5 A;  5CIH B;  1PGQ A;  3RGU A;  2WSF H;  1X22 A;  5KAI H;  2KLU A;  1RY3 A;  1SQX G;  1S5L V;  1K04 A;  2Y9Y A;  2A06 G;  1HTL C;  3H1I E;  1MFZ A;  2WT7 B;  2H7H A;  3HE5 A;  1KV4 A;  1M1J B;  1ZR4 A;  1WEJ F;  2FBW C;  3CWB E;  1CSB A;  2FYU K;  1PL5 A;  3ZBM A;  2PCC B;  2WSE H;  4L74 A;  1YIQ A;  3SLE A;  1DVV A;  1J1E C;  5TIS H;  3B71 A;  3H1H E;  5CIB B;  4GOE A;  3G71 P;  1KOR A;  2W27 A;  3MGN A;  4ASW A;  1NYH A;  4U7J A;  4AAO A;  2V7Q J;  1I8O A;  4H0L D;  2XND H;  1JCD A;  4N78 E;  3RK3 C;  4WY4 B;  1CTY A;  1KFM A;  3UIA A;  5C39 A;  3KPE A;  3WUU A;  4H44 B;  1EB7 A;  1YQ3 C;  2FXM A;  1PP9 E;  1UII A;  2L91 A;  2FFD B;  2PAJ A;  4I1L A;  1GL2 D;  2G3A A;  1HCM A;  4QAO A;  3K5B A;  1DW1 A;  1LP1 B;  2WWW A;  2OZ1 A;  1QYZ A;  3KQG A;  4YPC A;  1QVF O;  3SWK A;  3B8E B;  3HUS C;  1VQK P;  2FRC A;  5KAF V;  2CE1 A;  3S1K A;  3RK2 C;  4HKZ H;  1QL4 A;  4IL6 E;  3B5N A;  1N9C A;  3MIW A;  3CXH I;  1ETP A;  2WPQ A;  3SWF A;  1SQB E;  3H1L G;  1URQ B;  3FXD A;  1AYG A;  1MV8 A;  3WMM 0;  3M97 X;  5CIE B;  1NU1 G;  3L72 G;  3C8V A;  3RN0 A;  3USS A;  4AUW A;  3DMI A;  5K5G B;  2ZOO A;  3OCD B;  5AVV B;  4H13 B;  2E75 C;  4C46 A;  1SQP E;  1LTA C;  3VMZ A;  1LNQ A;  1SQQ G;  4EDF A;  4GT1 A;  4TLF A;  2ZT9 B;  2B87 B;  1G1I A;  1H8A A;  4XYD B;  2I8D A;  3FX0 A;  5M1B A;  3L71 E;  2ORL A;  4JBZ A;  3PHL A;  3N7N A;  3ZOY A;  1PV3 A;  1AA0 A;  1COR A;  1KIL B;  3L73 G;  1N7S B;  5GTI E;  1S2E A;  5KLV E;  4WQ9 A;  1Q86 Q;  3RL0 g;  1IFP A;  2BCC E;  4WY4 D;  1ZW0 A;  4BRY B;  3PXS A;  3CCL P;  1L0N G;  2VRS A;  4BRY A;  5EXQ A;  3LW5 J;  1NTZ G;  5CJ4 A;  1SFC A;  2Z5I A;  4N3Y B;  1U57 A;  4FA9 A;  1IFM A;  2YXQ B;  4IL6 H;  4JYB A;  1KYO E;  1CZQ A;  4UB8 V;  3V2P A;  1OAE A;  2D2C B;  1W2B O;  1PGO A;  3B5N C;  5DF5 A;  1BGY G;  1U7M A;  2D2C C;  4K3I A;  1FZB A;  1KMI Z;  1CI6 B;  1IK7 A;  5AW2 B;  2BH5 X;  1W2L A;  1KYO W;  3VTP C;  2Y0E A;  3VMY A;  1FJ0 A;  5H2F E;  1OZH A;  1VQL P;  4OVN F;  2OYI A;  1KB9 H;  1GDV A;  3ZOO A;  1S1C X;  4U3F E;  2WVR A;  3OA8 B;  3L75 D;  1XTG B;  1SQB J;  1SQP J;  3ZOX A;  1H31 B;  1SQQ K;  1JNM A;  3E7K A;  1CW5 A;  4H0J A;  2CE0 A;  2M5A B;  4OGQ B;  2WTY A;  2MJZ A;  1OVV A;  5APQ A;  1U7J A;  1VQ4 P;  2P7J A;  2QRX A;  3A0B H;  3M9B A;  3CYT I;  3C9I A;  5AVZ B;  2ZYA A;  3M0D A;  3AE2 C;  2D2C D;  3P32 A;  1OW6 A;  1FE6 A;  3MHV A;  1RE3 C;  2YKQ A;  3CI9 A;  3BCC D;  2CPS A;  2ZXY A;  3CXH D;  2R5D A;  3CC7 P;  3VMA A;  1GL2 A;  2NRG A;  1FZG A;  1PP9 J;  5B66 V;  3E1R A;  4EIE A;  2R32 A;  1H1O A;  3SSU A;  4WQE A;  1Q7Y Q;  3AEB C;  4DZO A;  1JB0 J;  4UB8 E;  2N1T D;  3Q1M A;  5AW0 B;  2BPB B;  3RBZ A;  1NTK G;  1HGZ A;  3P8M C;  1VQ7 P;  1R8E A;  4WQD A;  3L73 D;  2M0B A;  1NTM K;  3H1H J;  3O6Q B;  2QJY C;  2M8R A;  4LGD E;  1LT1 A;  1GDT A;  1KN7 A;  3CWB J;  2JWA A;  2OAR A;  3CXH E;  2XNX A;  2FYU J;  3RK3 B;  2NZ2 A;  4AX3 A;  1MZ4 A;  1JUN A;  1AKK A;  1GJQ A;  4XE5 B;  3H1I J;  2Y0C A;  3JSV C;  2IX7 C;  2YO3 A;  2Q9I A;  3B4S A;  2XZR A;  2C8S A;  4JYC A;  1YTZ T;  2FFD C;  1RE3 A;  3KDP B;  5AW9 B;  3Q3D A;  3HTK B;  2KK7 A;  3N4X A;  3C2C A;  1PFI A;  1T2K C;  1M90 Q;  4L3G A;  4R4L A;  1S9K D;  1M1J A;  5KJ7 D;  3PJS K;  1YQ4 C;  2WT7 A;  5TIS E;  3WFE C;  2KZJ A;  2VHD A;  1Q81 Q;  3HE4 B;  1ZV8 A;  2B87 A;  3H1L E;  1KB0 A;  2N18 C;  4W7Y A;  4O1W A;  2HPC A;  3V2R A;  3VRD A;  2OYI B;  3L70 D;  3IFM A;  1LTJ C;  1HJ5 A;  2LIR A;  3Q5R A;  3H1J D;  1GU4 A;  1RAQ A;  5APW A;  2HG5 D;  1W2E A;  1HJB A;  2N9J A;  4PWA A;  2Q1K A;  1CTJ A;  2YKP A;  1IK9 A;  3TDK A;  5E79 E;  1P84 E;  3MP7 B;  1IFJ A;  2V07 A;  1SQQ E;  3X39 A;  4FB1 A;  1QEX A;  4FA1 A;  1GZL A;  1QX8 A;  3SXT A;  1GK6 A;  5AW8 B;  2N9Y B;  1BDD A;  3G6E P;  1GIW A;  5GTI H;  5AVT B;  1C6S A;  1G2C A;  1KIL C;  2I1K A;  2K88 A;  3M9Q A;  1N50 A;  2K1A A;  4AAM A;  2XTS B;  4I2L C;  1C2N A;  4IOI H;  2GIW A;  3CWB G;  2JEE A;  2JTI B;  1S4X A;  1EZV E;  1AVO A;  4ZNC A;  1VF5 B;  3I55 P;  2I1J A;  2C1U A;  3DR0 A;  2QIW A;  2QM8 A;  1RF1 A;  4HJG H;  2E75 D;  4NPE A;  3D6Z A;  4JF7 A;  2BGV X;  3KHU A;  2BEQ D;  1SQX E;  4WQ7 A;  2H8P D;  1DII C;  3QWO C;  1C6R A;  2ZZS 1;  3CCS P;  3HD7 D;  1LC2 A;  4I7Z B;  3VYM A;  1T6A A;  3WFD C;  4Y99 B;  1FAV A;  2KYV A;  2B89 A;  5DFS A;  2OYH A;  1AFO A;  3MD0 A;  3V4Q A;  1DX7 A;  3T97 B;  3SFD C;  1JTH A;  3H32 B;  4NPD A;  3ZCF A;  1KQF B;  1L9J C;  4MN4 C;  3CX5 E;  5KLV K;  3H1L J;  4WQA A;  1GMJ A;  1H0T B;  2HOD A;  3H6P A;  1N8R Q;  2ZJS E;  1CSX A;  3CME P;  3HQ7 A;  4Y5R A;  2V4H A;  1Y8A A;  1T3U A;  1PPJ G;  5BU8 B;  2XV5 A;  2N1T B;  3KYQ A;  1NTZ D;  1SQX D;  1SQV G;  1S6V B;  3RBX A;  3TGU E;  2H43 A;  2G8Y A;  2O01 N;  1IFN A;  2W8Z A;  1SQP K;  1LTT C;  2BCC G;  3ITK A;  4BWN A;  1Q2N A;  4WB4 A;  2ZXE B;  1CIE A;  2IBZ I;  1PGP A;  1NWQ A;  2IZ0 A;  1SQB D;  2QJP C;  1GD2 E;  2JQR A;  4AYC A;  4ZMD A;  2ZT9 C;  1LWU A;  3PH0 A;  2BH4 X;  1FOC A;  1M1J C;  4JPZ B;  3G9R A;  1GTW A;  2E74 D;  5KAI E;  1J1D B;  1KB9 D;  1KX2 A;  4ZKU A;  2OTL P;  1DW2 A;  1WMK A;  1CSV A;  2IFN A;  3CWB D;  3H1K E;  1GL2 C;  3L35 A;  1FI7 A;  2FFD A;  1PP9 D;  2KSJ A;  1GU2 A;  5CCH D;  1DVH A;  4HYT B;  2O01 H;  1M57 D;  3WU2 H;  1JCC A;  1BCC J;  2K9J B;  1BGY J;  2Q5U A;  4D6T E;  4BXL A;  3L71 G;  4FA5 A;  2Y0D A;  3HRN A;  1CTZ A;  1M6Z A;  3L73 J;  2PP6 A;  5AVR B;  2KP8 A;  3A0H E;  1ZXG A;  1E5W A;  1PPJ D;  2L5G B;  2L4D A;  2QEX P;  5B6Q A;  3HUS B;  2JP3 A;  1S9K E;  2W6J H;  4N6J A;  1RF1 C;  4GIF A;  1UIX A;  1LT9 B;  3ZIY A;  3RK2 D;  1YJN P;  3RK3 E;  1RF1 B;  4N0K A;  1CHI A;  1N86 A;  4L3H A;  1SVF A;  1RAP A;  1KYO D;  1EDI A;  3CU4 A;  2AIU A;  1VL2 A;  1DH3 A;  3BVH A;  1ZR2 A;  3TGU D;  1SQV J;  1M56 D;  2N18 B;  1ZRT E;  1DD4 A;  4PJ0 H;  1A56 A;  2PFX A;  2KZI A;  4U3F J;  3JBT B;  2QJK C;  5BU5 A;  5TIS V;  5C9M A;  5CIF B;  1FI9 A;  3T97 A;  3A2A A;  2KIK A;  1E8E A;  1FDM A;  5GTH E;  1BSH A;  1LTJ B;  2ZVO B;  5AW1 B;  3CL3 D;  2FXP A;  2E5T A;  1P84 H;  4M3L A;  5E79 H;  5KTB A;  1HF9 A;  4V2K A;  3C1L A;  2HOD B;  1JY2 O;  1CHJ A;  3IF4 A;  3NMD A;  4PV1 D;  1KD1 Q;  2Q6Q A;  1FBM A;  1L0L K;  2P1J A;  2AXC A;  2CA4 B;  4RKU J;  1ZRT D;  1YYC A;  3RMZ A;  1JDL A;  1NGM B;  1K3H A;  3LIE A;  2YIU B;  2GA1 A;  3MUD C;  3TGU G;  4RO0 A;  1M8O B;  3U1C A;  1K73 Q;  1FZC B;  1S3J A;  2NPS B;  3CXH W;  5CCH C;  1FZC C;  4Q5P A;  4RJT A;  4IFF A;  2PCB B;  1PIX A;  2W83 C;  1LWU B;  3CD6 P;  1VF5 C;  1KIL A;  3Q5P A;  1PGJ A;  3AE1 C;  4WBA A;  1HJ0 A;  2YK3 A;  1H9Y A;  1SFC D;  5IY5 1;  1BE3 J;  1NTZ J;  2O1J A;  1NTK K;  1P84 I;  1RE4 C;  1MG2 D;  3L4O A;  2LKM A;  1PP9 G;  1OCD A;  3CCR P;  1MKM A;  3AEG C;  3CCQ P;  4XA4 A;  1VQO P;  1KQS O;  2N1T A;  3H1L D;  1FS0 E;  3HTK A;  1L4A B;  2C1D B;  4W80 A;  2AI5 A;  1K3G A;  2BEZ F;  3NFQ A;  1L4A C;  1G2C B;  2KOG A;  1MFT A;  5CHX A;  5KAF H;  2IDB A;  3AE3 C;  5AW5 B;  2KSE A;  3CX5 I;  1CHH A;  3W67 A;  2KS1 B;  4UB8 H;  2WPS A;  2IBZ E;  2I8F A;  5AW4 B;  2K3R A;  2CA3 B;  1NAY A;  2WMM A;  3TYY A;  1FZA A;  4Z1M H;  2YCC A;  2W90 A;  1EDJ A;  1AOQ A;  1CED A;  1X8Y A;  4UB6 H;  1A8C A;  3CPW O;  1WRG A;  3WU2 E;  1OWA A;  3PLN A;  5AVS B;  1L0L G;  2QVA A;  1WT6 A;  2V7Q H;  3W68 A;  1N90 A;  1GW3 A;  5AVY B;  2QG4 A;  1M70 A;  2LXC B;  4HB1 A;  3CCM P;  1W5C T;  1CXA A;  2WSC J;  3OCD A;  3MUD A;  4AQR D;  1R0Q A;  3L70 E;  2WQY C;  1QGK B;  4WQB A;  5APY A;  1GKS A;  1CXC A;  2E5Y A;  1HH0 A;  3L75 E;  1M7L A;  4GKG A;  5CIG B;  1NH4 A;  3EWK A;  1DW3 A;  4A7P A;  3GG2 A;  2QJP B;  1FI3 A;  4L75 A;  1JMB A;  3CLQ A;  1RH5 B;  1JO5 A;  3H1J E;  2FKW B;  1K8A Q;  1N7L A;  1ZOY C;  5AW3 B;  1IRW A;  1CNO A;  3OA7 A;  1BE3 E;  1S5L X;  3CCE P;  5AVQ B;  2EXV A;  2ZYG A;  2QJY B;  1F1F A;  1E79 H;  1Q90 D;  3AE5 C;  1VQ5 P;  1GL2 B;  3RN1 A;  5CCG D;  1I54 A;  1BE3 G;  4L73 A;  2GM4 A;  2OTJ P;  3ZOW A;  2R3C A;  1IO4 A;  3MK7 C;  3L74 D;  2IBZ D;  1MUU A;  1RE4 A;  2WSS H;  3IAO A;  5B66 H;  3GHG C;  4WQC A;  3GHG A;  1DW0 A;  3GHG B;  5CCH A;  3U59 A;  1NNO A;  2SPZ A;  1HBW A;  1SS1 A;  1EXI A;  1N7S A;  2JR8 A;  4XXL A;  1JOC A;  3D6Y A;  3CCV P;  2FYU G;  3L71 J;  3G4S P;  3WC8 A;  1NHL A;  1KB9 I;  3HQ6 A;  2PGD A;  3GMA A;  2OYO A;  1B7V A;  3MTU E;  2K37 A;  1QVG O;  2D0W A;  1C6O A;  2LR2 A;  2HV4 A; 
#chains in the Genus database with same CATH homology
 2GB8 B;  1NTK D;  3KHU A;  1LMS A;  4WQ7 A;  1DII C;  1C6R A;  2ZZS 1;  1WEJ F;  1J3S A;  1LFM A;  1LC2 A;  3VYM A;  1QL3 A;  3WFD C;  3ZBM A;  2PCC B;  1YIQ A;  3A9F A;  1CO6 A;  3SLE A;  5C0Z A;  1DVV A;  1U75 B;  5CIB B;  1M60 A;  5DFS A;  4AAO A;  1C7M A;  1I8O A;  3ZCF A;  5AUR A;  1CCH A;  1L9J C;  4WQA A;  4O1Q A;  1CTY A;  1CCR A;  5CID B;  4FAV A;  1CSX A;  1EB7 A;  3HQ7 A;  4UB6 V;  4Y5R A;  2B11 B;  1C75 A;  2L91 A;  3WFB C;  1IQC A;  1HCM A;  4QAO A;  1NTZ D;  1DW1 A;  1SQX D;  2OZ1 A;  1QYZ A;  2N9I A;  1S6V B;  1YIC A;  2AXT V;  1KV9 A;  1BL9 A;  3PTZ A;  3TYI A;  2FRC A;  5KAF V;  2CE1 A;  2D0S A;  4PW9 B;  155C A;  3MK7 B;  1QL4 A;  3ITK A;  1N9C A;  5E79 V;  2YQB A;  1N15 A;  2GC4 D;  1IRV A;  1CIE A;  1ETP A;  4H0K A;  3A0B V;  1CC5 A;  3H1K D;  3A0H V;  1AYG A;  5TJH A;  3FWL A;  351C A;  3M97 X;  1SQB D;  5CIE B;  2JQR A;  3RN0 A;  2B4Z A;  1P84 D;  1F1C A;  1SQP D;  3SJL A;  1GQ1 A;  3DMI A;  2ZOO A;  1CRG A;  3OCD B;  3NBS A;  2BH4 X;  1FOC A;  1I6E A;  2DGE A;  1KB9 D;  1H33 B;  1KX2 A;  1DW2 A;  3VNW A;  1H33 A;  1CSV A;  2KS1 A;  4EDF A;  1HZV A;  3CWB D;  1EZV D;  5B5E V;  4XYD B;  4YE1 A;  3RLM A;  1FI7 A;  2O3J A;  1PP9 D;  1YEB A;  1GU2 A;  1ZZH A;  3HQ9 A;  1LC1 A;  1DVH A;  2ORL A;  1L0L D;  3PHL A;  3ZOY A;  2CXB A;  2BLF B;  1CYC A;  1COR A;  1CRI A;  2ZON G;  1CIH A;  2K9J B;  4WQ9 A;  1RZ5 A;  1CSW A;  5GTH V;  4FA5 A;  1RZ6 A;  2KNC B;  2Y0D A;  2MTA C;  1CTZ A;  1M6Z A;  2C2C A;  2DVH A;  3PXS A;  3O1Y A;  1PPJ D;  1WVE C;  5EXQ A;  1DIQ C;  2L4D A;  2RMZ A;  5B6Q A;  4FA9 A;  1HRO A;  5DJQ B;  3ZIY A;  1KX7 A;  1H9X A;  1HJ4 A;  4UB8 V;  4AAN A;  4N0K A;  2N3Y A;  1CRY A;  1CHI A;  1OAE A;  5KLV D;  4L3H A;  1RAP A;  2FWL A;  1KYO D;  1CRH A;  3CU4 A;  2AIU A;  5DF5 A;  3TGU D;  1VYD A;  2N18 B;  1HRC A;  1A56 A;  4K3I A;  1NML A;  4NFG B;  3JBT B;  5TIS V;  5C9M A;  3TF5 A;  2BH5 X;  1W2L A;  5CIF B;  1FI9 A;  1KYO W;  2FYU D;  2Y0E A;  2Q3E A;  1FJ0 A;  4P4Q B;  4GYD A;  1E8E A;  1NIR A;  1GDV A;  3NWV A;  5KLI B;  1HZU A;  3ZOO A;  5GTI V;  1I55 A;  4V2K A;  3OA8 B;  3L75 D;  3SWS A;  1YNR A;  2A06 D;  3ZOX A;  1CHJ A;  1H31 B;  1C52 A;  3KZI V;  3PRJ A;  1A2S A;  2B12 B;  1COT A;  2CA4 B;  2C1V A;  1BE3 D;  1ZRT D;  2CE0 A;  1CRJ A;  4H0J A;  3RMZ A;  1JDL A;  2ZBO A;  1K3H A;  2YIU B;  1H32 B;  3CYT I;  3CXH W;  3WFC C;  2FYN B;  4Q5P A;  4RJT A;  2PCB B;  1YTC A;  3SVW A;  3BCC D;  2C1D A;  2ZXY A;  3CXH D;  3WUI A;  2PAC A;  3ORV A;  2YK3 A;  4LJI A;  5H2F V;  3VMA A;  1H9Y A;  5KAI V;  3HQ8 A;  5B66 V;  5IY5 1;  1L9B C;  4EIE A;  3PH2 B;  2V08 A;  1H1O A;  3O5C A;  4WQE A;  2B0Z B;  1MG2 D;  1C2R A;  3L4O A;  4RSZ A;  3L4M A;  4EIF A;  1OCD A;  1HH7 A;  2BPB B;  1NMI A;  1FHB A;  1FCD C;  4WQD A;  3L73 D;  3H1L D;  1CRC A;  1CSU A;  2C1D B;  2AI5 A;  2MHM A;  1K3G A;  4IL6 V;  3O20 A;  1HJ3 A;  3L72 D;  4J20 A;  2JWA A;  1YCC A;  1QKS A;  3CP5 A;  1CHH A;  1NTM D;  1H31 A;  1YEA A;  4AX3 A;  1MZ4 A;  2I8F A;  1AKK A;  1GJQ A;  2CA3 B;  1NU1 D;  2C9X B;  4PJ0 V;  2Y0C A;  4L1Q A;  4WQ8 A;  2YCC A;  2LIT A;  4MU8 A;  1AOQ A;  1CED A;  2C8S A;  1A8C A;  1E29 A;  1CYJ A;  3PLN A;  4AAL A;  1N90 A;  4FA4 A;  1E2R A;  4KMG A;  1U74 B;  3C2C A;  3GW6 A;  2OZ1 B;  2QG4 A;  1M70 A;  1W5C T;  2BCC D;  1MG3 D;  1CXA A;  3OCD A;  4L3G A;  1R0Q A;  2N3B A;  3H1H D;  4WQB A;  3O0R C;  3WFE C;  1GKS A;  2VHD A;  1CYI A;  1CXC A;  1KB0 A;  2N18 C;  4EIC A;  4O1W A;  5CIG B;  3VRD A;  1DW3 A;  4A7P A;  3L70 D;  3GG2 A;  5CYT R;  4U3F D;  2QJP B;  1LS9 A;  1FI3 A;  1HJ5 A;  1SQV D;  2LIR A;  3PXT A;  3H1J D;  1H32 A;  1RAQ A;  3WU2 V;  2RN0 A;  3CX5 D;  5KKZ B;  2N9J A;  4PWA A;  4JCG A;  4FAN A;  1CTJ A;  1DT1 A;  1IRW A;  1CNO A;  1YFC A;  1I5T A;  3TDK A;  3CX5 W;  1IZL 0;  2EXV A;  2V07 A;  3X39 A;  4FB1 A;  2QJY B;  1F1F A;  1BGY D;  1I6D A;  4FA1 A;  2B10 B;  3PXW A;  3RN1 A;  3SXT A;  1I54 A;  1I8P A;  3ZOW A;  2N9Y B;  4GED B;  3MK7 C;  3L74 D;  1GIW A;  2IBZ D;  4D6T D;  5CIC B;  451C A;  1C6S A;  4EID A;  4WQC A;  1QN2 A;  3OA8 A;  1AOF A;  1BCC D;  2BCN B;  4DY9 A;  1DW0 A;  1IO3 A;  1N50 A;  1L0N D;  3L71 D;  4AAM A;  1NNO A;  1CIG A;  1KIB A;  2XTS B;  1CIF A;  1C2N A;  4PD4 D;  1SQQ D;  3DP5 A;  4XXL A;  5CIH B;  2GIW A;  2JTI B;  5DJQ C;  3WC8 A;  2GC7 D;  2QJK B;  3H1I D;  3NBT A;  3HQ6 A;  1B7V A;  1S5L V;  2C1U A;  3DR0 A;  2D0W A;  1C6O A;  2HV4 A;  2BGV X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...