3CWBD

Chicken cytochrome bc1 complex inhibited by an iodinated analogue of the polyketide crocacin-d
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of molecular modeling in the design of analogues of the fungicidal natural products crocacins A and D.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
total genus 65
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2008-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3cwbD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3cwbD02
2PCBB 2ZZS1 2IBZD 2XTSB 4EICA 1CO6A 4A7PA 4PD4D 5KLVD 1CSWA 4L3GA 5DJQB 3PXTA 5EXQA 1HZVA 1QYZA 2ZXYA 3MK7C 1CYCA 1CCRA 3OCDB 2V08A 3ZBMA 3WUIA 1CHHA 1IZL0 3HQ9A 3VMAA 4Q5PA 3GG2A 1CYIA 1SQBD 3DMIA 1C6OA 2ZOOA 1RAQA 1H33A 4J20A 1B7VA 4AAOA 1H9XA 3KZIV 1QL3A 1GJQA 4Y5RA 1NU1D 3PXSA 4XXLA 4YE1A 1EZVD 4WQ7A 4GEDB 4WQDA 1CRYA 3PTZA 3H1LD 3RLMA 3CXHD 2N9IA 2HV4A 5H2FV 3L75D 1I8OA 4WQ9A 3SVWA 1C6RA 1L9BC 2ZONG 3O5CA 1MG2D 2CA4B 2OZ1A 1KYOW 3NBSA 3H1HD 2I8FA 2RN0A 3SLEA 3HQ7A 5GTIV 1E2RA 4WQAA 2YQBA 5AURA 1COTA 5KAFV 1YCCA 4FA4A 2MTAC 1HJ3A 3L4OA 3CYTI 2FWLA 4QAOA 2CE0A 3L74D 1OAEA 1CIHA 1K3GA 4WQCA 1CEDA 3NBTA 3ZOWA 1M70A 1CIEA 1NMIA 1N50A 2DVHA 2O3JA 1AOQA 1IRVA 2ZBOA 1H32B 1QL4A 2B12B 4UB8V 2YCCA 1LS9A 3A0HV 1GDVA 3X39A 3ZOYA 3CXHW 3H1ID 4FANA 2C1VA 5CIFB 1L0LD 1ZZHA 5TJHA 3TGUD 2CXBA 3L4MA 4O1QA 1KYOD 1I8PA 4EIFA 4H0KA 1C6SA 4DY9A 2L4DA 1CC5A 1F1CA 3ZCFA 2CA3B 2ORLA 4AAMA 1H1OA 3JBTB 3GW6A 3WFEC 2V07A 3L72D 3TF5A 2N9JA 1DW0A 2C1DB 2C9XB 2BCCD 2C1DA 2JWAA 2N18C 1DW2A 2FYUD 4NFGB 2B4ZA 5KKZB 2BGVX 3OA8B 1CTJA 5C9MA 4RSZA 2GB8B 1N90A 2BPBB 1CTZA 5CIGB 1DIQC 1KV9A 4FAVA 2JTIB 1AOFA 1CRCA 5KAIV 4FA9A 1WEJF 1ZRTD 1YIQA 2KNCB 3CX5W 4FB1A 1W5CT 4AALA 1S6VB 3H1JD 1A8CA 1C2RA 2PACA 1AYGA 451CA 2C1UA 1FOCA 2BH5X 4K3IA 1HJ5A 4IL6V 3DP5A 2LIRA 3C2CA 2C2CA 1MZ4A 2EXVA 1H33B 1CYJA 1BL9A 1NMLA 1F1FA 1C2NA 1BGYD 1GQ1A 3CX5D 4JCGA 3WC8A 2YIUB 1A56A 1SQXD 1N9CA 1DVHA 3VRDA 4L1QA 1RAPA 2PCCB 1HZUA 1DT1A 1WVEC 1FHBA 1W2LA 3SWSA 1I5TA 5DJQC 1CXCA 1C75A 3BCCD 4EIEA 1L9JC 5DFSA 1CTYA 2AXTV 1QKSA 1P84D 1CIGA 1E29A 1I6DA 1FCDC 2C8SA 1H31B 3ZOXA 2FYNB 1SQQD 1VYDA 4KMGA 5CIHB 1LC1A 1GIWA 4L3HA 4EIDA 2CE1A 2D0WA 1LC2A 1FI9A 2MHMA 1MG3D 2YK3A 1I6EA 1U75B 3RN1A 5KLIB 4UB6V 1BCCD 5GTHV 2L91A 1E8EA 1A2SA 1N15A 2JQRA 2QJKB 1KX7A 1CRHA 3KHUA 1M6ZA 1CORA 5C0ZA 3DR0A 3TYIA 2Q3EA 1R0QA 2BLFB 2D0SA 351CA 3WU2V 1CIFA 3OA8A 3FWLA 2KS1A 4RJTA 4H0JA 2OZ1B 1S5LV 3WFDC 1KB9D 1IQCA 1NTMD 155CA 1CRJA 4PJ0V 5CICB 2AI5A 5CIDB 4FA5A 5CIEB 3M97X 3OCDA 1NTKD 4XYDB 1YTCA 2GC4D 3O1YA 2Y0CA 3L70D 1H9YA 1CRGA 2A06D 3H1KD 4AX3A 5CIBB 5DF5A 4AANA 4EDFA 3SXTA 1I55A 3PHLA 2FRCA 1SQPD 1LMSA 2QJPB 1RZ6A 1GU2A 2GIWA 1CSUA 3CU4A 4O1WA 5CYTR 1CSVA 4MU8A 3PRJA 1FJ0A 4P4QB 1QN2A 1NTZD 1YICA 1J3SA 3VYMA 2LITA 1NIRA 1FI3A 3RN0A 5B6QA 2GC7D 2QG4A 1PP9D 1DW1A 1M60A 1LFMA 2Y0DA 1HH7A 3RMZA 3L73D 2N18B 3ORVA 2AIUA 1DIIC 1H31A 2K9JB 1YEBA 4U3FD 2N3YA 3HQ6A 2B10B 1YNRA 2BH4X 1DW3A 3PH2B 4GYDA 1CHIA 1C7MA 3PXWA 1PPJD 2VHDA 2QJYB 3ITKA 3NWVA 3O0RC 2B0ZB 2N3BA 2N9YB 1YFCA 3WFBC 1DVVA 3VNWA 4N0KA 3TDKA 1IO3A 3HQ8A 4WQBA 1SQVD 3SJLA 1H32A 1IRWA 1HCMA 1BE3D 1YEAA 1NNOA 1CSXA 1CHJA 3ZOOA 2B11B 1I54A 3CP5A 4LJIA 1GKSA 1HRCA 2Y0EA 3A9FA 1FI7A 1EB7A 5E79V 5B66V 1L0ND 5TISV 1K3HA 1KX2A 4D6TD 1CNOA 1HJ4A 1OCDA 1HROA 1JDLA 1CCHA 4WQ8A 1AKKA 1KIBA 2RMZA 4PWAA 3L71D 2DGEA 3A0BV 1KB0A 1C52A 4FA1A 1ETPA 1RZ5A 3O20A 5IY51 1U74B 4V2KA 4PW9B 4WQEA 1CRIA 3MK7B 2BCNB 3WFCC 1CXAA 3PLNA 3ZIYA 3CWBD 5B5EV
chains in the Genus database with same CATH superfamily
2ZZS1 1EDLA 2XTSB 4PD4D 1CSWA 4DJGA 1EZVE 5EXQA 2D2CB 2QA4P 2V08A 1BCCJ 3ZBMA 3V2QA 1CHHA 1IZL0 3AE3C 4Q5PA 4B86A 2M3EA 2HPCB 1FZCB 1NU1G 3CX5E 3DMIA 2ZOOA 3GF3A 1PP9E 3UIAA 3LW5J 1JMBA 1LWUC 1U7JA 2ZXXA 2M5AB 1CRYA 3PTZA 1S5LE 4NPFX 1NTMJ 2HV4A 1GTWA 1SP4A 1YIJP 1MZ9A 1PGOA 1EDKA 2JR8A 3G6EP 4YXDC 3O5CA 4JYBA 4W7YA 1YTZT 2CA4B 2OZ1A 4BXLA 4AYCA 4UB6E 2OYHC 5AW7B 3L70E 4HB1A 2YQBA 3F5HA 1FAVA 5KAFV 1W2BO 1DH3A 2CK3H 3P8CE 1FZFA 4QAOA 2G3AA 3FX0A 1CIHA 3FGAD 1E79H 3GF7A 2E5TA 3VN0A 1NMIA 1GK6A 1HJBA 1S3JA 1AOQA 2ZBOA 2B12B 1SQVE 3L73G 5M1BA 1LS9A 3ZOYA 3A3YB 1GDVA 1KILC 3CXHW 2HODB 2C1VA 1SFCD 1DD4A 1FE6A 1FDOA 1C6SA 2JJLA 3RBZA 1LTBC 1W2EA 3ABVC 1F1CA 1YI2P 2WMMA 3AEEC 2QEXP 3GW6A 3BCCJ 3WFEC 3HE5B 2XV5A 3GLMA 1KC8Q 1LTTC 2IDBA 1DW0A 3L71E 2N18C 1VF5C 2B4ZA 3P7KA 2Q1KA 1AA0A 4ASVA 4BRYB 2O01J 2KZJA 1M1JC 4W80A 4CPGA 2W6AA 1SQBK 2AEJA 2ZYGA 4H44C 3CX5W 3OJAB 1AFOA 2OYIB 2P7JA 2H89C 2Q7CA 4JF7A 3RL0D 1RY3A 2E76C 1OMIA 1EXJA 1C2RA 1PIXA 3HRNA 3RK3D 1CW5A 1ZV8A 5AW1B 2BH5X 3L75E 4IL6V 1HUCA 1NTKK 3H1LE 3DP5A 2LIRA 1H33B 1NMLA 2KLUA 1BGYD 4JCGA 2YIUB 2RH0A 2NPSC 2A06G 3S1KA 4OGQD 1A56A 1SQXD 1EZVG 1VQKP 2QM7A 4AUWA 2BCCG 1FZAA 3Q5PA 1VQMP 2GM4A 2P2UA 1I5TA 2ZYDA 1KB9E 3G4SP 3HUSC 3V4QA 1MUUA 4PD4E 4EIEA 2WSCH 3CCUP 5DFSA 1X8YA 4U3FG 1NHLA 4BRYA 4R4MA 3WU2H 1WRGA 1HH0A 2R5DA 1H31B 3ZOXA 4N6JA 2FYNB 1VYDA 4KMGA 2P1JA 1LC1A 2WITA 3RL0C 4H13C 2E76D 1J2JB 2CE1A 2OGUA 4WY4A 3Q5SA 1LC2A 2Y9YA 1FI9A 4H44D 2FFDA 1FOSF 4GOEA 3RN1A 1KB9H 1VQOP 1SQVK 1G2CA 1VPCA 3MHVA 4EI2A 1KX7A 3H32B 1LNQA 3CCQP 1BE3E 3RL0B 1R0QA 2BLFB 1LTJC 3L74G 1LTGC 4H0JA 4L74A 5CCGD 1HBWA 5AVUB 2OZ1B 3CCVP 3CC2P 1USEA 2N1TA 3CC7P 1YITP 3D6YA 1IQCA 3L74E 1MFTA 1ZW0A 1K73Q 1QLED 4WB4A 2AXTH 1NU1J 2VRSA 1IC2A 4D6TJ 1L0NJ 1BGYE 1GZLA 1NTKG 4IOIH 1KQLA 1ZXGA 3I56P 3O1YA 2Q3IA 1KN7A 1CRGA 2A06D 1E5WA 4AX3A 5E79E 5CIBB 4EDFA 1JEKA 3I55P 2PRRA 1P84H 5AW4B 2JO1A 3O8ZA 1RZ6A 1X0TA 4KHXA 2GIWA 1FBMA 1K04A 2Y9ZA 1KD1Q 1VQPP 5CYTR 3HTKA 2FBWC 1T8ZA 1S9KE 4ZKPA 2FYUG 1W5CE 1QN2A 2W90A 1NIRA 2WVRA 1VF5B 1X79B 4I2LC 4KT0J 3SWYA 4RESB 1JCCA 5TISE 1DW1A 5B66E 3L72G 1M60A 3SWKA 2MKVA 2E75C 5BU8B 1KILD 3WUVA 1YEBA 1YBKA 3L72E 2N3YA 4EOTA 3HQ6A 2YMYA 2B0ZB 1H0TA 1OW8A 1DVVA 3G9RA 3TNUA 2N1TB 3JSVC 2M3BA 3TDKA 1IO3A 1ZLLA 1FZCA 3U1AA 1SQPJ 4L75A 1Z56A 4HYTB 3H1LG 3H1KJ 2YMKA 4LJIA 2E43A 1GKSA 1FI7A 1NTZK 3JC22 1T2KD 1L0ND 4D6TD 1SLQA 1CCHA 4WQ8A 3CXHI 1RHZB 1OFCX 3NTNA 5APTA 4PJ0H 4LC1A 2K9YA 2V7QH 1SQXK 4C7NB 3H1IG 1Q81Q 2IBZG 4PV1B 3MK7B 2FYUK 2OTKE 3PLNA 1GDTA 3MZWB 1N7SD 1DX7A 4JQ0D 1T6AA 2FXPA 2HYNA 1FDMA 5KAIH 1QYZA 2ZXYA 3MK7C 1VF5D 3L70G 3F89A 3HQ9A 3VMXA 1OVVA 1H88A 3VMAA 1LWUA 1L0LG 1CYIA 1C6OA 2BCCJ 2FXOA 2IFMA 4J20A 3V6IA 4PJ0E 1YJ9P 4AAOA 1QL3A 1M1KQ 1NU1D 4XXLA 4WQ7A 4WQDA 1VQ9P 3RLMA 2N9IA 5H2FV 3L75D 1KB9I 3KQGA 2SPZA 1C6RA 4GIFA 3TGUJ 1JO5A 1L9BC 2ZONG 2YO3A 1J1EB 4Y28J 3P32A 2JWDA 1FZGA 1FJKA 1RE3C 5CCHC 3MGNA 5GTHE 3HQ7A 2A06E 3IAOA 2W83C 4WQAA 1PGJA 1QL2A 1NTKE 2YXQB 2MTAC 1NTZG 2QIWA 1GW3A 2FWLA 2QJYC 3KXDA 1RE3A 1URQD 5CCHA 3NBTA 1N50A 4IL6E 1SQPK 2O3JA 4WY4C 2KNCA 1IRVA 1H32B 1QL4A 3A0HV 1YQ3C 3CWBE 2K1AA 2HODA 3TGUD 3G71P 1KYOD 1I8PA 4OH8B 5GTHH 3OW2O 5APUA 1N73A 1PPJE 3AE7C 4DY9A 4AAMA 5EFWB 3L72D 2C1DB 2C9XB 2I1JA 3JCUE 1Q86Q 1DW2A 3AE2C 5KKZB 2KK7A 2BGVX 1LTSC 1SQXJ 3OA8B 1CTJA 2ZAEB 4RSZA 1KILB 1N90A 5AVQB 2BPBB 1MV8A 5CIGB 2IYOA 3OAKA 4K3AA 1SQQE 1CRCA 5KAIV 4I7ZC 1WEJF 2KNCB 1SFCB 4FB1A 1RE4A 4AALA 1KZUB 5AW3B 1FZEA 3SSUA 1PPJG 3Q5RA 1NOHA 2BEQD 1M7LA 5CJ0A 2PACA 2NZ2A 1IK7A 1KTMA 4UB8E 2C1UA 1FOCA 3NFQA 2DW3A 2E75D 1HJ5A 2FY8A 2C2CA 3VYIA 1LP1A 1C2NA 5E79H 4UB8H 5KLIC 3CD6P 5DJUB 2R44A 2W6JH 1SQBE 5CMZA 3WC8A 1KFNA 5TISH 3CL3D 2B88A 2HPCA 4DT0A 3VRDA 2PCCB 1HZUA 1HGVA 1GW4A 1HTLC 5APSA 1DT1A 1GU4A 5DJQC 1CXCA 3BCCD 1DEEG 2C0XA 3WMM0 5AVVB 1QKSA 3RK3B 1GMJA 2GA1A 2N9BA 1I6DA 2C8SA 1Q82Q 4N78E 1SQQD 1DIPA 1CI6A 1GL2D 1BCCE 4EIDA 2E5YA 1MG3D 2YK3A 4I6MC 2BEZF 4MN4C 2FYUE 3GHGC 5AVYB 1BCCD 5GTHV 2OARA 3HD7B 4Y99C 5CCGC 4D6TG 1X9VA 2JQRA 3KHUA 1NVOA 3HD7C 1NTME 1JNMA 2OTJP 2PAJA 3VP9A 5C0ZA 351CA 3WU2V 2KSEA 2KS1A 3D6ZA 2KZIA 1S72P 2XKMA 4GOFA 3WFDC 2XNXA 1ZP0C 4PJ0V 3T97B 2PGDA 3B5NB 3V2PA 3L70J 3AEBC 1KQGB 3HE5A 3P8CD 2QE7H 3A0BE 3M97X 1NTKD 2GC4D 3H1JG 4N3YB 1QVGO 1GL2C 3W67A 1IFIA 2KIKA 1I55A 3S4RA 1IFNA 1X22A 4GT1A 2E42A 2QJPB 1BE3G 3L36A 5KLVK 2WSFH 2NPSB 5AVZB 1SQQG 5AW5B 1FJ0A 2R3SA 4P4QB 1FC2C 1YICA 3VYMA 2LITA 2E74D 2HR3A 3BCCE 3C9IA 1FI3A 3RN0A 1MFZA 2YXRB 2KS1B 1NTMK 2CPSA 1CZQA 2Q5UA 3CC4P 3L73D 4U7JA 1ZOYC 2N18B 2AIUA 1PV3A 3CCJP 3GHGA 2YKQA 1S5LH 5C39A 2KSJA 1NWQA 3H6PA 2B10B 3PP5A 3PH2B 2C0WA 1C7MA 1CHIA 5KLVE 5APQA 2VHDA 1XTCC 2QJYB 2O1KA 1KYOE 1N86A 3O0RC 3RK3E 1L0LE 3WFBC 4N0KA 1NO4A 2NRGA 3RL0g 4OGQB 4DZOA 2P10A 1OX3A 1YEAA 2JEEA 3L75J 2FKWB 1NNOA 4NPEA 3M06A 1JB0J 1LP1B 5AVWB 1HRCA 3A9FA 1M1JA 1EB7A 4OGQC 2XNDH 5B66V 3VP8A 1KX2A 1M57D 1Q2NA 1CNOA 1HJ4A 3L73J 1OCDA 5KLVG 2WTYA 1FOSE 3VTPC 1VQ7P 3CCSP 3H1HE 1KB0A 2J5UA 1RZ5A 1EC5A 3M9BA 4EIJA 2IFNA 5AW0B 4PW9B 2BCNB 3WFCC 3H1JJ 2HG5D 3K5BA 2JP3A 2IBZD 3WU2E 2WQYC 4EICA 4KJMA 4A7PA 2LKMA 3LIDA 4GODA 2IPPA 2KLVA 3I5CA 5AW8B 2AXCA 4TLFA 3OCDB 1CSBA 1KILE 1NKZB 1RF1B 5AVSB 3HUSB 1Q90D 4YPCA 1SQQK 2KUBA 1CI6B 1RAQA 1H33A 3NMDA 1B7VA 3CCRP 1H9XA 2LXBA 1GJQA 4Y5RA 3IF4A 3N4XA 1EZVD 3B5NC 3D71A 3H1LD 3CXHD 1URQA 5CCHD 3L37A 3CMEP 1GL2A 5AW9B 4H0LB 3SWFA 3U59A 3CCMP 1JUNA 3IR9A 2ZVNB 1JM0A 1KYOW 1NH4A 1L4AC 3H1HD 2I8FA 3B5NA 3LW5H 3L74J 5GTIV 1WMKA 1E2RA 1NU1E 4U3FJ 3M91A 4D6TE 2QM8A 2Q9IA 2OTLP 1YCCA 1HJ3A 1OW7A 3L4OA 1QX8A 5K5GB 3L74D 1K3GA 3L75G 3ZOWA 2RKLA 1G2CB 1K05A 1GL2B 4H13B 4UB8V 1VL2A 2OQQA 3QWOC 1L0LD 5TJHA 1JTHA 4O1QA 1YJNP 1PP9G 4EIFA 1PFIA 4H0KA 4LLHA 2H88C 3BRVB 2IX7C 1D7MA 1H1OA 1LTAC 2QSIA 1KV4A 3BATA 2V07A 3TF5A 2N9JA 5KAIE 1AV1A 2C1DA 1YQ4C 4NFGB 1N8RQ 5C9MA 2GB8B 3EFGA 3C8VA 5APXA 3L72J 1CTZA 1OZHA 1SS1A 2ZXEB 3L35A 1Y8AA 2B87B 1QGKB 4I1LA 1JY3O 4FAVA 1L2PA 2JTIB 4FA9A 1VQNP 1LT9C 1K9MQ 3A0HH 5CCGA 3B4SA 4WBAA 3H1IJ 1LTJA 3CI9A 1A02F 3H1JD 2KOGA 1K8AQ 3II6A 1NAYA 1A8CA 2YKOA 1SFCC 3Q3DA 1AYGA 3A0HE 1SQXG 4I7ZB 3CPWO 1AQ5A 4K3IA 4DOJA 3A7OA 3C2CA 3AE1C 1QEXA 1SQVG 1BL9A 1F1FA 3CX5D 1JCDA 3AE4C 1BDCA 1LWUB 3VMYA 5AVXB 1DVHA 4JPZB 5CHXA 1RAPA 4WWIA 2B89A 2M8RA 3SWSA 2WSCJ 3S9OA 1NTZE 1FDIA 2D2CC 3AECC 3P8MC 2WPSA 1KILA 5APVA 1E29A 3PH0A 3MTUE 3W68A 1FCDC 2WPQA 1JY2P 2E74C 1NKNA 3MD0A 5DJTB 2QVAA 2YO2A 1R8EA 2FYNC 3HUSA 3H25A 5CBNA 1G1IA 4L3HA 1U7MA 1H0TB 3JCUH 2MHMA 4ZNCA 1I6EA 2K88A 2B87A 2BCCE 3MUDC 5KLIB 1PP9J 4UB6V 1SQPG 3A0BH 3AEDC 3IN6A 3KDPB 3B71A 3BVHA 2QJKB 2ZT9D 2FYZA 3EWKA 3H1KG 5H2FH 2HLOA 3E1RA 3C1LA 1CORA 1JOCA 3TGUE 1J1EC 3DR0A 3TYIA 2Q3EA 3M0DA 4EYYQ 2WPVB 3G3ZA 1FS0E 3OA8A 3QH9A 5H2FE 4RJTA 1S5LV 1NU1K 3H32A 4GKGA 3N7NA 1BCCG 3KZIE 5CICB 3B5ND 4QMAA 2WSFJ 3Q2YA 4C7NA 1YTZI 3MIWA 4FA5A 5L8RJ 3MP7B 3E1IA 1NTKJ 2N1TD 4H13D 2E76B 4BWNA 1YTCA 1KQFB 1S4XA 3AEGC 3EFFK 2Y0CA 1ZN5A 3L70D 1SVFA 1M8OB 3H1KD 1FZCC 4C7RA 4OWFA 4AANA 5AVRB 3SXTA 1SQPD 4WY4D 2YKPA 1J1DB 1AVYA 1QL1A 1PL5A 1SQVJ 2K3RA 3RBXA 1VQ8P 5B66H 3CU4A 1PGPA 2XU6A 1KORA 3KZIH 3SFDC 4MU8A 3E7KA 2M5AA 1J3SA 3CCEP 1L0NK 1IO4A 1IFDA 5B6QA 3RK2B 2GC7D 3HTKB 3L71J 5BVZA 2Y0DA 2IZ1A 5KAFH 1SQXE 1HH7A 3RMZA 1M90Q 1NYHA 1H31A 2K9JB 3WUUA 2KB7P 3CXHH 4U3FD 2I8DA 5AVTB 2BASA 5BU5A 5KJ7C 1DW3A 2KXPB 4GYDA 1SQQJ 5APWA 1PPJD 1RF1A 2PFXA 2N3BA 2N9YB 2ZJSE 1RQUA 2FFDB 1Y47A 4AQRD 4H0LD 2IYPA 1SQVD 1H32A 1AJYA 1ZRTE 3RK3C 1CHJA 2B11B 2OYIC 1DD3A 3H1LJ 3V4WA 4H44B 1VQLP 2Y0EA 2C9NY 3TK1A 2E74B 1UIIA 1Q7YQ 5E79V 2CPBA 2PP6A 4ZMDA 3T97A 5TISV 2WWWA 1K3HA 4XE5B 4O9BA 1HROA 1JDLA 1OVUA 2RMZA 3L71D 2DGEA 3M9QA 5CJ4A 3RGUA 1C52A 5GTIH 1LT1A 4OVNF 1USDA 1KFMA 2OYIA 3O20A 5IY51 1U74B 4V2KA 1KYOI 1L4AA 1CRIA 1CXAA 3ZIYA 1IZNB 1N7SB 2PCBB 4R4LA 4ASWA 1CO6A 1SQBG 4L73A 1YHQP 5KLVD 5APYA 4L3GA 5DJQB 3PXTA 1HZVA 3A2AA 1CYCA 1CCRA 1OIPA 4H0LC 2GUSA 4ZKUA 3WUIA 4JBZA 1HGZA 1LTIC 3GG2A 4IFFA 1P84I 2FXMA 2FYUJ 1R5LA 1T2KC 1SQBD 1BDDA 3KZIV 1URQC 3PXSA 2ZFCA 4YE1A 3HD7D 4GEDB 2KP8A 1HJ0A 1QVFO 1M56D 2OYHB 1N7LA 3L71G 3KPEA 2IBZE 3RK2D 1NJIQ 1I8OA 4WQ9A 1L4AD 3OA7A 3SVWA 1UIXA 1BE3J 4W7ZA 2KYVA 2LXCB 1RF0A 3VOPA 2J58A 2M0BA 1MG2D 3AE9C 2OYOA 3D70A 1NGMB 3NBSA 4IFMA 3H1HG 1EXIA 2RN0A 1AQTA 2AXTE 3SLEA 2R3CA 1EZVI 1S1CX 1EQ7A 3CX5H 1KMIZ 4WVZA 1JMMA 4WY4B 1Y9BA 2ZT9C 5AURA 2Q6QA 1H89A 1LTJB 1COTA 1L0NE 3FWNA 1BGYJ 4FA4A 1KYOH 1S2EA 1RH5B 2W6BA 4TT3H 1H8AA 3CYTI 4JYCA 2CE0A 1OAEA 2W8ZA 4WQCA 1CEDA 1L4AB 3TYYA 3D0WA 3TNUB 1M70A 1S5LX 1CIEA 1TU3F 2DVHA 2YCCA 1U57A 3X39A 1GU5A 4FANA 3H1ID 3CMAP 5CIFB 1ZZHA 2CXBA 3L4MA 1G1JA 4IL6X 3AEFC 2ZVOB 2L4DA 1VDFA 1CC5A 1PZQA 3CWBG 3ZCFA 2CA3B 2ORLA 3JBTB 4IL6H 4C46A 1EDJA 5CBOA 2BCCD 2JWAA 4RO0A 2FYUD 3AE6C 3R4YA 3V5BA 3V2NA 1IFMA 3RK2C 2HFED 2OYHA 4XFJA 2WT7B 1DIQC 1KV9A 5KLVJ 4PV1C 1AOFA 1ZRTD 3U1CA 1YIQA 1S9KD 3B8EB 1W5CT 1L0LJ 2K9JA 1S6VB 3O6QA 2YIUC 1IFJA 1ZMEC 2G8YA 1SQPE 2XZRA 451CA 3USSA 1FU1A 4Z1MH 3FXDA 1PGQA 2O01H 3CXHE 3H1KE 4YXWH 2Z4EA 2NPSA 5KJ7D 1MZ4A 2EXVA 2N1TC 1VQ6P 2QJPC 1CYJA 2B9BA 1JY2N 2J59M 1GD2E 1GQ1A 1LJ2A 2ZYAA 3L73E 2Z5IA 1N9CA 2WT7A 1HF9A 4L1QA 5KAFE 1YJWP 1DEBA 1WVEC 1FHBA 1W2LA 1L0NG 2QRXA 3H1HJ 3A5TA 2AEMA 1C75A 1OVRA 2AEFA 3VMZA 3CCLP 5GTIE 1L9JC 1FJPA 1IJDB 1CTYA 2AXTV 3FXEA 3H1JE 4K35A 3L4FA 1N7SA 4L76A 1P84D 3CLQA 1CIGA 2W27A 3BCCG 3WUTA 1IFPA 3HE4B 1OXZA 2E75B 2WPRA 3GHGB 3EQ2A 1N7SC 1JTHB 1MKMA 3AE5C 3TSIA 5CIHB 4HH2A 1L0LK 2H43A 1T3UA 2YNYA 1GIWA 2O01N 3IFMA 3NXSA 2D0WA 5KTBA 1GK4A 3BASA 1BSHA 3Q1MA 1U75B 2UWJE 4LGDE 2IZ0A 4UB6H 2L91A 1E8EA 1IK9A 1OW6A 1A2SA 1J1DC 2L5GB 1VQ4P 2JKVA 1N15A 3AE8C 4N78D 2KI7B 1CRHA 1N73B 1M6ZA 2ZT9B 2XDJA 1AVOA 2WSSH 4RKUJ 2D0SA 3CX5I 1FZBA 1NTMG 1CIFA 3FWLA 2K37A 2R32A 3M9HA 1JY3P 1R5SA 1KB9D 4HKZH 1NTMD 155CA 1CRJA 4IFDK 2AI5A 5AW2B 5CIDB 1N73C 4M3LA 4U3FE 5CIEB 3SFEC 3OCDA 4XYDB 4HJGH 2WZ7A 2Z5HA 3R2PA 5B5EH 2MJZA 3PJSK 1H9YA 2I1KA 3KYQA 5DF5A 3PHLA 2FRCA 3TGUG 5B5EE 4PD4I 2FFDC 1LMSA 5KKZC 3V2RA 1GU2A 3HE4A 1NAFA 1CSUA 2GUVA 3ZDMA 1YYCA 3CWBJ 3M0DC 4O1WA 1CSVA 1ZR4A 3AEAC 3PRJA 2WSEJ 1URQB 1NTZD 1JY2O 1RE4C 2H8PD 4Y99B 2WSEH 1RQVA 2ITAA 3LIEA 1BGYG 2QG4A 2P58A 1PP9D 3MUDA 1XTGB 2P67A 1LFMA 2O1JA 4GDOA 3ORVA 1DIIC 1A02J 3M0AA 1LT9B 1YNRA 2BH4X 2POHA 2H7HA 3PXWA 2C9LY 2R5BA 2A45I 3ITKA 3NWVA 2NPSD 1YFCA 3VNWA 4NPDA 3H1IE 3HQ8A 4WQBA 1RF0C 1JY3N 4YTPC 1HWTC 1M1JB 4XA4A 1ZR2A 3SJLA 1IRWA 1HCMA 1BE3D 1VQ5P 1LGHB 1OWAA 1WT6A 1BSNA 1CSXA 5KJ7A 3ZOOA 1I54A 3O6QB 2A45G 3CP5A 3HD7A 2IBZI 1T3JA 2V4HA 4PV1D 2A45H 1SQBJ 1KQSO 1LT9A 1AKKA 1EDIA 3BRTB 1KIBA 4PWAA 1N2DC 3GMAA 3A0BV 4PD4H 1HVVA 4FA1A 1ETPA 2D2CD 2JDIH 1SFCA 2V7QJ 1NTZJ 1RF1C 4WQEA 5AW6B 2QJKC 4DCKA 2LR2A 1P84E 3CWBD 5B5EV
chains in the Genus database with same CATH topology
2PCBB 2ZZS1 2IBZD 2XTSB 4EICA 1CO6A 4A7PA 4PD4D 5KLVD 1CSWA 4L3GA 5DJQB 3PXTA 5EXQA 1HZVA 1QYZA 2ZXYA 3MK7C 1CYCA 1CCRA 3OCDB 2V08A 3ZBMA 3WUIA 1CHHA 1IZL0 3HQ9A 3VMAA 4Q5PA 3GG2A 1CYIA 1SQBD 3DMIA 1C6OA 2ZOOA 1RAQA 1H33A 4J20A 1B7VA 4AAOA 1H9XA 3KZIV 1QL3A 1GJQA 4Y5RA 1NU1D 3PXSA 4XXLA 4YE1A 1EZVD 4WQ7A 4GEDB 4WQDA 1CRYA 3PTZA 3H1LD 3RLMA 3CXHD 2N9IA 2HV4A 5H2FV 3L75D 1I8OA 4WQ9A 3SVWA 1C6RA 1L9BC 2ZONG 3O5CA 1MG2D 2CA4B 2OZ1A 1KYOW 3NBSA 3H1HD 2I8FA 2RN0A 3SLEA 3HQ7A 5GTIV 1E2RA 4WQAA 2YQBA 5AURA 1COTA 5KAFV 1YCCA 4FA4A 2MTAC 1HJ3A 3L4OA 3CYTI 2FWLA 4QAOA 2CE0A 3L74D 1OAEA 1CIHA 1K3GA 4WQCA 1CEDA 3NBTA 3ZOWA 1M70A 1CIEA 1NMIA 1N50A 2DVHA 2O3JA 1AOQA 1IRVA 2ZBOA 1H32B 1QL4A 2B12B 4UB8V 2YCCA 1LS9A 3A0HV 1GDVA 3X39A 3ZOYA 3CXHW 3H1ID 4FANA 2C1VA 5CIFB 1L0LD 1ZZHA 5TJHA 3TGUD 2CXBA 3L4MA 4O1QA 1KYOD 1I8PA 4EIFA 4H0KA 1C6SA 4DY9A 2L4DA 1CC5A 1F1CA 3ZCFA 2CA3B 2ORLA 4AAMA 1H1OA 3JBTB 3GW6A 3WFEC 2V07A 3L72D 3TF5A 2N9JA 1DW0A 2C1DB 2C9XB 2BCCD 2C1DA 2JWAA 2N18C 1DW2A 2FYUD 4NFGB 2B4ZA 5KKZB 2BGVX 3OA8B 1CTJA 5C9MA 4RSZA 2GB8B 1N90A 2BPBB 1CTZA 5CIGB 1DIQC 1KV9A 4FAVA 2JTIB 1AOFA 1CRCA 5KAIV 4FA9A 1WEJF 1ZRTD 1YIQA 2KNCB 3CX5W 4FB1A 1W5CT 4AALA 1S6VB 3H1JD 1A8CA 1C2RA 2PACA 1AYGA 451CA 2C1UA 1FOCA 2BH5X 4K3IA 1HJ5A 4IL6V 3DP5A 2LIRA 3C2CA 2C2CA 1MZ4A 2EXVA 1H33B 1CYJA 1BL9A 1NMLA 1F1FA 1C2NA 1BGYD 1GQ1A 3CX5D 4JCGA 3WC8A 2YIUB 1A56A 1SQXD 1N9CA 1DVHA 3VRDA 4L1QA 1RAPA 2PCCB 1HZUA 1DT1A 1WVEC 1FHBA 1W2LA 3SWSA 1I5TA 5DJQC 1CXCA 1C75A 3BCCD 4EIEA 1L9JC 5DFSA 1CTYA 2AXTV 1QKSA 1P84D 1CIGA 1E29A 1I6DA 1FCDC 2C8SA 1H31B 3ZOXA 2FYNB 1SQQD 1VYDA 4KMGA 5CIHB 1LC1A 1GIWA 4L3HA 4EIDA 2CE1A 2D0WA 1LC2A 1FI9A 2MHMA 1MG3D 2YK3A 1I6EA 1U75B 3RN1A 5KLIB 4UB6V 1BCCD 5GTHV 2L91A 1E8EA 1A2SA 1N15A 2JQRA 2QJKB 1KX7A 1CRHA 3KHUA 1M6ZA 1CORA 5C0ZA 3DR0A 3TYIA 2Q3EA 1R0QA 2BLFB 2D0SA 351CA 3WU2V 1CIFA 3OA8A 3FWLA 2KS1A 4RJTA 4H0JA 2OZ1B 1S5LV 3WFDC 1KB9D 1IQCA 1NTMD 155CA 1CRJA 4PJ0V 5CICB 2AI5A 5CIDB 4FA5A 5CIEB 3M97X 3OCDA 1NTKD 4XYDB 1YTCA 2GC4D 3O1YA 2Y0CA 3L70D 1H9YA 1CRGA 2A06D 3H1KD 4AX3A 5CIBB 5DF5A 4AANA 4EDFA 3SXTA 1I55A 3PHLA 2FRCA 1SQPD 1LMSA 2QJPB 1RZ6A 1GU2A 2GIWA 1CSUA 3CU4A 4O1WA 5CYTR 1CSVA 4MU8A 3PRJA 1FJ0A 4P4QB 1QN2A 1NTZD 1YICA 1J3SA 3VYMA 2LITA 1NIRA 1FI3A 3RN0A 5B6QA 2GC7D 2QG4A 1PP9D 1DW1A 1M60A 1LFMA 2Y0DA 1HH7A 3RMZA 3L73D 2N18B 3ORVA 2AIUA 1DIIC 1H31A 2K9JB 1YEBA 4U3FD 2N3YA 3HQ6A 2B10B 1YNRA 2BH4X 1DW3A 3PH2B 4GYDA 1CHIA 1C7MA 3PXWA 1PPJD 2VHDA 2QJYB 3ITKA 3NWVA 3O0RC 2B0ZB 2N3BA 2N9YB 1YFCA 3WFBC 1DVVA 3VNWA 4N0KA 3TDKA 1IO3A 3HQ8A 4WQBA 1SQVD 3SJLA 1H32A 1IRWA 1HCMA 1BE3D 1YEAA 1NNOA 1CSXA 1CHJA 3ZOOA 2B11B 1I54A 3CP5A 4LJIA 1GKSA 1HRCA 2Y0EA 3A9FA 1FI7A 1EB7A 5E79V 5B66V 1L0ND 5TISV 1K3HA 1KX2A 4D6TD 1CNOA 1HJ4A 1OCDA 1HROA 1JDLA 1CCHA 4WQ8A 1AKKA 1KIBA 2RMZA 4PWAA 3L71D 2DGEA 3A0BV 1KB0A 1C52A 4FA1A 1ETPA 1RZ5A 3O20A 5IY51 1U74B 4V2KA 4PW9B 4WQEA 1CRIA 3MK7B 2BCNB 3WFCC 1CXAA 3PLNA 3ZIYA 3CWBD 5B5EV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PCB B;  2ZZS 1;  2IBZ D;  2XTS B;  4EIC A;  1CO6 A;  4A7P A;  4PD4 D;  5KLV D;  1CSW A;  4L3G A;  5DJQ B;  3PXT A;  5EXQ A;  1HZV A;  1QYZ A;  2ZXY A;  3MK7 C;  1CYC A;  1CCR A;  3OCD B;  2V08 A;  3ZBM A;  3WUI A;  1CHH A;  1IZL 0;  3HQ9 A;  3VMA A;  4Q5P A;  3GG2 A;  1CYI A;  1SQB D;  3DMI A;  1C6O A;  2ZOO A;  1RAQ A;  1H33 A;  4J20 A;  1B7V A;  4AAO A;  1H9X A;  3KZI V;  1QL3 A;  1GJQ A;  4Y5R A;  1NU1 D;  3PXS A;  4XXL A;  4YE1 A;  1EZV D;  4WQ7 A;  4GED B;  4WQD A;  1CRY A;  3PTZ A;  3H1L D;  3RLM A;  3CXH D;  2N9I A;  2HV4 A;  5H2F V;  3L75 D;  1I8O A;  4WQ9 A;  3SVW A;  1C6R A;  1L9B C;  2ZON G;  3O5C A;  1MG2 D;  2CA4 B;  2OZ1 A;  1KYO W;  3NBS A;  3H1H D;  2I8F A;  2RN0 A;  3SLE A;  3HQ7 A;  5GTI V;  1E2R A;  4WQA A;  2YQB A;  5AUR A;  1COT A;  5KAF V;  1YCC A;  4FA4 A;  2MTA C;  1HJ3 A;  3L4O A;  3CYT I;  2FWL A;  4QAO A;  2CE0 A;  3L74 D;  1OAE A;  1CIH A;  1K3G A;  4WQC A;  1CED A;  3NBT A;  3ZOW A;  1M70 A;  1CIE A;  1NMI A;  1N50 A;  2DVH A;  2O3J A;  1AOQ A;  1IRV A;  2ZBO A;  1H32 B;  1QL4 A;  2B12 B;  4UB8 V;  2YCC A;  1LS9 A;  3A0H V;  1GDV A;  3X39 A;  3ZOY A;  3CXH W;  3H1I D;  4FAN A;  2C1V A;  5CIF B;  1L0L D;  1ZZH A;  5TJH A;  3TGU D;  2CXB A;  3L4M A;  4O1Q A;  1KYO D;  1I8P A;  4EIF A;  4H0K A;  1C6S A;  4DY9 A;  2L4D A;  1CC5 A;  1F1C A;  3ZCF A;  2CA3 B;  2ORL A;  4AAM A;  1H1O A;  3JBT B;  3GW6 A;  3WFE C;  2V07 A;  3L72 D;  3TF5 A;  2N9J A;  1DW0 A;  2C1D B;  2C9X B;  2BCC D;  2C1D A;  2JWA A;  2N18 C;  1DW2 A;  2FYU D;  4NFG B;  2B4Z A;  5KKZ B;  2BGV X;  3OA8 B;  1CTJ A;  5C9M A;  4RSZ A;  2GB8 B;  1N90 A;  2BPB B;  1CTZ A;  5CIG B;  1DIQ C;  1KV9 A;  4FAV A;  2JTI B;  1AOF A;  1CRC A;  5KAI V;  4FA9 A;  1WEJ F;  1ZRT D;  1YIQ A;  2KNC B;  3CX5 W;  4FB1 A;  1W5C T;  4AAL A;  1S6V B;  3H1J D;  1A8C A;  1C2R A;  2PAC A;  1AYG A;  451C A;  2C1U A;  1FOC A;  2BH5 X;  4K3I A;  1HJ5 A;  4IL6 V;  3DP5 A;  2LIR A;  3C2C A;  2C2C A;  1MZ4 A;  2EXV A;  1H33 B;  1CYJ A;  1BL9 A;  1NML A;  1F1F A;  1C2N A;  1BGY D;  1GQ1 A;  3CX5 D;  4JCG A;  3WC8 A;  2YIU B;  1A56 A;  1SQX D;  1N9C A;  1DVH A;  3VRD A;  4L1Q A;  1RAP A;  2PCC B;  1HZU A;  1DT1 A;  1WVE C;  1FHB A;  1W2L A;  3SWS A;  1I5T A;  5DJQ C;  1CXC A;  1C75 A;  3BCC D;  4EIE A;  1L9J C;  5DFS A;  1CTY A;  2AXT V;  1QKS A;  1P84 D;  1CIG A;  1E29 A;  1I6D A;  1FCD C;  2C8S A;  1H31 B;  3ZOX A;  2FYN B;  1SQQ D;  1VYD A;  4KMG A;  5CIH B;  1LC1 A;  1GIW A;  4L3H A;  4EID A;  2CE1 A;  2D0W A;  1LC2 A;  1FI9 A;  2MHM A;  1MG3 D;  2YK3 A;  1I6E A;  1U75 B;  3RN1 A;  5KLI B;  4UB6 V;  1BCC D;  5GTH V;  2L91 A;  1E8E A;  1A2S A;  1N15 A;  2JQR A;  2QJK B;  1KX7 A;  1CRH A;  3KHU A;  1M6Z A;  1COR A;  5C0Z A;  3DR0 A;  3TYI A;  2Q3E A;  1R0Q A;  2BLF B;  2D0S A;  351C A;  3WU2 V;  1CIF A;  3OA8 A;  3FWL A;  2KS1 A;  4RJT A;  4H0J A;  2OZ1 B;  1S5L V;  3WFD C;  1KB9 D;  1IQC A;  1NTM D;  155C A;  1CRJ A;  4PJ0 V;  5CIC B;  2AI5 A;  5CID B;  4FA5 A;  5CIE B;  3M97 X;  3OCD A;  1NTK D;  4XYD B;  1YTC A;  2GC4 D;  3O1Y A;  2Y0C A;  3L70 D;  1H9Y A;  1CRG A;  2A06 D;  3H1K D;  4AX3 A;  5CIB B;  5DF5 A;  4AAN A;  4EDF A;  3SXT A;  1I55 A;  3PHL A;  2FRC A;  1SQP D;  1LMS A;  2QJP B;  1RZ6 A;  1GU2 A;  2GIW A;  1CSU A;  3CU4 A;  4O1W A;  5CYT R;  1CSV A;  4MU8 A;  3PRJ A;  1FJ0 A;  4P4Q B;  1QN2 A;  1NTZ D;  1YIC A;  1J3S A;  3VYM A;  2LIT A;  1NIR A;  1FI3 A;  3RN0 A;  5B6Q A;  2GC7 D;  2QG4 A;  1PP9 D;  1DW1 A;  1M60 A;  1LFM A;  2Y0D A;  1HH7 A;  3RMZ A;  3L73 D;  2N18 B;  3ORV A;  2AIU A;  1DII C;  1H31 A;  2K9J B;  1YEB A;  4U3F D;  2N3Y A;  3HQ6 A;  2B10 B;  1YNR A;  2BH4 X;  1DW3 A;  3PH2 B;  4GYD A;  1CHI A;  1C7M A;  3PXW A;  1PPJ D;  2VHD A;  2QJY B;  3ITK A;  3NWV A;  3O0R C;  2B0Z B;  2N3B A;  2N9Y B;  1YFC A;  3WFB C;  1DVV A;  3VNW A;  4N0K A;  3TDK A;  1IO3 A;  3HQ8 A;  4WQB A;  1SQV D;  3SJL A;  1H32 A;  1IRW A;  1HCM A;  1BE3 D;  1YEA A;  1NNO A;  1CSX A;  1CHJ A;  3ZOO A;  2B11 B;  1I54 A;  3CP5 A;  4LJI A;  1GKS A;  1HRC A;  2Y0E A;  3A9F A;  1FI7 A;  1EB7 A;  5E79 V;  5B66 V;  1L0N D;  5TIS V;  1K3H A;  1KX2 A;  4D6T D;  1CNO A;  1HJ4 A;  1OCD A;  1HRO A;  1JDL A;  1CCH A;  4WQ8 A;  1AKK A;  1KIB A;  2RMZ A;  4PWA A;  3L71 D;  2DGE A;  3A0B V;  1KB0 A;  1C52 A;  4FA1 A;  1ETP A;  1RZ5 A;  3O20 A;  5IY5 1;  1U74 B;  4V2K A;  4PW9 B;  4WQE A;  1CRI A;  3MK7 B;  2BCN B;  3WFC C;  1CXA A;  3PLN A;  3ZIY A;  3CWB D;  5B5E V; 
#chains in the Genus database with same CATH topology
 2ZZS 1;  1EDL A;  2XTS B;  4PD4 D;  1CSW A;  4DJG A;  1EZV E;  5EXQ A;  2D2C B;  2QA4 P;  2V08 A;  1BCC J;  3ZBM A;  3V2Q A;  1CHH A;  1IZL 0;  3AE3 C;  4Q5P A;  4B86 A;  2M3E A;  2HPC B;  1FZC B;  1NU1 G;  3CX5 E;  3DMI A;  2ZOO A;  3GF3 A;  1PP9 E;  3UIA A;  3LW5 J;  1JMB A;  1LWU C;  1U7J A;  2ZXX A;  2M5A B;  1CRY A;  3PTZ A;  1S5L E;  4NPF X;  1NTM J;  2HV4 A;  1GTW A;  1SP4 A;  1YIJ P;  1MZ9 A;  1PGO A;  1EDK A;  2JR8 A;  3G6E P;  4YXD C;  3O5C A;  4JYB A;  4W7Y A;  1YTZ T;  2CA4 B;  2OZ1 A;  4BXL A;  4AYC A;  4UB6 E;  2OYH C;  5AW7 B;  3L70 E;  4HB1 A;  2YQB A;  3F5H A;  1FAV A;  5KAF V;  1W2B O;  1DH3 A;  2CK3 H;  3P8C E;  1FZF A;  4QAO A;  2G3A A;  3FX0 A;  1CIH A;  3FGA D;  1E79 H;  3GF7 A;  2E5T A;  3VN0 A;  1NMI A;  1GK6 A;  1HJB A;  1S3J A;  1AOQ A;  2ZBO A;  2B12 B;  1SQV E;  3L73 G;  5M1B A;  1LS9 A;  3ZOY A;  3A3Y B;  1GDV A;  1KIL C;  3CXH W;  2HOD B;  2C1V A;  1SFC D;  1DD4 A;  1FE6 A;  1FDO A;  1C6S A;  2JJL A;  3RBZ A;  1LTB C;  1W2E A;  3ABV C;  1F1C A;  1YI2 P;  2WMM A;  3AEE C;  2QEX P;  3GW6 A;  3BCC J;  3WFE C;  3HE5 B;  2XV5 A;  3GLM A;  1KC8 Q;  1LTT C;  2IDB A;  1DW0 A;  3L71 E;  2N18 C;  1VF5 C;  2B4Z A;  3P7K A;  2Q1K A;  1AA0 A;  4ASV A;  4BRY B;  2O01 J;  2KZJ A;  1M1J C;  4W80 A;  4CPG A;  2W6A A;  1SQB K;  2AEJ A;  2ZYG A;  4H44 C;  3CX5 W;  3OJA B;  1AFO A;  2OYI B;  2P7J A;  2H89 C;  2Q7C A;  4JF7 A;  3RL0 D;  1RY3 A;  2E76 C;  1OMI A;  1EXJ A;  1C2R A;  1PIX A;  3HRN A;  3RK3 D;  1CW5 A;  1ZV8 A;  5AW1 B;  2BH5 X;  3L75 E;  4IL6 V;  1HUC A;  1NTK K;  3H1L E;  3DP5 A;  2LIR A;  1H33 B;  1NML A;  2KLU A;  1BGY D;  4JCG A;  2YIU B;  2RH0 A;  2NPS C;  2A06 G;  3S1K A;  4OGQ D;  1A56 A;  1SQX D;  1EZV G;  1VQK P;  2QM7 A;  4AUW A;  2BCC G;  1FZA A;  3Q5P A;  1VQM P;  2GM4 A;  2P2U A;  1I5T A;  2ZYD A;  1KB9 E;  3G4S P;  3HUS C;  3V4Q A;  1MUU A;  4PD4 E;  4EIE A;  2WSC H;  3CCU P;  5DFS A;  1X8Y A;  4U3F G;  1NHL A;  4BRY A;  4R4M A;  3WU2 H;  1WRG A;  1HH0 A;  2R5D A;  1H31 B;  3ZOX A;  4N6J A;  2FYN B;  1VYD A;  4KMG A;  2P1J A;  1LC1 A;  2WIT A;  3RL0 C;  4H13 C;  2E76 D;  1J2J B;  2CE1 A;  2OGU A;  4WY4 A;  3Q5S A;  1LC2 A;  2Y9Y A;  1FI9 A;  4H44 D;  2FFD A;  1FOS F;  4GOE A;  3RN1 A;  1KB9 H;  1VQO P;  1SQV K;  1G2C A;  1VPC A;  3MHV A;  4EI2 A;  1KX7 A;  3H32 B;  1LNQ A;  3CCQ P;  1BE3 E;  3RL0 B;  1R0Q A;  2BLF B;  1LTJ C;  3L74 G;  1LTG C;  4H0J A;  4L74 A;  5CCG D;  1HBW A;  5AVU B;  2OZ1 B;  3CCV P;  3CC2 P;  1USE A;  2N1T A;  3CC7 P;  1YIT P;  3D6Y A;  1IQC A;  3L74 E;  1MFT A;  1ZW0 A;  1K73 Q;  1QLE D;  4WB4 A;  2AXT H;  1NU1 J;  2VRS A;  1IC2 A;  4D6T J;  1L0N J;  1BGY E;  1GZL A;  1NTK G;  4IOI H;  1KQL A;  1ZXG A;  3I56 P;  3O1Y A;  2Q3I A;  1KN7 A;  1CRG A;  2A06 D;  1E5W A;  4AX3 A;  5E79 E;  5CIB B;  4EDF A;  1JEK A;  3I55 P;  2PRR A;  1P84 H;  5AW4 B;  2JO1 A;  3O8Z A;  1RZ6 A;  1X0T A;  4KHX A;  2GIW A;  1FBM A;  1K04 A;  2Y9Z A;  1KD1 Q;  1VQP P;  5CYT R;  3HTK A;  2FBW C;  1T8Z A;  1S9K E;  4ZKP A;  2FYU G;  1W5C E;  1QN2 A;  2W90 A;  1NIR A;  2WVR A;  1VF5 B;  1X79 B;  4I2L C;  4KT0 J;  3SWY A;  4RES B;  1JCC A;  5TIS E;  1DW1 A;  5B66 E;  3L72 G;  1M60 A;  3SWK A;  2MKV A;  2E75 C;  5BU8 B;  1KIL D;  3WUV A;  1YEB A;  1YBK A;  3L72 E;  2N3Y A;  4EOT A;  3HQ6 A;  2YMY A;  2B0Z B;  1H0T A;  1OW8 A;  1DVV A;  3G9R A;  3TNU A;  2N1T B;  3JSV C;  2M3B A;  3TDK A;  1IO3 A;  1ZLL A;  1FZC A;  3U1A A;  1SQP J;  4L75 A;  1Z56 A;  4HYT B;  3H1L G;  3H1K J;  2YMK A;  4LJI A;  2E43 A;  1GKS A;  1FI7 A;  1NTZ K;  3JC2 2;  1T2K D;  1L0N D;  4D6T D;  1SLQ A;  1CCH A;  4WQ8 A;  3CXH I;  1RHZ B;  1OFC X;  3NTN A;  5APT A;  4PJ0 H;  4LC1 A;  2K9Y A;  2V7Q H;  1SQX K;  4C7N B;  3H1I G;  1Q81 Q;  2IBZ G;  4PV1 B;  3MK7 B;  2FYU K;  2OTK E;  3PLN A;  1GDT A;  3MZW B;  1N7S D;  1DX7 A;  4JQ0 D;  1T6A A;  2FXP A;  2HYN A;  1FDM A;  5KAI H;  1QYZ A;  2ZXY A;  3MK7 C;  1VF5 D;  3L70 G;  3F89 A;  3HQ9 A;  3VMX A;  1OVV A;  1H88 A;  3VMA A;  1LWU A;  1L0L G;  1CYI A;  1C6O A;  2BCC J;  2FXO A;  2IFM A;  4J20 A;  3V6I A;  4PJ0 E;  1YJ9 P;  4AAO A;  1QL3 A;  1M1K Q;  1NU1 D;  4XXL A;  4WQ7 A;  4WQD A;  1VQ9 P;  3RLM A;  2N9I A;  5H2F V;  3L75 D;  1KB9 I;  3KQG A;  2SPZ A;  1C6R A;  4GIF A;  3TGU J;  1JO5 A;  1L9B C;  2ZON G;  2YO3 A;  1J1E B;  4Y28 J;  3P32 A;  2JWD A;  1FZG A;  1FJK A;  1RE3 C;  5CCH C;  3MGN A;  5GTH E;  3HQ7 A;  2A06 E;  3IAO A;  2W83 C;  4WQA A;  1PGJ A;  1QL2 A;  1NTK E;  2YXQ B;  2MTA C;  1NTZ G;  2QIW A;  1GW3 A;  2FWL A;  2QJY C;  3KXD A;  1RE3 A;  1URQ D;  5CCH A;  3NBT A;  1N50 A;  4IL6 E;  1SQP K;  2O3J A;  4WY4 C;  2KNC A;  1IRV A;  1H32 B;  1QL4 A;  3A0H V;  1YQ3 C;  3CWB E;  2K1A A;  2HOD A;  3TGU D;  3G71 P;  1KYO D;  1I8P A;  4OH8 B;  5GTH H;  3OW2 O;  5APU A;  1N73 A;  1PPJ E;  3AE7 C;  4DY9 A;  4AAM A;  5EFW B;  3L72 D;  2C1D B;  2C9X B;  2I1J A;  3JCU E;  1Q86 Q;  1DW2 A;  3AE2 C;  5KKZ B;  2KK7 A;  2BGV X;  1LTS C;  1SQX J;  3OA8 B;  1CTJ A;  2ZAE B;  4RSZ A;  1KIL B;  1N90 A;  5AVQ B;  2BPB B;  1MV8 A;  5CIG B;  2IYO A;  3OAK A;  4K3A A;  1SQQ E;  1CRC A;  5KAI V;  4I7Z C;  1WEJ F;  2KNC B;  1SFC B;  4FB1 A;  1RE4 A;  4AAL A;  1KZU B;  5AW3 B;  1FZE A;  3SSU A;  1PPJ G;  3Q5R A;  1NOH A;  2BEQ D;  1M7L A;  5CJ0 A;  2PAC A;  2NZ2 A;  1IK7 A;  1KTM A;  4UB8 E;  2C1U A;  1FOC A;  3NFQ A;  2DW3 A;  2E75 D;  1HJ5 A;  2FY8 A;  2C2C A;  3VYI A;  1LP1 A;  1C2N A;  5E79 H;  4UB8 H;  5KLI C;  3CD6 P;  5DJU B;  2R44 A;  2W6J H;  1SQB E;  5CMZ A;  3WC8 A;  1KFN A;  5TIS H;  3CL3 D;  2B88 A;  2HPC A;  4DT0 A;  3VRD A;  2PCC B;  1HZU A;  1HGV A;  1GW4 A;  1HTL C;  5APS A;  1DT1 A;  1GU4 A;  5DJQ C;  1CXC A;  3BCC D;  1DEE G;  2C0X A;  3WMM 0;  5AVV B;  1QKS A;  3RK3 B;  1GMJ A;  2GA1 A;  2N9B A;  1I6D A;  2C8S A;  1Q82 Q;  4N78 E;  1SQQ D;  1DIP A;  1CI6 A;  1GL2 D;  1BCC E;  4EID A;  2E5Y A;  1MG3 D;  2YK3 A;  4I6M C;  2BEZ F;  4MN4 C;  2FYU E;  3GHG C;  5AVY B;  1BCC D;  5GTH V;  2OAR A;  3HD7 B;  4Y99 C;  5CCG C;  4D6T G;  1X9V A;  2JQR A;  3KHU A;  1NVO A;  3HD7 C;  1NTM E;  1JNM A;  2OTJ P;  2PAJ A;  3VP9 A;  5C0Z A;  351C A;  3WU2 V;  2KSE A;  2KS1 A;  3D6Z A;  2KZI A;  1S72 P;  2XKM A;  4GOF A;  3WFD C;  2XNX A;  1ZP0 C;  4PJ0 V;  3T97 B;  2PGD A;  3B5N B;  3V2P A;  3L70 J;  3AEB C;  1KQG B;  3HE5 A;  3P8C D;  2QE7 H;  3A0B E;  3M97 X;  1NTK D;  2GC4 D;  3H1J G;  4N3Y B;  1QVG O;  1GL2 C;  3W67 A;  1IFI A;  2KIK A;  1I55 A;  3S4R A;  1IFN A;  1X22 A;  4GT1 A;  2E42 A;  2QJP B;  1BE3 G;  3L36 A;  5KLV K;  2WSF H;  2NPS B;  5AVZ B;  1SQQ G;  5AW5 B;  1FJ0 A;  2R3S A;  4P4Q B;  1FC2 C;  1YIC A;  3VYM A;  2LIT A;  2E74 D;  2HR3 A;  3BCC E;  3C9I A;  1FI3 A;  3RN0 A;  1MFZ A;  2YXR B;  2KS1 B;  1NTM K;  2CPS A;  1CZQ A;  2Q5U A;  3CC4 P;  3L73 D;  4U7J A;  1ZOY C;  2N18 B;  2AIU A;  1PV3 A;  3CCJ P;  3GHG A;  2YKQ A;  1S5L H;  5C39 A;  2KSJ A;  1NWQ A;  3H6P A;  2B10 B;  3PP5 A;  3PH2 B;  2C0W A;  1C7M A;  1CHI A;  5KLV E;  5APQ A;  2VHD A;  1XTC C;  2QJY B;  2O1K A;  1KYO E;  1N86 A;  3O0R C;  3RK3 E;  1L0L E;  3WFB C;  4N0K A;  1NO4 A;  2NRG A;  3RL0 g;  4OGQ B;  4DZO A;  2P10 A;  1OX3 A;  1YEA A;  2JEE A;  3L75 J;  2FKW B;  1NNO A;  4NPE A;  3M06 A;  1JB0 J;  1LP1 B;  5AVW B;  1HRC A;  3A9F A;  1M1J A;  1EB7 A;  4OGQ C;  2XND H;  5B66 V;  3VP8 A;  1KX2 A;  1M57 D;  1Q2N A;  1CNO A;  1HJ4 A;  3L73 J;  1OCD A;  5KLV G;  2WTY A;  1FOS E;  3VTP C;  1VQ7 P;  3CCS P;  3H1H E;  1KB0 A;  2J5U A;  1RZ5 A;  1EC5 A;  3M9B A;  4EIJ A;  2IFN A;  5AW0 B;  4PW9 B;  2BCN B;  3WFC C;  3H1J J;  2HG5 D;  3K5B A;  2JP3 A;  2IBZ D;  3WU2 E;  2WQY C;  4EIC A;  4KJM A;  4A7P A;  2LKM A;  3LID A;  4GOD A;  2IPP A;  2KLV A;  3I5C A;  5AW8 B;  2AXC A;  4TLF A;  3OCD B;  1CSB A;  1KIL E;  1NKZ B;  1RF1 B;  5AVS B;  3HUS B;  1Q90 D;  4YPC A;  1SQQ K;  2KUB A;  1CI6 B;  1RAQ A;  1H33 A;  3NMD A;  1B7V A;  3CCR P;  1H9X A;  2LXB A;  1GJQ A;  4Y5R A;  3IF4 A;  3N4X A;  1EZV D;  3B5N C;  3D71 A;  3H1L D;  3CXH D;  1URQ A;  5CCH D;  3L37 A;  3CME P;  1GL2 A;  5AW9 B;  4H0L B;  3SWF A;  3U59 A;  3CCM P;  1JUN A;  3IR9 A;  2ZVN B;  1JM0 A;  1KYO W;  1NH4 A;  1L4A C;  3H1H D;  2I8F A;  3B5N A;  3LW5 H;  3L74 J;  5GTI V;  1WMK A;  1E2R A;  1NU1 E;  4U3F J;  3M91 A;  4D6T E;  2QM8 A;  2Q9I A;  2OTL P;  1YCC A;  1HJ3 A;  1OW7 A;  3L4O A;  1QX8 A;  5K5G B;  3L74 D;  1K3G A;  3L75 G;  3ZOW A;  2RKL A;  1G2C B;  1K05 A;  1GL2 B;  4H13 B;  4UB8 V;  1VL2 A;  2OQQ A;  3QWO C;  1L0L D;  5TJH A;  1JTH A;  4O1Q A;  1YJN P;  1PP9 G;  4EIF A;  1PFI A;  4H0K A;  4LLH A;  2H88 C;  3BRV B;  2IX7 C;  1D7M A;  1H1O A;  1LTA C;  2QSI A;  1KV4 A;  3BAT A;  2V07 A;  3TF5 A;  2N9J A;  5KAI E;  1AV1 A;  2C1D A;  1YQ4 C;  4NFG B;  1N8R Q;  5C9M A;  2GB8 B;  3EFG A;  3C8V A;  5APX A;  3L72 J;  1CTZ A;  1OZH A;  1SS1 A;  2ZXE B;  3L35 A;  1Y8A A;  2B87 B;  1QGK B;  4I1L A;  1JY3 O;  4FAV A;  1L2P A;  2JTI B;  4FA9 A;  1VQN P;  1LT9 C;  1K9M Q;  3A0H H;  5CCG A;  3B4S A;  4WBA A;  3H1I J;  1LTJ A;  3CI9 A;  1A02 F;  3H1J D;  2KOG A;  1K8A Q;  3II6 A;  1NAY A;  1A8C A;  2YKO A;  1SFC C;  3Q3D A;  1AYG A;  3A0H E;  1SQX G;  4I7Z B;  3CPW O;  1AQ5 A;  4K3I A;  4DOJ A;  3A7O A;  3C2C A;  3AE1 C;  1QEX A;  1SQV G;  1BL9 A;  1F1F A;  3CX5 D;  1JCD A;  3AE4 C;  1BDC A;  1LWU B;  3VMY A;  5AVX B;  1DVH A;  4JPZ B;  5CHX A;  1RAP A;  4WWI A;  2B89 A;  2M8R A;  3SWS A;  2WSC J;  3S9O A;  1NTZ E;  1FDI A;  2D2C C;  3AEC C;  3P8M C;  2WPS A;  1KIL A;  5APV A;  1E29 A;  3PH0 A;  3MTU E;  3W68 A;  1FCD C;  2WPQ A;  1JY2 P;  2E74 C;  1NKN A;  3MD0 A;  5DJT B;  2QVA A;  2YO2 A;  1R8E A;  2FYN C;  3HUS A;  3H25 A;  5CBN A;  1G1I A;  4L3H A;  1U7M A;  1H0T B;  3JCU H;  2MHM A;  4ZNC A;  1I6E A;  2K88 A;  2B87 A;  2BCC E;  3MUD C;  5KLI B;  1PP9 J;  4UB6 V;  1SQP G;  3A0B H;  3AED C;  3IN6 A;  3KDP B;  3B71 A;  3BVH A;  2QJK B;  2ZT9 D;  2FYZ A;  3EWK A;  3H1K G;  5H2F H;  2HLO A;  3E1R A;  3C1L A;  1COR A;  1JOC A;  3TGU E;  1J1E C;  3DR0 A;  3TYI A;  2Q3E A;  3M0D A;  4EYY Q;  2WPV B;  3G3Z A;  1FS0 E;  3OA8 A;  3QH9 A;  5H2F E;  4RJT A;  1S5L V;  1NU1 K;  3H32 A;  4GKG A;  3N7N A;  1BCC G;  3KZI E;  5CIC B;  3B5N D;  4QMA A;  2WSF J;  3Q2Y A;  4C7N A;  1YTZ I;  3MIW A;  4FA5 A;  5L8R J;  3MP7 B;  3E1I A;  1NTK J;  2N1T D;  4H13 D;  2E76 B;  4BWN A;  1YTC A;  1KQF B;  1S4X A;  3AEG C;  3EFF K;  2Y0C A;  1ZN5 A;  3L70 D;  1SVF A;  1M8O B;  3H1K D;  1FZC C;  4C7R A;  4OWF A;  4AAN A;  5AVR B;  3SXT A;  1SQP D;  4WY4 D;  2YKP A;  1J1D B;  1AVY A;  1QL1 A;  1PL5 A;  1SQV J;  2K3R A;  3RBX A;  1VQ8 P;  5B66 H;  3CU4 A;  1PGP A;  2XU6 A;  1KOR A;  3KZI H;  3SFD C;  4MU8 A;  3E7K A;  2M5A A;  1J3S A;  3CCE P;  1L0N K;  1IO4 A;  1IFD A;  5B6Q A;  3RK2 B;  2GC7 D;  3HTK B;  3L71 J;  5BVZ A;  2Y0D A;  2IZ1 A;  5KAF H;  1SQX E;  1HH7 A;  3RMZ A;  1M90 Q;  1NYH A;  1H31 A;  2K9J B;  3WUU A;  2KB7 P;  3CXH H;  4U3F D;  2I8D A;  5AVT B;  2BAS A;  5BU5 A;  5KJ7 C;  1DW3 A;  2KXP B;  4GYD A;  1SQQ J;  5APW A;  1PPJ D;  1RF1 A;  2PFX A;  2N3B A;  2N9Y B;  2ZJS E;  1RQU A;  2FFD B;  1Y47 A;  4AQR D;  4H0L D;  2IYP A;  1SQV D;  1H32 A;  1AJY A;  1ZRT E;  3RK3 C;  1CHJ A;  2B11 B;  2OYI C;  1DD3 A;  3H1L J;  3V4W A;  4H44 B;  1VQL P;  2Y0E A;  2C9N Y;  3TK1 A;  2E74 B;  1UII A;  1Q7Y Q;  5E79 V;  2CPB A;  2PP6 A;  4ZMD A;  3T97 A;  5TIS V;  2WWW A;  1K3H A;  4XE5 B;  4O9B A;  1HRO A;  1JDL A;  1OVU A;  2RMZ A;  3L71 D;  2DGE A;  3M9Q A;  5CJ4 A;  3RGU A;  1C52 A;  5GTI H;  1LT1 A;  4OVN F;  1USD A;  1KFM A;  2OYI A;  3O20 A;  5IY5 1;  1U74 B;  4V2K A;  1KYO I;  1L4A A;  1CRI A;  1CXA A;  3ZIY A;  1IZN B;  1N7S B;  2PCB B;  4R4L A;  4ASW A;  1CO6 A;  1SQB G;  4L73 A;  1YHQ P;  5KLV D;  5APY A;  4L3G A;  5DJQ B;  3PXT A;  1HZV A;  3A2A A;  1CYC A;  1CCR A;  1OIP A;  4H0L C;  2GUS A;  4ZKU A;  3WUI A;  4JBZ A;  1HGZ A;  1LTI C;  3GG2 A;  4IFF A;  1P84 I;  2FXM A;  2FYU J;  1R5L A;  1T2K C;  1SQB D;  1BDD A;  3KZI V;  1URQ C;  3PXS A;  2ZFC A;  4YE1 A;  3HD7 D;  4GED B;  2KP8 A;  1HJ0 A;  1QVF O;  1M56 D;  2OYH B;  1N7L A;  3L71 G;  3KPE A;  2IBZ E;  3RK2 D;  1NJI Q;  1I8O A;  4WQ9 A;  1L4A D;  3OA7 A;  3SVW A;  1UIX A;  1BE3 J;  4W7Z A;  2KYV A;  2LXC B;  1RF0 A;  3VOP A;  2J58 A;  2M0B A;  1MG2 D;  3AE9 C;  2OYO A;  3D70 A;  1NGM B;  3NBS A;  4IFM A;  3H1H G;  1EXI A;  2RN0 A;  1AQT A;  2AXT E;  3SLE A;  2R3C A;  1EZV I;  1S1C X;  1EQ7 A;  3CX5 H;  1KMI Z;  4WVZ A;  1JMM A;  4WY4 B;  1Y9B A;  2ZT9 C;  5AUR A;  2Q6Q A;  1H89 A;  1LTJ B;  1COT A;  1L0N E;  3FWN A;  1BGY J;  4FA4 A;  1KYO H;  1S2E A;  1RH5 B;  2W6B A;  4TT3 H;  1H8A A;  3CYT I;  4JYC A;  2CE0 A;  1OAE A;  2W8Z A;  4WQC A;  1CED A;  1L4A B;  3TYY A;  3D0W A;  3TNU B;  1M70 A;  1S5L X;  1CIE A;  1TU3 F;  2DVH A;  2YCC A;  1U57 A;  3X39 A;  1GU5 A;  4FAN A;  3H1I D;  3CMA P;  5CIF B;  1ZZH A;  2CXB A;  3L4M A;  1G1J A;  4IL6 X;  3AEF C;  2ZVO B;  2L4D A;  1VDF A;  1CC5 A;  1PZQ A;  3CWB G;  3ZCF A;  2CA3 B;  2ORL A;  3JBT B;  4IL6 H;  4C46 A;  1EDJ A;  5CBO A;  2BCC D;  2JWA A;  4RO0 A;  2FYU D;  3AE6 C;  3R4Y A;  3V5B A;  3V2N A;  1IFM A;  3RK2 C;  2HFE D;  2OYH A;  4XFJ A;  2WT7 B;  1DIQ C;  1KV9 A;  5KLV J;  4PV1 C;  1AOF A;  1ZRT D;  3U1C A;  1YIQ A;  1S9K D;  3B8E B;  1W5C T;  1L0L J;  2K9J A;  1S6V B;  3O6Q A;  2YIU C;  1IFJ A;  1ZME C;  2G8Y A;  1SQP E;  2XZR A;  451C A;  3USS A;  1FU1 A;  4Z1M H;  3FXD A;  1PGQ A;  2O01 H;  3CXH E;  3H1K E;  4YXW H;  2Z4E A;  2NPS A;  5KJ7 D;  1MZ4 A;  2EXV A;  2N1T C;  1VQ6 P;  2QJP C;  1CYJ A;  2B9B A;  1JY2 N;  2J59 M;  1GD2 E;  1GQ1 A;  1LJ2 A;  2ZYA A;  3L73 E;  2Z5I A;  1N9C A;  2WT7 A;  1HF9 A;  4L1Q A;  5KAF E;  1YJW P;  1DEB A;  1WVE C;  1FHB A;  1W2L A;  1L0N G;  2QRX A;  3H1H J;  3A5T A;  2AEM A;  1C75 A;  1OVR A;  2AEF A;  3VMZ A;  3CCL P;  5GTI E;  1L9J C;  1FJP A;  1IJD B;  1CTY A;  2AXT V;  3FXE A;  3H1J E;  4K35 A;  3L4F A;  1N7S A;  4L76 A;  1P84 D;  3CLQ A;  1CIG A;  2W27 A;  3BCC G;  3WUT A;  1IFP A;  3HE4 B;  1OXZ A;  2E75 B;  2WPR A;  3GHG B;  3EQ2 A;  1N7S C;  1JTH B;  1MKM A;  3AE5 C;  3TSI A;  5CIH B;  4HH2 A;  1L0L K;  2H43 A;  1T3U A;  2YNY A;  1GIW A;  2O01 N;  3IFM A;  3NXS A;  2D0W A;  5KTB A;  1GK4 A;  3BAS A;  1BSH A;  3Q1M A;  1U75 B;  2UWJ E;  4LGD E;  2IZ0 A;  4UB6 H;  2L91 A;  1E8E A;  1IK9 A;  1OW6 A;  1A2S A;  1J1D C;  2L5G B;  1VQ4 P;  2JKV A;  1N15 A;  3AE8 C;  4N78 D;  2KI7 B;  1CRH A;  1N73 B;  1M6Z A;  2ZT9 B;  2XDJ A;  1AVO A;  2WSS H;  4RKU J;  2D0S A;  3CX5 I;  1FZB A;  1NTM G;  1CIF A;  3FWL A;  2K37 A;  2R32 A;  3M9H A;  1JY3 P;  1R5S A;  1KB9 D;  4HKZ H;  1NTM D;  155C A;  1CRJ A;  4IFD K;  2AI5 A;  5AW2 B;  5CID B;  1N73 C;  4M3L A;  4U3F E;  5CIE B;  3SFE C;  3OCD A;  4XYD B;  4HJG H;  2WZ7 A;  2Z5H A;  3R2P A;  5B5E H;  2MJZ A;  3PJS K;  1H9Y A;  2I1K A;  3KYQ A;  5DF5 A;  3PHL A;  2FRC A;  3TGU G;  5B5E E;  4PD4 I;  2FFD C;  1LMS A;  5KKZ C;  3V2R A;  1GU2 A;  3HE4 A;  1NAF A;  1CSU A;  2GUV A;  3ZDM A;  1YYC A;  3CWB J;  3M0D C;  4O1W A;  1CSV A;  1ZR4 A;  3AEA C;  3PRJ A;  2WSE J;  1URQ B;  1NTZ D;  1JY2 O;  1RE4 C;  2H8P D;  4Y99 B;  2WSE H;  1RQV A;  2ITA A;  3LIE A;  1BGY G;  2QG4 A;  2P58 A;  1PP9 D;  3MUD A;  1XTG B;  2P67 A;  1LFM A;  2O1J A;  4GDO A;  3ORV A;  1DII C;  1A02 J;  3M0A A;  1LT9 B;  1YNR A;  2BH4 X;  2POH A;  2H7H A;  3PXW A;  2C9L Y;  2R5B A;  2A45 I;  3ITK A;  3NWV A;  2NPS D;  1YFC A;  3VNW A;  4NPD A;  3H1I E;  3HQ8 A;  4WQB A;  1RF0 C;  1JY3 N;  4YTP C;  1HWT C;  1M1J B;  4XA4 A;  1ZR2 A;  3SJL A;  1IRW A;  1HCM A;  1BE3 D;  1VQ5 P;  1LGH B;  1OWA A;  1WT6 A;  1BSN A;  1CSX A;  5KJ7 A;  3ZOO A;  1I54 A;  3O6Q B;  2A45 G;  3CP5 A;  3HD7 A;  2IBZ I;  1T3J A;  2V4H A;  4PV1 D;  2A45 H;  1SQB J;  1KQS O;  1LT9 A;  1AKK A;  1EDI A;  3BRT B;  1KIB A;  4PWA A;  1N2D C;  3GMA A;  3A0B V;  4PD4 H;  1HVV A;  4FA1 A;  1ETP A;  2D2C D;  2JDI H;  1SFC A;  2V7Q J;  1NTZ J;  1RF1 C;  4WQE A;  5AW6 B;  2QJK C;  4DCK A;  2LR2 A;  1P84 E;  3CWB D;  5B5E V; 
#chains in the Genus database with same CATH homology
 2PCB B;  2ZZS 1;  2IBZ D;  2XTS B;  4EIC A;  1CO6 A;  4A7P A;  4PD4 D;  5KLV D;  1CSW A;  4L3G A;  5DJQ B;  3PXT A;  5EXQ A;  1HZV A;  1QYZ A;  2ZXY A;  3MK7 C;  1CYC A;  1CCR A;  3OCD B;  2V08 A;  3ZBM A;  3WUI A;  1CHH A;  1IZL 0;  3HQ9 A;  3VMA A;  4Q5P A;  3GG2 A;  1CYI A;  1SQB D;  3DMI A;  1C6O A;  2ZOO A;  1RAQ A;  1H33 A;  4J20 A;  1B7V A;  4AAO A;  1H9X A;  3KZI V;  1QL3 A;  1GJQ A;  4Y5R A;  1NU1 D;  3PXS A;  4XXL A;  4YE1 A;  1EZV D;  4WQ7 A;  4GED B;  4WQD A;  1CRY A;  3PTZ A;  3H1L D;  3RLM A;  3CXH D;  2N9I A;  2HV4 A;  5H2F V;  3L75 D;  1I8O A;  4WQ9 A;  3SVW A;  1C6R A;  1L9B C;  2ZON G;  3O5C A;  1MG2 D;  2CA4 B;  2OZ1 A;  1KYO W;  3NBS A;  3H1H D;  2I8F A;  2RN0 A;  3SLE A;  3HQ7 A;  5GTI V;  1E2R A;  4WQA A;  2YQB A;  5AUR A;  1COT A;  5KAF V;  1YCC A;  4FA4 A;  2MTA C;  1HJ3 A;  3L4O A;  3CYT I;  2FWL A;  4QAO A;  2CE0 A;  3L74 D;  1OAE A;  1CIH A;  1K3G A;  4WQC A;  1CED A;  3NBT A;  3ZOW A;  1M70 A;  1CIE A;  1NMI A;  1N50 A;  2DVH A;  2O3J A;  1AOQ A;  1IRV A;  2ZBO A;  1H32 B;  1QL4 A;  2B12 B;  4UB8 V;  2YCC A;  1LS9 A;  3A0H V;  1GDV A;  3X39 A;  3ZOY A;  3CXH W;  3H1I D;  4FAN A;  2C1V A;  5CIF B;  1L0L D;  1ZZH A;  5TJH A;  3TGU D;  2CXB A;  3L4M A;  4O1Q A;  1KYO D;  1I8P A;  4EIF A;  4H0K A;  1C6S A;  4DY9 A;  2L4D A;  1CC5 A;  1F1C A;  3ZCF A;  2CA3 B;  2ORL A;  4AAM A;  1H1O A;  3JBT B;  3GW6 A;  3WFE C;  2V07 A;  3L72 D;  3TF5 A;  2N9J A;  1DW0 A;  2C1D B;  2C9X B;  2BCC D;  2C1D A;  2JWA A;  2N18 C;  1DW2 A;  2FYU D;  4NFG B;  2B4Z A;  5KKZ B;  2BGV X;  3OA8 B;  1CTJ A;  5C9M A;  4RSZ A;  2GB8 B;  1N90 A;  2BPB B;  1CTZ A;  5CIG B;  1DIQ C;  1KV9 A;  4FAV A;  2JTI B;  1AOF A;  1CRC A;  5KAI V;  4FA9 A;  1WEJ F;  1ZRT D;  1YIQ A;  2KNC B;  3CX5 W;  4FB1 A;  1W5C T;  4AAL A;  1S6V B;  3H1J D;  1A8C A;  1C2R A;  2PAC A;  1AYG A;  451C A;  2C1U A;  1FOC A;  2BH5 X;  4K3I A;  1HJ5 A;  4IL6 V;  3DP5 A;  2LIR A;  3C2C A;  2C2C A;  1MZ4 A;  2EXV A;  1H33 B;  1CYJ A;  1BL9 A;  1NML A;  1F1F A;  1C2N A;  1BGY D;  1GQ1 A;  3CX5 D;  4JCG A;  3WC8 A;  2YIU B;  1A56 A;  1SQX D;  1N9C A;  1DVH A;  3VRD A;  4L1Q A;  1RAP A;  2PCC B;  1HZU A;  1DT1 A;  1WVE C;  1FHB A;  1W2L A;  3SWS A;  1I5T A;  5DJQ C;  1CXC A;  1C75 A;  3BCC D;  4EIE A;  1L9J C;  5DFS A;  1CTY A;  2AXT V;  1QKS A;  1P84 D;  1CIG A;  1E29 A;  1I6D A;  1FCD C;  2C8S A;  1H31 B;  3ZOX A;  2FYN B;  1SQQ D;  1VYD A;  4KMG A;  5CIH B;  1LC1 A;  1GIW A;  4L3H A;  4EID A;  2CE1 A;  2D0W A;  1LC2 A;  1FI9 A;  2MHM A;  1MG3 D;  2YK3 A;  1I6E A;  1U75 B;  3RN1 A;  5KLI B;  4UB6 V;  1BCC D;  5GTH V;  2L91 A;  1E8E A;  1A2S A;  1N15 A;  2JQR A;  2QJK B;  1KX7 A;  1CRH A;  3KHU A;  1M6Z A;  1COR A;  5C0Z A;  3DR0 A;  3TYI A;  2Q3E A;  1R0Q A;  2BLF B;  2D0S A;  351C A;  3WU2 V;  1CIF A;  3OA8 A;  3FWL A;  2KS1 A;  4RJT A;  4H0J A;  2OZ1 B;  1S5L V;  3WFD C;  1KB9 D;  1IQC A;  1NTM D;  155C A;  1CRJ A;  4PJ0 V;  5CIC B;  2AI5 A;  5CID B;  4FA5 A;  5CIE B;  3M97 X;  3OCD A;  1NTK D;  4XYD B;  1YTC A;  2GC4 D;  3O1Y A;  2Y0C A;  3L70 D;  1H9Y A;  1CRG A;  2A06 D;  3H1K D;  4AX3 A;  5CIB B;  5DF5 A;  4AAN A;  4EDF A;  3SXT A;  1I55 A;  3PHL A;  2FRC A;  1SQP D;  1LMS A;  2QJP B;  1RZ6 A;  1GU2 A;  2GIW A;  1CSU A;  3CU4 A;  4O1W A;  5CYT R;  1CSV A;  4MU8 A;  3PRJ A;  1FJ0 A;  4P4Q B;  1QN2 A;  1NTZ D;  1YIC A;  1J3S A;  3VYM A;  2LIT A;  1NIR A;  1FI3 A;  3RN0 A;  5B6Q A;  2GC7 D;  2QG4 A;  1PP9 D;  1DW1 A;  1M60 A;  1LFM A;  2Y0D A;  1HH7 A;  3RMZ A;  3L73 D;  2N18 B;  3ORV A;  2AIU A;  1DII C;  1H31 A;  2K9J B;  1YEB A;  4U3F D;  2N3Y A;  3HQ6 A;  2B10 B;  1YNR A;  2BH4 X;  1DW3 A;  3PH2 B;  4GYD A;  1CHI A;  1C7M A;  3PXW A;  1PPJ D;  2VHD A;  2QJY B;  3ITK A;  3NWV A;  3O0R C;  2B0Z B;  2N3B A;  2N9Y B;  1YFC A;  3WFB C;  1DVV A;  3VNW A;  4N0K A;  3TDK A;  1IO3 A;  3HQ8 A;  4WQB A;  1SQV D;  3SJL A;  1H32 A;  1IRW A;  1HCM A;  1BE3 D;  1YEA A;  1NNO A;  1CSX A;  1CHJ A;  3ZOO A;  2B11 B;  1I54 A;  3CP5 A;  4LJI A;  1GKS A;  1HRC A;  2Y0E A;  3A9F A;  1FI7 A;  1EB7 A;  5E79 V;  5B66 V;  1L0N D;  5TIS V;  1K3H A;  1KX2 A;  4D6T D;  1CNO A;  1HJ4 A;  1OCD A;  1HRO A;  1JDL A;  1CCH A;  4WQ8 A;  1AKK A;  1KIB A;  2RMZ A;  4PWA A;  3L71 D;  2DGE A;  3A0B V;  1KB0 A;  1C52 A;  4FA1 A;  1ETP A;  1RZ5 A;  3O20 A;  5IY5 1;  1U74 B;  4V2K A;  4PW9 B;  4WQE A;  1CRI A;  3MK7 B;  2BCN B;  3WFC C;  1CXA A;  3PLN A;  3ZIY A;  3CWB D;  5B5E V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...