3CWBD

Chicken cytochrome bc1 complex inhibited by an iodinated analogue of the polyketide crocacin-d
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
241
structure length
241
Chain Sequence
b'GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title The role of molecular modeling in the design of analogues of the fungicidal natural products crocacins A and D.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 65
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2008-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3cwbD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3cwbD02
1C2RA 2QJKB 3L4MA 1FCDC 1E29A 1J3SA 4WQ9A 2BCNB 1CRYA 1KV9A 4L1QA 4DY9A 1NTKD 3O1YA 1LMSA 1CSUA 2ZOOA 1CCHA 2MHMA 1AYGA 1CHJA 1CIGA 3ZBMA 1DVVA 1C75A 3X39A 5KLVD 1W2LA 1M6ZA 2B12B 3RN0A 1H33A 2FYNB 1KIBA 4EIEA 4FA4A 2B10B 4PW9B 5KLIB 2JQRA 1K3GA 3PLNA 1DIQC 2FWLA 3OCDB 1H9YA 1LFMA 4AAMA 5E79V 3PRJA 5GTIV 1CTZA 2Y0DA 1A2SA 1OAEA 5KAFV 2Q3EA 2BPBB 2DVHA 2YK3A 2AI5A 5CYTR 2BH4X 1I55A 4FANA 1DVHA 3ZOWA 1YEBA 1FHBA 2HV4A 2JWAA 3ITKA 351CA 2PCBB 2I8FA 2N3YA 1SQVD 1W5CT 1L9BC 2N18C 3TF5A 1NTMD 3NBSA 4IL6V 3HQ7A 3PXTA 1H31A 4P4QB 5H2FV 1CXAA 1CIFA 3CXHW 1RAQA 1L0LD 2Y0CA 3O0RC 4EDFA 3TGUD 1SQBD 3WFEC 1SQXD 4N0KA 3CYTI 4FA9A 4WQAA 3CX5D 1L9JC 1IRVA 5CIEB 1RZ5A 2ORLA 4XXLA 3TYIA 4WQCA 3VNWA 1DW1A 1H33B 2FYUD 1MZ4A 3WC8A 3SXTA 3PTZA 5DF5A 3ZCFA 2C8SA 1R0QA 5TISV 1ZRTD 3H1ID 4GEDB 3L4OA 4Q5PA 5CICB 3RLMA 2N3BA 1KX2A 1CRGA 3WFCC 1CCRA 4NFGB 5CIDB 4D6TD 4KMGA 4FAVA 4FA1A 3A0HV 5KAIV 1CRJA 3NBTA 3ORVA 4H0KA 4FA5A 1IQCA 2L4DA 1C2NA 2C9XB 3GG2A 5GTHV 1LC2A 1YICA 2B4ZA 4WQ8A 2CA3B 1N90A 1CSWA 2AXTV 5B5EV 1P84D 1JDLA 1QL3A 2KNCB 3L75D 1C52A 1I8OA 155CA 1H31B 1CIHA 451CA 1I54A 3MK7B 4AX3A 1HRCA 2XTSB 1C6RA 1DW0A 4L3HA 1CRHA 2ZONG 1KX7A 2DGEA 1BCCD 3TDKA 1KB9D 1I6EA 3ZIYA 1MG3D 1ETPA 3L71D 3O5CA 2RN0A 1HJ3A 5B66V 1IZL0 1CTJA 2N9JA 1YTCA 4YE1A 2QG4A 1HJ5A 2CXBA 2PACA 5CIGB 5CIHB 1VYDA 4Y5RA 1NIRA 1HZVA 1FJ0A 2ZBOA 3H1LD 3SJLA 3H1JD 1SQQD 4AALA 1F1CA 3M97X 2MTAC 4AANA 4J20A 4A7PA 1GIWA 3PHLA 4JCGA 1F1FA 2IBZD 2YQBA 1AOFA 2VHDA 4K3IA 5KKZB 5C0ZA 1RZ6A 1GDVA 1NTZD 2B11B 1IRWA 1S5LV 2QJPB 3DMIA 1CSVA 3SVWA 2QJYB 2OZ1A 1A8CA 1CIEA 2Y0EA 2CE0A 1CEDA 1C6OA 3RMZA 1E8EA 5B6QA 2K9JB 1M60A 1IO3A 2GC4D 1N15A 1AKKA 1CTYA 4L3GA 2CE1A 2N9IA 3ZOYA 2N9YB 1YFCA 2CA4B 3CWBD 1KYOD 2C2CA 2BH5X 1GU2A 1CRCA 1CRIA 1PP9D 1BL9A 1HROA 1I5TA 2BLFB 3DR0A 1WVEC 5DJQB 4AAOA 2D0WA 2A06D 1H9XA 1U74B 1CXCA 3PXSA 2JTIB 2L91A 3ZOOA 1HZUA 2V07A 4WQ7A 4UB6V 3L72D 1C7MA 1ZZHA 1COTA 4PWAA 1HJ4A 1CO6A 4WQBA 1CNOA 2V08A 3A9FA 3CP5A 1N50A 5DJQC 1GQ1A 4PD4D 3WU2V 1RAPA 3CXHD 4RJTA 1C6SA 3HQ8A 1A56A 2RMZA 5C9MA 1QKSA 3OA8A 2GIWA 1CYCA 2BCCD 3HQ9A 1NMIA 1SQPD 1CYIA 4WQEA 4EIDA 1I6DA 1FOCA 4WQDA 1EZVD 1YEAA 2BGVX 2C1DA 2C1VA 1HCMA 1QYZA 1YCCA 3BCCD 3RN1A 4GYDA 1L0ND 3JBTB 2OZ1B 1LS9A 5EXQA 5CIBB 1S6VB 3C2CA 1DW2A 4H0JA 3GW6A 1QL4A 3MK7C 3CX5W 3L73D 4XYDB 1AOQA 1E2RA 3PH2B 4MU8A 4EICA 1H32A 2AIUA 1NU1D 2YIUB 4RSZA 1KYOW 3KHUA 5IY51 3VMAA 2GC7D 2N18B 1CORA 4EIFA 3DP5A 3HQ6A 1CYJA 3PXWA 1M70A 1EB7A 5AURA 3SLEA 1NMLA 1GJQA 4UB8V 1QN2A 1I8PA 3WFDC 2O3JA 1FI3A 4O1WA 3WFBC 1B7VA 1WEJF 3SWSA 2YCCA 3CU4A 1U75B 4O1QA 2ZXYA 1KB0A 1YIQA 1NNOA 1YNRA 3VRDA 1DW3A 2D0SA 3FWLA 4QAOA 1N9CA 2PCCB 1OCDA 1FI7A 1CC5A 1K3HA 2B0ZB 1HH7A 3A0BV 3ZOXA 1H1OA 2C1UA 3OA8B 3O20A 1FI9A 4V2KA 2EXVA 1BE3D 1BGYD 1PPJD 2C1DB 2ZZS1 3OCDA 1DT1A 4FB1A 3KZIV 2GB8B 3L74D 1CSXA 1CHIA 1CHHA 1LC1A 1GKSA 5TJHA 3H1HD 3NWVA 3H1KD 2FRCA 4PJ0V 4U3FD 1DIIC 4LJIA 5CIFB 1MG2D 2LITA 2KS1A 3WUIA 1H32B 3VYMA 3L70D 2LIRA 5DFSA
chains in the Genus database with same CATH superfamily
1VQ7P 3NXSA 2QJKB 2FFDC 5M1BA 1SS1A 1CRYA 2N1TC 1N7SD 3KYQA 5KLVG 2A06E 1JCDA 1Y47A 4BWNA 3O1YA 1HTLC 2M5AA 2IZ1A 4WB4A 1VQKP 2LXBA 1S9KD 2ZOOA 2E74B 1CCHA 5KAIH 3ZBMA 2O1JA 1DVVA 2YXQB 2QJKC 2WSEH 2AEFA 1M6ZA 1H33A 2FYNB 5GTHH 2D2CD 4EIEA 2YMYA 5CCGA 4FA4A 3A0HE 5B5EH 3KDPB 2B10B 3M0DA 1AA0A 2ITAA 2W27A 3PLNA 1DIQC 1NU1K 1P84E 1HGZA 1SQPE 4AAMA 1QLED 3L4FA 3E1RA 1CTZA 1LTIC 1A2SA 2FYNC 2G8YA 4ZNCA 1L0NE 3HUSB 2HPCB 2DVHA 1PZQA 1IK9A 1I55A 5E79H 5CJ4A 2BCCJ 1U7MA 5CJ0A 3OW2O 1FHBA 1U57A 3FGAD 2I8FA 2N3YA 1FU1A 1SQVD 2N18C 4YXDC 3HQ7A 1FZAA 2BEQD 3VP9A 1YJWP 1H31A 3QH9A 2K1AA 1CXAA 1SQQE 2GM4A 3CXHW 3LW5H 4EYYQ 3VYIA 3HUSC 1L0LD 3RL0C 1FDMA 1SQBK 2W83C 1SQXK 2M5AB 1H0TA 5APYA 1S5LH 1JY3O 3AEAC 3HRNA 3KXDA 2B87A 1LTAC 1DW1A 1H33B 3MUDA 1PGOA 2C8SA 1R0QA 3MIWA 5AW0B 5AVXB 1NAFA 1PGJA 3FXEA 3CD6P 3CWBE 5CICB 1ZR2A 2OTKE 1KX2A 1PGQA 2E76B 1CRGA 1BGYE 3HD7A 4D6TD 1PP9E 3D71A 2OTJP 5TISH 3W68A 1Z56A 1GTWA 3OJAB 1DH3A 3ORVA 4H13C 5CCGC 1C2NA 2ZYGA 1LC2A 3M0DC 4M3LA 4WQ8A 1LTBC 5KJ7A 1QL2A 1RF1C 2AXTV 1P84D 3L71G 2NZ2A 2E76C 5AVZB 3WU2H 1H31B 3CCVP 2XTSB 1JMBA 1RF0A 3CXHE 1VQOP 1J2JB 4RO0A 3TK1A 3O5CA 1KILA 1IZL0 1ZV8A 1NGMB 3P8CE 1FJPA 1H0TB 2QG4A 1EZVE 2ZVOB 1KB9H 1OMIA 4EOTA 4TT3H 2W90A 2B87B 1GW4A 1NIRA 1HZVA 2I8DA 1SQQD 4AALA 2XNDH 2AEJA 2MTAC 1LJ2A 4AANA 1Q86Q 1FZEA 1RHZB 3PHLA 1F1FA 2IBZD 3HTKA 1YBKA 1OXZA 4K3IA 2IFMA 3W67A 1GDVA 2N1TD 1NU1E 3RK2B 4HKZH 3L75J 2QJYB 1LTJA 2OZ1A 3MUDC 2P58A 2R44A 1E8EA 1ZMEC 5B6QA 2IYPA 1KQLA 4C46A 2ZT9C 5AW7B 2CA4B 1KZUB 3G3ZA 3CWBD 1K9MQ 1GU2A 1PP9D 1M7LA 3M9BA 1NOHA 2Z5HA 4PD4I 3DR0A 1WVEC 1X9VA 2QJYC 2D0WA 4OH8B 1U74B 4IL6E 2PFXA 1KILB 1R8EA 4GT1A 4UB6V 3L72D 3JCUH 1SQBE 1CNOA 2V08A 1SQXE 3A9FA 3OA7A 1KD1Q 4O9BA 1GQ1A 1RF0C 3CXHD 1L0LJ 3BRTB 3H1KE 3MTUE 2WITA 2YMKA 5CBNA 2Q9IA 2MJZA 4W7YA 3HTKB 4ZMDA 5C9MA 1KILC 3OA8A 1PIXA 1CYCA 1GL2C 3P8CD 1K8AQ 1NMIA 2FYZA 1HBWA 2W8ZA 1EZVD 5BVZA 1FZBA 2AEMA 1N86A 4I2LC 4PV1B 3RL0D 3C8VA 3L70E 1LTJB 2OZ1B 5EXQA 3CCMP 4QMAA 3AE5C 2RH0A 2Q5UA 2XZRA 4N78D 4ZKUA 4H0JA 5KAIE 1L2PA 4MU8A 4NPEA 1NU1D 1Y8AA 1NTZG 4D6TJ 1EDKA 1KN7A 5IY51 1LTJC 3VMAA 5B5EE 4EI2A 3RK3B 3SLEA 1T3UA 1QN2A 4XFJA 2O3JA 3WFBC 4R4LA 2YCCA 4LC1A 3CU4A 4H13D 2XDJA 3JC22 1ZP0C 1KB0A 2XU6A 1YNRA 4UB8H 2YNYA 3BATA 3FWLA 4DJGA 5E79E 3L74G 1EDJA 1OW6A 1XTCC 5AVWB 3A0BV 3OA8B 4YPCA 1FI9A 1L4AD 2KOGA 2IYOA 1BE3D 4TLFA 1UIXA 4U3FG 2P67A 2O01N 4H0LC 1CHIA 1KILE 1SQQJ 1JY3N 1KQFB 2RKLA 3H1KD 1AVYA 2M0BA 2HODA 1JY3P 4GOEA 2HFED 1LWUA 1YQ3C 5AVYB 3D6YA 1IFNA 4MN4C 3GF7A 1LTGC 1IFJA 3RGUA 3BCCG 3L70D 2YXRB 1C2RA 1FCDC 1E29A 1YQ4C 2KXPB 4WQ9A 2BCNB 2P2UA 2ZXXA 5AW2B 4L1QA 2YKQA 4OGQB 3CWBJ 1CSUA 5CCHA 5TISE 1L0NK 1UIIA 1AYGA 1PP9J 1CHJA 3AE4C 1WRGA 5EFWB 1Q90D 2ZT9D 3X39A 1S2EA 2H7HA 2B12B 1JOCA 1KIBA 1VQMP 3V2QA 3VMZA 3B71A 1VDFA 1KQGB 4OGQC 5KLIB 2JQRA 1IFDA 3WU2E 3RK3E 3PRJA 5AW1B 5GTIV 1LT1A 1SQVG 3AEGC 3BCCE 5KAFV 3AE6C 2HODB 3Q3DA 2BPBB 4WWIA 2AI5A 1YITP 1BCCE 1KB9E 4FANA 5KLIC 1L0LG 1JM0A 2HV4A 2QSIA 2JWAA 4DOJA 4RKUJ 1W5CT 3AE7C 4BRYA 3TF5A 4NPDA 1NTMD 3G4SP 1KILD 3L73E 3H1LE 4NPFX 1GL2D 5BU8B 1CIFA 1J1DC 2P1JA 3USSA 1DX7A 2QA4P 4JF7A 3SFDC 2Q1KA 2WSFH 1N73A 3L35A 1T2KD 5H2FH 3VMYA 4N0KA 3CYTI 3V2NA 2BASA 4WQAA 1NU1J 2PGDA 4RESB 3VNWA 1K05A 3I5CA 4D6TG 3SXTA 3PTZA 1KYOH 2P10A 3MD0A 1R5LA 3H1ID 3MGNA 4GEDB 1IO4A 1YIJP 1NTKG 1M8OB 4Q5PA 5CCHC 3QWOC 2LR2A 1LT9A 3WFCC 1PPJE 2Q3IA 1N7LA 1U7JA 3A0HV 3TSIA 1CRJA 3NBTA 3NMDA 3JCUE 3H1HE 1BE3J 1YICA 3R2PA 1CSWA 1ZLLA 4PD4H 2W6BA 1SQXJ 1PV3A 4BRYB 3L75D 2N9BA 1C52A 155CA 1LNQA 451CA 3B8EB 3MK7B 1AQTA 1HRCA 2QIWA 1HJ0A 4GIFA 4L3HA 3H1KJ 5AVRB 1YHQP 2DGEA 1N73B 1BCCD 2IBZI 1KB9D 4H0LD 2RN0A 2E74C 1QX8A 1CTJA 3H25A 2IBZG 1HJ5A 5CIHB 1VYDA 4Y5RA 1IC2A 3L70J 1QVFO 3H1LD 3M9HA 5B66H 4JYCA 1E79H 3V2PA 1JEKA 4I6MC 1GIWA 2OYIA 1E5WA 1X8YA 4JCGA 1N73C 5KLVE 3TGUG 3CX5I 2YQBA 4KJMA 5KKZB 1BDCA 3SWKA 4Y28J 1RZ6A 1LT9B 2IPPA 2B11B 2QJPB 1G2CA 3FWNA 3DMIA 3SVWA 3B4SA 2FYUG 4B86A 1C6OA 1RQVA 1FBMA 3N4XA 2GC4D 1Q82Q 2O01H 2CE1A 2N9IA 3ZOYA 4UB8E 1HWTC 1NKNA 1KTMA 3F5HA 2C2CA 2KB7P 5AW3B 4ASWA 2QJPC 3L72G 1I5TA 2HYNA 5DJQB 1EC5A 4AAOA 1VL2A 4YXWH 2A06D 5AVVB 1N8RQ 1EDLA 4GKGA 2R5BA 3ZOOA 1HZUA 3CCQP 1C7MA 1ZZHA 3BASA 3VN0A 1VQPP 1COTA 1EDIA 2Q7CA 3U59A 1HJ4A 1CO6A 1NTMJ 1DEEG 1USEA 4JQ0D 5DJQC 2QE7H 2I1KA 3VMXA 1SVFA 1BDDA 3VTPC 3HE4A 3KPEA 1ZXGA 2OYIB 3EFGA 2RMZA 2NPSA 1HGVA 4OWFA 1FS0E 3AEEC 1MKMA 2GUSA 1SQPD 1H88A 4EIDA 2QM7A 4WQDA 1YEAA 2BGVX 1S3JA 1S72P 1HCMA 1JB0J 3AEDC 1L0ND 1G2CB 1FOSF 3SWFA 1VPCA 3H1JG 3KQGA 1VF5B 2OYIC 2V4HA 3H1IJ 3HE5A 1FZGA 1JTHA 4XYDB 3SWYA 1GU5A 4EICA 5BU5A 2AIUA 4RSZA 1KYOW 4IFDK 1QEXA 1VF5C 2GC7D 1CORA 3DP5A 3HQ6A 5CCHD 1SFCD 3PXWA 3Q5SA 1NVOA 3R4YA 3P7KA 1OW8A 1NMLA 1KYOI 1NH4A 1YTZI 3B5NA 3TNUA 1NTZK 1NYHA 3HD7B 3SWSA 1QL1A 5GTIH 3L71E 1OFCX 1BE3G 1NNOA 2D0SA 1A02F 1M56D 2WWWA 1NWQA 2L5GB 3HE4B 1K3HA 2B0ZB 1HH7A 1BCCJ 2NPSB 2C1UA 2KSJA 3SSUA 1X22A 3WUTA 1BGYD 3HD7C 3RK2C 3S1KA 3OCDA 5APVA 1CSXA 2C9LY 3H1LJ 3TYYA 2E74D 1GKSA 1AQ5A 4L75A 1N7SA 2HR3A 2JWDA 3I55P 5KJ7C 2KYVA 5H2FE 3KZIH 3HE5B 3AE3C 1GK6A 1NJIQ 2BCCG 3G71P 3V4QA 5APXA 1JTHB 1M1JA 2KS1A 3WUIA 4PJ0H 3CCRP 2HLOA 1ZOYC 2KK7A 5AVSB 1OW7A 1KV9A 3B5NB 1ZRTE 2M8RA 1OWAA 3AECC 3TNUB 1RY3A 1G1IA 1YTZT 3Q5PA 1EXIA 1T8ZA 2BEZF 1CIGA 1H8AA 1C75A 1FDOA 3Q5RA 1K73Q 3NFQA 4PD4E 1M1KQ 4PW9B 4PV1C 5KTBA 2AXCA 3MHVA 2FWLA 5GTHE 3OCDB 1J1EB 1H9YA 3P8MC 1LFMA 5E79V 2Y0DA 2ZJSE 1Q7YQ 2A45I 2E5YA 2XV5A 3IAOA 1N7SB 1NTMG 2B88A 2WMMA 2A45G 2WSCJ 4BXLA 2BH4X 3CL3D 2LXCB 3SFEC 5CCGD 1SQPJ 2UWJE 2B89A 1M1JB 2KS1B 2PCBB 5B66E 1J1EC 1SQVK 3NBSA 1L0NJ 2CPBA 2K88A 2W6JH 3E1IA 3RK3C 1QVGO 2H88C 2E76D 2JKVA 3PH0A 1ZN5A 2E5TA 1RAQA 1L0LK 1HUCA 2YKPA 2Y0CA 3II6A 2W6AA 3A7OA 4GOFA 1SQBD 2M3BA 1FOSE 4C7NA 1SQXD 4FA9A 1M1JC 1Q2NA 3H1IG 1L9JC 4DCKA 3IN6A 1IRVA 1NTZE 3H32A 3CMEP 5CIEB 3VP8A 4XXLA 3TYIA 2P7JA 4WQCA 4I7ZB 3CX5H 1S5LE 2KSEA 3IFMA 4JYBA 1MZ4A 3CI9A 2QVAA 5DF5A 3ZCFA 5TISV 1ZRTD 2PP6A 3L4OA 1VF5D 1NKZB 1WT6A 1T6AA 3RLMA 2N3BA 5DJUB 2V7QH 3BVHA 4NFGB 5CIDB 1FC2C 4KMGA 2I1JA 5AVTB 1URQA 4FA1A 3L75G 3L74E 4H0KA 4FA5A 1IQCA 1NTKK 1MFZA 1BGYJ 2JR8A 1N90A 1RH5B 4U3FE 1JDLA 1QL3A 5KLVK 1I8OA 1CIHA 1VQ8P 4IOIH 1C6RA 3HD7D 1RQUA 3RK2D 1DW0A 2AXTH 4HB1A 1CRHA 2ZONG 1KX7A 3A3YB 2YO2A 1I6EA 4I1LA 3ZIYA 5AW9B 4WBAA 3V5BA 4C7NB 4LGDE 2N9JA 4YE1A 1VQ5P 5CIGB 1AV1A 5KJ7D 3O8ZA 1W5CE 2C0XA 3H32B 3C9IA 4OVNF 2ZFCA 1OVRA 1LWUB 1GD2E 4J20A 4A7PA 3WUVA 4Z1MH 5CBOA 1KFNA 2WT7A 2VHDA 5C0ZA 1OX3A 3WUUA 1PFIA 4HH2A 1NTZD 3JSVC 2KZJA 3CCUP 1NAYA 1URQB 1LWUC 1LGHB 3CCLP 2IFNA 1OZHA 1A8CA 1CIEA 3RMZA 1CSBA 3U1AA 4WVZA 2A06G 1DEBA 1IO3A 2Y9YA 2YO3A 1R5SA 4L3GA 3MP7B 2N9YB 3UIAA 4W7ZA 2FXMA 4IFMA 2BH5X 2FYUK 1CRCA 1CRIA 3A2AA 3G9RA 3GHGA 1HROA 1URQC 1LTSC 2BLFB 4PV1D 1VQ4P 1RE4A 1SQVE 1JO5A 2WPQA 1JY2N 2ZXEB 3CLQA 2KLUA 1P84I 1HVVA 3RBXA 1FZCA 1L0LE 1FJKA 2V07A 4WQ7A 4PWAA 4WQBA 1SQPG 4CPGA 3CP5A 1AFOA 3KZIE 1KV4A 1LTTC 4UB6H 1L0NG 4RJTA 1C6SA 3RBZA 1SQBJ 3RK3D 1CI6A 4DZOA 4PJ0E 3HQ9A 2WT7B 2K37A 4Y99B 2C1VA 5AVUB 3BCCD 3RN1A 2Z5IA 1SQQG 2KI7B 3RL0g 1LS9A 4D6TE 5CIBB 2WVRA 3U1CA 1S6VB 5APSA 3CC7P 2VRSA 1DW2A 1NTKE 4Y99C 3FXDA 3M91A 3MK7C 3CX5W 3L73D 1AOQA 1E2RA 3PH2B 1JCCA 2ZYDA 3GHGB 1RF1A 1SLQA 2N18B 2KZIA 2K9YA 3S9OA 1CYJA 2JP3A 1MFTA 1DIPA 1M70A 1L4AA 1EB7A 4WY4A 5AURA 2K3RA 2WSEJ 1GJQA 4UB8V 3WFDC 1FZCB 2WTYA 2OARA 1FI3A 2XNXA 3RL0B 1B7VA 1X0TA 3CWBG 2JO1A 1U75B 4O1QA 1PGPA 1BGYG 4N6JA 3GHGC 2KIKA 1PP9G 2LKMA 1RE4C 2CK3H 3EFFK 3T97A 1FI7A 1CC5A 2PRRA 5KKZC 1IFPA 1EXJA 1LT9C 1CI6B 3AE8C 1FZCC 2EXVA 3EWKA 1OVVA 1PPJD 2A45H 2IBZE 3CPWO 4OGQD 2E43A 1GK4A 3A0BH 1KMIZ 3CXHI 2IDBA 1LC1A 1IFIA 1HJBA 3H1HD 3NWVA 2R32A 1S1CX 3PP5A 1EZVI 4LJIA 3TGUE 3LW5J 4H13B 3IR9A 1SP4A 1GW3A 2LITA 1EZVG 2SPZA 4GODA 1EQ7A 3CX5E 1NTZJ 3VYMA 1RF1B 2LIRA 2FXOA 5DFSA 3Q2YA 3IF4A 3L4MA 2FYUE 2O01J 4HJGH 5AW8B 1JNMA 1J3SA 1L4AB 4WY4B 1XTGB 5APQA 2POHA 1M90Q 1DD3A 4DY9A 3BRVB 1NTKD 1LMSA 2FY8A 4LLHA 3CC4P 1OVUA 1YI2P 2MHMA 3LIDA 1NU1G 3L72E 2OYOA 3L74J 5KLVD 1W2LA 3RN0A 4JBZA 3T97B 1L4AC 4WY4C 3C1LA 1FE6A 1A02J 1MUUA 2B9BA 1WMKA 3G6EP 1URQD 4K3AA 1K3GA 4U3FJ 3P32A 2KUBA 2IZ0A 1GL2A 2AXTE 1VQNP 2WSSH 1OAEA 2WPSA 2Q3EA 1GDTA 2YK3A 5CYTR 1FDIA 4EIJA 3FX0A 1DVHA 3ZOWA 1YEBA 3ZDMA 2OYHA 3ITKA 351CA 1W2BO 5KAFH 1SQBG 3BCCJ 1L9BC 4N78E 2ZT9B 2KNCA 1SQXG 1NTMK 4IL6V 1IJDB 3PXTA 4P4QB 3V6IA 3H6PA 5H2FV 3H1JE 1GZLA 3H1KG 1YYCA 4L76A 3O0RC 1PL5A 4EDFA 3TGUD 3WFEC 4H44B 5APWA 3L73J 1JY2O 1Y9BA 2PAJA 3CX5D 2Z4EA 3L70G 1RZ5A 1USDA 2ORLA 1CW5A 2NPSC 2FYUD 2G3AA 5AW5B 3WC8A 1K04A 1BSNA 4GDOA 3Q1MA 3LIEA 2M3EA 4AUWA 2C9NY 1N2DC 4L73A 2FBWC 2Q6QA 4H44C 3M9QA 3D6ZA 3V4WA 1DD4A 4W80A 1KYOE 1GL2B 1BE3E 2R3SA 1CCRA 1RE3A 4FAVA 4DT0A 1SQVJ 2E75B 1YJ9P 3CCEP 1VQLP 5KAIV 2ZYAA 2L4DA 1NO4A 2C9XB 3GG2A 3AE9C 2K9JA 5GTHV 1LP1A 1IK7A 2B4ZA 3L37A 4IFFA 4KHXA 2CA3B 4U7JA 2OYHB 5B5EV 3A0HH 3V2RA 2KNCB 4UB6E 2KP8A 3GMAA 4AQRD 1P84H 1TU3F 2E75C 1I54A 4AX3A 2WSCH 5C39A 5CMZA 3H1HJ 1AJYA 4HYTB 2QRXA 5CHXA 3B5NC 3D70A 1T2KC 3TDKA 1MG3D 1ETPA 3L71D 4AYCA 1HJ3A 5B66V 2BCCE 2OYHC 1YTCA 2WPRA 2CXBA 4JPZB 2PACA 4C7RA 3GLMA 5AW4B 2H89C 1FJ0A 2ZBOA 3SJLA 3H1JD 1F1CA 3M97X 1YJNP 4ASVA 4IL6X 1D7MA 1GU4A 1MZ9A 1ZW0A 1NTKJ 1FZFA 1H89A 1AOFA 3AE2C 3N7NA 2D2CB 3S4RA 1N7SC 1IRWA 1S5LV 2DW3A 2H8PD 1IFMA 2HG5D 5L8RJ 5KLVJ 1CSVA 2OQQA 2Y0EA 2CE0A 4H0LB 1CEDA 3A5TA 2J59M 3OAKA 2K9JB 2NRGA 2YKOA 1M60A 1LP1B 1N15A 3GF3A 2O1KA 1AKKA 1CTYA 2JEEA 2XKMA 1YFCA 2D2CC 1KYOD 4WY4D 1RE3C 1BL9A 2JDIH 2Y9ZA 5DJTB 1G1JA 1NTME 1H9XA 1HH0A 4K35A 1CXCA 3PXSA 2JTIB 3L36A 1Q81Q 2L91A 3A0BE 1KC8Q 2E42A 4XA4A 3F89A 1AVOA 3O6QA 1IZNB 4I7ZC 2OTLP 1N50A 3NTNA 1S4XA 1JUNA 1KORA 4PD4D 3K5BA 1KB9I 3WU2V 3CC2P 1RAPA 3HQ8A 1MV8A 1A56A 1BCCG 3TGUJ 1QKSA 1T3JA 2GIWA 2BCCD 3CXHH 1SQPK 1VQ9P 1CYIA 4WQEA 1I6DA 1FOCA 3EQ2A 2H43A 2WZ7A 5APTA 2FXPA 2C1DA 3H1IE 1QYZA 1YCCA 2WPVB 4R4MA 4GYDA 3CMAP 1SFCA 2GUVA 3L73G 3JBTB 3H1LG 4N3YB 5APUA 2FYUJ 1FAVA 1X79B 2FFDA 4KT0J 3I56P 2N1TA 3E7KA 3C2CA 1M57D 2V7QJ 2ZAEB 3GW6A 1QL4A 2GA1A 2NPSD 2WQYC 1VQ6P 1S9KE 1SQQK 1H32A 3L72J 2YIUB 2R5DA 1ZR4A 3KHUA 2C0WA 4EIFA 3L75E 4H44D 2CPSA 1KQSO 1KFMA 1OIPA 2QEXP 1S5LX 2J5UA 3VOPA 1J1DB 1I8PA 1HF9A 3MZWB 3CCSP 4O1WA 3M06A 3AEBC 1W2EA 1WEJF 3O6QB 2OGUA 1QGKB 2ZXYA 1GMJA 2YIUC 1YIQA 3VRDA 1PPJG 1DW3A 2FKWB 4QAOA 1N9CA 2PCCB 4XE5B 1OCDA 1CZQA 5GTIE 3WMM0 3AEFC 3D0WA 4L74A 3AE1C 3ZOXA 3H1HG 2ZVNB 5KAFE 1H1OA 3L71J 2IX7C 5K5GB 3O20A 5AW6B 2E75D 4V2KA 4YTPC 1NHLA 5AVQB 4IL6H 3B5ND 2C1DB 2ZZS1 3ABVC 1DT1A 4FB1A 3KZIV 2GB8B 3L74D 1SFCB 1CHHA 2KLVA 3CCJP 3H1JJ 5TJHA 2FFDB 2QM8A 2JJLA 3PJSK 1JY2P 4ZKPA 2FRCA 3HUSA 4PJ0V 2HPCA 2N1TB 4U3FD 1DIIC 1JMMA 1BSHA 2R3CA 5CIFB 1MG2D 2MKVA 2WSFJ 3M0AA 1H32B 1SFCC 2J58A
chains in the Genus database with same CATH topology
1C2RA 2QJKB 3L4MA 1FCDC 1E29A 1J3SA 4WQ9A 2BCNB 1CRYA 1KV9A 4L1QA 4DY9A 1NTKD 3O1YA 1LMSA 1CSUA 2ZOOA 1CCHA 2MHMA 1AYGA 1CHJA 1CIGA 3ZBMA 1DVVA 1C75A 3X39A 5KLVD 1W2LA 1M6ZA 2B12B 3RN0A 1H33A 2FYNB 1KIBA 4EIEA 4FA4A 2B10B 4PW9B 5KLIB 2JQRA 1K3GA 3PLNA 1DIQC 2FWLA 3OCDB 1H9YA 1LFMA 4AAMA 5E79V 3PRJA 5GTIV 1CTZA 2Y0DA 1A2SA 1OAEA 5KAFV 2Q3EA 2BPBB 2DVHA 2YK3A 2AI5A 5CYTR 2BH4X 1I55A 4FANA 1DVHA 3ZOWA 1YEBA 1FHBA 2HV4A 2JWAA 3ITKA 351CA 2PCBB 2I8FA 2N3YA 1SQVD 1W5CT 1L9BC 2N18C 3TF5A 1NTMD 3NBSA 4IL6V 3HQ7A 3PXTA 1H31A 4P4QB 5H2FV 1CXAA 1CIFA 3CXHW 1RAQA 1L0LD 2Y0CA 3O0RC 4EDFA 3TGUD 1SQBD 3WFEC 1SQXD 4N0KA 3CYTI 4FA9A 4WQAA 3CX5D 1L9JC 1IRVA 5CIEB 1RZ5A 2ORLA 4XXLA 3TYIA 4WQCA 3VNWA 1DW1A 1H33B 2FYUD 1MZ4A 3WC8A 3SXTA 3PTZA 5DF5A 3ZCFA 2C8SA 1R0QA 5TISV 1ZRTD 3H1ID 4GEDB 3L4OA 4Q5PA 5CICB 3RLMA 2N3BA 1KX2A 1CRGA 3WFCC 1CCRA 4NFGB 5CIDB 4D6TD 4KMGA 4FAVA 4FA1A 3A0HV 5KAIV 1CRJA 3NBTA 3ORVA 4H0KA 4FA5A 1IQCA 2L4DA 1C2NA 2C9XB 3GG2A 5GTHV 1LC2A 1YICA 2B4ZA 4WQ8A 2CA3B 1N90A 1CSWA 2AXTV 5B5EV 1P84D 1JDLA 1QL3A 2KNCB 3L75D 1C52A 1I8OA 155CA 1H31B 1CIHA 451CA 1I54A 3MK7B 4AX3A 1HRCA 2XTSB 1C6RA 1DW0A 4L3HA 1CRHA 2ZONG 1KX7A 2DGEA 1BCCD 3TDKA 1KB9D 1I6EA 3ZIYA 1MG3D 1ETPA 3L71D 3O5CA 2RN0A 1HJ3A 5B66V 1IZL0 1CTJA 2N9JA 1YTCA 4YE1A 2QG4A 1HJ5A 2CXBA 2PACA 5CIGB 5CIHB 1VYDA 4Y5RA 1NIRA 1HZVA 1FJ0A 2ZBOA 3H1LD 3SJLA 3H1JD 1SQQD 4AALA 1F1CA 3M97X 2MTAC 4AANA 4J20A 4A7PA 1GIWA 3PHLA 4JCGA 1F1FA 2IBZD 2YQBA 1AOFA 2VHDA 4K3IA 5KKZB 5C0ZA 1RZ6A 1GDVA 1NTZD 2B11B 1IRWA 1S5LV 2QJPB 3DMIA 1CSVA 3SVWA 2QJYB 2OZ1A 1A8CA 1CIEA 2Y0EA 2CE0A 1CEDA 1C6OA 3RMZA 1E8EA 5B6QA 2K9JB 1M60A 1IO3A 2GC4D 1N15A 1AKKA 1CTYA 4L3GA 2CE1A 2N9IA 3ZOYA 2N9YB 1YFCA 2CA4B 3CWBD 1KYOD 2C2CA 2BH5X 1GU2A 1CRCA 1CRIA 1PP9D 1BL9A 1HROA 1I5TA 2BLFB 3DR0A 1WVEC 5DJQB 4AAOA 2D0WA 2A06D 1H9XA 1U74B 1CXCA 3PXSA 2JTIB 2L91A 3ZOOA 1HZUA 2V07A 4WQ7A 4UB6V 3L72D 1C7MA 1ZZHA 1COTA 4PWAA 1HJ4A 1CO6A 4WQBA 1CNOA 2V08A 3A9FA 3CP5A 1N50A 5DJQC 1GQ1A 4PD4D 3WU2V 1RAPA 3CXHD 4RJTA 1C6SA 3HQ8A 1A56A 2RMZA 5C9MA 1QKSA 3OA8A 2GIWA 1CYCA 2BCCD 3HQ9A 1NMIA 1SQPD 1CYIA 4WQEA 4EIDA 1I6DA 1FOCA 4WQDA 1EZVD 1YEAA 2BGVX 2C1DA 2C1VA 1HCMA 1QYZA 1YCCA 3BCCD 3RN1A 4GYDA 1L0ND 3JBTB 2OZ1B 1LS9A 5EXQA 5CIBB 1S6VB 3C2CA 1DW2A 4H0JA 3GW6A 1QL4A 3MK7C 3CX5W 3L73D 4XYDB 1AOQA 1E2RA 3PH2B 4MU8A 4EICA 1H32A 2AIUA 1NU1D 2YIUB 4RSZA 1KYOW 3KHUA 5IY51 3VMAA 2GC7D 2N18B 1CORA 4EIFA 3DP5A 3HQ6A 1CYJA 3PXWA 1M70A 1EB7A 5AURA 3SLEA 1NMLA 1GJQA 4UB8V 1QN2A 1I8PA 3WFDC 2O3JA 1FI3A 4O1WA 3WFBC 1B7VA 1WEJF 3SWSA 2YCCA 3CU4A 1U75B 4O1QA 2ZXYA 1KB0A 1YIQA 1NNOA 1YNRA 3VRDA 1DW3A 2D0SA 3FWLA 4QAOA 1N9CA 2PCCB 1OCDA 1FI7A 1CC5A 1K3HA 2B0ZB 1HH7A 3A0BV 3ZOXA 1H1OA 2C1UA 3OA8B 3O20A 1FI9A 4V2KA 2EXVA 1BE3D 1BGYD 1PPJD 2C1DB 2ZZS1 3OCDA 1DT1A 4FB1A 3KZIV 2GB8B 3L74D 1CSXA 1CHIA 1CHHA 1LC1A 1GKSA 5TJHA 3H1HD 3NWVA 3H1KD 2FRCA 4PJ0V 4U3FD 1DIIC 4LJIA 5CIFB 1MG2D 2LITA 2KS1A 3WUIA 1H32B 3VYMA 3L70D 2LIRA 5DFSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C2R A;  2QJK B;  3L4M A;  1FCD C;  1E29 A;  1J3S A;  4WQ9 A;  2BCN B;  1CRY A;  1KV9 A;  4L1Q A;  4DY9 A;  1NTK D;  3O1Y A;  1LMS A;  1CSU A;  2ZOO A;  1CCH A;  2MHM A;  1AYG A;  1CHJ A;  1CIG A;  3ZBM A;  1DVV A;  1C75 A;  3X39 A;  5KLV D;  1W2L A;  1M6Z A;  2B12 B;  3RN0 A;  1H33 A;  2FYN B;  1KIB A;  4EIE A;  4FA4 A;  2B10 B;  4PW9 B;  5KLI B;  2JQR A;  1K3G A;  3PLN A;  1DIQ C;  2FWL A;  3OCD B;  1H9Y A;  1LFM A;  4AAM A;  5E79 V;  3PRJ A;  5GTI V;  1CTZ A;  2Y0D A;  1A2S A;  1OAE A;  5KAF V;  2Q3E A;  2BPB B;  2DVH A;  2YK3 A;  2AI5 A;  5CYT R;  2BH4 X;  1I55 A;  4FAN A;  1DVH A;  3ZOW A;  1YEB A;  1FHB A;  2HV4 A;  2JWA A;  3ITK A;  351C A;  2PCB B;  2I8F A;  2N3Y A;  1SQV D;  1W5C T;  1L9B C;  2N18 C;  3TF5 A;  1NTM D;  3NBS A;  4IL6 V;  3HQ7 A;  3PXT A;  1H31 A;  4P4Q B;  5H2F V;  1CXA A;  1CIF A;  3CXH W;  1RAQ A;  1L0L D;  2Y0C A;  3O0R C;  4EDF A;  3TGU D;  1SQB D;  3WFE C;  1SQX D;  4N0K A;  3CYT I;  4FA9 A;  4WQA A;  3CX5 D;  1L9J C;  1IRV A;  5CIE B;  1RZ5 A;  2ORL A;  4XXL A;  3TYI A;  4WQC A;  3VNW A;  1DW1 A;  1H33 B;  2FYU D;  1MZ4 A;  3WC8 A;  3SXT A;  3PTZ A;  5DF5 A;  3ZCF A;  2C8S A;  1R0Q A;  5TIS V;  1ZRT D;  3H1I D;  4GED B;  3L4O A;  4Q5P A;  5CIC B;  3RLM A;  2N3B A;  1KX2 A;  1CRG A;  3WFC C;  1CCR A;  4NFG B;  5CID B;  4D6T D;  4KMG A;  4FAV A;  4FA1 A;  3A0H V;  5KAI V;  1CRJ A;  3NBT A;  3ORV A;  4H0K A;  4FA5 A;  1IQC A;  2L4D A;  1C2N A;  2C9X B;  3GG2 A;  5GTH V;  1LC2 A;  1YIC A;  2B4Z A;  4WQ8 A;  2CA3 B;  1N90 A;  1CSW A;  2AXT V;  5B5E V;  1P84 D;  1JDL A;  1QL3 A;  2KNC B;  3L75 D;  1C52 A;  1I8O A;  155C A;  1H31 B;  1CIH A;  451C A;  1I54 A;  3MK7 B;  4AX3 A;  1HRC A;  2XTS B;  1C6R A;  1DW0 A;  4L3H A;  1CRH A;  2ZON G;  1KX7 A;  2DGE A;  1BCC D;  3TDK A;  1KB9 D;  1I6E A;  3ZIY A;  1MG3 D;  1ETP A;  3L71 D;  3O5C A;  2RN0 A;  1HJ3 A;  5B66 V;  1IZL 0;  1CTJ A;  2N9J A;  1YTC A;  4YE1 A;  2QG4 A;  1HJ5 A;  2CXB A;  2PAC A;  5CIG B;  5CIH B;  1VYD A;  4Y5R A;  1NIR A;  1HZV A;  1FJ0 A;  2ZBO A;  3H1L D;  3SJL A;  3H1J D;  1SQQ D;  4AAL A;  1F1C A;  3M97 X;  2MTA C;  4AAN A;  4J20 A;  4A7P A;  1GIW A;  3PHL A;  4JCG A;  1F1F A;  2IBZ D;  2YQB A;  1AOF A;  2VHD A;  4K3I A;  5KKZ B;  5C0Z A;  1RZ6 A;  1GDV A;  1NTZ D;  2B11 B;  1IRW A;  1S5L V;  2QJP B;  3DMI A;  1CSV A;  3SVW A;  2QJY B;  2OZ1 A;  1A8C A;  1CIE A;  2Y0E A;  2CE0 A;  1CED A;  1C6O A;  3RMZ A;  1E8E A;  5B6Q A;  2K9J B;  1M60 A;  1IO3 A;  2GC4 D;  1N15 A;  1AKK A;  1CTY A;  4L3G A;  2CE1 A;  2N9I A;  3ZOY A;  2N9Y B;  1YFC A;  2CA4 B;  3CWB D;  1KYO D;  2C2C A;  2BH5 X;  1GU2 A;  1CRC A;  1CRI A;  1PP9 D;  1BL9 A;  1HRO A;  1I5T A;  2BLF B;  3DR0 A;  1WVE C;  5DJQ B;  4AAO A;  2D0W A;  2A06 D;  1H9X A;  1U74 B;  1CXC A;  3PXS A;  2JTI B;  2L91 A;  3ZOO A;  1HZU A;  2V07 A;  4WQ7 A;  4UB6 V;  3L72 D;  1C7M A;  1ZZH A;  1COT A;  4PWA A;  1HJ4 A;  1CO6 A;  4WQB A;  1CNO A;  2V08 A;  3A9F A;  3CP5 A;  1N50 A;  5DJQ C;  1GQ1 A;  4PD4 D;  3WU2 V;  1RAP A;  3CXH D;  4RJT A;  1C6S A;  3HQ8 A;  1A56 A;  2RMZ A;  5C9M A;  1QKS A;  3OA8 A;  2GIW A;  1CYC A;  2BCC D;  3HQ9 A;  1NMI A;  1SQP D;  1CYI A;  4WQE A;  4EID A;  1I6D A;  1FOC A;  4WQD A;  1EZV D;  1YEA A;  2BGV X;  2C1D A;  2C1V A;  1HCM A;  1QYZ A;  1YCC A;  3BCC D;  3RN1 A;  4GYD A;  1L0N D;  3JBT B;  2OZ1 B;  1LS9 A;  5EXQ A;  5CIB B;  1S6V B;  3C2C A;  1DW2 A;  4H0J A;  3GW6 A;  1QL4 A;  3MK7 C;  3CX5 W;  3L73 D;  4XYD B;  1AOQ A;  1E2R A;  3PH2 B;  4MU8 A;  4EIC A;  1H32 A;  2AIU A;  1NU1 D;  2YIU B;  4RSZ A;  1KYO W;  3KHU A;  5IY5 1;  3VMA A;  2GC7 D;  2N18 B;  1COR A;  4EIF A;  3DP5 A;  3HQ6 A;  1CYJ A;  3PXW A;  1M70 A;  1EB7 A;  5AUR A;  3SLE A;  1NML A;  1GJQ A;  4UB8 V;  1QN2 A;  1I8P A;  3WFD C;  2O3J A;  1FI3 A;  4O1W A;  3WFB C;  1B7V A;  1WEJ F;  3SWS A;  2YCC A;  3CU4 A;  1U75 B;  4O1Q A;  2ZXY A;  1KB0 A;  1YIQ A;  1NNO A;  1YNR A;  3VRD A;  1DW3 A;  2D0S A;  3FWL A;  4QAO A;  1N9C A;  2PCC B;  1OCD A;  1FI7 A;  1CC5 A;  1K3H A;  2B0Z B;  1HH7 A;  3A0B V;  3ZOX A;  1H1O A;  2C1U A;  3OA8 B;  3O20 A;  1FI9 A;  4V2K A;  2EXV A;  1BE3 D;  1BGY D;  1PPJ D;  2C1D B;  2ZZS 1;  3OCD A;  1DT1 A;  4FB1 A;  3KZI V;  2GB8 B;  3L74 D;  1CSX A;  1CHI A;  1CHH A;  1LC1 A;  1GKS A;  5TJH A;  3H1H D;  3NWV A;  3H1K D;  2FRC A;  4PJ0 V;  4U3F D;  1DII C;  4LJI A;  5CIF B;  1MG2 D;  2LIT A;  2KS1 A;  3WUI A;  1H32 B;  3VYM A;  3L70 D;  2LIR A;  5DFS A; 
#chains in the Genus database with same CATH topology
 1VQ7 P;  3NXS A;  2QJK B;  2FFD C;  5M1B A;  1SS1 A;  1CRY A;  2N1T C;  1N7S D;  3KYQ A;  5KLV G;  2A06 E;  1JCD A;  1Y47 A;  4BWN A;  3O1Y A;  1HTL C;  2M5A A;  2IZ1 A;  4WB4 A;  1VQK P;  2LXB A;  1S9K D;  2ZOO A;  2E74 B;  1CCH A;  5KAI H;  3ZBM A;  2O1J A;  1DVV A;  2YXQ B;  2QJK C;  2WSE H;  2AEF A;  1M6Z A;  1H33 A;  2FYN B;  5GTH H;  2D2C D;  4EIE A;  2YMY A;  5CCG A;  4FA4 A;  3A0H E;  5B5E H;  3KDP B;  2B10 B;  3M0D A;  1AA0 A;  2ITA A;  2W27 A;  3PLN A;  1DIQ C;  1NU1 K;  1P84 E;  1HGZ A;  1SQP E;  4AAM A;  1QLE D;  3L4F A;  3E1R A;  1CTZ A;  1LTI C;  1A2S A;  2FYN C;  2G8Y A;  4ZNC A;  1L0N E;  3HUS B;  2HPC B;  2DVH A;  1PZQ A;  1IK9 A;  1I55 A;  5E79 H;  5CJ4 A;  2BCC J;  1U7M A;  5CJ0 A;  3OW2 O;  1FHB A;  1U57 A;  3FGA D;  2I8F A;  2N3Y A;  1FU1 A;  1SQV D;  2N18 C;  4YXD C;  3HQ7 A;  1FZA A;  2BEQ D;  3VP9 A;  1YJW P;  1H31 A;  3QH9 A;  2K1A A;  1CXA A;  1SQQ E;  2GM4 A;  3CXH W;  3LW5 H;  4EYY Q;  3VYI A;  3HUS C;  1L0L D;  3RL0 C;  1FDM A;  1SQB K;  2W83 C;  1SQX K;  2M5A B;  1H0T A;  5APY A;  1S5L H;  1JY3 O;  3AEA C;  3HRN A;  3KXD A;  2B87 A;  1LTA C;  1DW1 A;  1H33 B;  3MUD A;  1PGO A;  2C8S A;  1R0Q A;  3MIW A;  5AW0 B;  5AVX B;  1NAF A;  1PGJ A;  3FXE A;  3CD6 P;  3CWB E;  5CIC B;  1ZR2 A;  2OTK E;  1KX2 A;  1PGQ A;  2E76 B;  1CRG A;  1BGY E;  3HD7 A;  4D6T D;  1PP9 E;  3D71 A;  2OTJ P;  5TIS H;  3W68 A;  1Z56 A;  1GTW A;  3OJA B;  1DH3 A;  3ORV A;  4H13 C;  5CCG C;  1C2N A;  2ZYG A;  1LC2 A;  3M0D C;  4M3L A;  4WQ8 A;  1LTB C;  5KJ7 A;  1QL2 A;  1RF1 C;  2AXT V;  1P84 D;  3L71 G;  2NZ2 A;  2E76 C;  5AVZ B;  3WU2 H;  1H31 B;  3CCV P;  2XTS B;  1JMB A;  1RF0 A;  3CXH E;  1VQO P;  1J2J B;  4RO0 A;  3TK1 A;  3O5C A;  1KIL A;  1IZL 0;  1ZV8 A;  1NGM B;  3P8C E;  1FJP A;  1H0T B;  2QG4 A;  1EZV E;  2ZVO B;  1KB9 H;  1OMI A;  4EOT A;  4TT3 H;  2W90 A;  2B87 B;  1GW4 A;  1NIR A;  1HZV A;  2I8D A;  1SQQ D;  4AAL A;  2XND H;  2AEJ A;  2MTA C;  1LJ2 A;  4AAN A;  1Q86 Q;  1FZE A;  1RHZ B;  3PHL A;  1F1F A;  2IBZ D;  3HTK A;  1YBK A;  1OXZ A;  4K3I A;  2IFM A;  3W67 A;  1GDV A;  2N1T D;  1NU1 E;  3RK2 B;  4HKZ H;  3L75 J;  2QJY B;  1LTJ A;  2OZ1 A;  3MUD C;  2P58 A;  2R44 A;  1E8E A;  1ZME C;  5B6Q A;  2IYP A;  1KQL A;  4C46 A;  2ZT9 C;  5AW7 B;  2CA4 B;  1KZU B;  3G3Z A;  3CWB D;  1K9M Q;  1GU2 A;  1PP9 D;  1M7L A;  3M9B A;  1NOH A;  2Z5H A;  4PD4 I;  3DR0 A;  1WVE C;  1X9V A;  2QJY C;  2D0W A;  4OH8 B;  1U74 B;  4IL6 E;  2PFX A;  1KIL B;  1R8E A;  4GT1 A;  4UB6 V;  3L72 D;  3JCU H;  1SQB E;  1CNO A;  2V08 A;  1SQX E;  3A9F A;  3OA7 A;  1KD1 Q;  4O9B A;  1GQ1 A;  1RF0 C;  3CXH D;  1L0L J;  3BRT B;  3H1K E;  3MTU E;  2WIT A;  2YMK A;  5CBN A;  2Q9I A;  2MJZ A;  4W7Y A;  3HTK B;  4ZMD A;  5C9M A;  1KIL C;  3OA8 A;  1PIX A;  1CYC A;  1GL2 C;  3P8C D;  1K8A Q;  1NMI A;  2FYZ A;  1HBW A;  2W8Z A;  1EZV D;  5BVZ A;  1FZB A;  2AEM A;  1N86 A;  4I2L C;  4PV1 B;  3RL0 D;  3C8V A;  3L70 E;  1LTJ B;  2OZ1 B;  5EXQ A;  3CCM P;  4QMA A;  3AE5 C;  2RH0 A;  2Q5U A;  2XZR A;  4N78 D;  4ZKU A;  4H0J A;  5KAI E;  1L2P A;  4MU8 A;  4NPE A;  1NU1 D;  1Y8A A;  1NTZ G;  4D6T J;  1EDK A;  1KN7 A;  5IY5 1;  1LTJ C;  3VMA A;  5B5E E;  4EI2 A;  3RK3 B;  3SLE A;  1T3U A;  1QN2 A;  4XFJ A;  2O3J A;  3WFB C;  4R4L A;  2YCC A;  4LC1 A;  3CU4 A;  4H13 D;  2XDJ A;  3JC2 2;  1ZP0 C;  1KB0 A;  2XU6 A;  1YNR A;  4UB8 H;  2YNY A;  3BAT A;  3FWL A;  4DJG A;  5E79 E;  3L74 G;  1EDJ A;  1OW6 A;  1XTC C;  5AVW B;  3A0B V;  3OA8 B;  4YPC A;  1FI9 A;  1L4A D;  2KOG A;  2IYO A;  1BE3 D;  4TLF A;  1UIX A;  4U3F G;  2P67 A;  2O01 N;  4H0L C;  1CHI A;  1KIL E;  1SQQ J;  1JY3 N;  1KQF B;  2RKL A;  3H1K D;  1AVY A;  2M0B A;  2HOD A;  1JY3 P;  4GOE A;  2HFE D;  1LWU A;  1YQ3 C;  5AVY B;  3D6Y A;  1IFN A;  4MN4 C;  3GF7 A;  1LTG C;  1IFJ A;  3RGU A;  3BCC G;  3L70 D;  2YXR B;  1C2R A;  1FCD C;  1E29 A;  1YQ4 C;  2KXP B;  4WQ9 A;  2BCN B;  2P2U A;  2ZXX A;  5AW2 B;  4L1Q A;  2YKQ A;  4OGQ B;  3CWB J;  1CSU A;  5CCH A;  5TIS E;  1L0N K;  1UII A;  1AYG A;  1PP9 J;  1CHJ A;  3AE4 C;  1WRG A;  5EFW B;  1Q90 D;  2ZT9 D;  3X39 A;  1S2E A;  2H7H A;  2B12 B;  1JOC A;  1KIB A;  1VQM P;  3V2Q A;  3VMZ A;  3B71 A;  1VDF A;  1KQG B;  4OGQ C;  5KLI B;  2JQR A;  1IFD A;  3WU2 E;  3RK3 E;  3PRJ A;  5AW1 B;  5GTI V;  1LT1 A;  1SQV G;  3AEG C;  3BCC E;  5KAF V;  3AE6 C;  2HOD B;  3Q3D A;  2BPB B;  4WWI A;  2AI5 A;  1YIT P;  1BCC E;  1KB9 E;  4FAN A;  5KLI C;  1L0L G;  1JM0 A;  2HV4 A;  2QSI A;  2JWA A;  4DOJ A;  4RKU J;  1W5C T;  3AE7 C;  4BRY A;  3TF5 A;  4NPD A;  1NTM D;  3G4S P;  1KIL D;  3L73 E;  3H1L E;  4NPF X;  1GL2 D;  5BU8 B;  1CIF A;  1J1D C;  2P1J A;  3USS A;  1DX7 A;  2QA4 P;  4JF7 A;  3SFD C;  2Q1K A;  2WSF H;  1N73 A;  3L35 A;  1T2K D;  5H2F H;  3VMY A;  4N0K A;  3CYT I;  3V2N A;  2BAS A;  4WQA A;  1NU1 J;  2PGD A;  4RES B;  3VNW A;  1K05 A;  3I5C A;  4D6T G;  3SXT A;  3PTZ A;  1KYO H;  2P10 A;  3MD0 A;  1R5L A;  3H1I D;  3MGN A;  4GED B;  1IO4 A;  1YIJ P;  1NTK G;  1M8O B;  4Q5P A;  5CCH C;  3QWO C;  2LR2 A;  1LT9 A;  3WFC C;  1PPJ E;  2Q3I A;  1N7L A;  1U7J A;  3A0H V;  3TSI A;  1CRJ A;  3NBT A;  3NMD A;  3JCU E;  3H1H E;  1BE3 J;  1YIC A;  3R2P A;  1CSW A;  1ZLL A;  4PD4 H;  2W6B A;  1SQX J;  1PV3 A;  4BRY B;  3L75 D;  2N9B A;  1C52 A;  155C A;  1LNQ A;  451C A;  3B8E B;  3MK7 B;  1AQT A;  1HRC A;  2QIW A;  1HJ0 A;  4GIF A;  4L3H A;  3H1K J;  5AVR B;  1YHQ P;  2DGE A;  1N73 B;  1BCC D;  2IBZ I;  1KB9 D;  4H0L D;  2RN0 A;  2E74 C;  1QX8 A;  1CTJ A;  3H25 A;  2IBZ G;  1HJ5 A;  5CIH B;  1VYD A;  4Y5R A;  1IC2 A;  3L70 J;  1QVF O;  3H1L D;  3M9H A;  5B66 H;  4JYC A;  1E79 H;  3V2P A;  1JEK A;  4I6M C;  1GIW A;  2OYI A;  1E5W A;  1X8Y A;  4JCG A;  1N73 C;  5KLV E;  3TGU G;  3CX5 I;  2YQB A;  4KJM A;  5KKZ B;  1BDC A;  3SWK A;  4Y28 J;  1RZ6 A;  1LT9 B;  2IPP A;  2B11 B;  2QJP B;  1G2C A;  3FWN A;  3DMI A;  3SVW A;  3B4S A;  2FYU G;  4B86 A;  1C6O A;  1RQV A;  1FBM A;  3N4X A;  2GC4 D;  1Q82 Q;  2O01 H;  2CE1 A;  2N9I A;  3ZOY A;  4UB8 E;  1HWT C;  1NKN A;  1KTM A;  3F5H A;  2C2C A;  2KB7 P;  5AW3 B;  4ASW A;  2QJP C;  3L72 G;  1I5T A;  2HYN A;  5DJQ B;  1EC5 A;  4AAO A;  1VL2 A;  4YXW H;  2A06 D;  5AVV B;  1N8R Q;  1EDL A;  4GKG A;  2R5B A;  3ZOO A;  1HZU A;  3CCQ P;  1C7M A;  1ZZH A;  3BAS A;  3VN0 A;  1VQP P;  1COT A;  1EDI A;  2Q7C A;  3U59 A;  1HJ4 A;  1CO6 A;  1NTM J;  1DEE G;  1USE A;  4JQ0 D;  5DJQ C;  2QE7 H;  2I1K A;  3VMX A;  1SVF A;  1BDD A;  3VTP C;  3HE4 A;  3KPE A;  1ZXG A;  2OYI B;  3EFG A;  2RMZ A;  2NPS A;  1HGV A;  4OWF A;  1FS0 E;  3AEE C;  1MKM A;  2GUS A;  1SQP D;  1H88 A;  4EID A;  2QM7 A;  4WQD A;  1YEA A;  2BGV X;  1S3J A;  1S72 P;  1HCM A;  1JB0 J;  3AED C;  1L0N D;  1G2C B;  1FOS F;  3SWF A;  1VPC A;  3H1J G;  3KQG A;  1VF5 B;  2OYI C;  2V4H A;  3H1I J;  3HE5 A;  1FZG A;  1JTH A;  4XYD B;  3SWY A;  1GU5 A;  4EIC A;  5BU5 A;  2AIU A;  4RSZ A;  1KYO W;  4IFD K;  1QEX A;  1VF5 C;  2GC7 D;  1COR A;  3DP5 A;  3HQ6 A;  5CCH D;  1SFC D;  3PXW A;  3Q5S A;  1NVO A;  3R4Y A;  3P7K A;  1OW8 A;  1NML A;  1KYO I;  1NH4 A;  1YTZ I;  3B5N A;  3TNU A;  1NTZ K;  1NYH A;  3HD7 B;  3SWS A;  1QL1 A;  5GTI H;  3L71 E;  1OFC X;  1BE3 G;  1NNO A;  2D0S A;  1A02 F;  1M56 D;  2WWW A;  1NWQ A;  2L5G B;  3HE4 B;  1K3H A;  2B0Z B;  1HH7 A;  1BCC J;  2NPS B;  2C1U A;  2KSJ A;  3SSU A;  1X22 A;  3WUT A;  1BGY D;  3HD7 C;  3RK2 C;  3S1K A;  3OCD A;  5APV A;  1CSX A;  2C9L Y;  3H1L J;  3TYY A;  2E74 D;  1GKS A;  1AQ5 A;  4L75 A;  1N7S A;  2HR3 A;  2JWD A;  3I55 P;  5KJ7 C;  2KYV A;  5H2F E;  3KZI H;  3HE5 B;  3AE3 C;  1GK6 A;  1NJI Q;  2BCC G;  3G71 P;  3V4Q A;  5APX A;  1JTH B;  1M1J A;  2KS1 A;  3WUI A;  4PJ0 H;  3CCR P;  2HLO A;  1ZOY C;  2KK7 A;  5AVS B;  1OW7 A;  1KV9 A;  3B5N B;  1ZRT E;  2M8R A;  1OWA A;  3AEC C;  3TNU B;  1RY3 A;  1G1I A;  1YTZ T;  3Q5P A;  1EXI A;  1T8Z A;  2BEZ F;  1CIG A;  1H8A A;  1C75 A;  1FDO A;  3Q5R A;  1K73 Q;  3NFQ A;  4PD4 E;  1M1K Q;  4PW9 B;  4PV1 C;  5KTB A;  2AXC A;  3MHV A;  2FWL A;  5GTH E;  3OCD B;  1J1E B;  1H9Y A;  3P8M C;  1LFM A;  5E79 V;  2Y0D A;  2ZJS E;  1Q7Y Q;  2A45 I;  2E5Y A;  2XV5 A;  3IAO A;  1N7S B;  1NTM G;  2B88 A;  2WMM A;  2A45 G;  2WSC J;  4BXL A;  2BH4 X;  3CL3 D;  2LXC B;  3SFE C;  5CCG D;  1SQP J;  2UWJ E;  2B89 A;  1M1J B;  2KS1 B;  2PCB B;  5B66 E;  1J1E C;  1SQV K;  3NBS A;  1L0N J;  2CPB A;  2K88 A;  2W6J H;  3E1I A;  3RK3 C;  1QVG O;  2H88 C;  2E76 D;  2JKV A;  3PH0 A;  1ZN5 A;  2E5T A;  1RAQ A;  1L0L K;  1HUC A;  2YKP A;  2Y0C A;  3II6 A;  2W6A A;  3A7O A;  4GOF A;  1SQB D;  2M3B A;  1FOS E;  4C7N A;  1SQX D;  4FA9 A;  1M1J C;  1Q2N A;  3H1I G;  1L9J C;  4DCK A;  3IN6 A;  1IRV A;  1NTZ E;  3H32 A;  3CME P;  5CIE B;  3VP8 A;  4XXL A;  3TYI A;  2P7J A;  4WQC A;  4I7Z B;  3CX5 H;  1S5L E;  2KSE A;  3IFM A;  4JYB A;  1MZ4 A;  3CI9 A;  2QVA A;  5DF5 A;  3ZCF A;  5TIS V;  1ZRT D;  2PP6 A;  3L4O A;  1VF5 D;  1NKZ B;  1WT6 A;  1T6A A;  3RLM A;  2N3B A;  5DJU B;  2V7Q H;  3BVH A;  4NFG B;  5CID B;  1FC2 C;  4KMG A;  2I1J A;  5AVT B;  1URQ A;  4FA1 A;  3L75 G;  3L74 E;  4H0K A;  4FA5 A;  1IQC A;  1NTK K;  1MFZ A;  1BGY J;  2JR8 A;  1N90 A;  1RH5 B;  4U3F E;  1JDL A;  1QL3 A;  5KLV K;  1I8O A;  1CIH A;  1VQ8 P;  4IOI H;  1C6R A;  3HD7 D;  1RQU A;  3RK2 D;  1DW0 A;  2AXT H;  4HB1 A;  1CRH A;  2ZON G;  1KX7 A;  3A3Y B;  2YO2 A;  1I6E A;  4I1L A;  3ZIY A;  5AW9 B;  4WBA A;  3V5B A;  4C7N B;  4LGD E;  2N9J A;  4YE1 A;  1VQ5 P;  5CIG B;  1AV1 A;  5KJ7 D;  3O8Z A;  1W5C E;  2C0X A;  3H32 B;  3C9I A;  4OVN F;  2ZFC A;  1OVR A;  1LWU B;  1GD2 E;  4J20 A;  4A7P A;  3WUV A;  4Z1M H;  5CBO A;  1KFN A;  2WT7 A;  2VHD A;  5C0Z A;  1OX3 A;  3WUU A;  1PFI A;  4HH2 A;  1NTZ D;  3JSV C;  2KZJ A;  3CCU P;  1NAY A;  1URQ B;  1LWU C;  1LGH B;  3CCL P;  2IFN A;  1OZH A;  1A8C A;  1CIE A;  3RMZ A;  1CSB A;  3U1A A;  4WVZ A;  2A06 G;  1DEB A;  1IO3 A;  2Y9Y A;  2YO3 A;  1R5S A;  4L3G A;  3MP7 B;  2N9Y B;  3UIA A;  4W7Z A;  2FXM A;  4IFM A;  2BH5 X;  2FYU K;  1CRC A;  1CRI A;  3A2A A;  3G9R A;  3GHG A;  1HRO A;  1URQ C;  1LTS C;  2BLF B;  4PV1 D;  1VQ4 P;  1RE4 A;  1SQV E;  1JO5 A;  2WPQ A;  1JY2 N;  2ZXE B;  3CLQ A;  2KLU A;  1P84 I;  1HVV A;  3RBX A;  1FZC A;  1L0L E;  1FJK A;  2V07 A;  4WQ7 A;  4PWA A;  4WQB A;  1SQP G;  4CPG A;  3CP5 A;  1AFO A;  3KZI E;  1KV4 A;  1LTT C;  4UB6 H;  1L0N G;  4RJT A;  1C6S A;  3RBZ A;  1SQB J;  3RK3 D;  1CI6 A;  4DZO A;  4PJ0 E;  3HQ9 A;  2WT7 B;  2K37 A;  4Y99 B;  2C1V A;  5AVU B;  3BCC D;  3RN1 A;  2Z5I A;  1SQQ G;  2KI7 B;  3RL0 g;  1LS9 A;  4D6T E;  5CIB B;  2WVR A;  3U1C A;  1S6V B;  5APS A;  3CC7 P;  2VRS A;  1DW2 A;  1NTK E;  4Y99 C;  3FXD A;  3M91 A;  3MK7 C;  3CX5 W;  3L73 D;  1AOQ A;  1E2R A;  3PH2 B;  1JCC A;  2ZYD A;  3GHG B;  1RF1 A;  1SLQ A;  2N18 B;  2KZI A;  2K9Y A;  3S9O A;  1CYJ A;  2JP3 A;  1MFT A;  1DIP A;  1M70 A;  1L4A A;  1EB7 A;  4WY4 A;  5AUR A;  2K3R A;  2WSE J;  1GJQ A;  4UB8 V;  3WFD C;  1FZC B;  2WTY A;  2OAR A;  1FI3 A;  2XNX A;  3RL0 B;  1B7V A;  1X0T A;  3CWB G;  2JO1 A;  1U75 B;  4O1Q A;  1PGP A;  1BGY G;  4N6J A;  3GHG C;  2KIK A;  1PP9 G;  2LKM A;  1RE4 C;  2CK3 H;  3EFF K;  3T97 A;  1FI7 A;  1CC5 A;  2PRR A;  5KKZ C;  1IFP A;  1EXJ A;  1LT9 C;  1CI6 B;  3AE8 C;  1FZC C;  2EXV A;  3EWK A;  1OVV A;  1PPJ D;  2A45 H;  2IBZ E;  3CPW O;  4OGQ D;  2E43 A;  1GK4 A;  3A0B H;  1KMI Z;  3CXH I;  2IDB A;  1LC1 A;  1IFI A;  1HJB A;  3H1H D;  3NWV A;  2R32 A;  1S1C X;  3PP5 A;  1EZV I;  4LJI A;  3TGU E;  3LW5 J;  4H13 B;  3IR9 A;  1SP4 A;  1GW3 A;  2LIT A;  1EZV G;  2SPZ A;  4GOD A;  1EQ7 A;  3CX5 E;  1NTZ J;  3VYM A;  1RF1 B;  2LIR A;  2FXO A;  5DFS A;  3Q2Y A;  3IF4 A;  3L4M A;  2FYU E;  2O01 J;  4HJG H;  5AW8 B;  1JNM A;  1J3S A;  1L4A B;  4WY4 B;  1XTG B;  5APQ A;  2POH A;  1M90 Q;  1DD3 A;  4DY9 A;  3BRV B;  1NTK D;  1LMS A;  2FY8 A;  4LLH A;  3CC4 P;  1OVU A;  1YI2 P;  2MHM A;  3LID A;  1NU1 G;  3L72 E;  2OYO A;  3L74 J;  5KLV D;  1W2L A;  3RN0 A;  4JBZ A;  3T97 B;  1L4A C;  4WY4 C;  3C1L A;  1FE6 A;  1A02 J;  1MUU A;  2B9B A;  1WMK A;  3G6E P;  1URQ D;  4K3A A;  1K3G A;  4U3F J;  3P32 A;  2KUB A;  2IZ0 A;  1GL2 A;  2AXT E;  1VQN P;  2WSS H;  1OAE A;  2WPS A;  2Q3E A;  1GDT A;  2YK3 A;  5CYT R;  1FDI A;  4EIJ A;  3FX0 A;  1DVH A;  3ZOW A;  1YEB A;  3ZDM A;  2OYH A;  3ITK A;  351C A;  1W2B O;  5KAF H;  1SQB G;  3BCC J;  1L9B C;  4N78 E;  2ZT9 B;  2KNC A;  1SQX G;  1NTM K;  4IL6 V;  1IJD B;  3PXT A;  4P4Q B;  3V6I A;  3H6P A;  5H2F V;  3H1J E;  1GZL A;  3H1K G;  1YYC A;  4L76 A;  3O0R C;  1PL5 A;  4EDF A;  3TGU D;  3WFE C;  4H44 B;  5APW A;  3L73 J;  1JY2 O;  1Y9B A;  2PAJ A;  3CX5 D;  2Z4E A;  3L70 G;  1RZ5 A;  1USD A;  2ORL A;  1CW5 A;  2NPS C;  2FYU D;  2G3A A;  5AW5 B;  3WC8 A;  1K04 A;  1BSN A;  4GDO A;  3Q1M A;  3LIE A;  2M3E A;  4AUW A;  2C9N Y;  1N2D C;  4L73 A;  2FBW C;  2Q6Q A;  4H44 C;  3M9Q A;  3D6Z A;  3V4W A;  1DD4 A;  4W80 A;  1KYO E;  1GL2 B;  1BE3 E;  2R3S A;  1CCR A;  1RE3 A;  4FAV A;  4DT0 A;  1SQV J;  2E75 B;  1YJ9 P;  3CCE P;  1VQL P;  5KAI V;  2ZYA A;  2L4D A;  1NO4 A;  2C9X B;  3GG2 A;  3AE9 C;  2K9J A;  5GTH V;  1LP1 A;  1IK7 A;  2B4Z A;  3L37 A;  4IFF A;  4KHX A;  2CA3 B;  4U7J A;  2OYH B;  5B5E V;  3A0H H;  3V2R A;  2KNC B;  4UB6 E;  2KP8 A;  3GMA A;  4AQR D;  1P84 H;  1TU3 F;  2E75 C;  1I54 A;  4AX3 A;  2WSC H;  5C39 A;  5CMZ A;  3H1H J;  1AJY A;  4HYT B;  2QRX A;  5CHX A;  3B5N C;  3D70 A;  1T2K C;  3TDK A;  1MG3 D;  1ETP A;  3L71 D;  4AYC A;  1HJ3 A;  5B66 V;  2BCC E;  2OYH C;  1YTC A;  2WPR A;  2CXB A;  4JPZ B;  2PAC A;  4C7R A;  3GLM A;  5AW4 B;  2H89 C;  1FJ0 A;  2ZBO A;  3SJL A;  3H1J D;  1F1C A;  3M97 X;  1YJN P;  4ASV A;  4IL6 X;  1D7M A;  1GU4 A;  1MZ9 A;  1ZW0 A;  1NTK J;  1FZF A;  1H89 A;  1AOF A;  3AE2 C;  3N7N A;  2D2C B;  3S4R A;  1N7S C;  1IRW A;  1S5L V;  2DW3 A;  2H8P D;  1IFM A;  2HG5 D;  5L8R J;  5KLV J;  1CSV A;  2OQQ A;  2Y0E A;  2CE0 A;  4H0L B;  1CED A;  3A5T A;  2J59 M;  3OAK A;  2K9J B;  2NRG A;  2YKO A;  1M60 A;  1LP1 B;  1N15 A;  3GF3 A;  2O1K A;  1AKK A;  1CTY A;  2JEE A;  2XKM A;  1YFC A;  2D2C C;  1KYO D;  4WY4 D;  1RE3 C;  1BL9 A;  2JDI H;  2Y9Z A;  5DJT B;  1G1J A;  1NTM E;  1H9X A;  1HH0 A;  4K35 A;  1CXC A;  3PXS A;  2JTI B;  3L36 A;  1Q81 Q;  2L91 A;  3A0B E;  1KC8 Q;  2E42 A;  4XA4 A;  3F89 A;  1AVO A;  3O6Q A;  1IZN B;  4I7Z C;  2OTL P;  1N50 A;  3NTN A;  1S4X A;  1JUN A;  1KOR A;  4PD4 D;  3K5B A;  1KB9 I;  3WU2 V;  3CC2 P;  1RAP A;  3HQ8 A;  1MV8 A;  1A56 A;  1BCC G;  3TGU J;  1QKS A;  1T3J A;  2GIW A;  2BCC D;  3CXH H;  1SQP K;  1VQ9 P;  1CYI A;  4WQE A;  1I6D A;  1FOC A;  3EQ2 A;  2H43 A;  2WZ7 A;  5APT A;  2FXP A;  2C1D A;  3H1I E;  1QYZ A;  1YCC A;  2WPV B;  4R4M A;  4GYD A;  3CMA P;  1SFC A;  2GUV A;  3L73 G;  3JBT B;  3H1L G;  4N3Y B;  5APU A;  2FYU J;  1FAV A;  1X79 B;  2FFD A;  4KT0 J;  3I56 P;  2N1T A;  3E7K A;  3C2C A;  1M57 D;  2V7Q J;  2ZAE B;  3GW6 A;  1QL4 A;  2GA1 A;  2NPS D;  2WQY C;  1VQ6 P;  1S9K E;  1SQQ K;  1H32 A;  3L72 J;  2YIU B;  2R5D A;  1ZR4 A;  3KHU A;  2C0W A;  4EIF A;  3L75 E;  4H44 D;  2CPS A;  1KQS O;  1KFM A;  1OIP A;  2QEX P;  1S5L X;  2J5U A;  3VOP A;  1J1D B;  1I8P A;  1HF9 A;  3MZW B;  3CCS P;  4O1W A;  3M06 A;  3AEB C;  1W2E A;  1WEJ F;  3O6Q B;  2OGU A;  1QGK B;  2ZXY A;  1GMJ A;  2YIU C;  1YIQ A;  3VRD A;  1PPJ G;  1DW3 A;  2FKW B;  4QAO A;  1N9C A;  2PCC B;  4XE5 B;  1OCD A;  1CZQ A;  5GTI E;  3WMM 0;  3AEF C;  3D0W A;  4L74 A;  3AE1 C;  3ZOX A;  3H1H G;  2ZVN B;  5KAF E;  1H1O A;  3L71 J;  2IX7 C;  5K5G B;  3O20 A;  5AW6 B;  2E75 D;  4V2K A;  4YTP C;  1NHL A;  5AVQ B;  4IL6 H;  3B5N D;  2C1D B;  2ZZS 1;  3ABV C;  1DT1 A;  4FB1 A;  3KZI V;  2GB8 B;  3L74 D;  1SFC B;  1CHH A;  2KLV A;  3CCJ P;  3H1J J;  5TJH A;  2FFD B;  2QM8 A;  2JJL A;  3PJS K;  1JY2 P;  4ZKP A;  2FRC A;  3HUS A;  4PJ0 V;  2HPC A;  2N1T B;  4U3F D;  1DII C;  1JMM A;  1BSH A;  2R3C A;  5CIF B;  1MG2 D;  2MKV A;  2WSF J;  3M0A A;  1H32 B;  1SFC C;  2J58 A; 
#chains in the Genus database with same CATH homology
 1C2R A;  2QJK B;  3L4M A;  1FCD C;  1E29 A;  1J3S A;  4WQ9 A;  2BCN B;  1CRY A;  1KV9 A;  4L1Q A;  4DY9 A;  1NTK D;  3O1Y A;  1LMS A;  1CSU A;  2ZOO A;  1CCH A;  2MHM A;  1AYG A;  1CHJ A;  1CIG A;  3ZBM A;  1DVV A;  1C75 A;  3X39 A;  5KLV D;  1W2L A;  1M6Z A;  2B12 B;  3RN0 A;  1H33 A;  2FYN B;  1KIB A;  4EIE A;  4FA4 A;  2B10 B;  4PW9 B;  5KLI B;  2JQR A;  1K3G A;  3PLN A;  1DIQ C;  2FWL A;  3OCD B;  1H9Y A;  1LFM A;  4AAM A;  5E79 V;  3PRJ A;  5GTI V;  1CTZ A;  2Y0D A;  1A2S A;  1OAE A;  5KAF V;  2Q3E A;  2BPB B;  2DVH A;  2YK3 A;  2AI5 A;  5CYT R;  2BH4 X;  1I55 A;  4FAN A;  1DVH A;  3ZOW A;  1YEB A;  1FHB A;  2HV4 A;  2JWA A;  3ITK A;  351C A;  2PCB B;  2I8F A;  2N3Y A;  1SQV D;  1W5C T;  1L9B C;  2N18 C;  3TF5 A;  1NTM D;  3NBS A;  4IL6 V;  3HQ7 A;  3PXT A;  1H31 A;  4P4Q B;  5H2F V;  1CXA A;  1CIF A;  3CXH W;  1RAQ A;  1L0L D;  2Y0C A;  3O0R C;  4EDF A;  3TGU D;  1SQB D;  3WFE C;  1SQX D;  4N0K A;  3CYT I;  4FA9 A;  4WQA A;  3CX5 D;  1L9J C;  1IRV A;  5CIE B;  1RZ5 A;  2ORL A;  4XXL A;  3TYI A;  4WQC A;  3VNW A;  1DW1 A;  1H33 B;  2FYU D;  1MZ4 A;  3WC8 A;  3SXT A;  3PTZ A;  5DF5 A;  3ZCF A;  2C8S A;  1R0Q A;  5TIS V;  1ZRT D;  3H1I D;  4GED B;  3L4O A;  4Q5P A;  5CIC B;  3RLM A;  2N3B A;  1KX2 A;  1CRG A;  3WFC C;  1CCR A;  4NFG B;  5CID B;  4D6T D;  4KMG A;  4FAV A;  4FA1 A;  3A0H V;  5KAI V;  1CRJ A;  3NBT A;  3ORV A;  4H0K A;  4FA5 A;  1IQC A;  2L4D A;  1C2N A;  2C9X B;  3GG2 A;  5GTH V;  1LC2 A;  1YIC A;  2B4Z A;  4WQ8 A;  2CA3 B;  1N90 A;  1CSW A;  2AXT V;  5B5E V;  1P84 D;  1JDL A;  1QL3 A;  2KNC B;  3L75 D;  1C52 A;  1I8O A;  155C A;  1H31 B;  1CIH A;  451C A;  1I54 A;  3MK7 B;  4AX3 A;  1HRC A;  2XTS B;  1C6R A;  1DW0 A;  4L3H A;  1CRH A;  2ZON G;  1KX7 A;  2DGE A;  1BCC D;  3TDK A;  1KB9 D;  1I6E A;  3ZIY A;  1MG3 D;  1ETP A;  3L71 D;  3O5C A;  2RN0 A;  1HJ3 A;  5B66 V;  1IZL 0;  1CTJ A;  2N9J A;  1YTC A;  4YE1 A;  2QG4 A;  1HJ5 A;  2CXB A;  2PAC A;  5CIG B;  5CIH B;  1VYD A;  4Y5R A;  1NIR A;  1HZV A;  1FJ0 A;  2ZBO A;  3H1L D;  3SJL A;  3H1J D;  1SQQ D;  4AAL A;  1F1C A;  3M97 X;  2MTA C;  4AAN A;  4J20 A;  4A7P A;  1GIW A;  3PHL A;  4JCG A;  1F1F A;  2IBZ D;  2YQB A;  1AOF A;  2VHD A;  4K3I A;  5KKZ B;  5C0Z A;  1RZ6 A;  1GDV A;  1NTZ D;  2B11 B;  1IRW A;  1S5L V;  2QJP B;  3DMI A;  1CSV A;  3SVW A;  2QJY B;  2OZ1 A;  1A8C A;  1CIE A;  2Y0E A;  2CE0 A;  1CED A;  1C6O A;  3RMZ A;  1E8E A;  5B6Q A;  2K9J B;  1M60 A;  1IO3 A;  2GC4 D;  1N15 A;  1AKK A;  1CTY A;  4L3G A;  2CE1 A;  2N9I A;  3ZOY A;  2N9Y B;  1YFC A;  2CA4 B;  3CWB D;  1KYO D;  2C2C A;  2BH5 X;  1GU2 A;  1CRC A;  1CRI A;  1PP9 D;  1BL9 A;  1HRO A;  1I5T A;  2BLF B;  3DR0 A;  1WVE C;  5DJQ B;  4AAO A;  2D0W A;  2A06 D;  1H9X A;  1U74 B;  1CXC A;  3PXS A;  2JTI B;  2L91 A;  3ZOO A;  1HZU A;  2V07 A;  4WQ7 A;  4UB6 V;  3L72 D;  1C7M A;  1ZZH A;  1COT A;  4PWA A;  1HJ4 A;  1CO6 A;  4WQB A;  1CNO A;  2V08 A;  3A9F A;  3CP5 A;  1N50 A;  5DJQ C;  1GQ1 A;  4PD4 D;  3WU2 V;  1RAP A;  3CXH D;  4RJT A;  1C6S A;  3HQ8 A;  1A56 A;  2RMZ A;  5C9M A;  1QKS A;  3OA8 A;  2GIW A;  1CYC A;  2BCC D;  3HQ9 A;  1NMI A;  1SQP D;  1CYI A;  4WQE A;  4EID A;  1I6D A;  1FOC A;  4WQD A;  1EZV D;  1YEA A;  2BGV X;  2C1D A;  2C1V A;  1HCM A;  1QYZ A;  1YCC A;  3BCC D;  3RN1 A;  4GYD A;  1L0N D;  3JBT B;  2OZ1 B;  1LS9 A;  5EXQ A;  5CIB B;  1S6V B;  3C2C A;  1DW2 A;  4H0J A;  3GW6 A;  1QL4 A;  3MK7 C;  3CX5 W;  3L73 D;  4XYD B;  1AOQ A;  1E2R A;  3PH2 B;  4MU8 A;  4EIC A;  1H32 A;  2AIU A;  1NU1 D;  2YIU B;  4RSZ A;  1KYO W;  3KHU A;  5IY5 1;  3VMA A;  2GC7 D;  2N18 B;  1COR A;  4EIF A;  3DP5 A;  3HQ6 A;  1CYJ A;  3PXW A;  1M70 A;  1EB7 A;  5AUR A;  3SLE A;  1NML A;  1GJQ A;  4UB8 V;  1QN2 A;  1I8P A;  3WFD C;  2O3J A;  1FI3 A;  4O1W A;  3WFB C;  1B7V A;  1WEJ F;  3SWS A;  2YCC A;  3CU4 A;  1U75 B;  4O1Q A;  2ZXY A;  1KB0 A;  1YIQ A;  1NNO A;  1YNR A;  3VRD A;  1DW3 A;  2D0S A;  3FWL A;  4QAO A;  1N9C A;  2PCC B;  1OCD A;  1FI7 A;  1CC5 A;  1K3H A;  2B0Z B;  1HH7 A;  3A0B V;  3ZOX A;  1H1O A;  2C1U A;  3OA8 B;  3O20 A;  1FI9 A;  4V2K A;  2EXV A;  1BE3 D;  1BGY D;  1PPJ D;  2C1D B;  2ZZS 1;  3OCD A;  1DT1 A;  4FB1 A;  3KZI V;  2GB8 B;  3L74 D;  1CSX A;  1CHI A;  1CHH A;  1LC1 A;  1GKS A;  5TJH A;  3H1H D;  3NWV A;  3H1K D;  2FRC A;  4PJ0 V;  4U3F D;  1DII C;  4LJI A;  5CIF B;  1MG2 D;  2LIT A;  2KS1 A;  3WUI A;  1H32 B;  3VYM A;  3L70 D;  2LIR A;  5DFS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...