3CWBD

Chicken cytochrome bc1 complex inhibited by an iodinated analogue of the polyketide crocacin-d
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title The role of molecular modeling in the design of analogues of the fungicidal natural products crocacins A and D.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 65
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2008-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3cwbD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3cwbD02
1SQPD 1YTCA 3CU4A 1HH7A 2B10B 1M6ZA 2QJKB 2VHDA 1CC5A 4P4QB 4FA4A 5IY51 1KV9A 5KLIB 4MU8A 1QKSA 1DW2A 1W2LA 3GG2A 1CORA 3TF5A 1CXCA 1FI3A 2ZXYA 3DMIA 5C9MA 1CHJA 1CSVA 1E29A 1LS9A 2JQRA 3KZIV 1CHIA 3VNWA 3CWBD 5TISV 1S5LV 1QYZA 4O1WA 3WUIA 1RAQA 4WQDA 1YNRA 1CTZA 1U75B 2CE0A 1A8CA 4XXLA 5CIEB 4WQEA 3CP5A 2O3JA 1COTA 3A9FA 3TGUD 3SJLA 3L72D 4WQCA 1CNOA 4AAMA 3RMZA 2MHMA 2PCBB 3M97X 1CRIA 1VYDA 4L3HA 3OA8A 3RN0A 1GKSA 1AYGA 2Y0EA 4N0KA 1CYCA 1I8PA 4PWAA 3RLMA 1EB7A 2MTAC 1YICA 3WFBC 3HQ7A 3ZOYA 3C2CA 4PD4D 1IZL0 5GTIV 1CIEA 2N18B 1DIQC 4RJTA 1GDVA 2N9IA 3CXHD 1J3SA 1CXAA 3NWVA 4FAVA 1I54A 1BE3D 1DW3A 4H0JA 5C0ZA 3H1KD 5KKZB 4QAOA 1CRHA 2V08A 4NFGB 5H2FV 1K3HA 3L73D 1NU1D 1M60A 3PTZA 1BL9A 1H33B 5DJQB 2CA3B 4O1QA 3GW6A 3VYMA 1H9XA 4J20A 2YIUB 4YE1A 2FYUD 4AX3A 3SLEA 1YEAA 2GC7D 3ZCFA 2Y0CA 3JBTB 2CE1A 4UB6V 1CRCA 1L0LD 1DIIC 1BCCD 2FYNB 5CIDB 1C2RA 1SQQD 1C6SA 3SWSA 1JDLA 3H1ID 5CIFB 1ZZHA 3ORVA 4EIEA 5TJHA 1GQ1A 2B4ZA 1OCDA 1KIBA 1N50A 1CCHA 2BPBB 1HJ5A 2YK3A 5CIGB 1EZVD 1QL4A 1RAPA 2XTSB 5AURA 1BGYD 5B6QA 5E79V 1E2RA 1IQCA 5CIBB 3WFEC 1MZ4A 1N9CA 1HJ3A 1YIQA 2LITA 1QL3A 3SXTA 1LMSA 4DY9A 1H31B 2CXBA 1LC2A 1CO6A 3ZOWA 1FJ0A 1KYOW 1DW1A 1FCDC 4AAOA 2C1UA 4U3FD 1F1FA 2ZZS1 1L9BC 1DVVA 5KAIV 3NBTA 3WU2V 1CTJA 2D0WA 1H33A 3HQ6A 2EXVA 3MK7C 2JTIB 3CYTI 4WQBA 2B12B 4AANA 2GC4D 1H9YA 4Y5RA 5KLVD 3PXWA 2GB8B 3L71D 4D6TD 2ZONG 1I55A 1NNOA 4FA9A 1AOFA 1CIHA 1ETPA 2BCNB 2JWAA 4A7PA 1E8EA 2KS1A 1YFCA 2ZOOA 1HZUA 1CSWA 1N90A 2C2CA 2A06D 1M70A 4LJIA 2QJYB 1CSXA 351CA 4FB1A 1S6VB 3ZBMA 1W5CT 4L1QA 4UB8V 3H1LD 4EIFA 1RZ6A 5GTHV 1C75A 2I8FA 1K3GA 3ITKA 2BGVX 2B0ZB 5EXQA 1C52A 4XYDB 2OZ1B 3HQ8A 1FI9A 1H1OA 1FOCA 1HJ4A 1H31A 2FRCA 1SQBD 1CYJA 1I6DA 1NTKD 1A2SA 2BH5X 1KX7A 3PXSA 1B7VA 3X39A 2N18C 3VRDA 2AIUA 1AKKA 2K9JB 3PH2B 2C1DB 4GEDB 2GIWA 1GJQA 2AXTV 3TDKA 4EDFA 2HV4A 4WQ7A 2N3BA 3H1HD 1CCRA 4WQ9A 3WFDC 1I6EA 4WQ8A 3BCCD 2PACA 1PP9D 1HZVA 451CA 5DFSA 3FWLA 1YEBA 1HROA 1KB0A 5DJQC 3L75D 5CYTR 1IO3A 1A56A 3MK7B 3DP5A 1LC1A 1GIWA 4V2KA 2L4DA 5CICB 3VMAA 1I5TA 3CX5W 2AI5A 3L70D 4FA1A 3PRJA 1CYIA 1RZ5A 1CEDA 1CRYA 1OAEA 1QN2A 3CXHW 1NMIA 3RN1A 3WC8A 2Q3EA 4WQAA 3WFCC 3KHUA 2DGEA 4Q5PA 1H32B 4K3IA 1YCCA 2N3YA 2BH4X 2D0SA 1CRGA 2QG4A 1DW0A 1NTMD 1C6OA 1CRJA 2C9XB 3L4OA 3NBSA 4IL6V 3HQ9A 3OCDA 1CIGA 3TYIA 2OZ1A 1DT1A 1AOQA 2V07A 4JCGA 1C6RA 3DR0A 1WEJF 3ZIYA 1NMLA 4H0KA 1MG2D 2C8SA 2ORLA 3PLNA 1KX2A 4EICA 2IBZD 1C2NA 2N9JA 2C1VA 5B5EV 2BCCD 3SVWA 1L0ND 2C1DA 3ZOXA 5CIHB 1DVHA 1P84D 4PJ0V 1PPJD 3CX5D 4FA5A 3H1JD 3L4MA 2KNCB 5B66V 1KYOD 1CHHA 1HRCA 2N9YB 3PHLA 3O20A 2QJPB 2ZBOA 1NIRA 3OCDB 5KAFV 4L3GA 2RMZA 1WVEC 2CA4B 1IRWA 1GU2A 1SQVD 1C7MA 3A0BV 4AALA 1U74B 2PCCB 4GYDA 2YQBA 1L9JC 1ZRTD 1FHBA 1I8OA 4RSZA 3PXTA 1F1CA 3OA8B 1CSUA 2L91A 155CA 1CTYA 1SQXD 1R0QA 3ZOOA 1H32A 1MG3D 1NTZD 3O5CA 2B11B 1KB9D 2LIRA 1HCMA 2RN0A 2BLFB 2YCCA 1LFMA 2DVHA 3O0RC 2Y0DA 4KMGA 3O1YA 1CIFA 1FI7A 3L74D 1IRVA 5DF5A 4FANA 2FWLA 4PW9B 3A0HV 4EIDA 1N15A
chains in the Genus database with same CATH superfamily
1HH7A 5CCHC 4IL6X 3S1KA 4OWFA 3KPEA 2QJKB 3L35A 2VHDA 4P4QB 5IY51 1KV9A 1RE4C 4U3FE 4I7ZB 1QKSA 4NPFX 4U3FG 3TF5A 1CXCA 2O01N 3TYYA 2DW3A 4WY4C 1ZXGA 1KILA 5C9MA 3TNUA 3H1LJ 1MFZA 2WSFH 3TGUG 1E29A 4D6TE 3KZIV 5AW3B 5TISV 3WUIA 1YJWP 2HFED 2HG5D 5EFWB 3RL0g 2O01H 2K3RA 3B5NB 3RL0D 2O3JA 1XTCC 3VN0A 3L72D 2W6JH 4AAMA 2IBZE 3RMZA 3M97X 3L36A 4L3HA 3OA8A 4N78E 3WFBC 3HQ7A 3ZOYA 1NU1G 4EYYQ 1AJYA 4C7NA 1PP9J 3TNUB 4PD4D 1T3JA 1M56D 1YTZI 1CIEA 2N18B 1NGMB 4B86A 2N9IA 2PFXA 2HLOA 1JUNA 1W2EA 3WU2H 3NWVA 2ZFCA 3FXEA 1BE3D 1DW3A 5C0ZA 4GKGA 4QAOA 1ZW0A 3AEDC 5H2FV 2IYPA 2J58A 3VMYA 3M0AA 4IFFA 1N7LA 3PTZA 1IFNA 1MFTA 5DJQB 1GL2D 1SQQG 1SQBK 2CA3B 4UB8E 1RF1B 2B89A 1NTKK 4PV1D 3AEFC 2YNYA 4AX3A 4YE1A 1KB9E 4M3LA 2CE1A 1QGKB 3C8VA 1DIIC 1VF5C 1C2RA 3CCLP 1JDLA 5CIFB 2OTKE 5CCHD 1ZR4A 3VTPC 4UB8H 3O6QA 3M9BA 1JO5A 2D2CB 1URQC 1SVFA 4GIFA 1KB9H 1EZVD 1EC5A 4WY4D 1ZP0C 5CCGC 1HBWA 1U7MA 5AURA 1S72P 1IFMA 4JYBA 3FGAD 2WZ7A 1MZ4A 2CK3H 1N9CA 1FAVA 1GK6A 5APQA 1OXZA 1LC2A 3ZOWA 2NRGA 1KYOW 2IZ1A 2XV5A 4BXLA 1JCDA 3HD7B 4U3FD 1LT9C 3E7KA 3R2PA 2AXCA 1DVVA 5KAIV 5AVYB 1SP4A 4YPCA 1JOCA 2Q3IA 2BCCE 1L0NE 4WQBA 2B12B 2E76B 1TU3F 3PXWA 2BCCG 1L0NG 4D6TD 2QJKC 1FZCC 3MIWA 2ZJSE 2QA4P 4FA9A 2YMYA 3BCCJ 1AOFA 3AECC 5L8RJ 2BCNB 1VQ5P 2HPCA 3EQ2A 4A7PA 2OYHA 3AE9C 3V4QA 3L4FA 3E1IA 3TSIA 2QEXP 3EFFK 1S1CX 1JEKA 1HZUA 2GA1A 2C2CA 1VQ4P 3NMDA 1BSNA 1S5LH 4O9BA 4YXWH 3L70J 4IFDK 4PJ0E 4IL6H 4LJIA 1SQVK 5AVVB 4N78D 351CA 1IO4A 4FB1A 1EQ7A 4L1QA 3B5NC 1IFJA 3WUUA 1USEA 3CXHH 1Y9BA 4H44B 1IJDB 2P7JA 1NTZE 1VF5D 1BDCA 2G3AA 1C52A 1SQXK 2ZT9C 4Y99B 1H1OA 1R5LA 2P67A 3D71A 1URQD 2C9NY 1OX3A 3L74E 4RO0A 4PJ0H 2KLVA 1CYJA 3WMM0 2WT7A 1I6DA 1KILC 2BH5X 5CCGD 5KJ7A 3MUDA 3X39A 1J1DB 2N18C 2K9JB 2Q7CA 2BEQD 1GZLA 4AUWA 1SQPK 1DX7A 2L5GB 1LP1A 1PFIA 4HB1A 1DH3A 4WQ7A 4DOJA 3SFDC 2N3BA 4JF7A 4DCKA 3A0BH 5DFSA 2Z5HA 1CI6B 1T3UA 1JMBA 1KB0A 1LT1A 5DJQC 1RF1C 3H1JJ 1A56A 2QRXA 3DP5A 5AVXB 3GF7A 3CWBE 5CICB 2IZ0A 3CC4P 2IBZI 3CWBG 4HH2A 1CYIA 4UB6H 1OAEA 1QN2A 3L73J 1NMIA 1H8AA 1QLED 3RBZA 3SFEC 4Q5PA 2R5DA 4K3IA 3P8CE 2N3YA 2KI7B 5KLVE 2FYUJ 1LTGC 2M5AB 5CBNA 1C6OA 5CCHA 1VQPP 2FXMA 3HE4A 1RE4A 2OZ1A 1L0LJ 5E79H 1X8YA 2KXPB 4ZNCA 4JCGA 3NFQA 3DR0A 3CD6P 5AVQB 1A02J 4WY4A 1SLQA 2ORLA 3PLNA 4EICA 2Q1KA 1Q7YQ 2C1VA 3KZIH 2BCCD 3B5ND 1L0ND 1KB9I 5TISH 4L75A 1DVHA 2UWJE 2IPPA 1NU1K 3H1LE 4ASVA 3QWOC 4WWIA 3L4MA 1FDMA 2H8PD 5B66E 3AE4C 4I1LA 5APUA 1R8EA 2FYUK 2K1AA 4ZKUA 2QJPB 1W5CE 1KILD 2M8RA 4L3GA 3GMAA 1WVEC 2FYZA 2JR8A 2E76C 1BCCE 1GU2A 3T97B 1BCCG 2IFMA 1L0LK 4GYDA 1JB0J 1SQQK 1M1KQ 1FHBA 1I8OA 2A45H 1YHQP 4ASWA 2FXPA 1FU1A 2B87B 1IK7A 1NTZD 1JTHA 2ITAA 1XTGB 2RN0A 4HJGH 4RESB 3O0RC 2Y0DA 4KMGA 5H2FH 3O1YA 3KYQA 1LTJB 3CI9A 2NZ2A 1K9MQ 3JC22 3L74D 2P10A 4FANA 4GDOA 1USDA 4EIDA 3A0HE 3RK2B 2CPBA 1YTCA 4H44C 3CU4A 2B10B 3UIAA 4FA4A 1CC5A 2ZVOB 2KK7A 5KLIB 4OGQB 3H1KJ 4Y99C 3FWNA 1HVVA 2D2CD 1FS0E 1DW2A 1IFIA 2HYNA 2OYHC 1A02F 3DMIA 1EDKA 1CHJA 3L72G 1J1DC 1M57D 5BU8B 3CXHI 2LR2A 1LS9A 4NPDA 1URQA 1EXJA 3VNWA 2WTYA 3CWBD 1SFCA 1S5LV 1QYZA 5CCGA 1YNRA 2CE0A 1CZQA 5CIEB 2YXQB 3H1IJ 2PCBB 3Q5PA 1YQ3C 3PJSK 1VYDA 3P8CD 5BU5A 1FBMA 3RK3C 3RN0A 4I2LC 3G4SP 3RL0C 2A06G 4N0KA 4XE5B 4PWAA 3RLMA 2Q5UA 1EB7A 1N7SB 1KYOE 2WMMA 5KJ7C 1IZL0 1GW3A 1BGYJ 5GTIE 2E76D 3U59A 1OWAA 5KAIH 1AVYA 1CXAA 1SFCB 2WPVB 1KN7A 2P1JA 2FBWC 4QMAA 1I54A 4H0JA 1RE3C 4U7JA 5KKZB 1IZNB 4RKUJ 1CRHA 1QEXA 3CX5H 1BL9A 1H33B 3F89A 4XA4A 2PGDA 2YO3A 4O1QA 3GW6A 1H9XA 1RF0A 4J20A 2WSEJ 1NHLA 1Q81Q 3SLEA 1YTZT 1YEAA 1PZQA 1VQOP 2W90A 5CBOA 2Y0CA 2HR3A 3BCCE 3JBTB 2YKPA 2XU6A 1NTMJ 4UB6V 2KSJA 3H1HG 1CRCA 3L71J 1BCCD 2HODB 4H44D 3L75E 3SWSA 3Q2YA 1GQ1A 1UIXA 4BRYB 3L75G 5M1BA 2B4ZA 1K04A 3B5NA 4H0LB 3L70E 1HJ5A 5CIGB 2QJPC 2J5UA 3WUTA 2I8DA 1KFNA 4EI2A 5B6QA 5E79V 3GLMA 1IQCA 4ZMDA 2CPSA 1NAYA 3VYIA 3RGUA 2LITA 2Y9YA 1YBKA 4OH8B 1LMSA 1H31B 2CXBA 1CO6A 3D6YA 1NTMK 4C46A 1DW1A 4D6TG 3F5HA 2ZYAA 1JM0A 1OVUA 3V2RA 1NAFA 3RK3D 1LTJC 5CJ4A 1SQBJ 1L9BC 3Q5RA 2KYVA 1NTKJ 2Q6QA 2W6AA 1CTJA 3WU2E 2D0WA 3I56P 3HQ6A 3I55P 3ABVC 1S3JA 1KQFB 1RF1A 3MK7C 3RK2C 1U7JA 4AANA 5KJ7D 4GOFA 1PGPA 2IBZG 2LKMA 1QVGO 2GB8B 1PPJE 3H1JE 4OGQC 2ZVNB 4JBZA 3AE5C 2M3BA 3LW5H 1DD3A 1FZBA 2JWAA 3H1JG 5AVWB 5APXA 3IR9A 3L73E 1N90A 2A06D 2KLUA 3LIDA 2N9BA 2QJYB 1VQ7P 1S6VB 3ZBMA 2E75B 1KD1Q 5GTHV 3ITKA 2BGVX 2V4HA 1FJPA 1VQMP 4XYDB 1IC2A 2R44A 3II6A 2NPSA 5APSA 1HGVA 1HJ4A 3MGNA 2FRCA 1YI2P 5CJ0A 1KORA 1N7SC 1G1JA 2WPRA 2QSIA 1A2SA 1KX7A 3PXSA 2JEEA 4L74A 1X22A 3HD7A 1B7VA 1NJIQ 3VRDA 2J59M 1SFCC 2C0XA 1GJQA 2AXTV 3TDKA 3BRVB 1NWQA 2HV4A 1VPCA 4K3AA 3WFDC 3H1HD 1CCRA 5KKZC 4WQ8A 3BCCD 2PACA 4TLFA 451CA 2KUBA 3FWLA 3HRNA 1YEBA 2ZXEB 3VP8A 1HROA 2MJZA 1JCCA 3L75D 5CYTR 5APWA 3P32A 1LC1A 4V2KA 3AEAC 3MTUE 2L4DA 2NPSB 3U1AA 2GUSA 1HH0A 3CX5W 1BE3J 3L70D 1RZ5A 1CEDA 1OIPA 5AVRB 3RK2D 3RN1A 1SQVJ 2Z5IA 1AV1A 3CX5I 3A5TA 1RH5B 1E5WA 3V5BA 3CCRP 1Q86Q 1KYOI 2BH4X 2D0SA 2QIWA 2KNCA 4OGQD 2P2UA 5KTBA 1DD4A 1Q2NA 3O8ZA 4H0LC 1SQXJ 1S5LE 1U57A 3NBSA 2XZRA 4IL6E 2N1TB 3TYIA 3HE5B 5APYA 3H25A 4I7ZC 1DT1A 1AOQA 2V07A 1RF0C 1FC2C 3CXHE 1SS1A 1WEJF 1AA0A 1ZMEC 1NMLA 4H0KA 4DJGA 1MG2D 3H1KE 2IBZD 3S4RA 1SQPJ 1ZLLA 2N9JA 5B5EV 1L4AB 4GT1A 3V2PA 1N8RQ 1FOSE 2K9JA 3GHGB 2BASA 5CIHB 5AVUB 1PPJD 4FA5A 3H1JD 3VMZA 2KNCB 1CHHA 1CI6A 1NO4A 1N7SD 1S4XA 1NTZG 3JCUH 1IRWA 3H1IE 3A0BE 3CCVP 3CMAP 3L37A 1YYCA 1SFCD 3G9RA 2YQBA 3L74G 1CSUA 3LW5J 1OZHA 1FZFA 3TGUJ 1R0QA 3IF4A 3OW2O 2R3SA 3O5CA 1KB9D 1MKMA 1BGYE 4UB6E 2DVHA 1VQNP 1RE3A 2M5AA 1BGYG 5APTA 1RQUA 3EWKA 2QJYC 3CL3D 1CIFA 1FI7A 1IRVA 1G1IA 2E75C 1GIWA 3OAKA 2YKQA 1M6ZA 5AW0B 3PH0A 4MU8A 4LLHA 4L76A 5E79E 1W2LA 1NU1J 2K9YA 1UIIA 4H0LD 1FI3A 2ZXYA 1OVRA 3WUVA 1CSVA 1NTME 2D2CC 1ZOYC 3L71E 2JQRA 3KZIE 1CHIA 1AFOA 2OGUA 5TISE 5KLVG 3L71G 1RAQA 3HUSB 3AE1C 5CHXA 1U75B 2V7QH 3T97A 1SQQJ 2WSEH 3CP5A 3A9FA 3ZDMA 3FX0A 2G8YA 2W8ZA 1CNOA 2MHMA 1HJBA 1G2CA 1JNMA 3D70A 1AYGA 1P84E 2NPSC 2Y0EA 3N4XA 1CYCA 1KQSO 2MTAC 2B87A 1W2BO 3HD7C 1VQ9P 3H1LG 1DIQC 1LTJA 4RJTA 3CXHD 1GD2E 3H1KD 4NFGB 1P84H 1SQBE 5H2FE 1K3HA 1JY2P 1JY3P 1NTKE 2N1TC 3P7KA 1PV3A 1H0TB 1NTKG 1FDIA 1G2CB 3CCSP 3VYMA 2YIUB 3A2AA 2K88A 2GC7D 1PP9E 1E79H 1L4AC 2B88A 3KQGA 2E75D 3GHGC 2FYNB 1PP9G 5CIDB 3H1ID 2H88C 3SWFA 1ZZHA 4EOTA 4EIEA 5TJHA 2KS1B 3KDPB 3HTKB 1KIBA 2R3CA 5GTHH 2YK3A 5KAFH 1RAPA 2XTSB 2B9BA 2BCCJ 2IX7C 4AYCA 3CPWO 1BGYD 3E1RA 2WWWA 2W27A 3WFEC 3H32A 1N7SA 2AEMA 3NTNA 1HJ3A 2RH0A 3KXDA 4W80A 2O1KA 1QL3A 3M0DA 3SXTA 1LWUB 4GOEA 4DZOA 2WVRA 2AXTH 2OQQA 3Q5SA 1FJ0A 2WQYC 4AAOA 3M9QA 4W7ZA 2C1UA 1GK4A 2OTLP 2E5TA 1F1FA 2ZZS1 2NPSD 5KAIE 2W6BA 1H33A 1X0TA 1M7LA 2JTIB 3CYTI 3VP9A 2YMKA 3HD7D 3BRTB 1RY3A 4OVNF 5KLVD 2SPZA 3L71D 1OW8A 2PAJA 3MHVA 1I55A 1L0NK 3CX5E 4PD4E 3S9OA 4YTPC 3TK1A 1J1EB 1NNOA 3H32B 3BASA 1CIHA 1ETPA 3GF3A 1X79B 2W83C 2QE7H 1LTBC 2HODA 1BE3E 2YO2A 1E8EA 2N1TD 4BRYA 4EIJA 1YFCA 1N73B 2WITA 3SWKA 5B5EE 1M90Q 1SQVE 1YITP 1NKNA 1PGJA 2E43A 4JYCA 1HUCA 4PD4H 1PL5A 1ZRTE 3MZWB 1CSXA 2P58A 3HUSC 5AVZB 4KJMA 2OTJP 1W5CT 2FKWB 3H1LD 1R5SA 1L4AD 1SQXE 1H89A 2V7QJ 1M1JB 2KSEA 1T8ZA 1C75A 1K3GA 2VRSA 1PGOA 4L73A 1KC8Q 3HQ8A 1NTZK 1LGHB 2JKVA 1VL2A 5B5EH 3AE7C 3K5BA 1H31A 1K73Q 3BCCG 1SQBD 3FXDA 3CC2P 1Q82Q 1NTKD 3JSVC 1GW4A 1PGQA 1AQ5A 3C9IA 4N6JA 1SQPE 2M3EA 1DIPA 1AKKA 1GU4A 3PH2B 2C1DB 1KTMA 1EXIA 2PP6A 4EDFA 1QL1A 3L70G 1LTIC 1PP9D 1T6AA 5AW7B 1OW6A 3CCEP 3V2QA 1IO3A 1AVOA 3G6EP 2KZIA 2WSCH 1FZEA 4H13B 2ZXXA 2YIUC 3AE2C 1I5TA 2AI5A 2OYOA 1FZCB 2ZYDA 1D7MA 1P84I 2Q3EA 2Y9ZA 2FYNC 1OFCX 3TGUE 5AW5B 1H32B 2LXCB 1YCCA 1M8OB 2QVAA 5AW6B 3M91A 5DJUB 2K37A 2A45I 2OARA 2WPQA 5AVTB 4WVZA 1CRJA 2C9XB 5KLVK 3L4OA 3R4YA 3HQ9A 5KLIC 3CCQP 2AEFA 4KHXA 1BCCJ 1PPJG 2FFDA 1C6RA 3QH9A 1IK9A 2PRRA 2ZT9B 1NU1E 2WSSH 1LWUC 2M0BA 3ZOXA 3L73G 4MN4C 1KILB 2Q9IA 3CX5D 1MV8A 1GDTA 5B66V 2FYUE 1KYOD 1FZAA 3VOPA 3EFGA 2N9YB 2FYUG 3PHLA 1DEBA 1VQLP 3I5CA 2ZBOA 1NIRA 5KAFV 1KZUB 2RMZA 4JPZB 2CA4B 1L0LE 2XKMA 3V6IA 1YJNP 1SQQE 1SQVD 1C7MA 1VQ6P 2FFDB 3AEEC 1L0LG 1U74B 2PCCB 1J1EC 1L9JC 1ZRTD 3PXTA 1F1CA 1ZN5A 3OA8B 3M0DC 2L91A 155CA 1Y47A 3W67A 3Q1MA 1CTYA 3L72J 1SQXD 2E74B 3ZOOA 3IFMA 1MZ9A 4C7NB 1N73C 1HCMA 2BLFB 3B4SA 1LFMA 4N3YB 5AVSB 3CMEP 2JWDA 2N1TA 2JDIH 5DF5A 5C39A 3HE5A 2FWLA 4PW9B 3A0HV 2JO1A 1JY2N 1SQPD 1M1JC 1JY3N 3G3ZA 1Q90D 3P8MC 1L4AA 4C7RA 3GG2A 1CORA 2POHA 3GHGA 3MP7B 1KMIZ 4Z1MH 5BVZA 3PP5A 4PD4I 1YIJP 1QL2A 1YJ9P 1OMIA 4ZKPA 3M9HA 3W68A 4IFMA 1S9KE 2H7HA 1DEEG 3H6PA 4O1WA 4WQDA 5CMZA 3O6QB 1CW5A 1CTZA 2I1KA 4HKZH 1A8CA 4XXLA 4WQEA 1AQTA 4YXDC 1COTA 1HGZA 1EDLA 3TGUD 4XFJA 3SJLA 4WQCA 5AW9B 1LJ2A 1CRIA 1GKSA 4H13C 1FJKA 1EDIA 2WSCJ 3JCUE 3H1KG 1I8PA 2KP8A 4JQ0D 1YICA 3H1HJ 3C2CA 1LTSC 2IDBA 3V4WA 5GTIV 3OA7A 1JY2O 2OYIA 1GDVA 3L75J 1JY3O 1KILE 1J3SA 4FAVA 2H43A 2E42A 2WSFJ 1EZVI 1Z56A 2V08A 3L73D 1NU1D 1M60A 1T2KC 2AEJA 2R5BA 3H1IG 4U3FJ 2O01J 2R32A 2FYUD 1Y8AA 3ZCFA 1JMMA 2E5YA 1HJ0A 3D0WA 5AW4B 2KOGA 2GUVA 4BWNA 2HPCB 2OYHB 4D6TJ 1L0LD 1SQQD 1C6SA 1KFMA 2OYIB 2XNXA 3RBXA 3ORVA 3CCUP 1LNQA 3SWYA 3N7NA 4K35A 3HUSA 1OCDA 1N50A 5AW2B 1CCHA 1FE6A 2O1JA 2BPBB 2FXOA 3SSUA 2H89C 1L2PA 1QL4A 4WBAA 3IN6A 2FFDC 2QM8A 1ZR2A 1E2RA 5CIBB 3MD0A 1NH4A 3NXSA 1GTWA 1YIQA 1NYHA 3RK3B 4TT3H 3RL0B 4DY9A 2XNDH 2E74C 3LIEA 4CPGA 1GL2A 1NTMG 2WT7B 1FCDC 2ZAEB 1MUUA 5K5GB 4H13D 3AE8C 4GODA 3VMXA 1VDFA 1HF9A 3NBTA 1GU5A 3WU2V 1H0TA 1LP1B 2EXVA 2GC4D 1H9YA 4Y5RA 1S9KD 4I6MC 3U1CA 2ZONG 4W7YA 2YKOA 3A7OA 3CLQA 1HTLC 1CSBA 1RQVA 1IFDA 1T2KD 2A45G 1GL2B 2KS1A 1FDOA 2ZOOA 1CSWA 3HTKA 4PV1B 3BVHA 2KZJA 1M70A 5APVA 1HWTC 3B71A 2RKLA 1SQBG 3CC7P 2ZT9D 1S2EA 4UB8V 3D6ZA 4EIFA 1RZ6A 1VQ8P 5GTHE 1BSHA 4DT0A 2I8FA 1GMJA 3BATA 1NVOA 1OVVA 2B0ZB 5EXQA 5KAFE 1PIXA 3HE4B 2OZ1B 1YQ4C 1FI9A 1FOCA 5AW8B 1LWUA 1KQLA 5AW1B 4WY4B 2YXRB 3AE6C 5B66H 2AIUA 2XDJA 4IOIH 4GEDB 2GIWA 2AXTE 2WPSA 2JP3A 2IFNA 4WQ9A 1I6EA 1L0NJ 1WRGA 1HZVA 2E74D 4HYTB 3MK7B 5DJTB 3VMAA 3IAOA 2I1JA 1N2DC 4FA1A 3PRJA 1IFPA 3RK3E 1N73A 1CRYA 3CXHW 3WC8A 3AEGC 4WQAA 3L72E 2OYIC 3WFCC 3KHUA 2DGEA 1N86A 3OJAB 4NPEA 1JTHB 1CRGA 3A0HH 2IYOA 2QM7A 2QG4A 1VQKP 1DW0A 1LTTC 4R4MA 1NTMD 1M1JA 1ZV8A 3B8EB 2LXBA 4LC1A 1NTZJ 4IL6V 3OCDA 2GM4A 1CIGA 1NKZB 2MKVA 4WB4A 3AE3C 3ZIYA 3L74J 1RHZB 2C0WA 1KV4A 2C8SA 2A06E 1KX2A 1C2NA 1BE3G 3SVWA 2BEZF 2C1DA 1VF5B 1FZGA 1P84D 4R4LA 1OW7A 4PJ0V 1SQVG 1QX8A 3V2NA 3MUDC 4KT0J 1H88A 1LT9A 4Y28J 1HRCA 3AEBC 1URQB 2JJLA 4LGDE 3O20A 1KQGB 1EDJA 1SQXG 3OCDB 2ZYGA 3G71P 3CWBJ 3A0BV 1FZCA 4AALA 3M06A 1QVFO 3C1LA 1KYOH 1K8AQ 4RSZA 5GTIH 3Q3DA 1EZVE 2FY8A 1K05A 2KIKA 1LTAC 1H32A 3H1HE 1GL2C 1SQPG 1MG3D 1EZVG 1WT6A 2B11B 2LIRA 2YCCA 4PV1C 3CCJP 5KLVJ 1X9VA 1FOSF 1LT9B 3A3YB 3CCMP 1WMKA 2Z4EA 2C9LY 2KB7P 1J2JB 1BDDA 4AQRD 3USSA 1NOHA 1S5LX 1N15A
chains in the Genus database with same CATH topology
1SQPD 1YTCA 3CU4A 1HH7A 2B10B 1M6ZA 2QJKB 2VHDA 1CC5A 4P4QB 4FA4A 5IY51 1KV9A 5KLIB 4MU8A 1QKSA 1DW2A 1W2LA 3GG2A 1CORA 3TF5A 1CXCA 1FI3A 2ZXYA 3DMIA 5C9MA 1CHJA 1CSVA 1E29A 1LS9A 2JQRA 3KZIV 1CHIA 3VNWA 3CWBD 5TISV 1S5LV 1QYZA 4O1WA 3WUIA 1RAQA 4WQDA 1YNRA 1CTZA 1U75B 2CE0A 1A8CA 4XXLA 5CIEB 4WQEA 3CP5A 2O3JA 1COTA 3A9FA 3TGUD 3SJLA 3L72D 4WQCA 1CNOA 4AAMA 3RMZA 2MHMA 2PCBB 3M97X 1CRIA 1VYDA 4L3HA 3OA8A 3RN0A 1GKSA 1AYGA 2Y0EA 4N0KA 1CYCA 1I8PA 4PWAA 3RLMA 1EB7A 2MTAC 1YICA 3WFBC 3HQ7A 3ZOYA 3C2CA 4PD4D 1IZL0 5GTIV 1CIEA 2N18B 1DIQC 4RJTA 1GDVA 2N9IA 3CXHD 1J3SA 1CXAA 3NWVA 4FAVA 1I54A 1BE3D 1DW3A 4H0JA 5C0ZA 3H1KD 5KKZB 4QAOA 1CRHA 2V08A 4NFGB 5H2FV 1K3HA 3L73D 1NU1D 1M60A 3PTZA 1BL9A 1H33B 5DJQB 2CA3B 4O1QA 3GW6A 3VYMA 1H9XA 4J20A 2YIUB 4YE1A 2FYUD 4AX3A 3SLEA 1YEAA 2GC7D 3ZCFA 2Y0CA 3JBTB 2CE1A 4UB6V 1CRCA 1L0LD 1DIIC 1BCCD 2FYNB 5CIDB 1C2RA 1SQQD 1C6SA 3SWSA 1JDLA 3H1ID 5CIFB 1ZZHA 3ORVA 4EIEA 5TJHA 1GQ1A 2B4ZA 1OCDA 1KIBA 1N50A 1CCHA 2BPBB 1HJ5A 2YK3A 5CIGB 1EZVD 1QL4A 1RAPA 2XTSB 5AURA 1BGYD 5B6QA 5E79V 1E2RA 1IQCA 5CIBB 3WFEC 1MZ4A 1N9CA 1HJ3A 1YIQA 2LITA 1QL3A 3SXTA 1LMSA 4DY9A 1H31B 2CXBA 1LC2A 1CO6A 3ZOWA 1FJ0A 1KYOW 1DW1A 1FCDC 4AAOA 2C1UA 4U3FD 1F1FA 2ZZS1 1L9BC 1DVVA 5KAIV 3NBTA 3WU2V 1CTJA 2D0WA 1H33A 3HQ6A 2EXVA 3MK7C 2JTIB 3CYTI 4WQBA 2B12B 4AANA 2GC4D 1H9YA 4Y5RA 5KLVD 3PXWA 2GB8B 3L71D 4D6TD 2ZONG 1I55A 1NNOA 4FA9A 1AOFA 1CIHA 1ETPA 2BCNB 2JWAA 4A7PA 1E8EA 2KS1A 1YFCA 2ZOOA 1HZUA 1CSWA 1N90A 2C2CA 2A06D 1M70A 4LJIA 2QJYB 1CSXA 351CA 4FB1A 1S6VB 3ZBMA 1W5CT 4L1QA 4UB8V 3H1LD 4EIFA 1RZ6A 5GTHV 1C75A 2I8FA 1K3GA 3ITKA 2BGVX 2B0ZB 5EXQA 1C52A 4XYDB 2OZ1B 3HQ8A 1FI9A 1H1OA 1FOCA 1HJ4A 1H31A 2FRCA 1SQBD 1CYJA 1I6DA 1NTKD 1A2SA 2BH5X 1KX7A 3PXSA 1B7VA 3X39A 2N18C 3VRDA 2AIUA 1AKKA 2K9JB 3PH2B 2C1DB 4GEDB 2GIWA 1GJQA 2AXTV 3TDKA 4EDFA 2HV4A 4WQ7A 2N3BA 3H1HD 1CCRA 4WQ9A 3WFDC 1I6EA 4WQ8A 3BCCD 2PACA 1PP9D 1HZVA 451CA 5DFSA 3FWLA 1YEBA 1HROA 1KB0A 5DJQC 3L75D 5CYTR 1IO3A 1A56A 3MK7B 3DP5A 1LC1A 1GIWA 4V2KA 2L4DA 5CICB 3VMAA 1I5TA 3CX5W 2AI5A 3L70D 4FA1A 3PRJA 1CYIA 1RZ5A 1CEDA 1CRYA 1OAEA 1QN2A 3CXHW 1NMIA 3RN1A 3WC8A 2Q3EA 4WQAA 3WFCC 3KHUA 2DGEA 4Q5PA 1H32B 4K3IA 1YCCA 2N3YA 2BH4X 2D0SA 1CRGA 2QG4A 1DW0A 1NTMD 1C6OA 1CRJA 2C9XB 3L4OA 3NBSA 4IL6V 3HQ9A 3OCDA 1CIGA 3TYIA 2OZ1A 1DT1A 1AOQA 2V07A 4JCGA 1C6RA 3DR0A 1WEJF 3ZIYA 1NMLA 4H0KA 1MG2D 2C8SA 2ORLA 3PLNA 1KX2A 4EICA 2IBZD 1C2NA 2N9JA 2C1VA 5B5EV 2BCCD 3SVWA 1L0ND 2C1DA 3ZOXA 5CIHB 1DVHA 1P84D 4PJ0V 1PPJD 3CX5D 4FA5A 3H1JD 3L4MA 2KNCB 5B66V 1KYOD 1CHHA 1HRCA 2N9YB 3PHLA 3O20A 2QJPB 2ZBOA 1NIRA 3OCDB 5KAFV 4L3GA 2RMZA 1WVEC 2CA4B 1IRWA 1GU2A 1SQVD 1C7MA 3A0BV 4AALA 1U74B 2PCCB 4GYDA 2YQBA 1L9JC 1ZRTD 1FHBA 1I8OA 4RSZA 3PXTA 1F1CA 3OA8B 1CSUA 2L91A 155CA 1CTYA 1SQXD 1R0QA 3ZOOA 1H32A 1MG3D 1NTZD 3O5CA 2B11B 1KB9D 2LIRA 1HCMA 2RN0A 2BLFB 2YCCA 1LFMA 2DVHA 3O0RC 2Y0DA 4KMGA 3O1YA 1CIFA 1FI7A 3L74D 1IRVA 5DF5A 4FANA 2FWLA 4PW9B 3A0HV 4EIDA 1N15A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQP D;  1YTC A;  3CU4 A;  1HH7 A;  2B10 B;  1M6Z A;  2QJK B;  2VHD A;  1CC5 A;  4P4Q B;  4FA4 A;  5IY5 1;  1KV9 A;  5KLI B;  4MU8 A;  1QKS A;  1DW2 A;  1W2L A;  3GG2 A;  1COR A;  3TF5 A;  1CXC A;  1FI3 A;  2ZXY A;  3DMI A;  5C9M A;  1CHJ A;  1CSV A;  1E29 A;  1LS9 A;  2JQR A;  3KZI V;  1CHI A;  3VNW A;  3CWB D;  5TIS V;  1S5L V;  1QYZ A;  4O1W A;  3WUI A;  1RAQ A;  4WQD A;  1YNR A;  1CTZ A;  1U75 B;  2CE0 A;  1A8C A;  4XXL A;  5CIE B;  4WQE A;  3CP5 A;  2O3J A;  1COT A;  3A9F A;  3TGU D;  3SJL A;  3L72 D;  4WQC A;  1CNO A;  4AAM A;  3RMZ A;  2MHM A;  2PCB B;  3M97 X;  1CRI A;  1VYD A;  4L3H A;  3OA8 A;  3RN0 A;  1GKS A;  1AYG A;  2Y0E A;  4N0K A;  1CYC A;  1I8P A;  4PWA A;  3RLM A;  1EB7 A;  2MTA C;  1YIC A;  3WFB C;  3HQ7 A;  3ZOY A;  3C2C A;  4PD4 D;  1IZL 0;  5GTI V;  1CIE A;  2N18 B;  1DIQ C;  4RJT A;  1GDV A;  2N9I A;  3CXH D;  1J3S A;  1CXA A;  3NWV A;  4FAV A;  1I54 A;  1BE3 D;  1DW3 A;  4H0J A;  5C0Z A;  3H1K D;  5KKZ B;  4QAO A;  1CRH A;  2V08 A;  4NFG B;  5H2F V;  1K3H A;  3L73 D;  1NU1 D;  1M60 A;  3PTZ A;  1BL9 A;  1H33 B;  5DJQ B;  2CA3 B;  4O1Q A;  3GW6 A;  3VYM A;  1H9X A;  4J20 A;  2YIU B;  4YE1 A;  2FYU D;  4AX3 A;  3SLE A;  1YEA A;  2GC7 D;  3ZCF A;  2Y0C A;  3JBT B;  2CE1 A;  4UB6 V;  1CRC A;  1L0L D;  1DII C;  1BCC D;  2FYN B;  5CID B;  1C2R A;  1SQQ D;  1C6S A;  3SWS A;  1JDL A;  3H1I D;  5CIF B;  1ZZH A;  3ORV A;  4EIE A;  5TJH A;  1GQ1 A;  2B4Z A;  1OCD A;  1KIB A;  1N50 A;  1CCH A;  2BPB B;  1HJ5 A;  2YK3 A;  5CIG B;  1EZV D;  1QL4 A;  1RAP A;  2XTS B;  5AUR A;  1BGY D;  5B6Q A;  5E79 V;  1E2R A;  1IQC A;  5CIB B;  3WFE C;  1MZ4 A;  1N9C A;  1HJ3 A;  1YIQ A;  2LIT A;  1QL3 A;  3SXT A;  1LMS A;  4DY9 A;  1H31 B;  2CXB A;  1LC2 A;  1CO6 A;  3ZOW A;  1FJ0 A;  1KYO W;  1DW1 A;  1FCD C;  4AAO A;  2C1U A;  4U3F D;  1F1F A;  2ZZS 1;  1L9B C;  1DVV A;  5KAI V;  3NBT A;  3WU2 V;  1CTJ A;  2D0W A;  1H33 A;  3HQ6 A;  2EXV A;  3MK7 C;  2JTI B;  3CYT I;  4WQB A;  2B12 B;  4AAN A;  2GC4 D;  1H9Y A;  4Y5R A;  5KLV D;  3PXW A;  2GB8 B;  3L71 D;  4D6T D;  2ZON G;  1I55 A;  1NNO A;  4FA9 A;  1AOF A;  1CIH A;  1ETP A;  2BCN B;  2JWA A;  4A7P A;  1E8E A;  2KS1 A;  1YFC A;  2ZOO A;  1HZU A;  1CSW A;  1N90 A;  2C2C A;  2A06 D;  1M70 A;  4LJI A;  2QJY B;  1CSX A;  351C A;  4FB1 A;  1S6V B;  3ZBM A;  1W5C T;  4L1Q A;  4UB8 V;  3H1L D;  4EIF A;  1RZ6 A;  5GTH V;  1C75 A;  2I8F A;  1K3G A;  3ITK A;  2BGV X;  2B0Z B;  5EXQ A;  1C52 A;  4XYD B;  2OZ1 B;  3HQ8 A;  1FI9 A;  1H1O A;  1FOC A;  1HJ4 A;  1H31 A;  2FRC A;  1SQB D;  1CYJ A;  1I6D A;  1NTK D;  1A2S A;  2BH5 X;  1KX7 A;  3PXS A;  1B7V A;  3X39 A;  2N18 C;  3VRD A;  2AIU A;  1AKK A;  2K9J B;  3PH2 B;  2C1D B;  4GED B;  2GIW A;  1GJQ A;  2AXT V;  3TDK A;  4EDF A;  2HV4 A;  4WQ7 A;  2N3B A;  3H1H D;  1CCR A;  4WQ9 A;  3WFD C;  1I6E A;  4WQ8 A;  3BCC D;  2PAC A;  1PP9 D;  1HZV A;  451C A;  5DFS A;  3FWL A;  1YEB A;  1HRO A;  1KB0 A;  5DJQ C;  3L75 D;  5CYT R;  1IO3 A;  1A56 A;  3MK7 B;  3DP5 A;  1LC1 A;  1GIW A;  4V2K A;  2L4D A;  5CIC B;  3VMA A;  1I5T A;  3CX5 W;  2AI5 A;  3L70 D;  4FA1 A;  3PRJ A;  1CYI A;  1RZ5 A;  1CED A;  1CRY A;  1OAE A;  1QN2 A;  3CXH W;  1NMI A;  3RN1 A;  3WC8 A;  2Q3E A;  4WQA A;  3WFC C;  3KHU A;  2DGE A;  4Q5P A;  1H32 B;  4K3I A;  1YCC A;  2N3Y A;  2BH4 X;  2D0S A;  1CRG A;  2QG4 A;  1DW0 A;  1NTM D;  1C6O A;  1CRJ A;  2C9X B;  3L4O A;  3NBS A;  4IL6 V;  3HQ9 A;  3OCD A;  1CIG A;  3TYI A;  2OZ1 A;  1DT1 A;  1AOQ A;  2V07 A;  4JCG A;  1C6R A;  3DR0 A;  1WEJ F;  3ZIY A;  1NML A;  4H0K A;  1MG2 D;  2C8S A;  2ORL A;  3PLN A;  1KX2 A;  4EIC A;  2IBZ D;  1C2N A;  2N9J A;  2C1V A;  5B5E V;  2BCC D;  3SVW A;  1L0N D;  2C1D A;  3ZOX A;  5CIH B;  1DVH A;  1P84 D;  4PJ0 V;  1PPJ D;  3CX5 D;  4FA5 A;  3H1J D;  3L4M A;  2KNC B;  5B66 V;  1KYO D;  1CHH A;  1HRC A;  2N9Y B;  3PHL A;  3O20 A;  2QJP B;  2ZBO A;  1NIR A;  3OCD B;  5KAF V;  4L3G A;  2RMZ A;  1WVE C;  2CA4 B;  1IRW A;  1GU2 A;  1SQV D;  1C7M A;  3A0B V;  4AAL A;  1U74 B;  2PCC B;  4GYD A;  2YQB A;  1L9J C;  1ZRT D;  1FHB A;  1I8O A;  4RSZ A;  3PXT A;  1F1C A;  3OA8 B;  1CSU A;  2L91 A;  155C A;  1CTY A;  1SQX D;  1R0Q A;  3ZOO A;  1H32 A;  1MG3 D;  1NTZ D;  3O5C A;  2B11 B;  1KB9 D;  2LIR A;  1HCM A;  2RN0 A;  2BLF B;  2YCC A;  1LFM A;  2DVH A;  3O0R C;  2Y0D A;  4KMG A;  3O1Y A;  1CIF A;  1FI7 A;  3L74 D;  1IRV A;  5DF5 A;  4FAN A;  2FWL A;  4PW9 B;  3A0H V;  4EID A;  1N15 A; 
#chains in the Genus database with same CATH topology
 1HH7 A;  5CCH C;  4IL6 X;  3S1K A;  4OWF A;  3KPE A;  2QJK B;  3L35 A;  2VHD A;  4P4Q B;  5IY5 1;  1KV9 A;  1RE4 C;  4U3F E;  4I7Z B;  1QKS A;  4NPF X;  4U3F G;  3TF5 A;  1CXC A;  2O01 N;  3TYY A;  2DW3 A;  4WY4 C;  1ZXG A;  1KIL A;  5C9M A;  3TNU A;  3H1L J;  1MFZ A;  2WSF H;  3TGU G;  1E29 A;  4D6T E;  3KZI V;  5AW3 B;  5TIS V;  3WUI A;  1YJW P;  2HFE D;  2HG5 D;  5EFW B;  3RL0 g;  2O01 H;  2K3R A;  3B5N B;  3RL0 D;  2O3J A;  1XTC C;  3VN0 A;  3L72 D;  2W6J H;  4AAM A;  2IBZ E;  3RMZ A;  3M97 X;  3L36 A;  4L3H A;  3OA8 A;  4N78 E;  3WFB C;  3HQ7 A;  3ZOY A;  1NU1 G;  4EYY Q;  1AJY A;  4C7N A;  1PP9 J;  3TNU B;  4PD4 D;  1T3J A;  1M56 D;  1YTZ I;  1CIE A;  2N18 B;  1NGM B;  4B86 A;  2N9I A;  2PFX A;  2HLO A;  1JUN A;  1W2E A;  3WU2 H;  3NWV A;  2ZFC A;  3FXE A;  1BE3 D;  1DW3 A;  5C0Z A;  4GKG A;  4QAO A;  1ZW0 A;  3AED C;  5H2F V;  2IYP A;  2J58 A;  3VMY A;  3M0A A;  4IFF A;  1N7L A;  3PTZ A;  1IFN A;  1MFT A;  5DJQ B;  1GL2 D;  1SQQ G;  1SQB K;  2CA3 B;  4UB8 E;  1RF1 B;  2B89 A;  1NTK K;  4PV1 D;  3AEF C;  2YNY A;  4AX3 A;  4YE1 A;  1KB9 E;  4M3L A;  2CE1 A;  1QGK B;  3C8V A;  1DII C;  1VF5 C;  1C2R A;  3CCL P;  1JDL A;  5CIF B;  2OTK E;  5CCH D;  1ZR4 A;  3VTP C;  4UB8 H;  3O6Q A;  3M9B A;  1JO5 A;  2D2C B;  1URQ C;  1SVF A;  4GIF A;  1KB9 H;  1EZV D;  1EC5 A;  4WY4 D;  1ZP0 C;  5CCG C;  1HBW A;  1U7M A;  5AUR A;  1S72 P;  1IFM A;  4JYB A;  3FGA D;  2WZ7 A;  1MZ4 A;  2CK3 H;  1N9C A;  1FAV A;  1GK6 A;  5APQ A;  1OXZ A;  1LC2 A;  3ZOW A;  2NRG A;  1KYO W;  2IZ1 A;  2XV5 A;  4BXL A;  1JCD A;  3HD7 B;  4U3F D;  1LT9 C;  3E7K A;  3R2P A;  2AXC A;  1DVV A;  5KAI V;  5AVY B;  1SP4 A;  4YPC A;  1JOC A;  2Q3I A;  2BCC E;  1L0N E;  4WQB A;  2B12 B;  2E76 B;  1TU3 F;  3PXW A;  2BCC G;  1L0N G;  4D6T D;  2QJK C;  1FZC C;  3MIW A;  2ZJS E;  2QA4 P;  4FA9 A;  2YMY A;  3BCC J;  1AOF A;  3AEC C;  5L8R J;  2BCN B;  1VQ5 P;  2HPC A;  3EQ2 A;  4A7P A;  2OYH A;  3AE9 C;  3V4Q A;  3L4F A;  3E1I A;  3TSI A;  2QEX P;  3EFF K;  1S1C X;  1JEK A;  1HZU A;  2GA1 A;  2C2C A;  1VQ4 P;  3NMD A;  1BSN A;  1S5L H;  4O9B A;  4YXW H;  3L70 J;  4IFD K;  4PJ0 E;  4IL6 H;  4LJI A;  1SQV K;  5AVV B;  4N78 D;  351C A;  1IO4 A;  4FB1 A;  1EQ7 A;  4L1Q A;  3B5N C;  1IFJ A;  3WUU A;  1USE A;  3CXH H;  1Y9B A;  4H44 B;  1IJD B;  2P7J A;  1NTZ E;  1VF5 D;  1BDC A;  2G3A A;  1C52 A;  1SQX K;  2ZT9 C;  4Y99 B;  1H1O A;  1R5L A;  2P67 A;  3D71 A;  1URQ D;  2C9N Y;  1OX3 A;  3L74 E;  4RO0 A;  4PJ0 H;  2KLV A;  1CYJ A;  3WMM 0;  2WT7 A;  1I6D A;  1KIL C;  2BH5 X;  5CCG D;  5KJ7 A;  3MUD A;  3X39 A;  1J1D B;  2N18 C;  2K9J B;  2Q7C A;  2BEQ D;  1GZL A;  4AUW A;  1SQP K;  1DX7 A;  2L5G B;  1LP1 A;  1PFI A;  4HB1 A;  1DH3 A;  4WQ7 A;  4DOJ A;  3SFD C;  2N3B A;  4JF7 A;  4DCK A;  3A0B H;  5DFS A;  2Z5H A;  1CI6 B;  1T3U A;  1JMB A;  1KB0 A;  1LT1 A;  5DJQ C;  1RF1 C;  3H1J J;  1A56 A;  2QRX A;  3DP5 A;  5AVX B;  3GF7 A;  3CWB E;  5CIC B;  2IZ0 A;  3CC4 P;  2IBZ I;  3CWB G;  4HH2 A;  1CYI A;  4UB6 H;  1OAE A;  1QN2 A;  3L73 J;  1NMI A;  1H8A A;  1QLE D;  3RBZ A;  3SFE C;  4Q5P A;  2R5D A;  4K3I A;  3P8C E;  2N3Y A;  2KI7 B;  5KLV E;  2FYU J;  1LTG C;  2M5A B;  5CBN A;  1C6O A;  5CCH A;  1VQP P;  2FXM A;  3HE4 A;  1RE4 A;  2OZ1 A;  1L0L J;  5E79 H;  1X8Y A;  2KXP B;  4ZNC A;  4JCG A;  3NFQ A;  3DR0 A;  3CD6 P;  5AVQ B;  1A02 J;  4WY4 A;  1SLQ A;  2ORL A;  3PLN A;  4EIC A;  2Q1K A;  1Q7Y Q;  2C1V A;  3KZI H;  2BCC D;  3B5N D;  1L0N D;  1KB9 I;  5TIS H;  4L75 A;  1DVH A;  2UWJ E;  2IPP A;  1NU1 K;  3H1L E;  4ASV A;  3QWO C;  4WWI A;  3L4M A;  1FDM A;  2H8P D;  5B66 E;  3AE4 C;  4I1L A;  5APU A;  1R8E A;  2FYU K;  2K1A A;  4ZKU A;  2QJP B;  1W5C E;  1KIL D;  2M8R A;  4L3G A;  3GMA A;  1WVE C;  2FYZ A;  2JR8 A;  2E76 C;  1BCC E;  1GU2 A;  3T97 B;  1BCC G;  2IFM A;  1L0L K;  4GYD A;  1JB0 J;  1SQQ K;  1M1K Q;  1FHB A;  1I8O A;  2A45 H;  1YHQ P;  4ASW A;  2FXP A;  1FU1 A;  2B87 B;  1IK7 A;  1NTZ D;  1JTH A;  2ITA A;  1XTG B;  2RN0 A;  4HJG H;  4RES B;  3O0R C;  2Y0D A;  4KMG A;  5H2F H;  3O1Y A;  3KYQ A;  1LTJ B;  3CI9 A;  2NZ2 A;  1K9M Q;  3JC2 2;  3L74 D;  2P10 A;  4FAN A;  4GDO A;  1USD A;  4EID A;  3A0H E;  3RK2 B;  2CPB A;  1YTC A;  4H44 C;  3CU4 A;  2B10 B;  3UIA A;  4FA4 A;  1CC5 A;  2ZVO B;  2KK7 A;  5KLI B;  4OGQ B;  3H1K J;  4Y99 C;  3FWN A;  1HVV A;  2D2C D;  1FS0 E;  1DW2 A;  1IFI A;  2HYN A;  2OYH C;  1A02 F;  3DMI A;  1EDK A;  1CHJ A;  3L72 G;  1J1D C;  1M57 D;  5BU8 B;  3CXH I;  2LR2 A;  1LS9 A;  4NPD A;  1URQ A;  1EXJ A;  3VNW A;  2WTY A;  3CWB D;  1SFC A;  1S5L V;  1QYZ A;  5CCG A;  1YNR A;  2CE0 A;  1CZQ A;  5CIE B;  2YXQ B;  3H1I J;  2PCB B;  3Q5P A;  1YQ3 C;  3PJS K;  1VYD A;  3P8C D;  5BU5 A;  1FBM A;  3RK3 C;  3RN0 A;  4I2L C;  3G4S P;  3RL0 C;  2A06 G;  4N0K A;  4XE5 B;  4PWA A;  3RLM A;  2Q5U A;  1EB7 A;  1N7S B;  1KYO E;  2WMM A;  5KJ7 C;  1IZL 0;  1GW3 A;  1BGY J;  5GTI E;  2E76 D;  3U59 A;  1OWA A;  5KAI H;  1AVY A;  1CXA A;  1SFC B;  2WPV B;  1KN7 A;  2P1J A;  2FBW C;  4QMA A;  1I54 A;  4H0J A;  1RE3 C;  4U7J A;  5KKZ B;  1IZN B;  4RKU J;  1CRH A;  1QEX A;  3CX5 H;  1BL9 A;  1H33 B;  3F89 A;  4XA4 A;  2PGD A;  2YO3 A;  4O1Q A;  3GW6 A;  1H9X A;  1RF0 A;  4J20 A;  2WSE J;  1NHL A;  1Q81 Q;  3SLE A;  1YTZ T;  1YEA A;  1PZQ A;  1VQO P;  2W90 A;  5CBO A;  2Y0C A;  2HR3 A;  3BCC E;  3JBT B;  2YKP A;  2XU6 A;  1NTM J;  4UB6 V;  2KSJ A;  3H1H G;  1CRC A;  3L71 J;  1BCC D;  2HOD B;  4H44 D;  3L75 E;  3SWS A;  3Q2Y A;  1GQ1 A;  1UIX A;  4BRY B;  3L75 G;  5M1B A;  2B4Z A;  1K04 A;  3B5N A;  4H0L B;  3L70 E;  1HJ5 A;  5CIG B;  2QJP C;  2J5U A;  3WUT A;  2I8D A;  1KFN A;  4EI2 A;  5B6Q A;  5E79 V;  3GLM A;  1IQC A;  4ZMD A;  2CPS A;  1NAY A;  3VYI A;  3RGU A;  2LIT A;  2Y9Y A;  1YBK A;  4OH8 B;  1LMS A;  1H31 B;  2CXB A;  1CO6 A;  3D6Y A;  1NTM K;  4C46 A;  1DW1 A;  4D6T G;  3F5H A;  2ZYA A;  1JM0 A;  1OVU A;  3V2R A;  1NAF A;  3RK3 D;  1LTJ C;  5CJ4 A;  1SQB J;  1L9B C;  3Q5R A;  2KYV A;  1NTK J;  2Q6Q A;  2W6A A;  1CTJ A;  3WU2 E;  2D0W A;  3I56 P;  3HQ6 A;  3I55 P;  3ABV C;  1S3J A;  1KQF B;  1RF1 A;  3MK7 C;  3RK2 C;  1U7J A;  4AAN A;  5KJ7 D;  4GOF A;  1PGP A;  2IBZ G;  2LKM A;  1QVG O;  2GB8 B;  1PPJ E;  3H1J E;  4OGQ C;  2ZVN B;  4JBZ A;  3AE5 C;  2M3B A;  3LW5 H;  1DD3 A;  1FZB A;  2JWA A;  3H1J G;  5AVW B;  5APX A;  3IR9 A;  3L73 E;  1N90 A;  2A06 D;  2KLU A;  3LID A;  2N9B A;  2QJY B;  1VQ7 P;  1S6V B;  3ZBM A;  2E75 B;  1KD1 Q;  5GTH V;  3ITK A;  2BGV X;  2V4H A;  1FJP A;  1VQM P;  4XYD B;  1IC2 A;  2R44 A;  3II6 A;  2NPS A;  5APS A;  1HGV A;  1HJ4 A;  3MGN A;  2FRC A;  1YI2 P;  5CJ0 A;  1KOR A;  1N7S C;  1G1J A;  2WPR A;  2QSI A;  1A2S A;  1KX7 A;  3PXS A;  2JEE A;  4L74 A;  1X22 A;  3HD7 A;  1B7V A;  1NJI Q;  3VRD A;  2J59 M;  1SFC C;  2C0X A;  1GJQ A;  2AXT V;  3TDK A;  3BRV B;  1NWQ A;  2HV4 A;  1VPC A;  4K3A A;  3WFD C;  3H1H D;  1CCR A;  5KKZ C;  4WQ8 A;  3BCC D;  2PAC A;  4TLF A;  451C A;  2KUB A;  3FWL A;  3HRN A;  1YEB A;  2ZXE B;  3VP8 A;  1HRO A;  2MJZ A;  1JCC A;  3L75 D;  5CYT R;  5APW A;  3P32 A;  1LC1 A;  4V2K A;  3AEA C;  3MTU E;  2L4D A;  2NPS B;  3U1A A;  2GUS A;  1HH0 A;  3CX5 W;  1BE3 J;  3L70 D;  1RZ5 A;  1CED A;  1OIP A;  5AVR B;  3RK2 D;  3RN1 A;  1SQV J;  2Z5I A;  1AV1 A;  3CX5 I;  3A5T A;  1RH5 B;  1E5W A;  3V5B A;  3CCR P;  1Q86 Q;  1KYO I;  2BH4 X;  2D0S A;  2QIW A;  2KNC A;  4OGQ D;  2P2U A;  5KTB A;  1DD4 A;  1Q2N A;  3O8Z A;  4H0L C;  1SQX J;  1S5L E;  1U57 A;  3NBS A;  2XZR A;  4IL6 E;  2N1T B;  3TYI A;  3HE5 B;  5APY A;  3H25 A;  4I7Z C;  1DT1 A;  1AOQ A;  2V07 A;  1RF0 C;  1FC2 C;  3CXH E;  1SS1 A;  1WEJ F;  1AA0 A;  1ZME C;  1NML A;  4H0K A;  4DJG A;  1MG2 D;  3H1K E;  2IBZ D;  3S4R A;  1SQP J;  1ZLL A;  2N9J A;  5B5E V;  1L4A B;  4GT1 A;  3V2P A;  1N8R Q;  1FOS E;  2K9J A;  3GHG B;  2BAS A;  5CIH B;  5AVU B;  1PPJ D;  4FA5 A;  3H1J D;  3VMZ A;  2KNC B;  1CHH A;  1CI6 A;  1NO4 A;  1N7S D;  1S4X A;  1NTZ G;  3JCU H;  1IRW A;  3H1I E;  3A0B E;  3CCV P;  3CMA P;  3L37 A;  1YYC A;  1SFC D;  3G9R A;  2YQB A;  3L74 G;  1CSU A;  3LW5 J;  1OZH A;  1FZF A;  3TGU J;  1R0Q A;  3IF4 A;  3OW2 O;  2R3S A;  3O5C A;  1KB9 D;  1MKM A;  1BGY E;  4UB6 E;  2DVH A;  1VQN P;  1RE3 A;  2M5A A;  1BGY G;  5APT A;  1RQU A;  3EWK A;  2QJY C;  3CL3 D;  1CIF A;  1FI7 A;  1IRV A;  1G1I A;  2E75 C;  1GIW A;  3OAK A;  2YKQ A;  1M6Z A;  5AW0 B;  3PH0 A;  4MU8 A;  4LLH A;  4L76 A;  5E79 E;  1W2L A;  1NU1 J;  2K9Y A;  1UII A;  4H0L D;  1FI3 A;  2ZXY A;  1OVR A;  3WUV A;  1CSV A;  1NTM E;  2D2C C;  1ZOY C;  3L71 E;  2JQR A;  3KZI E;  1CHI A;  1AFO A;  2OGU A;  5TIS E;  5KLV G;  3L71 G;  1RAQ A;  3HUS B;  3AE1 C;  5CHX A;  1U75 B;  2V7Q H;  3T97 A;  1SQQ J;  2WSE H;  3CP5 A;  3A9F A;  3ZDM A;  3FX0 A;  2G8Y A;  2W8Z A;  1CNO A;  2MHM A;  1HJB A;  1G2C A;  1JNM A;  3D70 A;  1AYG A;  1P84 E;  2NPS C;  2Y0E A;  3N4X A;  1CYC A;  1KQS O;  2MTA C;  2B87 A;  1W2B O;  3HD7 C;  1VQ9 P;  3H1L G;  1DIQ C;  1LTJ A;  4RJT A;  3CXH D;  1GD2 E;  3H1K D;  4NFG B;  1P84 H;  1SQB E;  5H2F E;  1K3H A;  1JY2 P;  1JY3 P;  1NTK E;  2N1T C;  3P7K A;  1PV3 A;  1H0T B;  1NTK G;  1FDI A;  1G2C B;  3CCS P;  3VYM A;  2YIU B;  3A2A A;  2K88 A;  2GC7 D;  1PP9 E;  1E79 H;  1L4A C;  2B88 A;  3KQG A;  2E75 D;  3GHG C;  2FYN B;  1PP9 G;  5CID B;  3H1I D;  2H88 C;  3SWF A;  1ZZH A;  4EOT A;  4EIE A;  5TJH A;  2KS1 B;  3KDP B;  3HTK B;  1KIB A;  2R3C A;  5GTH H;  2YK3 A;  5KAF H;  1RAP A;  2XTS B;  2B9B A;  2BCC J;  2IX7 C;  4AYC A;  3CPW O;  1BGY D;  3E1R A;  2WWW A;  2W27 A;  3WFE C;  3H32 A;  1N7S A;  2AEM A;  3NTN A;  1HJ3 A;  2RH0 A;  3KXD A;  4W80 A;  2O1K A;  1QL3 A;  3M0D A;  3SXT A;  1LWU B;  4GOE A;  4DZO A;  2WVR A;  2AXT H;  2OQQ A;  3Q5S A;  1FJ0 A;  2WQY C;  4AAO A;  3M9Q A;  4W7Z A;  2C1U A;  1GK4 A;  2OTL P;  2E5T A;  1F1F A;  2ZZS 1;  2NPS D;  5KAI E;  2W6B A;  1H33 A;  1X0T A;  1M7L A;  2JTI B;  3CYT I;  3VP9 A;  2YMK A;  3HD7 D;  3BRT B;  1RY3 A;  4OVN F;  5KLV D;  2SPZ A;  3L71 D;  1OW8 A;  2PAJ A;  3MHV A;  1I55 A;  1L0N K;  3CX5 E;  4PD4 E;  3S9O A;  4YTP C;  3TK1 A;  1J1E B;  1NNO A;  3H32 B;  3BAS A;  1CIH A;  1ETP A;  3GF3 A;  1X79 B;  2W83 C;  2QE7 H;  1LTB C;  2HOD A;  1BE3 E;  2YO2 A;  1E8E A;  2N1T D;  4BRY A;  4EIJ A;  1YFC A;  1N73 B;  2WIT A;  3SWK A;  5B5E E;  1M90 Q;  1SQV E;  1YIT P;  1NKN A;  1PGJ A;  2E43 A;  4JYC A;  1HUC A;  4PD4 H;  1PL5 A;  1ZRT E;  3MZW B;  1CSX A;  2P58 A;  3HUS C;  5AVZ B;  4KJM A;  2OTJ P;  1W5C T;  2FKW B;  3H1L D;  1R5S A;  1L4A D;  1SQX E;  1H89 A;  2V7Q J;  1M1J B;  2KSE A;  1T8Z A;  1C75 A;  1K3G A;  2VRS A;  1PGO A;  4L73 A;  1KC8 Q;  3HQ8 A;  1NTZ K;  1LGH B;  2JKV A;  1VL2 A;  5B5E H;  3AE7 C;  3K5B A;  1H31 A;  1K73 Q;  3BCC G;  1SQB D;  3FXD A;  3CC2 P;  1Q82 Q;  1NTK D;  3JSV C;  1GW4 A;  1PGQ A;  1AQ5 A;  3C9I A;  4N6J A;  1SQP E;  2M3E A;  1DIP A;  1AKK A;  1GU4 A;  3PH2 B;  2C1D B;  1KTM A;  1EXI A;  2PP6 A;  4EDF A;  1QL1 A;  3L70 G;  1LTI C;  1PP9 D;  1T6A A;  5AW7 B;  1OW6 A;  3CCE P;  3V2Q A;  1IO3 A;  1AVO A;  3G6E P;  2KZI A;  2WSC H;  1FZE A;  4H13 B;  2ZXX A;  2YIU C;  3AE2 C;  1I5T A;  2AI5 A;  2OYO A;  1FZC B;  2ZYD A;  1D7M A;  1P84 I;  2Q3E A;  2Y9Z A;  2FYN C;  1OFC X;  3TGU E;  5AW5 B;  1H32 B;  2LXC B;  1YCC A;  1M8O B;  2QVA A;  5AW6 B;  3M91 A;  5DJU B;  2K37 A;  2A45 I;  2OAR A;  2WPQ A;  5AVT B;  4WVZ A;  1CRJ A;  2C9X B;  5KLV K;  3L4O A;  3R4Y A;  3HQ9 A;  5KLI C;  3CCQ P;  2AEF A;  4KHX A;  1BCC J;  1PPJ G;  2FFD A;  1C6R A;  3QH9 A;  1IK9 A;  2PRR A;  2ZT9 B;  1NU1 E;  2WSS H;  1LWU C;  2M0B A;  3ZOX A;  3L73 G;  4MN4 C;  1KIL B;  2Q9I A;  3CX5 D;  1MV8 A;  1GDT A;  5B66 V;  2FYU E;  1KYO D;  1FZA A;  3VOP A;  3EFG A;  2N9Y B;  2FYU G;  3PHL A;  1DEB A;  1VQL P;  3I5C A;  2ZBO A;  1NIR A;  5KAF V;  1KZU B;  2RMZ A;  4JPZ B;  2CA4 B;  1L0L E;  2XKM A;  3V6I A;  1YJN P;  1SQQ E;  1SQV D;  1C7M A;  1VQ6 P;  2FFD B;  3AEE C;  1L0L G;  1U74 B;  2PCC B;  1J1E C;  1L9J C;  1ZRT D;  3PXT A;  1F1C A;  1ZN5 A;  3OA8 B;  3M0D C;  2L91 A;  155C A;  1Y47 A;  3W67 A;  3Q1M A;  1CTY A;  3L72 J;  1SQX D;  2E74 B;  3ZOO A;  3IFM A;  1MZ9 A;  4C7N B;  1N73 C;  1HCM A;  2BLF B;  3B4S A;  1LFM A;  4N3Y B;  5AVS B;  3CME P;  2JWD A;  2N1T A;  2JDI H;  5DF5 A;  5C39 A;  3HE5 A;  2FWL A;  4PW9 B;  3A0H V;  2JO1 A;  1JY2 N;  1SQP D;  1M1J C;  1JY3 N;  3G3Z A;  1Q90 D;  3P8M C;  1L4A A;  4C7R A;  3GG2 A;  1COR A;  2POH A;  3GHG A;  3MP7 B;  1KMI Z;  4Z1M H;  5BVZ A;  3PP5 A;  4PD4 I;  1YIJ P;  1QL2 A;  1YJ9 P;  1OMI A;  4ZKP A;  3M9H A;  3W68 A;  4IFM A;  1S9K E;  2H7H A;  1DEE G;  3H6P A;  4O1W A;  4WQD A;  5CMZ A;  3O6Q B;  1CW5 A;  1CTZ A;  2I1K A;  4HKZ H;  1A8C A;  4XXL A;  4WQE A;  1AQT A;  4YXD C;  1COT A;  1HGZ A;  1EDL A;  3TGU D;  4XFJ A;  3SJL A;  4WQC A;  5AW9 B;  1LJ2 A;  1CRI A;  1GKS A;  4H13 C;  1FJK A;  1EDI A;  2WSC J;  3JCU E;  3H1K G;  1I8P A;  2KP8 A;  4JQ0 D;  1YIC A;  3H1H J;  3C2C A;  1LTS C;  2IDB A;  3V4W A;  5GTI V;  3OA7 A;  1JY2 O;  2OYI A;  1GDV A;  3L75 J;  1JY3 O;  1KIL E;  1J3S A;  4FAV A;  2H43 A;  2E42 A;  2WSF J;  1EZV I;  1Z56 A;  2V08 A;  3L73 D;  1NU1 D;  1M60 A;  1T2K C;  2AEJ A;  2R5B A;  3H1I G;  4U3F J;  2O01 J;  2R32 A;  2FYU D;  1Y8A A;  3ZCF A;  1JMM A;  2E5Y A;  1HJ0 A;  3D0W A;  5AW4 B;  2KOG A;  2GUV A;  4BWN A;  2HPC B;  2OYH B;  4D6T J;  1L0L D;  1SQQ D;  1C6S A;  1KFM A;  2OYI B;  2XNX A;  3RBX A;  3ORV A;  3CCU P;  1LNQ A;  3SWY A;  3N7N A;  4K35 A;  3HUS A;  1OCD A;  1N50 A;  5AW2 B;  1CCH A;  1FE6 A;  2O1J A;  2BPB B;  2FXO A;  3SSU A;  2H89 C;  1L2P A;  1QL4 A;  4WBA A;  3IN6 A;  2FFD C;  2QM8 A;  1ZR2 A;  1E2R A;  5CIB B;  3MD0 A;  1NH4 A;  3NXS A;  1GTW A;  1YIQ A;  1NYH A;  3RK3 B;  4TT3 H;  3RL0 B;  4DY9 A;  2XND H;  2E74 C;  3LIE A;  4CPG A;  1GL2 A;  1NTM G;  2WT7 B;  1FCD C;  2ZAE B;  1MUU A;  5K5G B;  4H13 D;  3AE8 C;  4GOD A;  3VMX A;  1VDF A;  1HF9 A;  3NBT A;  1GU5 A;  3WU2 V;  1H0T A;  1LP1 B;  2EXV A;  2GC4 D;  1H9Y A;  4Y5R A;  1S9K D;  4I6M C;  3U1C A;  2ZON G;  4W7Y A;  2YKO A;  3A7O A;  3CLQ A;  1HTL C;  1CSB A;  1RQV A;  1IFD A;  1T2K D;  2A45 G;  1GL2 B;  2KS1 A;  1FDO A;  2ZOO A;  1CSW A;  3HTK A;  4PV1 B;  3BVH A;  2KZJ A;  1M70 A;  5APV A;  1HWT C;  3B71 A;  2RKL A;  1SQB G;  3CC7 P;  2ZT9 D;  1S2E A;  4UB8 V;  3D6Z A;  4EIF A;  1RZ6 A;  1VQ8 P;  5GTH E;  1BSH A;  4DT0 A;  2I8F A;  1GMJ A;  3BAT A;  1NVO A;  1OVV A;  2B0Z B;  5EXQ A;  5KAF E;  1PIX A;  3HE4 B;  2OZ1 B;  1YQ4 C;  1FI9 A;  1FOC A;  5AW8 B;  1LWU A;  1KQL A;  5AW1 B;  4WY4 B;  2YXR B;  3AE6 C;  5B66 H;  2AIU A;  2XDJ A;  4IOI H;  4GED B;  2GIW A;  2AXT E;  2WPS A;  2JP3 A;  2IFN A;  4WQ9 A;  1I6E A;  1L0N J;  1WRG A;  1HZV A;  2E74 D;  4HYT B;  3MK7 B;  5DJT B;  3VMA A;  3IAO A;  2I1J A;  1N2D C;  4FA1 A;  3PRJ A;  1IFP A;  3RK3 E;  1N73 A;  1CRY A;  3CXH W;  3WC8 A;  3AEG C;  4WQA A;  3L72 E;  2OYI C;  3WFC C;  3KHU A;  2DGE A;  1N86 A;  3OJA B;  4NPE A;  1JTH B;  1CRG A;  3A0H H;  2IYO A;  2QM7 A;  2QG4 A;  1VQK P;  1DW0 A;  1LTT C;  4R4M A;  1NTM D;  1M1J A;  1ZV8 A;  3B8E B;  2LXB A;  4LC1 A;  1NTZ J;  4IL6 V;  3OCD A;  2GM4 A;  1CIG A;  1NKZ B;  2MKV A;  4WB4 A;  3AE3 C;  3ZIY A;  3L74 J;  1RHZ B;  2C0W A;  1KV4 A;  2C8S A;  2A06 E;  1KX2 A;  1C2N A;  1BE3 G;  3SVW A;  2BEZ F;  2C1D A;  1VF5 B;  1FZG A;  1P84 D;  4R4L A;  1OW7 A;  4PJ0 V;  1SQV G;  1QX8 A;  3V2N A;  3MUD C;  4KT0 J;  1H88 A;  1LT9 A;  4Y28 J;  1HRC A;  3AEB C;  1URQ B;  2JJL A;  4LGD E;  3O20 A;  1KQG B;  1EDJ A;  1SQX G;  3OCD B;  2ZYG A;  3G71 P;  3CWB J;  3A0B V;  1FZC A;  4AAL A;  3M06 A;  1QVF O;  3C1L A;  1KYO H;  1K8A Q;  4RSZ A;  5GTI H;  3Q3D A;  1EZV E;  2FY8 A;  1K05 A;  2KIK A;  1LTA C;  1H32 A;  3H1H E;  1GL2 C;  1SQP G;  1MG3 D;  1EZV G;  1WT6 A;  2B11 B;  2LIR A;  2YCC A;  4PV1 C;  3CCJ P;  5KLV J;  1X9V A;  1FOS F;  1LT9 B;  3A3Y B;  3CCM P;  1WMK A;  2Z4E A;  2C9L Y;  2KB7 P;  1J2J B;  1BDD A;  4AQR D;  3USS A;  1NOH A;  1S5L X;  1N15 A; 
#chains in the Genus database with same CATH homology
 1SQP D;  1YTC A;  3CU4 A;  1HH7 A;  2B10 B;  1M6Z A;  2QJK B;  2VHD A;  1CC5 A;  4P4Q B;  4FA4 A;  5IY5 1;  1KV9 A;  5KLI B;  4MU8 A;  1QKS A;  1DW2 A;  1W2L A;  3GG2 A;  1COR A;  3TF5 A;  1CXC A;  1FI3 A;  2ZXY A;  3DMI A;  5C9M A;  1CHJ A;  1CSV A;  1E29 A;  1LS9 A;  2JQR A;  3KZI V;  1CHI A;  3VNW A;  3CWB D;  5TIS V;  1S5L V;  1QYZ A;  4O1W A;  3WUI A;  1RAQ A;  4WQD A;  1YNR A;  1CTZ A;  1U75 B;  2CE0 A;  1A8C A;  4XXL A;  5CIE B;  4WQE A;  3CP5 A;  2O3J A;  1COT A;  3A9F A;  3TGU D;  3SJL A;  3L72 D;  4WQC A;  1CNO A;  4AAM A;  3RMZ A;  2MHM A;  2PCB B;  3M97 X;  1CRI A;  1VYD A;  4L3H A;  3OA8 A;  3RN0 A;  1GKS A;  1AYG A;  2Y0E A;  4N0K A;  1CYC A;  1I8P A;  4PWA A;  3RLM A;  1EB7 A;  2MTA C;  1YIC A;  3WFB C;  3HQ7 A;  3ZOY A;  3C2C A;  4PD4 D;  1IZL 0;  5GTI V;  1CIE A;  2N18 B;  1DIQ C;  4RJT A;  1GDV A;  2N9I A;  3CXH D;  1J3S A;  1CXA A;  3NWV A;  4FAV A;  1I54 A;  1BE3 D;  1DW3 A;  4H0J A;  5C0Z A;  3H1K D;  5KKZ B;  4QAO A;  1CRH A;  2V08 A;  4NFG B;  5H2F V;  1K3H A;  3L73 D;  1NU1 D;  1M60 A;  3PTZ A;  1BL9 A;  1H33 B;  5DJQ B;  2CA3 B;  4O1Q A;  3GW6 A;  3VYM A;  1H9X A;  4J20 A;  2YIU B;  4YE1 A;  2FYU D;  4AX3 A;  3SLE A;  1YEA A;  2GC7 D;  3ZCF A;  2Y0C A;  3JBT B;  2CE1 A;  4UB6 V;  1CRC A;  1L0L D;  1DII C;  1BCC D;  2FYN B;  5CID B;  1C2R A;  1SQQ D;  1C6S A;  3SWS A;  1JDL A;  3H1I D;  5CIF B;  1ZZH A;  3ORV A;  4EIE A;  5TJH A;  1GQ1 A;  2B4Z A;  1OCD A;  1KIB A;  1N50 A;  1CCH A;  2BPB B;  1HJ5 A;  2YK3 A;  5CIG B;  1EZV D;  1QL4 A;  1RAP A;  2XTS B;  5AUR A;  1BGY D;  5B6Q A;  5E79 V;  1E2R A;  1IQC A;  5CIB B;  3WFE C;  1MZ4 A;  1N9C A;  1HJ3 A;  1YIQ A;  2LIT A;  1QL3 A;  3SXT A;  1LMS A;  4DY9 A;  1H31 B;  2CXB A;  1LC2 A;  1CO6 A;  3ZOW A;  1FJ0 A;  1KYO W;  1DW1 A;  1FCD C;  4AAO A;  2C1U A;  4U3F D;  1F1F A;  2ZZS 1;  1L9B C;  1DVV A;  5KAI V;  3NBT A;  3WU2 V;  1CTJ A;  2D0W A;  1H33 A;  3HQ6 A;  2EXV A;  3MK7 C;  2JTI B;  3CYT I;  4WQB A;  2B12 B;  4AAN A;  2GC4 D;  1H9Y A;  4Y5R A;  5KLV D;  3PXW A;  2GB8 B;  3L71 D;  4D6T D;  2ZON G;  1I55 A;  1NNO A;  4FA9 A;  1AOF A;  1CIH A;  1ETP A;  2BCN B;  2JWA A;  4A7P A;  1E8E A;  2KS1 A;  1YFC A;  2ZOO A;  1HZU A;  1CSW A;  1N90 A;  2C2C A;  2A06 D;  1M70 A;  4LJI A;  2QJY B;  1CSX A;  351C A;  4FB1 A;  1S6V B;  3ZBM A;  1W5C T;  4L1Q A;  4UB8 V;  3H1L D;  4EIF A;  1RZ6 A;  5GTH V;  1C75 A;  2I8F A;  1K3G A;  3ITK A;  2BGV X;  2B0Z B;  5EXQ A;  1C52 A;  4XYD B;  2OZ1 B;  3HQ8 A;  1FI9 A;  1H1O A;  1FOC A;  1HJ4 A;  1H31 A;  2FRC A;  1SQB D;  1CYJ A;  1I6D A;  1NTK D;  1A2S A;  2BH5 X;  1KX7 A;  3PXS A;  1B7V A;  3X39 A;  2N18 C;  3VRD A;  2AIU A;  1AKK A;  2K9J B;  3PH2 B;  2C1D B;  4GED B;  2GIW A;  1GJQ A;  2AXT V;  3TDK A;  4EDF A;  2HV4 A;  4WQ7 A;  2N3B A;  3H1H D;  1CCR A;  4WQ9 A;  3WFD C;  1I6E A;  4WQ8 A;  3BCC D;  2PAC A;  1PP9 D;  1HZV A;  451C A;  5DFS A;  3FWL A;  1YEB A;  1HRO A;  1KB0 A;  5DJQ C;  3L75 D;  5CYT R;  1IO3 A;  1A56 A;  3MK7 B;  3DP5 A;  1LC1 A;  1GIW A;  4V2K A;  2L4D A;  5CIC B;  3VMA A;  1I5T A;  3CX5 W;  2AI5 A;  3L70 D;  4FA1 A;  3PRJ A;  1CYI A;  1RZ5 A;  1CED A;  1CRY A;  1OAE A;  1QN2 A;  3CXH W;  1NMI A;  3RN1 A;  3WC8 A;  2Q3E A;  4WQA A;  3WFC C;  3KHU A;  2DGE A;  4Q5P A;  1H32 B;  4K3I A;  1YCC A;  2N3Y A;  2BH4 X;  2D0S A;  1CRG A;  2QG4 A;  1DW0 A;  1NTM D;  1C6O A;  1CRJ A;  2C9X B;  3L4O A;  3NBS A;  4IL6 V;  3HQ9 A;  3OCD A;  1CIG A;  3TYI A;  2OZ1 A;  1DT1 A;  1AOQ A;  2V07 A;  4JCG A;  1C6R A;  3DR0 A;  1WEJ F;  3ZIY A;  1NML A;  4H0K A;  1MG2 D;  2C8S A;  2ORL A;  3PLN A;  1KX2 A;  4EIC A;  2IBZ D;  1C2N A;  2N9J A;  2C1V A;  5B5E V;  2BCC D;  3SVW A;  1L0N D;  2C1D A;  3ZOX A;  5CIH B;  1DVH A;  1P84 D;  4PJ0 V;  1PPJ D;  3CX5 D;  4FA5 A;  3H1J D;  3L4M A;  2KNC B;  5B66 V;  1KYO D;  1CHH A;  1HRC A;  2N9Y B;  3PHL A;  3O20 A;  2QJP B;  2ZBO A;  1NIR A;  3OCD B;  5KAF V;  4L3G A;  2RMZ A;  1WVE C;  2CA4 B;  1IRW A;  1GU2 A;  1SQV D;  1C7M A;  3A0B V;  4AAL A;  1U74 B;  2PCC B;  4GYD A;  2YQB A;  1L9J C;  1ZRT D;  1FHB A;  1I8O A;  4RSZ A;  3PXT A;  1F1C A;  3OA8 B;  1CSU A;  2L91 A;  155C A;  1CTY A;  1SQX D;  1R0Q A;  3ZOO A;  1H32 A;  1MG3 D;  1NTZ D;  3O5C A;  2B11 B;  1KB9 D;  2LIR A;  1HCM A;  2RN0 A;  2BLF B;  2YCC A;  1LFM A;  2DVH A;  3O0R C;  2Y0D A;  4KMG A;  3O1Y A;  1CIF A;  1FI7 A;  3L74 D;  1IRV A;  5DF5 A;  4FAN A;  2FWL A;  4PW9 B;  3A0H V;  4EID A;  1N15 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...