3CWBE

Chicken cytochrome bc1 complex inhibited by an iodinated analogue of the polyketide crocacin-d
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
196
structure length
196
Chain Sequence
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of molecular modeling in the design of analogues of the fungicidal natural products crocacins A and D.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
total genus 39
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2008-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3cwbE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3cwbE02
1VM9A 4AAYB 2E4PA 3H1HE 2DE6D 4HKVA 4D6TE 2D2CD 2ZYLA 3BCCE 3EN1A 2IBZE 3TGUE 1UUWA 3GZYA 2QJYC 2B24A 4HM0A 4NBHD 4QDFB 2QJPC 2YIUC 3GL2A 2HMJA 4NBGD 3GKEA 3L71E 1G8JB 3EQQA 1NYKA 3L72E 3GTEA 3CWBE 2QJKC 1SJGA 1NTME 4AIVA 2JO6A 3H1JE 4P1CH 2NWFA 1SQBE 5BOKA 3VMGD 1ULIA 1O7NA 4EMJB 3H1IE 4HM1A 4PD4E 1SQVE 1SQQE 2NUMA 2I7FA 3GOBA 3L74E 5HL4A 2HMKA 2XRXA 5KLVE 4QDDA 1FQTA 1BCCE 4NB9D 3L70E 1NDOA 1O7PA 1ZRTE 2GBWA 4H0LD 5KLIC 2A06E 5AEWA 1JM1A 1ULJA 4NB8D 3C0DA 1PPJE 1VF5D 4OGQD 4QCKA 2YVJB 1VCKA 3GTSA 2GBXA 2FYNC 2BMRA 2HMLA 1BGYE 4NBAD 2E76D 2E74D 1L0NE 1WQLA 1P84E 2YFLA 4QDCA 4QURA 1RFSA 1SQPE 3VCPA 3VMID 2BCCE 2DE7D 2Q3WA 1SQXE 2NUKA 2ZT9D 4NBFD 3H1LE 3L75E 4HM8A 4PV1D 2BMOA 2NVEA 1NTZE 1PP9E 4H13D 4HM4A 3CX5E 2FYUE 4P1BH 1O7GA 1NU1E 3N0QA 2E4QA 4HM7A 1O7MA 4HM6A 2B1XA 4QDFA 5AEUA 1UUVA 1L0LE 4U3FE 2HMNA 3L73E 3H1KE 1G8KB 4NBBD 2XSHA 4QUQA 1EG9A 2HMMA 4HM5A 3VCAA 3GZXA 4H44D 1O7WA 2YFIA 1KB9E 4NBED 3FOUA 2XR8A 1EZVE 1Q90C 2HMOA 2QPZA 2YFJA 2JZAA 3GCEA 3CXHE 2NVFA 1NTKE 4HJLA 1RIEA 2XSOA 4HM2A 3VMHD 3DQYA 2E75D 4QUPA 1BE3E 1O7HA 2BMQA 4NBCD 1KYOE 2NVGA 3AZCA 5CXMA 3D89A 4HM3A 2DE5D 3GB4A 3GL0A 5KKZC 4NBDD 2CKFA
chains in the Genus database with same CATH superfamily
4AAYB 5KTBA 2AXTE 2GM4A 3H1ID 2XDJA 3GL2A 4PV1C 2W6AA 3GTEA 1YQ4C 1W2BO 2WITA 1BGYD 2W6JH 1SFCB 3UIAA 2KP8A 3SWKA 2PP6A 1TU3F 1HWTC 5AVZB 1BCCJ 3L70E 4OVNF 3HUSA 1O7PA 1S4XA 5AEWA 4HYTB 5AW3B 3CCQP 3IN6A 3GTSA 1HTLC 4PJ0H 2FFDC 1RE4C 2IZ0A 1ZOYC 3N7NA 3ZDMA 2HPCA 3GW6A 2C0XA 1YIJP 5AW0B 1GL2A 1NKZB 4H13D 1NTZE 3HD7C 2ITAA 1OW7A 4UB6E 3G3ZA 1QEXA 3HE5A 1DIPA 3B5ND 3VMXA 1OMIA 3V2PA 1PP9D 2QVAA 1VQKP 1NTKJ 4EI2A 3VMYA 1KILC 3L70J 1SLQA 1EZVE 3IF4A 1RH5B 2HMOA 1RF0A 2WSEH 2OTJP 3MZWB 3DQYA 5B66E 1OX3A 5CXMA 4C7NA 5C39A 4HM3A 4GOFA 3V5BA 1NTKG 1VM9A 3AEFC 1JNMA 3H1HE 5H2FE 2P1JA 3VN0A 2R44A 1KD1Q 2B24A 1KYOH 1N2DC 1EQ7A 3P32A 1IFMA 2Y0EA 1S5LE 4U7JA 1IFPA 2M3EA 1L4AB 4UB8E 3AE6C 1O7NA 1SQXK 4GKGA 1E79H 2HMKA 1IFNA 3V2QA 2H7HA 3KZIH 1JM1A 3MUDA 1LT9C 2HYNA 1NTKK 4ASWA 1SQVJ 5K5GB 2R32A 4NBAD 1GW4A 5AW8B 1LNQA 5KJ7D 3AEBC 2FYNB 3SWFA 2ZXEB 1SQQG 5E79E 1SVFA 1EZVD 4NBFD 3GMAA 1VPCA 1KILA 2QEXP 2MJZA 1ZR4A 3RL0g 4L73A 1SQXG 3JCUH 2WSCJ 3V6IA 1KQSO 3VP8A 2NPSC 5B5EE 5CCHC 5H2FH 5AVSB 1PGOA 1SQVD 4LGDE 2WSEJ 2W6BA 1KB9D 2KOGA 4UB6H 1Q90C 1KQGB 3PP5A 1JMBA 2ZYAA 5M1BA 3AE7C 1L0ND 1S5LX 3AZCA 4YPCA 3WUUA 3CCEP 5GTHH 1PZQA 4BRYA 4O9BA 1DEEG 5AVQB 3B5NB 1N73B 1NYKA 1JEKA 1CI6A 4M3LA 1HH0A 1JY2P 1FZBA 3L74G 2FFDB 2DW3A 3H1JE 3PJSK 2N1TC 5TJHA 2LXCB 3E7KA 3CD6P 1N7LA 1GU4A 4XFJA 1FJPA 1RY3A 1ZRTE 1FZCC 1IK7A 4ZKPA 1FC2C 2OYIA 1JUNA 1VQOP 1URQA 4ASVA 2GUSA 3WUTA 2H8PD 2R3CA 1NU1J 3TK1A 4OGQB 1SFCC 1HUCA 2WMMA 1FBMA 3FXEA 3L71J 2K9JB 1NU1D 2BMOA 2LKMA 3L75G 3CPWO 4MN4C 2K88A 2E4QA 2E5TA 2WPQA 2M5AB 1W2EA 3Q3DA 1AQ5A 1D7MA 4C7NB 4UB8H 2P7JA 4N78D 3FOUA 3A0BH 3AE9C 2QPZA 1NTMG 3G71P 1W5CE 1ZMEC 3Q5PA 3IFMA 1URQC 2YXRB 3V4QA 2MKVA 2D2CD 2RKLA 5B66H 3L4FA 1BSHA 4N3YB 1S9KD 1SQPJ 3L72E 1S3JA 4C7RA 1IFDA 3H1LG 3H32A 3LW5H 2N1TA 4WY4D 1PGQA 1T6AA 3RK3C 1ZXGA 2ZYDA 4WY4A 1ZV8A 4R4MA 2B87B 2WSCH 2A06E 2BASA 2D2CB 4AQRD 1FOSE 2Y0CA 3S4RA 2R5DA 2YVJB 1KZUB 2IBZG 1U57A 3GLMA 2BMRA 4Y99C 4RKUJ 1L4AC 1SQPE 1X8YA 1G1JA 2BCCE 4PD4H 3KHUA 3C9IA 2Y9YA 3MP7B 3PTZA 2FYUE 1OWAA 1FZCB 2I1KA 2XNDH 3BRTB 2WT7B 2WVRA 3T97A 3USSA 1QL2A 2GUVA 3Q5RA 3P8MC 3VCAA 4IL6H 1VDFA 1RF1B 1FOSF 1HJBA 1JY3N 1AFOA 2JZAA 4ZNCA 1T2KD 1LT1A 1SQPD 4HM2A 3CWBG 2IX7C 1ZP0C 1KN7A 3RK2D 3B5NC 2YO2A 4QDFB 4HM0A 2KS1B 3H1LJ 2JJLA 3GKEA 3D71A 2KYVA 2WSSH 1QL1A 1DEBA 2FXMA 4ZMDA 5BOKA 1FE6A 2E43A 1YITP 4KT0J 1SQVK 1PPJD 4U3FD 3CCUP 3CC2P 4NB9D 1NDOA 2JDIH 2KLUA 1MKMA 2W27A 3A0HE 1XTCC 5L8RJ 2WTYA 1QLED 1L0NK 1IO4A 3BATA 4HB1A 4GOEA 2C0WA 3H1JJ 3VTPC 1AVYA 2N1TB 2YMKA 3H32B 1CW5A 1OW6A 3RK3B 1HGZA 2BCCJ 3OJAB 1N8RQ 2R5BA 3S9OA 4HM6A 4DZOA 1BE3G 3MHVA 1BE3J 3R2PA 1MUUA 5CJ0A 4YXWH 1G8KB 2IPPA 3RL0B 1VL2A 3OW2O 2JO1A 5AVXB 1NAFA 2B89A 1KB9E 2V7QJ 1T3UA 2XR8A 2LXBA 3PHLA 3E1RA 3AE5C 2IYPA 2P67A 1VQ7P 2ZT9B 3L73G 4EDFA 1URQB 4AUWA 2PFXA 1HGVA 3O6QA 3QH9A 2OYIB 2CKFA 2M5AA 3EN1A 3TGUE 2Y9ZA 2QJPC 3EQQA 1T8ZA 1UIXA 1K9MQ 1LTJB 1IFJA 4AIVA 1VF5C 1LWUC 2WWWA 1KORA 1SQBE 1U7MA 1M56D 1FZGA 5AW1B 3HE4A 3CCLP 2YO3A 4KHXA 1M1JC 3NMDA 3RK3D 1WT6A 1H0TB 2O3JA 1OZHA 2IFNA 3L73J 1EDLA 3CLQA 2J58A 2A45H 4QCKA 1VCKA 1VQ6P 5CBOA 4RJTA 5APXA 3MTUE 1P84I 2HODA 1NAYA 1BDCA 1M7LA 1URQD 1Y8AA 2O1KA 1SQXJ 3KXDA 3N0QA 3AE4C 3B5NA 2B1XA 5AEUA 2H88C 4WWIA 3RL0D 1SQQK 1X0TA 4DOJA 1PV3A 2OQQA 4Y99B 2XSHA 2J5UA 2YFIA 3U1CA 2P10A 4W80A 3O8ZA 3VMHD 2YKQA 4I6MC 2BEZF 3AE1C 3BCCD 1PP9G 5AW9B 1JY2N 3P8CE 2L5GB 2FKWB 4NBHD 1EXIA 1ZLLA 3L71E 1RF1A 3AEGC 3BVHA 3CWBE 3H6PA 3EQ2A 1L4AA 3H1HJ 1XTGB 3TGUG 1L0NJ 1GDTA 4L74A 4R4LA 1Q82Q 1H89A 1KQLA 1FZCA 4RESB 3I56P 2H89C 1FJKA 3I5CA 4IL6X 1KB9I 4EYYQ 1M1JA 2KXPB 3OAKA 3Q1MA 3AE3C 3WU2H 3PRJA 1NH4A 5AW2B 1OIPA 2FYNC 2QJKB 1T3JA 5BU5A 2YFLA 2E75B 1A02F 2J59M 2A06D 1NTZJ 5EFWB 3OA7A 2DE7D 2G3AA 3BCCG 4N6JA 5APWA 2IDBA 3HD7B 5CJ4A 1JY3O 5AW4B 1FZAA 1AQTA 1Q86Q 2BCCD 1LTIC 2HMNA 1GL2B 4D6TG 1EZVG 3WMM0 2W8ZA 1IC2A 2HPCB 4NPFX 5CCHA 4WBAA 1H88A 3CXHE 5TISE 1N86A 2A45I 3GHGC 5CCGC 2IZ1A 5KKZC 1OVRA 2FYZA 3L75J 2XNXA 4HKVA 3HE5B 2ZYLA 3L72J 4GIFA 1G8JB 2KUBA 1VF5B 3H1KG 4GODA 1OVVA 3CX5I 2A06G 1NTME 1NTZK 3W68A 2WPSA 4P1CH 2Q9IA 3MGNA 4PD4E 3FWLA 1ZW0A 2KNCA 5GTHE 2OYIC 2E74B 1JCDA 4LC1A 5KLIC 2HG5D 3L74D 1J1DB 1JB0J 4OGQD 1IZNB 1PGJA 1SQBK 3M06A 3HUSB 1SQBJ 5CMZA 2N9BA 3TDKA 3HRNA 2E74D 1QX8A 3G6EP 1LTSC 2YXQB 3H1LE 1JOCA 1M1JB 1OFCX 3VYIA 2WSFJ 1NU1K 3M0DC 3A0HH 1FDOA 2C9LY 3L71G 2FYUK 2SPZA 2RH0A 2QJYB 1JMMA 1KFNA 3TF5A 2M8RA 4QUQA 3KQGA 2E75C 5AVTB 3H1LD 1ZN5A 5APUA 3S1KA 4JBZA 5KLVJ 4XA4A 4BRYB 3HD7D 3KZIE 4H13C 4NBCD 2NPSA 2KSJA 3CI9A 1KYOI 2CK3H 4I2LC 2K9YA 4H44B 3CWBJ 1PGPA 5APSA 3CXHD 4JPZB 3GF3A 2K37A 3G4SP 3GZYA 3LIEA 5AW7B 2HMJA 1CZQA 2JKVA 2E76C 4JYCA 3AEAC 2OYOA 3II6A 1NTMD 3TGUJ 4D6TJ 2QJKC 1S5LH 4LLHA 2JO6A 1FS0E 3JC22 1H0TA 3VMGD 1JTHA 2OGUA 3CC4P 1LTTC 3PLNA 3MD0A 3Q2YA 4NB8D 1RQUA 3KPEA 1X9VA 4OGQC 1K73Q 1FZFA 2P58A 2YKOA 2E76D 1L0NE 1P84E 1SQBG 3AEDC 3TYYA 4QDCA 2CPSA 1LTAC 2XZRA 1M1KQ 1IJDB 1SQVG 3L75E 3GHGB 4Y28J 1LTBC 1GK4A 2NVEA 1L0LK 1GL2D 2FXOA 3M9QA 2OYHA 2NZ2A 3VOPA 1A02J 3H1JD 4EIJA 3B8EB 1SS1A 2K9JA 4NPDA 2YIUB 1AJYA 3AECC 1EDIA 2PAJA 4AYCA 4IFMA 1R5LA 5CCGD 1YTZT 2K3RA 3H25A 2XSOA 4I7ZB 5CCGA 1O7HA 3GHGA 1USEA 4JYBA 3O6QB 1X79B 1PIXA 2E5YA 2E4PA 4DT0A 2I8DA 1MZ9A 5KLIB 1L0LG 3Q5SA 3RK3E 4DJGA 3JCUE 3LW5J 3CX5H 4JQ0D 2YNYA 2ZJSE 1L4AD 3P7KA 1ULIA 1IFIA 5E79H 1CI6B 3C1LA 2AXTH 1Q2NA 1YQ3C 1FQTA 1USDA 2NRGA 2AEFA 2OTLP 1BCCG 2HLOA 2XU6A 5KAIE 3K5BA 5KAIH 2E76B 2FYUG 1FZEA 1LTGC 2KS1A 2O1JA 4W7YA 3L73D 4TT3H 1U7JA 2NUKA 2KLVA 3ABVC 2WZ7A 3CCJP 3F5HA 1PP9E 1NTZD 3CX5E 2YMYA 3V4WA 1VQ9P 1KILB 2OYHC 3L35A 2HMMA 4GT1A 1P84D 2QSIA 3VMZA 1OXZA 3M0AA 3T97B 1H8AA 1KMIZ 4H13B 2NVFA 4HJLA 3FX0A 1AV1A 2Z5HA 3H1IJ 1EXJA 3SSUA 2B9BA 2M3BA 3H1HD 1N7SB 4BXLA 2DE6D 1DH3A 3SFDC 1NWQA 3D70A 2QJYC 5KLVK 3RL0C 5AVRB 1LWUB 1NVOA 1AA0A 2ZT9C 3MUDC 2WT7A 2L91A 2Q7CA 4HH2A 2KNCB 2O01H 2PGDA 2ZVOB 4I1LA 1NGMB 3M9HA 2UWJE 2V4HA 3CX5D 2KK7A 1KV4A 3CXHH 5TISH 4PD4D 2D2CC 1L0LJ 5APVA 3FGAD 1WQLA 1CSBA 2FBWC 1ZR2A 4OWFA 1M90Q 1S72P 5AVVB 4I7ZC 1LJ2A 1GMJA 4WY4B 4OH8B 1BDDA 2AEMA 1RF0C 1SQQD 2IBZI 2ZAEB 4PV1B 2WPVB 1NKNA 1NYHA 5APTA 1YJNP 1NTKE 3WU2E 2KIKA 4TLFA 1BE3E 1FDMA 1YBKA 1KYOE 1SP4A 1BGYG 3HD7A 2WSFH 3GL0A 2ZXXA 1NOHA 3CMAP 2KZIA 2QJPB 4W7ZA 1PPJG 2JWDA 5CHXA 4U3FG 2OYHB 2N9YB 2YIUC 1KC8Q 1WMKA 2M0BA 3LIDA 3R4YA 1WRGA 1YHQP 3C8VA 1QVGO 3M0DA 1JCCA 3HTKA 3M9BA 4CPGA 5HL4A 1G1IA 3L72G 4HJGH 1VQ4P 3CMEP 3IAOA 1E5WA 3CL3D 1PPJE 2K1AA 1VF5D 2BEQD 3H1IG 3D6YA 5KAFH 1N73A 1BE3D 3B71A 3BRVB 1FU1A 3EFFK 1J1EB 3VCPA 1P84H 2WPRA 4PJ0E 1GZLA 2OTKE 3SWYA 4HM8A 3NXSA 2XKMA 1Q90D 1GU5A 1O7MA 1KTMA 1AVOA 2E42A 4KJMA 1JM0A 2YKPA 1Q7YQ 3L73E 4NBBD 2G8YA 3GZXA 1J2JB 3RBXA 1NTMK 1EDJA 1NU1G 4NBED 3L74J 1QVFO 2YFJA 3B4SA 3GCEA 2KSEA 3L36A 1DD4A 1RE3A 2Z4EA 5KKZB 3I55P 3V2NA 5AW6B 1OVUA 1ZRTD 4U3FJ 2BCCG 2Q1KA 2FY8A 2JEEA 3GB4A 2FYUJ 4NBDD 5KJ7C 5AVWB 1RQVA 2QA4P 1GL2C 1L2PA 3HTKB 3BCCJ 1K8AQ 3FXDA 4NPEA 3QWOC 2QRXA 1RE4A 2ZVNB 1JY3P 2RMZA 2I1JA 4EMJB 3P8CD 1QGKB 1SQQE 2NUMA 1K04A 3WUVA 2XRXA 5KLVE 3D6ZA 1J1DC 3L71D 2LR2A 2GBWA 3HUSC 2P2UA 3KDPB 1NTKD 3C0DA 5BU8B 1JO5A 3FWNA 2AXCA 4H0LB 3M91A 1SQXD 2GA1A 1KQFB 3SFEC 1RFSA 1GW3A 2JR8A 2Q3WA 5APYA 4WY4C 3RK2C 1S2EA 3GF7A 4PV1D 5KJ7A 4HM4A 2CPBA 4IFFA 1T2KC 3ITKA 2KZJA 1L0LE 2Q3EA 3H1KE 1RF1C 3A5TA 1EG9A 4YTPC 1O7WA 4C46A 3VP9A 3RBZA 2QE7H 2E75D 4H44C 2BMQA 1GD2E 3TGUD 1NTMJ 1M57D 2W83C 1PL5A 5DJTB 3CWBD 1Z56A 3A2AA 1N73C 3GG2A 2Q6QA 3G9RA 4WB4A 1J1EC 1FDIA 3H1IE 1SQVE 4A7PA 2E74C 1LWUA 1BSNA 1VQPP 5GTIE 1SFCD 1NO4A 3H1JG 4DCKA 1VQMP 1L0NG 3CCSP 1SFCA 1RHZB 1N7SA 1SQQJ 1Y9BA 2R3SA 1N7SD 3H1KJ 1LP1B 2Z5IA 4PD4I 3IR9A 2QM7A 3L70G 4XE5B 5GTIH 1PP9J 2RN0A 1MFZA 3PH0A 1YTZI 1G2CA 2ZT9D 3EFGA 4K3AA 1LGHB 2IYOA 4HM7A 1L0LD 1UIIA 1SQBD 1VQ5P 2V7QH 3MIWA 5AVYB 2OARA 4L75A 1K05A 2HR3A 1NHLA 2Q5UA 4HM5A 2WQYC 3V2RA 5AW5B 4IFDK 3H1KD 1FAVA 5AVUB 3KYQA 1NJIQ 1LP1A 2IFMA 1KB9H 5APQA 4ZKUA 2FYUD 3L75D 2POHA 3BCCE 1LTJC 5BVZA 2NPSD 3L70D 4YXDC 4H0LC 1HJ0A 2C9NY 1SJGA 2NWFA 2B87A 2HODB 1NTZG 4HM1A 1EDKA 1GTWA 1KILE 2I7FA 3GOBA 1OW8A 1R8EA 4QDDA 4BWNA 1Q81Q 4L76A 3L37A 1EZVI 2N1TD 2O01J 3JSVC 1Y47A 2QG4A 3U59A 3AEEC 2GBXA 2W90A 1YJWP 2HMLA 3CCMP 1VQNP 1VQ8P 1BGYE 1LT9A 3HE4B 2B88A 5KLVG 1PFIA 2VRSA 1VQLP 3BASA 1S1CX 1SQXE 1YJ9P 2KB7P 4IOIH 1BCCD 1HBWA 3A7OA 1LTJA 3H1HG 3CXHI 3E1IA 3U1AA 1O7GA 1NU1E 3NTNA 1R5SA 1X22A 3TNUA 1KYOD 1BGYJ 4IL6E 4QMAA 1JY2O 2Y0DA 4WVZA 5CCHD 2KI7B 2IBZD 3TNUB 1SQPK 3W67A 4HKZH 1GK6A 3RK2B 2O01N 3EWKA 4QUPA 2NVGA 5CBNA 2DE5D 2Q3IA 2AEJA 4D6TE 3RGUA 2IBZE 1UUWA 4N78E 4NBGD 5DJUB 5KLVD 2FXPA 1MFTA 1DX7A 4JF7A 1KFMA 1HF9A 4Z1MH 2HFED 3L74E 1SQPG 3VMAA 3N4XA 1BCCE 5KAFE 1N7SC 2JP3A 2A45G 4H0LD 1ULJA 4GDOA 1YYCA 2FFDA 3CCVP 4K35A 2NPSB 4EOTA 1LT9B 2QIWA 3NFQA 4QURA 1JTHB 1DD3A 5B5EH 3VMID 3F89A 1EC5A 2XV5A 3TSIA 3AE2C 2ZFCA 4B86A 4P1BH 3A0BE 3A3YB 2QM8A 1HVVA 4QDFA 4RO0A 2PRRA 1UUVA 1RE3C 1MV8A 4U3FE 2H43A 2JWAA 3CC7P 1KILD 2ZYGA 4H44D 3AE8C 3CCRP 1RIEA 1M8OB 1YI2P 1S9KE 3L72D 3D89A 1G2CB 1IK9A 4D6TD
chains in the Genus database with same CATH topology
1VM9A 4AAYB 2E4PA 3H1HE 2DE6D 4HKVA 4D6TE 2D2CD 2ZYLA 3BCCE 3EN1A 2IBZE 3TGUE 1UUWA 3GZYA 2QJYC 2B24A 4HM0A 4NBHD 4QDFB 2QJPC 2YIUC 3GL2A 2HMJA 4NBGD 3GKEA 3L71E 1G8JB 3EQQA 1NYKA 3L72E 3GTEA 3CWBE 2QJKC 1SJGA 1NTME 4AIVA 2JO6A 3H1JE 4P1CH 2NWFA 1SQBE 5BOKA 3VMGD 1ULIA 1O7NA 4EMJB 3H1IE 4HM1A 4PD4E 1SQVE 1SQQE 2NUMA 2I7FA 3GOBA 3L74E 5HL4A 2HMKA 2XRXA 5KLVE 4QDDA 1FQTA 1BCCE 4NB9D 3L70E 1NDOA 1O7PA 1ZRTE 2GBWA 4H0LD 5KLIC 2A06E 5AEWA 1JM1A 1ULJA 4NB8D 3C0DA 1PPJE 1VF5D 4OGQD 4QCKA 2YVJB 1VCKA 3GTSA 2GBXA 2FYNC 2BMRA 2HMLA 1BGYE 4NBAD 2E76D 2E74D 1L0NE 1WQLA 1P84E 2YFLA 4QDCA 4QURA 1RFSA 1SQPE 3VCPA 3VMID 2BCCE 2DE7D 2Q3WA 1SQXE 2NUKA 2ZT9D 4NBFD 3H1LE 3L75E 4HM8A 4PV1D 2BMOA 2NVEA 1NTZE 1PP9E 4H13D 4HM4A 3CX5E 2FYUE 4P1BH 1O7GA 1NU1E 3N0QA 2E4QA 4HM7A 1O7MA 4HM6A 2B1XA 4QDFA 5AEUA 1UUVA 1L0LE 4U3FE 2HMNA 3L73E 3H1KE 1G8KB 4NBBD 2XSHA 4QUQA 1EG9A 2HMMA 4HM5A 3VCAA 3GZXA 4H44D 1O7WA 2YFIA 1KB9E 4NBED 3FOUA 2XR8A 1EZVE 1Q90C 2HMOA 2QPZA 2YFJA 2JZAA 3GCEA 3CXHE 2NVFA 1NTKE 4HJLA 1RIEA 2XSOA 4HM2A 3VMHD 3DQYA 2E75D 4QUPA 1BE3E 1O7HA 2BMQA 4NBCD 1KYOE 2NVGA 3AZCA 5CXMA 3D89A 4HM3A 2DE5D 3GB4A 3GL0A 5KKZC 4NBDD 2CKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VM9 A;  4AAY B;  2E4P A;  3H1H E;  2DE6 D;  4HKV A;  4D6T E;  2D2C D;  2ZYL A;  3BCC E;  3EN1 A;  2IBZ E;  3TGU E;  1UUW A;  3GZY A;  2QJY C;  2B24 A;  4HM0 A;  4NBH D;  4QDF B;  2QJP C;  2YIU C;  3GL2 A;  2HMJ A;  4NBG D;  3GKE A;  3L71 E;  1G8J B;  3EQQ A;  1NYK A;  3L72 E;  3GTE A;  3CWB E;  2QJK C;  1SJG A;  1NTM E;  4AIV A;  2JO6 A;  3H1J E;  4P1C H;  2NWF A;  1SQB E;  5BOK A;  3VMG D;  1ULI A;  1O7N A;  4EMJ B;  3H1I E;  4HM1 A;  4PD4 E;  1SQV E;  1SQQ E;  2NUM A;  2I7F A;  3GOB A;  3L74 E;  5HL4 A;  2HMK A;  2XRX A;  5KLV E;  4QDD A;  1FQT A;  1BCC E;  4NB9 D;  3L70 E;  1NDO A;  1O7P A;  1ZRT E;  2GBW A;  4H0L D;  5KLI C;  2A06 E;  5AEW A;  1JM1 A;  1ULJ A;  4NB8 D;  3C0D A;  1PPJ E;  1VF5 D;  4OGQ D;  4QCK A;  2YVJ B;  1VCK A;  3GTS A;  2GBX A;  2FYN C;  2BMR A;  2HML A;  1BGY E;  4NBA D;  2E76 D;  2E74 D;  1L0N E;  1WQL A;  1P84 E;  2YFL A;  4QDC A;  4QUR A;  1RFS A;  1SQP E;  3VCP A;  3VMI D;  2BCC E;  2DE7 D;  2Q3W A;  1SQX E;  2NUK A;  2ZT9 D;  4NBF D;  3H1L E;  3L75 E;  4HM8 A;  4PV1 D;  2BMO A;  2NVE A;  1NTZ E;  1PP9 E;  4H13 D;  4HM4 A;  3CX5 E;  2FYU E;  4P1B H;  1O7G A;  1NU1 E;  3N0Q A;  2E4Q A;  4HM7 A;  1O7M A;  4HM6 A;  2B1X A;  4QDF A;  5AEU A;  1UUV A;  1L0L E;  4U3F E;  2HMN A;  3L73 E;  3H1K E;  1G8K B;  4NBB D;  2XSH A;  4QUQ A;  1EG9 A;  2HMM A;  4HM5 A;  3VCA A;  3GZX A;  4H44 D;  1O7W A;  2YFI A;  1KB9 E;  4NBE D;  3FOU A;  2XR8 A;  1EZV E;  1Q90 C;  2HMO A;  2QPZ A;  2YFJ A;  2JZA A;  3GCE A;  3CXH E;  2NVF A;  1NTK E;  4HJL A;  1RIE A;  2XSO A;  4HM2 A;  3VMH D;  3DQY A;  2E75 D;  4QUP A;  1BE3 E;  1O7H A;  2BMQ A;  4NBC D;  1KYO E;  2NVG A;  3AZC A;  5CXM A;  3D89 A;  4HM3 A;  2DE5 D;  3GB4 A;  3GL0 A;  5KKZ C;  4NBD D;  2CKF A; 
#chains in the Genus database with same CATH topology
 4AAY B;  5KTB A;  2AXT E;  2GM4 A;  3H1I D;  2XDJ A;  3GL2 A;  4PV1 C;  2W6A A;  3GTE A;  1YQ4 C;  1W2B O;  2WIT A;  1BGY D;  2W6J H;  1SFC B;  3UIA A;  2KP8 A;  3SWK A;  2PP6 A;  1TU3 F;  1HWT C;  5AVZ B;  1BCC J;  3L70 E;  4OVN F;  3HUS A;  1O7P A;  1S4X A;  5AEW A;  4HYT B;  5AW3 B;  3CCQ P;  3IN6 A;  3GTS A;  1HTL C;  4PJ0 H;  2FFD C;  1RE4 C;  2IZ0 A;  1ZOY C;  3N7N A;  3ZDM A;  2HPC A;  3GW6 A;  2C0X A;  1YIJ P;  5AW0 B;  1GL2 A;  1NKZ B;  4H13 D;  1NTZ E;  3HD7 C;  2ITA A;  1OW7 A;  4UB6 E;  3G3Z A;  1QEX A;  3HE5 A;  1DIP A;  3B5N D;  3VMX A;  1OMI A;  3V2P A;  1PP9 D;  2QVA A;  1VQK P;  1NTK J;  4EI2 A;  3VMY A;  1KIL C;  3L70 J;  1SLQ A;  1EZV E;  3IF4 A;  1RH5 B;  2HMO A;  1RF0 A;  2WSE H;  2OTJ P;  3MZW B;  3DQY A;  5B66 E;  1OX3 A;  5CXM A;  4C7N A;  5C39 A;  4HM3 A;  4GOF A;  3V5B A;  1NTK G;  1VM9 A;  3AEF C;  1JNM A;  3H1H E;  5H2F E;  2P1J A;  3VN0 A;  2R44 A;  1KD1 Q;  2B24 A;  1KYO H;  1N2D C;  1EQ7 A;  3P32 A;  1IFM A;  2Y0E A;  1S5L E;  4U7J A;  1IFP A;  2M3E A;  1L4A B;  4UB8 E;  3AE6 C;  1O7N A;  1SQX K;  4GKG A;  1E79 H;  2HMK A;  1IFN A;  3V2Q A;  2H7H A;  3KZI H;  1JM1 A;  3MUD A;  1LT9 C;  2HYN A;  1NTK K;  4ASW A;  1SQV J;  5K5G B;  2R32 A;  4NBA D;  1GW4 A;  5AW8 B;  1LNQ A;  5KJ7 D;  3AEB C;  2FYN B;  3SWF A;  2ZXE B;  1SQQ G;  5E79 E;  1SVF A;  1EZV D;  4NBF D;  3GMA A;  1VPC A;  1KIL A;  2QEX P;  2MJZ A;  1ZR4 A;  3RL0 g;  4L73 A;  1SQX G;  3JCU H;  2WSC J;  3V6I A;  1KQS O;  3VP8 A;  2NPS C;  5B5E E;  5CCH C;  5H2F H;  5AVS B;  1PGO A;  1SQV D;  4LGD E;  2WSE J;  2W6B A;  1KB9 D;  2KOG A;  4UB6 H;  1Q90 C;  1KQG B;  3PP5 A;  1JMB A;  2ZYA A;  5M1B A;  3AE7 C;  1L0N D;  1S5L X;  3AZC A;  4YPC A;  3WUU A;  3CCE P;  5GTH H;  1PZQ A;  4BRY A;  4O9B A;  1DEE G;  5AVQ B;  3B5N B;  1N73 B;  1NYK A;  1JEK A;  1CI6 A;  4M3L A;  1HH0 A;  1JY2 P;  1FZB A;  3L74 G;  2FFD B;  2DW3 A;  3H1J E;  3PJS K;  2N1T C;  5TJH A;  2LXC B;  3E7K A;  3CD6 P;  1N7L A;  1GU4 A;  4XFJ A;  1FJP A;  1RY3 A;  1ZRT E;  1FZC C;  1IK7 A;  4ZKP A;  1FC2 C;  2OYI A;  1JUN A;  1VQO P;  1URQ A;  4ASV A;  2GUS A;  3WUT A;  2H8P D;  2R3C A;  1NU1 J;  3TK1 A;  4OGQ B;  1SFC C;  1HUC A;  2WMM A;  1FBM A;  3FXE A;  3L71 J;  2K9J B;  1NU1 D;  2BMO A;  2LKM A;  3L75 G;  3CPW O;  4MN4 C;  2K88 A;  2E4Q A;  2E5T A;  2WPQ A;  2M5A B;  1W2E A;  3Q3D A;  1AQ5 A;  1D7M A;  4C7N B;  4UB8 H;  2P7J A;  4N78 D;  3FOU A;  3A0B H;  3AE9 C;  2QPZ A;  1NTM G;  3G71 P;  1W5C E;  1ZME C;  3Q5P A;  3IFM A;  1URQ C;  2YXR B;  3V4Q A;  2MKV A;  2D2C D;  2RKL A;  5B66 H;  3L4F A;  1BSH A;  4N3Y B;  1S9K D;  1SQP J;  3L72 E;  1S3J A;  4C7R A;  1IFD A;  3H1L G;  3H32 A;  3LW5 H;  2N1T A;  4WY4 D;  1PGQ A;  1T6A A;  3RK3 C;  1ZXG A;  2ZYD A;  4WY4 A;  1ZV8 A;  4R4M A;  2B87 B;  2WSC H;  2A06 E;  2BAS A;  2D2C B;  4AQR D;  1FOS E;  2Y0C A;  3S4R A;  2R5D A;  2YVJ B;  1KZU B;  2IBZ G;  1U57 A;  3GLM A;  2BMR A;  4Y99 C;  4RKU J;  1L4A C;  1SQP E;  1X8Y A;  1G1J A;  2BCC E;  4PD4 H;  3KHU A;  3C9I A;  2Y9Y A;  3MP7 B;  3PTZ A;  2FYU E;  1OWA A;  1FZC B;  2I1K A;  2XND H;  3BRT B;  2WT7 B;  2WVR A;  3T97 A;  3USS A;  1QL2 A;  2GUV A;  3Q5R A;  3P8M C;  3VCA A;  4IL6 H;  1VDF A;  1RF1 B;  1FOS F;  1HJB A;  1JY3 N;  1AFO A;  2JZA A;  4ZNC A;  1T2K D;  1LT1 A;  1SQP D;  4HM2 A;  3CWB G;  2IX7 C;  1ZP0 C;  1KN7 A;  3RK2 D;  3B5N C;  2YO2 A;  4QDF B;  4HM0 A;  2KS1 B;  3H1L J;  2JJL A;  3GKE A;  3D71 A;  2KYV A;  2WSS H;  1QL1 A;  1DEB A;  2FXM A;  4ZMD A;  5BOK A;  1FE6 A;  2E43 A;  1YIT P;  4KT0 J;  1SQV K;  1PPJ D;  4U3F D;  3CCU P;  3CC2 P;  4NB9 D;  1NDO A;  2JDI H;  2KLU A;  1MKM A;  2W27 A;  3A0H E;  1XTC C;  5L8R J;  2WTY A;  1QLE D;  1L0N K;  1IO4 A;  3BAT A;  4HB1 A;  4GOE A;  2C0W A;  3H1J J;  3VTP C;  1AVY A;  2N1T B;  2YMK A;  3H32 B;  1CW5 A;  1OW6 A;  3RK3 B;  1HGZ A;  2BCC J;  3OJA B;  1N8R Q;  2R5B A;  3S9O A;  4HM6 A;  4DZO A;  1BE3 G;  3MHV A;  1BE3 J;  3R2P A;  1MUU A;  5CJ0 A;  4YXW H;  1G8K B;  2IPP A;  3RL0 B;  1VL2 A;  3OW2 O;  2JO1 A;  5AVX B;  1NAF A;  2B89 A;  1KB9 E;  2V7Q J;  1T3U A;  2XR8 A;  2LXB A;  3PHL A;  3E1R A;  3AE5 C;  2IYP A;  2P67 A;  1VQ7 P;  2ZT9 B;  3L73 G;  4EDF A;  1URQ B;  4AUW A;  2PFX A;  1HGV A;  3O6Q A;  3QH9 A;  2OYI B;  2CKF A;  2M5A A;  3EN1 A;  3TGU E;  2Y9Z A;  2QJP C;  3EQQ A;  1T8Z A;  1UIX A;  1K9M Q;  1LTJ B;  1IFJ A;  4AIV A;  1VF5 C;  1LWU C;  2WWW A;  1KOR A;  1SQB E;  1U7M A;  1M56 D;  1FZG A;  5AW1 B;  3HE4 A;  3CCL P;  2YO3 A;  4KHX A;  1M1J C;  3NMD A;  3RK3 D;  1WT6 A;  1H0T B;  2O3J A;  1OZH A;  2IFN A;  3L73 J;  1EDL A;  3CLQ A;  2J58 A;  2A45 H;  4QCK A;  1VCK A;  1VQ6 P;  5CBO A;  4RJT A;  5APX A;  3MTU E;  1P84 I;  2HOD A;  1NAY A;  1BDC A;  1M7L A;  1URQ D;  1Y8A A;  2O1K A;  1SQX J;  3KXD A;  3N0Q A;  3AE4 C;  3B5N A;  2B1X A;  5AEU A;  2H88 C;  4WWI A;  3RL0 D;  1SQQ K;  1X0T A;  4DOJ A;  1PV3 A;  2OQQ A;  4Y99 B;  2XSH A;  2J5U A;  2YFI A;  3U1C A;  2P10 A;  4W80 A;  3O8Z A;  3VMH D;  2YKQ A;  4I6M C;  2BEZ F;  3AE1 C;  3BCC D;  1PP9 G;  5AW9 B;  1JY2 N;  3P8C E;  2L5G B;  2FKW B;  4NBH D;  1EXI A;  1ZLL A;  3L71 E;  1RF1 A;  3AEG C;  3BVH A;  3CWB E;  3H6P A;  3EQ2 A;  1L4A A;  3H1H J;  1XTG B;  3TGU G;  1L0N J;  1GDT A;  4L74 A;  4R4L A;  1Q82 Q;  1H89 A;  1KQL A;  1FZC A;  4RES B;  3I56 P;  2H89 C;  1FJK A;  3I5C A;  4IL6 X;  1KB9 I;  4EYY Q;  1M1J A;  2KXP B;  3OAK A;  3Q1M A;  3AE3 C;  3WU2 H;  3PRJ A;  1NH4 A;  5AW2 B;  1OIP A;  2FYN C;  2QJK B;  1T3J A;  5BU5 A;  2YFL A;  2E75 B;  1A02 F;  2J59 M;  2A06 D;  1NTZ J;  5EFW B;  3OA7 A;  2DE7 D;  2G3A A;  3BCC G;  4N6J A;  5APW A;  2IDB A;  3HD7 B;  5CJ4 A;  1JY3 O;  5AW4 B;  1FZA A;  1AQT A;  1Q86 Q;  2BCC D;  1LTI C;  2HMN A;  1GL2 B;  4D6T G;  1EZV G;  3WMM 0;  2W8Z A;  1IC2 A;  2HPC B;  4NPF X;  5CCH A;  4WBA A;  1H88 A;  3CXH E;  5TIS E;  1N86 A;  2A45 I;  3GHG C;  5CCG C;  2IZ1 A;  5KKZ C;  1OVR A;  2FYZ A;  3L75 J;  2XNX A;  4HKV A;  3HE5 B;  2ZYL A;  3L72 J;  4GIF A;  1G8J B;  2KUB A;  1VF5 B;  3H1K G;  4GOD A;  1OVV A;  3CX5 I;  2A06 G;  1NTM E;  1NTZ K;  3W68 A;  2WPS A;  4P1C H;  2Q9I A;  3MGN A;  4PD4 E;  3FWL A;  1ZW0 A;  2KNC A;  5GTH E;  2OYI C;  2E74 B;  1JCD A;  4LC1 A;  5KLI C;  2HG5 D;  3L74 D;  1J1D B;  1JB0 J;  4OGQ D;  1IZN B;  1PGJ A;  1SQB K;  3M06 A;  3HUS B;  1SQB J;  5CMZ A;  2N9B A;  3TDK A;  3HRN A;  2E74 D;  1QX8 A;  3G6E P;  1LTS C;  2YXQ B;  3H1L E;  1JOC A;  1M1J B;  1OFC X;  3VYI A;  2WSF J;  1NU1 K;  3M0D C;  3A0H H;  1FDO A;  2C9L Y;  3L71 G;  2FYU K;  2SPZ A;  2RH0 A;  2QJY B;  1JMM A;  1KFN A;  3TF5 A;  2M8R A;  4QUQ A;  3KQG A;  2E75 C;  5AVT B;  3H1L D;  1ZN5 A;  5APU A;  3S1K A;  4JBZ A;  5KLV J;  4XA4 A;  4BRY B;  3HD7 D;  3KZI E;  4H13 C;  4NBC D;  2NPS A;  2KSJ A;  3CI9 A;  1KYO I;  2CK3 H;  4I2L C;  2K9Y A;  4H44 B;  3CWB J;  1PGP A;  5APS A;  3CXH D;  4JPZ B;  3GF3 A;  2K37 A;  3G4S P;  3GZY A;  3LIE A;  5AW7 B;  2HMJ A;  1CZQ A;  2JKV A;  2E76 C;  4JYC A;  3AEA C;  2OYO A;  3II6 A;  1NTM D;  3TGU J;  4D6T J;  2QJK C;  1S5L H;  4LLH A;  2JO6 A;  1FS0 E;  3JC2 2;  1H0T A;  3VMG D;  1JTH A;  2OGU A;  3CC4 P;  1LTT C;  3PLN A;  3MD0 A;  3Q2Y A;  4NB8 D;  1RQU A;  3KPE A;  1X9V A;  4OGQ C;  1K73 Q;  1FZF A;  2P58 A;  2YKO A;  2E76 D;  1L0N E;  1P84 E;  1SQB G;  3AED C;  3TYY A;  4QDC A;  2CPS A;  1LTA C;  2XZR A;  1M1K Q;  1IJD B;  1SQV G;  3L75 E;  3GHG B;  4Y28 J;  1LTB C;  1GK4 A;  2NVE A;  1L0L K;  1GL2 D;  2FXO A;  3M9Q A;  2OYH A;  2NZ2 A;  3VOP A;  1A02 J;  3H1J D;  4EIJ A;  3B8E B;  1SS1 A;  2K9J A;  4NPD A;  2YIU B;  1AJY A;  3AEC C;  1EDI A;  2PAJ A;  4AYC A;  4IFM A;  1R5L A;  5CCG D;  1YTZ T;  2K3R A;  3H25 A;  2XSO A;  4I7Z B;  5CCG A;  1O7H A;  3GHG A;  1USE A;  4JYB A;  3O6Q B;  1X79 B;  1PIX A;  2E5Y A;  2E4P A;  4DT0 A;  2I8D A;  1MZ9 A;  5KLI B;  1L0L G;  3Q5S A;  3RK3 E;  4DJG A;  3JCU E;  3LW5 J;  3CX5 H;  4JQ0 D;  2YNY A;  2ZJS E;  1L4A D;  3P7K A;  1ULI A;  1IFI A;  5E79 H;  1CI6 B;  3C1L A;  2AXT H;  1Q2N A;  1YQ3 C;  1FQT A;  1USD A;  2NRG A;  2AEF A;  2OTL P;  1BCC G;  2HLO A;  2XU6 A;  5KAI E;  3K5B A;  5KAI H;  2E76 B;  2FYU G;  1FZE A;  1LTG C;  2KS1 A;  2O1J A;  4W7Y A;  3L73 D;  4TT3 H;  1U7J A;  2NUK A;  2KLV A;  3ABV C;  2WZ7 A;  3CCJ P;  3F5H A;  1PP9 E;  1NTZ D;  3CX5 E;  2YMY A;  3V4W A;  1VQ9 P;  1KIL B;  2OYH C;  3L35 A;  2HMM A;  4GT1 A;  1P84 D;  2QSI A;  3VMZ A;  1OXZ A;  3M0A A;  3T97 B;  1H8A A;  1KMI Z;  4H13 B;  2NVF A;  4HJL A;  3FX0 A;  1AV1 A;  2Z5H A;  3H1I J;  1EXJ A;  3SSU A;  2B9B A;  2M3B A;  3H1H D;  1N7S B;  4BXL A;  2DE6 D;  1DH3 A;  3SFD C;  1NWQ A;  3D70 A;  2QJY C;  5KLV K;  3RL0 C;  5AVR B;  1LWU B;  1NVO A;  1AA0 A;  2ZT9 C;  3MUD C;  2WT7 A;  2L91 A;  2Q7C A;  4HH2 A;  2KNC B;  2O01 H;  2PGD A;  2ZVO B;  4I1L A;  1NGM B;  3M9H A;  2UWJ E;  2V4H A;  3CX5 D;  2KK7 A;  1KV4 A;  3CXH H;  5TIS H;  4PD4 D;  2D2C C;  1L0L J;  5APV A;  3FGA D;  1WQL A;  1CSB A;  2FBW C;  1ZR2 A;  4OWF A;  1M90 Q;  1S72 P;  5AVV B;  4I7Z C;  1LJ2 A;  1GMJ A;  4WY4 B;  4OH8 B;  1BDD A;  2AEM A;  1RF0 C;  1SQQ D;  2IBZ I;  2ZAE B;  4PV1 B;  2WPV B;  1NKN A;  1NYH A;  5APT A;  1YJN P;  1NTK E;  3WU2 E;  2KIK A;  4TLF A;  1BE3 E;  1FDM A;  1YBK A;  1KYO E;  1SP4 A;  1BGY G;  3HD7 A;  2WSF H;  3GL0 A;  2ZXX A;  1NOH A;  3CMA P;  2KZI A;  2QJP B;  4W7Z A;  1PPJ G;  2JWD A;  5CHX A;  4U3F G;  2OYH B;  2N9Y B;  2YIU C;  1KC8 Q;  1WMK A;  2M0B A;  3LID A;  3R4Y A;  1WRG A;  1YHQ P;  3C8V A;  1QVG O;  3M0D A;  1JCC A;  3HTK A;  3M9B A;  4CPG A;  5HL4 A;  1G1I A;  3L72 G;  4HJG H;  1VQ4 P;  3CME P;  3IAO A;  1E5W A;  3CL3 D;  1PPJ E;  2K1A A;  1VF5 D;  2BEQ D;  3H1I G;  3D6Y A;  5KAF H;  1N73 A;  1BE3 D;  3B71 A;  3BRV B;  1FU1 A;  3EFF K;  1J1E B;  3VCP A;  1P84 H;  2WPR A;  4PJ0 E;  1GZL A;  2OTK E;  3SWY A;  4HM8 A;  3NXS A;  2XKM A;  1Q90 D;  1GU5 A;  1O7M A;  1KTM A;  1AVO A;  2E42 A;  4KJM A;  1JM0 A;  2YKP A;  1Q7Y Q;  3L73 E;  4NBB D;  2G8Y A;  3GZX A;  1J2J B;  3RBX A;  1NTM K;  1EDJ A;  1NU1 G;  4NBE D;  3L74 J;  1QVF O;  2YFJ A;  3B4S A;  3GCE A;  2KSE A;  3L36 A;  1DD4 A;  1RE3 A;  2Z4E A;  5KKZ B;  3I55 P;  3V2N A;  5AW6 B;  1OVU A;  1ZRT D;  4U3F J;  2BCC G;  2Q1K A;  2FY8 A;  2JEE A;  3GB4 A;  2FYU J;  4NBD D;  5KJ7 C;  5AVW B;  1RQV A;  2QA4 P;  1GL2 C;  1L2P A;  3HTK B;  3BCC J;  1K8A Q;  3FXD A;  4NPE A;  3QWO C;  2QRX A;  1RE4 A;  2ZVN B;  1JY3 P;  2RMZ A;  2I1J A;  4EMJ B;  3P8C D;  1QGK B;  1SQQ E;  2NUM A;  1K04 A;  3WUV A;  2XRX A;  5KLV E;  3D6Z A;  1J1D C;  3L71 D;  2LR2 A;  2GBW A;  3HUS C;  2P2U A;  3KDP B;  1NTK D;  3C0D A;  5BU8 B;  1JO5 A;  3FWN A;  2AXC A;  4H0L B;  3M91 A;  1SQX D;  2GA1 A;  1KQF B;  3SFE C;  1RFS A;  1GW3 A;  2JR8 A;  2Q3W A;  5APY A;  4WY4 C;  3RK2 C;  1S2E A;  3GF7 A;  4PV1 D;  5KJ7 A;  4HM4 A;  2CPB A;  4IFF A;  1T2K C;  3ITK A;  2KZJ A;  1L0L E;  2Q3E A;  3H1K E;  1RF1 C;  3A5T A;  1EG9 A;  4YTP C;  1O7W A;  4C46 A;  3VP9 A;  3RBZ A;  2QE7 H;  2E75 D;  4H44 C;  2BMQ A;  1GD2 E;  3TGU D;  1NTM J;  1M57 D;  2W83 C;  1PL5 A;  5DJT B;  3CWB D;  1Z56 A;  3A2A A;  1N73 C;  3GG2 A;  2Q6Q A;  3G9R A;  4WB4 A;  1J1E C;  1FDI A;  3H1I E;  1SQV E;  4A7P A;  2E74 C;  1LWU A;  1BSN A;  1VQP P;  5GTI E;  1SFC D;  1NO4 A;  3H1J G;  4DCK A;  1VQM P;  1L0N G;  3CCS P;  1SFC A;  1RHZ B;  1N7S A;  1SQQ J;  1Y9B A;  2R3S A;  1N7S D;  3H1K J;  1LP1 B;  2Z5I A;  4PD4 I;  3IR9 A;  2QM7 A;  3L70 G;  4XE5 B;  5GTI H;  1PP9 J;  2RN0 A;  1MFZ A;  3PH0 A;  1YTZ I;  1G2C A;  2ZT9 D;  3EFG A;  4K3A A;  1LGH B;  2IYO A;  4HM7 A;  1L0L D;  1UII A;  1SQB D;  1VQ5 P;  2V7Q H;  3MIW A;  5AVY B;  2OAR A;  4L75 A;  1K05 A;  2HR3 A;  1NHL A;  2Q5U A;  4HM5 A;  2WQY C;  3V2R A;  5AW5 B;  4IFD K;  3H1K D;  1FAV A;  5AVU B;  3KYQ A;  1NJI Q;  1LP1 A;  2IFM A;  1KB9 H;  5APQ A;  4ZKU A;  2FYU D;  3L75 D;  2POH A;  3BCC E;  1LTJ C;  5BVZ A;  2NPS D;  3L70 D;  4YXD C;  4H0L C;  1HJ0 A;  2C9N Y;  1SJG A;  2NWF A;  2B87 A;  2HOD B;  1NTZ G;  4HM1 A;  1EDK A;  1GTW A;  1KIL E;  2I7F A;  3GOB A;  1OW8 A;  1R8E A;  4QDD A;  4BWN A;  1Q81 Q;  4L76 A;  3L37 A;  1EZV I;  2N1T D;  2O01 J;  3JSV C;  1Y47 A;  2QG4 A;  3U59 A;  3AEE C;  2GBX A;  2W90 A;  1YJW P;  2HML A;  3CCM P;  1VQN P;  1VQ8 P;  1BGY E;  1LT9 A;  3HE4 B;  2B88 A;  5KLV G;  1PFI A;  2VRS A;  1VQL P;  3BAS A;  1S1C X;  1SQX E;  1YJ9 P;  2KB7 P;  4IOI H;  1BCC D;  1HBW A;  3A7O A;  1LTJ A;  3H1H G;  3CXH I;  3E1I A;  3U1A A;  1O7G A;  1NU1 E;  3NTN A;  1R5S A;  1X22 A;  3TNU A;  1KYO D;  1BGY J;  4IL6 E;  4QMA A;  1JY2 O;  2Y0D A;  4WVZ A;  5CCH D;  2KI7 B;  2IBZ D;  3TNU B;  1SQP K;  3W67 A;  4HKZ H;  1GK6 A;  3RK2 B;  2O01 N;  3EWK A;  4QUP A;  2NVG A;  5CBN A;  2DE5 D;  2Q3I A;  2AEJ A;  4D6T E;  3RGU A;  2IBZ E;  1UUW A;  4N78 E;  4NBG D;  5DJU B;  5KLV D;  2FXP A;  1MFT A;  1DX7 A;  4JF7 A;  1KFM A;  1HF9 A;  4Z1M H;  2HFE D;  3L74 E;  1SQP G;  3VMA A;  3N4X A;  1BCC E;  5KAF E;  1N7S C;  2JP3 A;  2A45 G;  4H0L D;  1ULJ A;  4GDO A;  1YYC A;  2FFD A;  3CCV P;  4K35 A;  2NPS B;  4EOT A;  1LT9 B;  2QIW A;  3NFQ A;  4QUR A;  1JTH B;  1DD3 A;  5B5E H;  3VMI D;  3F89 A;  1EC5 A;  2XV5 A;  3TSI A;  3AE2 C;  2ZFC A;  4B86 A;  4P1B H;  3A0B E;  3A3Y B;  2QM8 A;  1HVV A;  4QDF A;  4RO0 A;  2PRR A;  1UUV A;  1RE3 C;  1MV8 A;  4U3F E;  2H43 A;  2JWA A;  3CC7 P;  1KIL D;  2ZYG A;  4H44 D;  3AE8 C;  3CCR P;  1RIE A;  1M8O B;  1YI2 P;  1S9K E;  3L72 D;  3D89 A;  1G2C B;  1IK9 A;  4D6T D; 
#chains in the Genus database with same CATH homology
 1VM9 A;  4AAY B;  2E4P A;  3H1H E;  2DE6 D;  4HKV A;  4D6T E;  2D2C D;  2ZYL A;  3BCC E;  3EN1 A;  2IBZ E;  3TGU E;  1UUW A;  3GZY A;  2QJY C;  2B24 A;  4HM0 A;  4NBH D;  4QDF B;  2QJP C;  2YIU C;  3GL2 A;  2HMJ A;  4NBG D;  3GKE A;  3L71 E;  1G8J B;  3EQQ A;  1NYK A;  3L72 E;  3GTE A;  3CWB E;  2QJK C;  1SJG A;  1NTM E;  4AIV A;  2JO6 A;  3H1J E;  4P1C H;  2NWF A;  1SQB E;  5BOK A;  3VMG D;  1ULI A;  1O7N A;  4EMJ B;  3H1I E;  4HM1 A;  4PD4 E;  1SQV E;  1SQQ E;  2NUM A;  2I7F A;  3GOB A;  3L74 E;  5HL4 A;  2HMK A;  2XRX A;  5KLV E;  4QDD A;  1FQT A;  1BCC E;  4NB9 D;  3L70 E;  1NDO A;  1O7P A;  1ZRT E;  2GBW A;  4H0L D;  5KLI C;  2A06 E;  5AEW A;  1JM1 A;  1ULJ A;  4NB8 D;  3C0D A;  1PPJ E;  1VF5 D;  4OGQ D;  4QCK A;  2YVJ B;  1VCK A;  3GTS A;  2GBX A;  2FYN C;  2BMR A;  2HML A;  1BGY E;  4NBA D;  2E76 D;  2E74 D;  1L0N E;  1WQL A;  1P84 E;  2YFL A;  4QDC A;  4QUR A;  1RFS A;  1SQP E;  3VCP A;  3VMI D;  2BCC E;  2DE7 D;  2Q3W A;  1SQX E;  2NUK A;  2ZT9 D;  4NBF D;  3H1L E;  3L75 E;  4HM8 A;  4PV1 D;  2BMO A;  2NVE A;  1NTZ E;  1PP9 E;  4H13 D;  4HM4 A;  3CX5 E;  2FYU E;  4P1B H;  1O7G A;  1NU1 E;  3N0Q A;  2E4Q A;  4HM7 A;  1O7M A;  4HM6 A;  2B1X A;  4QDF A;  5AEU A;  1UUV A;  1L0L E;  4U3F E;  2HMN A;  3L73 E;  3H1K E;  1G8K B;  4NBB D;  2XSH A;  4QUQ A;  1EG9 A;  2HMM A;  4HM5 A;  3VCA A;  3GZX A;  4H44 D;  1O7W A;  2YFI A;  1KB9 E;  4NBE D;  3FOU A;  2XR8 A;  1EZV E;  1Q90 C;  2HMO A;  2QPZ A;  2YFJ A;  2JZA A;  3GCE A;  3CXH E;  2NVF A;  1NTK E;  4HJL A;  1RIE A;  2XSO A;  4HM2 A;  3VMH D;  3DQY A;  2E75 D;  4QUP A;  1BE3 E;  1O7H A;  2BMQ A;  4NBC D;  1KYO E;  2NVG A;  3AZC A;  5CXM A;  3D89 A;  4HM3 A;  2DE5 D;  3GB4 A;  3GL0 A;  5KKZ C;  4NBD D;  2CKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...