3CWIA

Crystal structure of thiamine biosynthesis protein (this) from geobacter metallireducens. northeast structural genomics consortium target gmr137
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
69
structure length
69
Chain Sequence
b'MNLTVNGKPSTVDGAESLNVTELLSALKVAQAEYVTVELNGEVLEREAFDATTVKDGDAVEFLYFMGGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiamine-biosynthesis protein ThiS
publication title Crystal structure of thiamine biosynthesis protein (ThiS) from Geobacter metallireducens.
rcsb
source organism Geobacter metallireducens gs-15
molecule tags Biosynthetic protein
total genus 15
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2008-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3cwiA00
1CJEA 1JRPA 3AE5B 4WQMA 2M56B 2B76B 1FRRA 3P4QB 1VDVA 1I7HA 1RYJA 2CU3A 2QIEB 1NVID 1ZOYB 1EWYC 3FC4A 3NVZA 3AE9B 4YSZB 3W5UB 1RM6C 2W55A 2MH7A 2WLBA 1QT9A 2E3TA 1QOGA 3AE8B 4N6EB 2PKOA 4HRSA 5C2TB 1VLBA 1OQRA 2MJDA 1JWAD 4LTUA 4HROA 3EUB2 1KRHA 1WRIA 1JQ4A 5MPOA 1FXIA 3AEEB 3AEAB 3P4RB 5GXGB 2DBYA 2WS3B 1DOXA 4USAA 1E7PB 2PVOD 2ACZB 3HUIA 1L6UA 5EE0A 3VRBB 4A9AA 1R7SA 2H89B 1J7CA 1QF6A 1J7AA 1JROA 1JALA 1WYGA 3AV8A 2HTME 3AE6B 1L0VB 3VRAB 4US8A 1CZPA 1NYRA 1YJJA 2M19A 3LB8C 4JX1C 2BS3B 1FO4A 2K5PA 1WWTA 4C7YA 4YSYB 1KF6B 3CIRB 5C3JB 1PUTA 4YTPB 3AEFB 3L4PA 2WDQB 4YXDB 1UWMA 2MJEA 1AWDA 1QLBB 1YQ4B 3B2GA 1E9MA 1L6VA 1WGKA 2JQRB 2JX5A 2LEKA 2L52A 1FRDA 3AE4B 3BIID 3ZYYX 1VJKA 1ZP0B 3AH7A 1PDXA 1TKGA 2Y5CA 4IDIA 3SFEB 3AM9A 3AE7B 3SR6A 1NENB 1NI3A 3WCQA 2CJNA 5H92C 1N60A 3NRZA 3FAHA 3NVYA 4WWMA 4C80A 4ZHOA 2Q5WD 5G5HA 1L5PA 3HVZA 5EE3A 1WXQA 2W3SA 3NS1A 4ZOHC 3VR8B 1JW9D 1FXAA 1XLQA 3P4SB 3NVVA 5G5GA 1DOYA 3P1MA 1TKEA 1KFYB 4JWSC 1B9RA 1SB3C 1T3QA 1YQ3B 2WDVB 1XLOA 2CJOA 3AEBB 2EKIA 2K22A 4US9A 2W3RA 3AN1A 1OFFA 1SIJA 2DWQA 3AEGB 3AMZA 3CWIA 3PO0A 4N59A 3KWLA 2AX5A 3LXFA 3W9CB 2WP9B 3NVWA 4YSXB 3AEDB 2OHFA 1XLPA 2WU5B 2H88B 1V97A 1RFKA 1N5XA 2WQYB 3B2FA 5H8YE 2W54A 1N61A 1NEKB 1N5WA 3AE1B 3ETRA 1NYQA 2N0SB 4YTMB 1N63A 2PVGC 1AYFA 2FBWB 1YJIA 1JWBD 3AECB 1QOFA 1DGJA 4YT0B 3VR9B 2KMMA 1GPXA 5AUKA 3P63A 2QJLA 4C7ZA 2L83A 3AE2B 2KAJA 4ZHPA 1ZUD2 1FIQA 2WU2B 1ZXIA 1RWSA 1E6EB 1XO3A 1IUEA 1FM0D 2BS2B 3DWGC 1GAQB 1QOAA 1TYGB 1FMAD 2BT6A 3HRDD 1FFVA 1J7BA 1FFUA 4ITKA 1F0ZA 3SFDB 4KX6B 1XLNA 4JWUC 1QOBA 1OQQA 1TJEA 2BS4B 2WDRB 3P4PB 1V8CA 1ROEA 3DWMA 3W5VB 4YTNB 3AE3B 5EE9A 3ABVB 4N58A 2G1EA 1N62A 3AB5A 1SF0A 1E10A 1TKYA 2K9XA 1A70A 4P6VF 1E0ZA 4FXCA 2MJ3A 2PIAA 3B9JA 5EE1A 1PFDA 3RPFC 1DOIA 5AUIA
chains in the Genus database with same CATH superfamily
1CJEA 2KO3A 4MH8A 4KIKB 3A1QB 1WFYA 1Q0WB 3L54A 2KNBA 3AE8B 1IGCA 3NUHB 3ZNZB 2V3NA 2MJDA 5BYSA 1CK1A 3NG0A 1JQ4A 1Y8RC 3AEEB 4W9HA 1TZ1A 3TMPB 2DNFA 3CSFA 4IUMB 5BO4B 3SD5A 4KDLB 2QDFA 3ZTDA 3Q6BA 1SJED 2BYVE 3AE6B 2WXGA 1YJJA 2CHWA 2C7MB 2DAFA 4HXDA 4HJGE 1UELA 1SXTA 2RDHA 1PUTA 3DBHB 2D3BA 2MJEA 4MJSA 4ARCA 3ONSA 2NVUI 1WI0A 2ZZPB 1EU3A 4W9GA 3WCQA 2L1AA 5AZFA 4K3BA 4MSQB 1D5XC 5G5GA 3ZRCA 5FR6A 1QZEA 1CMXB 4WWPA 3WIMA 4OVVA 4C56C 1C4PA 3W2DA 3KWLA 4F8CB 4DWFA 3LDZE 1WIAA 3TEYA 1GC6A 2KDBA 1N63A 3AECB 4JGHB 2WXQA 3B08A 1XD3B 3QX1A 4C7ZA 4ZHPA 2K8CA 4W9EA 1NDDA 1FPYA 1RLFA 3SEBA 4MDKE 2HDEA 2QMTA 4A8XC 4HDOA 1WGHA 2G3QB 3AE3B 3QWZB 1VZ7A 3AB5A 1F9JA 1E10A 3ENEA 2J0MA 3L17A 2M8SA 3V61A 5BMHA 4MJSB 2DYBA 3P42A 2Y5PA 1KJTA 3BZDB 5CX3A 3X0WA 5HI1A 3VH4B 3PPAA 2YVCA 1ZPSA 1VCBA 1MVKA 4KGTA 4EKUA 4II3B 3DBRI 1C3TA 2WX0A 4M8MA 4HROA 2KXJA 2C7HA 4MT5A 2KWVB 2N4FA 2PPHA 2J4XA 3R7QA 1KLGD 4L1BA 4E74A 2ACZB 3PGEA 3EFCA 2WXKA 4G50A 1ZE3D 1JALA 3MP9A 2DX5B 4ZRQA 3RNBC 1KLVA 4HVBA 2Y5BB 1PGXA 1YQBA 2IPKD 4C7YA 2V3SA 4W9DA 4YXDB 1YN4A 2AQ3B 4BKSA 3Q8FA 4M01A 3AM9A 2PW9A 2WYQA 3AE7B 2KMAA 1SGHA 2ZW0A 4MSMB 1K52A 1N60A 3U7DA 3UIOB 3Q8CA 1C4CA 2I38A 3AMZA 3V60A 2WP9B 4LJOB 1RFKA 4W9CA 1LM8B 4MGZE 4XWTA 5H8YE 4BZAA 4W9KA 3VR9B 4YT0B 4BFRA 3U52E 1L2NA 2DZJA 5KHOA 2KTFA 2PE9A 5BMIA 2GBJA 2D3GA 4GN1A 3ZDMC 3HRDD 1SJHD 4RF0A 4CHKA 1EF5A 2BS4B 4G3XB 1SIFA 4K7UA 3TJPA 2FAZA 4HLEA 2BYFA 2D3AA 5AZGA 2E6XA 1HE8A 5JZEB 2LRWA 4QAYA 3I9V1 3RPFC 2K0PA 5IAAC 2KKCA 2FCSA 2MX2A 5JHBA 1VDVA 2CU3A 2KC2A 1TZOA 1RM6C 4GLSC 4H2AA 2L32A 4ICUA 3AEAB 1E5WA 1WF9A 3CMMB 4B6WA 3HUIA 1WGYA 1X1MA 2BBCA 3IHPC 1J7AA 3HK0A 2OOBB 5L83A 3NHEB 1CZPA 3H8HA 5D94A 5J2RA 2XNAC 4I6PA 4BVUC 1D3ZA 1XF5L 2LZ6A 1KTKA 2J0KA 2V4IB 2LEKA 1FRDA 3JYUA 1C78A 3TEZA 1FCCC 1GB4A 1NENB 2QCZA 3TIXA 3IAM1 1YMHE 3FAHA 2X38A 3Q14C 4K7SA 4MH0E 1WX8A 4UDUC 1MPEA 3AEBB 3ZO5B 3TCAA 3V62A 3W9CB 3LXFA 3E9SA 1ZKHA 2QILA 4LDTB 1N5XA 2WQYB 3A9JA 4WAFA 2W54A 2N7DA 3PSEB 3ETRA 3ZQ4A 2KK8A 4GU2A 2KQ4X 2YEPB 1R4MB 4EEWA 1ZUD2 2KJHB 1YNTE 3DWGC 3GE8C 1Z5SB 2IO1B 1J7BA 1FFUA 1WM2A 4HKZE 4JE3B 5DPWA 2WXRA 4MGKE 2JZPA 4R3DA 4AP4C 5LXHA 3RD2A 3C8YA 3RNFC 1FNVA 1MI0A 4BOSC 1JRUA 2WXFA 3QJZA 1A70A 4FXCA 1YN3A 5HHDG 1DOIA 2L7RA 2A5UA 4E71A 2ZPYA 3OAWA 4F1SA 1R4NB 3BVGA 4G11A 2C9WB 5JXVA 1I4QA 3W5UB 2MH7A 1QT9A 1K8RB 2INDC 2DENB 1JWAD 3T8MA 3EFUA 2WS3B 3M95A 1K53A 3HVDA 1E7PB 5EE0A 1IBXA 1WXAA 2KWDA 4J6IA 1WYGA 3AV8A 3U30A 3DOWA 1RFAA 3VRAB 1LQBA 2K6DB 1FO4A 1UBIA 3DBSA 1V6EA 3BY4B 5TSSA 4S17A 3WAMA 1UWMA 2QEJC 2LXAA 4WURA 5JH5C 3UGBB 1PDXA 4MGYE 3V6CB 4NQKE 1WGRA 1S3SG 2V0GA 1V1OA 1QQRA 2PTLA 5EE3A 2BTEA 1WR1A 4HKQA 2N9PC 1B9RA 2K22A 4AS1A 5DCNA 4A90A 3I57A 4BBNC 2BKFA 4HPMB 3Q8BA 4OZCA 3N1YC 1AYFA 1DGJA 3VDZA 4EZLA 4KGSA 1ZDXA 1TS4A 2ONQA 3MHZA 5E6PA 2WU2B 3ZXRA 2N1VA 2WXIA 4KDIC 1IBXB 3U4EG 3NS8A 3DBLB 1SE2A 4HPPA 2N9EB 1UGJA 2LHDA 4DHJB 3AU5A 2KX3A 2ICIA 2IJ0A 4P16A 4LK0M 3R66C 2J7QB 4BAXA 2WXPA 1MG8A 3IXSA 4ZRJA 3FKYA 2C60A 2IGDA 3HIZA 2G4DB 2XEWA 4ARIA 1VR9A 3FC4A 3NVZA 3IFWB 4GDLB 4C4VA 4XZ4A 3L0WB 3TBLD 2MP2A 2WGSA 1XCQL 4JLCA 2L76A 2BB5A 2BF8B 1V49A 1PYWD 4WH4A 2BB6A 1WY8A 1E90A 3MJWA 4IWQA 4ASWC 1C77A 3APCA 2FNJB 2O6VD 3GS2A 2LXCA 1SSNA 3OWEB 1E8XA 2CHZA 3J9CA 2RSUA 2J52A 3B2GA 4M0WA 1I4GA 1E9MA 2BGFA 2JQRB 2KHWB 3OJ4B 4EUTA 4TKNA 1TKGA 1PGBA 4I6NB 2RPQA 1STEA 5IKCM 2KWCA 2FCNA 2W3SA 1WXMA 2GBNA 5J18A 2IDYA 4LNNA 1KFYB 1YQ3B 1IPGA 2KOXA 3DHHC 1WRDB 4N9F4 2FUG1 4RNAA 1SIJA 3W1YA 3MFGA 5G55A 2KQ7A 3D32A 3QA8A 2L0FA 2M1MA 2MP2B 2N0SB 4KIKA 3GZNB 4FBJB 2IO3B 4A6QA 1RWSA 5T8IA 3JVZX 4W9JA 3OJ3A 1TS2A 2KT7A 3T9LA 1AW7A 4KX6B 2OEDA 2KWUB 2WDRB 4PS7A 3QAQA 2INCC 1VD2A 2W82A 2KDFB 1IYFA 4IW0A 4IWOA 4M0WB 3DVGX 3W1SC 4L2YA 1FRRA 2YLMA 3A33B 4XC2A 1RYJA 4XE0A 2QIEB 1NVID 2IO0B 1EO6A 1OQYA 1T5XD 4W9FA 4M00A 3H9DA 2GBKA 1YJ1A 1VLBA 1OQRA 2NR2A 3EUB2 1KRHA 5MPOA 4WJOA 3IG3A 3PRPB 1L6UA 1C76A 1YX5B 3RI7C 2UYZB 2JRHA 4REZA 3WA0A 2PE6B 3VQIA 2KDEB 2K8BA 2JVCA 4US8A 3RZWC 2J53A 3KUZA 2LWPA 1D6EC 3P2BA 1AWDA 1WGKA 2MRPA 2L52A 3BIID 4BBNF 2BKRB 3Q3MC 2JWUA 3SFEB 2QC8A 1OGWA 4OZBA 3M63B 1NI3A 4ANWA 1AARA 1ZXHA 4ZYNA 3NVYA 2DZIA 3DVNV 1T0SC 3PHXB 4ANUA 3KH0A 3Q3FA 3VTWA 1JWMD 2MBOA 2JU6X 1UUPA 4MELA 1EU4A 1IGDA 2AX5A 3I5JC 3ZUNA 2WU5B 2H88B 1J19A 4XDCA 1B1ZA 1N5WA 2RD0A 2RGFA 5EDSA 5LXIB 4B9KA 2AQ2B 2FUHB 4HEA1 3A4SC 2BS2B 1G6JA 1BUIC 1PQSA 3Q3OC 1FXTB 4YTNB 4YWGG 1NI2A 3ABVB 2JXXA 1C4AA 2K8HA 1E0ZA 5IN7A 5EE1A 1HTOA 1H8CA 2M4NA 3P4QB 2GB1A 5AEKB 3AE9B 3MC9A 3VUXA 1QOGA 4KZCA 2KVRA 4FLHA 4FJYA 4P1BC 4WJNA 5HKHA 2M0XA 3L08A 3HHMA 2JPHA 4PS3A 1J7CA 1EM7A 3ML9A 3R8BA 3IT6B 2ZCBA 2YEPF 4JIOU 1NYRA 2AL3A 4JX1C 2K5PA 4ACFA 2IBIB 2B3AA 2BVCA 2ZVOA 1WR6E 3L4PA 2JX5A 2AL6A 3DCGA 3AULA 2MW5A 1WH3A 4AOFA 4NQLB 4DXGA 2MQJA 2D11A 1HZ6A 2MWSB 2L05A 1WXQA 2G9HD 1XLQA 2JWZA 2LHEA 2N9LA 5JHAA 4MGIE 3CWIA 3NVWA 1BMLC 2LASA 1Q10A 1UGMA 4A3OA 2CR5A 2LGYA 3DVGY 3C19A 3P63A 3RNAC 2K6QA 1RAXA 1GAQB 1QOAA 1WE6A 2K25A 3APDA 1V8CA 3W5VB 1ZW7A 3OLMD 1JWUD 4BOZB 1Q1OA 1FD6A 2K9XA 4C00A 2MA9B 3BK1A 3TEXA 2MJ3A 4GMVA 4W9LA 2B76B 3PLVA 5FKAC 1I7HA 2KN5A 2K3UA 1ZOYB 2O2VA 1I4PA 1GUAB 2KD0A 3FILA 2ZJDA 2PJHA 1TTNA 1C9FA 1IP9A 3E56A 2MBHA 4FHJA 2NBVB 3IAS1 3VAWA 1R7SA 4FULA 2HTHA 3NZUA 1QF6A 4MACA 4GGQA 4A3PA 2KDMA 2DYOA 4M8NA 5BMGA 2DHZA 2ZEQA 1F52A 2INNE 2LRUA 2N7JA 1JWSD 5C3JB 4LJPB 1L6VA 1FCLA 2BWES 3GB1A 5D2MB 2Y5CA 1R4NI 3DBRB 1K50A 3OG5A 1LGRA 1F77A 1L4DB 3X23A 3BINA 2XBBC 3VFKA 4ZHOA 3PT2B 1GJZA 3PZ8A 4XYCA 3P4SB 2CU1A 4NNJB 1DOYA 2RR9A 4KSKC 5AZHA 2LVQA 1E8ZA 2IZVB 2DLBA 1UH6A 2O2VB 3L16A 4KZ0A 4URKA 4IG7B 4BKSD 3FILB 2INPE 4IM2A 3VTVA 1T0QC 1QOFA 5AUKA 4WWNA 1FIQA 4WAAA 4RF1A 2LI5A 1WZ0A 3N9YC 1GC7A 2ZCCA 4ICVA 3Q8AA 1I4HA 4FJVB 1ROEA 1XT9B 3W1SA 3L13A 3QC8B 3DVNU 2REXA 1HTQA 2ON8A 1L7YA 5IP4D 4K81A 4KKJA 4HK2A 5D6JB 4E3CA 1JMLA 1OTRB 1OEYJ 3DPDA 2HJ8A 2WWZA 2IGHA 2DZKA 2N7EA 1DYQA 3PZDA 2Z8LA 3RFZB 5IOIA 1KOTA 4CYEA 2JYTA 3O13A 4WIPA 4XWWA 1L0XB 2KJ6A 3BK2A 3VRBB 3DBLI 3QCAA 1C1YB 4F7ZA 3RMKC 4II2B 3EGRA 4RH6A 2FCQA 3MHSD 2K1FA 3N1XC 3ZJTA 2VRRB 2ZNVC 3I3TB 3GP7A 2J42A 2KZRA 2KACA 2WXLA 3AI5A 2V4LA 3BYYB 4EFOA 2MHJA 2BPSA 3Q3JA 4DQOC 2L0TA 5G5HA 2OJRA 5J17A 2FIFA 4RMAA 2VZKD 3P1MA 4JWSC 2ASQA 3K9OB 3RYTA 2KMCA 3MC0B 3ZJUA 2N9KA 2EMSA 4US9A 1OFFA 3AEGB 4ANXA 2PMVA 1WM3A 2LGDA 4FA6A 3B2FA 2MBBB 1BXTA 4G0NB 1N61A 3ZNID 1UD7A 2PVGC 2GLSA 4ZRPA 1GPXA 1C79A 4GDLA 2WDTB 5LNK1 4XGAB 5L95C 2MSED 4HCNB 1YOVB 3DWMA 2ZPNA 4N58A 4RGOS 1MJDA 1SF0A 4A20A 2WNMA 2PIAA 5CHFA 2R2QA 2IGGA 2KYWA 5CHWA 4GIVA 4NJCA 3PTFC 2JUOA 1T0YA 1Y56A 4KVGB 1YX6B 1I42A 4S0RA 3O65B 4LTUA 1WXSA 1TS3A 1XCTL 2W9NA 3RNCC 2DBYA 4JQWC 4A9AA 1TT5B 3VTUA 1F2RI 4IWPA 3ZLZA 2LGIA 4B0EA 3IT4B 2I2YA 4OVUA 5E6NA 3V6EB 4EZJA 2MLBA 1V1PB 2O6VB 3AEFB 3N30A 4YTPB 1QLBB 3RULA 3T3OA 4GSWA 2NCNA 4NJ7A 3AE4B 3WANA 3AH7A 3ZDTA 3PRMB 2JZ3B 3VHTC 4D2KA 1WXVA 2G4SA 3H7PA 2Z0DB 3AXCA 1FXAA 2LJIA 3R3MA 1M4VA 3T3NA 2R2OA 1T0RC 3PO0A 2PLPA 3U8ZA 2GBRA 2CKHB 2QHOA 4NJ6A 1V97A 2OJWA 5CTRC 3QIJA 3I63C 1NYQA 2V1YA 4IM0A 3TUOA 4AJWA 1XQQA 4K1RB 3AE2B 2WXJA 4ZYSA 2JXTA 2GI9A 4LNOA 3SFDB 3CSTA 2N9XA 2JRIB 3Q3NC 3PVLA 2G1EA 2FCMA 1MG4A 2Z59B 4LNFA 4TUUA 2Z0EB 1TY0A 3EC8A 1E8WA 3AE5B 2M56B 1J8CA 3DBHI 4YSZB 2LMCA 3H7PB 2BW2A 1N6ZA 1UZXB 1V5TA 3IBEA 4FHKA 4NPNA 4RGTA 4HJKA 1FXIA 3NY5A 1DOXA 1RRBA 3NZ3A 2LJ5A 4ZRIA 4XX5A 3ZVVA 3MJ5A 1D4BA 1L0VB 3V3XA 1UBQA 4YSYB 3ECIA 3CIRB 3PS6A 5KHQA 3SDLC 1VJKA 3ZW3A 5C23A 3ZGZA 1E8YA 2MEKA 2KTRA 3H7SA 1V9JA 2KLCA 3NRZA 1WE7A 1WJNA 3H1UA 2NTSA 4GDKB 1HQRD 3VH3B 3ZIMA 3N20C 2WDVB 2EKIA 2BYEA 4WWMA 3Q69A 1H4RA 4IC7B 3KYDD 2M17A 3ZKJC 2KN4A 2WX1A 4OHJA 3WALA 1Z2MA 4DHZE 2C5LC 2QJLA 4HCPB 1MHHE 3TL5A 1TYGB 2HE7A 4WJQA 3WAOA 4YL8A 4KKIA 2KQSA 3K9PB 2BWFA 2BYTA 1EF1A 4DHZB 1MHXA 2NPTA 1GOZA 2KTRB 3VUWA 4DK5A 3N1ZC 5BYQA 2PKOA 4HRSA 2D5GA 5C2TB 4RM8A 4WQOB 3UQAA 1NBFC 3HM6X 3N32A 2RPVA 4USAA 2PVOD 2CHXA 3BYTB 3RZFA 5LLIA 2VH1A 4LNKA 2GBMA 1V2YA 3UQBA 3KQ4A 1T6BX 1KF6B 3RUIB 2KDIA 4TSSA 4LCDE 5E6OA 3RNGC 3SR6A 1P3QU 2WXHA 4L23A 4DBGA 3HVZA 3URYA 2G45B 2V3PA 1SB3C 1T3QA 2KC1A 3EA6A 1XLOA 2AYOB 2LVPA 2NPTB 4KSLC 5D3DA 4J3OD 2LGXA 2IYDB 1WX7A 1LFDA 3ZNHB 4PS8A 3VVWB 3B1LX 1AN8A 2LD9A 4IM3A 1YD8U 1E7VA 3PV1A 2AQ1B 1XO3A 1IUEA 1FM0D 1FMAD 1FFVA 3RN9C 1ET6A 2ZNVB 4NY0A 1K51A 2MCNB 3DHGC 5CHVC 5EE9A 4Q2JA 3M62B 2WXMA 4RCOA 1HXYD 4EOYA 5BYRA 3TEWA 2LGSA 3HM3A 3SU8X 1F2RC 1D5ZC 5IA7A 1UWXA 2FE8A 3GOEA 1P7FA 1VRAB 1YIWA 4B95A 1WRIA 1SBBB 4GXBA 4PYZA 4WJPA 3IVFA 4OVZA 2RDBC 2DZMA 3VUYA 3DHIC 1FNWA 4DXAB 3DQVA 4GOCA 3LB8C 1Q5WB 5TR5A 1U4AA 4KGRA 1I4RA 1V5OA 2WDQB 2V9HA 3BVZA 1ISNA 5DPSA 1EUVB 1R4MI 2KFKA 2WXNA 1D5MC 4JPSA 3KUDB 4C80A 3KLSX 3EECA 4NAMA 3PREA 3B0AA 5DPTA 3NVVA 1TKEA 3ZJVA 1TIFA 1QKZA 2DAJA 1L4ZB 1V81A 2W3RA 5C1ZA 2IO2B 3C0RB 4N59A 1KM7A 3QQ8B 3M3JA 2MBQA 4OW0A 3EHVA 3KYCD 1V80A 2A4ZA 4YTMB 1YJIA 2EMTA 1P9DU 4BKGA 5GMVA 1TS5A 2IY1B 1ZXIA 2TSSA 1WX9A 1WZ3A 4ZDVA 4ITKA 1J0GA 4IOIE 2CS4A 4ZRKA 3P4PB 1OQQA 4ANVA 4OZAA 1WGGA 1N62A 2LFIA 2AEHA 4TQ0A 3H6NA 2ZVNA 4JL9A 4WQMA 3A4RA 2D3CA 3ZXVA 2KFKB 3DDCB 1EWYC 4XDDA 4CQNA 1P7EA 2KFJA 3MTNB 4N6EB 3ZTCA 1SEBD 4MM3A 1ACCA 3P4RB 3PHWB 5E6JA 2QSDA 4EE2A 3JSVA 1P1AA 2JY6A 1JROA 4I6LB 4WWOA 3UINB 4RFBA 2M19A 1JCKB 3KWVA 2N1WA 3A9KA 2RDGA 4A55A 2JZZA 2ZW1A 1GG3A 3R2IA 1YQ4B 3ZYYX 4HPLB 4IDIA 4PYUA 4K3CA 2CJNA 2EKEC 2FIDA 2PEAA 3SHQA 4GB9A 2KJRA 1L5PA 4X57B 1QILA 2SAKA 3NS1A 2DYMA 4KV2A 3LYYA 1SE9A 2VZKB 3AN1A 4LDTD 3AU4A 2HD5B 2KX0A 2KANA 1KH0A 2I1JA 1I35A 3UIPB 4MM3B 3VXWA 1JWBD 3GE3C 2L83A 2KAJA 1WMHA 3JSVB 1XXGA 5HFYA 2BT6A 4K7WA 3PZ7A 1ZDVA 1UNSA 4JWUC 1TJEA 1MFWA 4FADA 1FNUA 2I1KA 2D2QA 3R2TA 3LJ3A 2GOWA 1TKYA 3A9KB 4P1CC 1PFDA 4LLGM 2AWTA 3A9JB 1JRPA 3RCZA 1EWCA 1WYWB 1V1PA 2O6VA 3R7RA 2WLBA 2Y3AA 1HZ5A 1M94A 2MBEA 3KUCB 1I4XA 1WGDA 2HJ1A 4BKTA 2VH2A 3KVFB 2XK5A 3Q8EA 2LVOA 3BWUD 1SE3A 4LNIA 3ML8A 1TGZB 1V86A 3ALBA 5D7GA 1ESFA 1WWTA 3V05A 4TQ1A 1UF0A 4AQ7A 2L8JA 1WMHB 2X8XX 1KLUD 3GZNI 4B0MA 3N3KB 1L0YB 1WJUA 3RNEC 5HG2A 1CQVA 5H92C 2JT4B 1YN5A 2L00B 1ET9A 1GNUA 4ZOHC 2D10A 4TV3A 1JW9D 3NJTA 1WJ6A 3ZNGC 2CJOA 2WHIA 2LUEA 1LO5D 2DWQA 1TBEA 3PRZA 2NS5A 2NBUA 4RGNA 1GB1A 4RM9A 2K39A 4NAWA 2J0JA 2KMMA 2KVZA 4DDID 2SEBD 3QARA 4AUQC 2XK5B 4DHJD 2GMIC 1OEYA 3JW0X 3L10B 4DDGD 1P0RA 1QOBA 2L3ZA 5DPRA 1HEZE 4TMAB 1ZGUB 1XEEA 3RT3B 3B9JA 4PT5A 2C7NB 4HDQA 5AUIA 2UU7A 4P7IA 2IY0B 2W55A 5I4DA 2E3TA 3BVMA 1TY2A 4O1NA 3QHTA 2JYEA 1F1HA 5GXGB 2GRIA 1VZ8A 1LXDA 2EELA 3Q2AC 3PLUA 4GDKA 2BQQA 2H89B 2NBWB 4FJZA 2XN9C 2HTME 4RGMA 5FR3A 3QK0A 2BS3B 4NAWB 1WSPA 5G2NA 3TSSA 2D07B 2LUMA 2JSVX 4C4VB 5FK9C 1A5RA 4EZKA 1ZP0B 1FEHA 2M0AA 3U7ZA 2UWQA 3A1QA 4NZLB 3UI3A 4PK1A 1E7UA 3WAPA 2Q5WD 1SE4A 2JF5A 3VR8B 4W9IA 2RMMA 2R61A 2NTTA 1S1QB 3APFA 3MC8A 3ZRFA 1ENFA 5D3IB 1VZ6A 2KLGA 3CF6E 1WJ4A 4YSXB 3AEDB 2OHFA 1XLPA 1HA5A 5IO9A 1NEKB 3AE1B 3KW5B 4HWIB 4DXFA 3S2AA 2FBWB 4IKGA 2NMQA 1P98A 1BT0A 1E6EB 4CO7A 2WXOA 1F0ZA 3NZSA 1XLNA 3NOBA 4FN2A 4M02A 3U2SC 3UF8A 4AJYB 4P6VF 4AWJA 1PGAA 4MEMA
chains in the Genus database with same CATH topology
1CJEA 1JMLA 2IGDA 4MH8A 4ARIA 1VR9A 3FC4A 3NVZA 1F2RC 1D5ZC 2IGHA 4GDLB 1UWXA 2FE8A 3AE8B 1IGCA 3NUHB 1DYQA 1P7FA 2MJDA 2V3NA 5BYSA 1VRAB 2Z8LA 3RFZB 1CK1A 1WRIA 1JQ4A 1XCQL 3AEEB 1SBBB 2JYTA 3O13A 4WIPA 2BB5A 1L0XB 3BK2A 4XWWA 1PYWD 4WH4A 3VRBB 2BB6A 4OVZA 1SJED 3EGRA 3AE6B 1FNWA 4RH6A 2WXGA 1YJJA 3LB8C 1C77A 3GS2A 1SSNA 4KGRA 3ZJTA 4HJGE 1I4RA 3GP7A 2J42A 3OWEB 1SXTA 2RDHA 1PUTA 2KACA 2WXLA 4M0WA 2WDQB 3J9CA 2J52A 2MJEA 3B2GA 1I4GA 1E9MA 3BVZA 2JQRB 3BYYB 4ARCA 1TKGA 1EU3A 1PGBA 1STEA 2WXNA 1D5MC 2L1AA 3WCQA 4JPSA 4DQOC 4C80A 3KLSX 5G5HA 2W3SA 4NAMA 1D5XC 5G5GA 2IDYA 3NVVA 2VZKD 3P1MA 1TKEA 1KFYB 4JWSC 3ZJVA 1YQ3B 1QKZA 3MC0B 3ZJUA 2N9KA 1L4ZB 4US9A 2W3RA 2FUG1 4RNAA 4C56C 1OFFA 1SIJA 3AEGB 1C4PA 3W2DA 2PMVA 4N59A 3KWLA 3MFGA 4OW0A 3B2FA 1BXTA 3TEYA 1N61A 2N0SB 4YTMB 1N63A 2PVGC 1YJIA 3AECB 4ZRPA 1GPXA 1C79A 2WXQA 1TS5A 4C7ZA 4A6QA 4ZHPA 5LNK1 1ZXIA 1RWSA 2TSSA 5T8IA 3SEBA 2HDEA 4ITKA 4IOIE 1TS2A 2QMTA 4A8XC 1AW7A 4KX6B 2OEDA 3P4PB 1OQQA 2WDRB 3DWMA 3AE3B 4OZAA 4N58A 4RGOS 1VZ7A 1N62A 2W82A 3AB5A 1SF0A 2LFIA 2WNMA 1E10A 4TQ0A 2PIAA 5BMHA 4L2YA 2IGGA 3P42A 2Y5PA 3BZDB 4WQMA 5HI1A 1FRRA 4NJCA 1RYJA 1ZPSA 4XE0A 2QIEB 1NVID 1EWYC 4XDDA 4CQNA 1T5XD 1P7EA 1Y56A 1MVKA 4KGTA 4N6EB 1VLBA 1OQRA 1SEBD 4LTUA 4HROA 1TS3A 1XCTL 1ACCA 3EUB2 1KRHA 5MPOA 4MT5A 3P4RB 2DBYA 2J4XA 5E6JA 2QSDA 1KLGD 4L1BA 4EE2A 2ACZB 1L6UA 1C76A 4A9AA 1F2RI 2WXKA 4REZA 1JROA 1ZE3D 1JALA 3VQIA 3MP9A 4RFBA 4ZRQA 4US8A 2M19A 1JCKB 3KWVA 2LGIA 4B0EA 3IT4B 2I2YA 1PGXA 2J53A 2IPKD 4C7YA 2RDGA 4A55A 1D6EC 1V1PB 4YTPB 3AEFB 2ZW1A 4YXDB 3R2IA 1AWDA 1QLBB 1YQ4B 1YN4A 2AQ3B 3ZYYX 1WGKA 3T3OA 3Q8FA 2L52A 3AE4B 3BIID 3AH7A 2JWUA 4IDIA 3SFEB 3AM9A 2PW9A 3AE7B 4OZBA 2ZW0A 1NI3A 1K52A 2CJNA 4D2KA 1N60A 1ZXHA 3NVYA 1L5PA 1QILA 2SAKA 3NS1A 1FXAA 2DYMA 2LJIA 1JWMD 1M4VA 3Q8CA 1C4CA 2I38A 2JU6X 3LYYA 2VZKB 3T3NA 3AN1A 1UUPA 3PO0A 2PLPA 1EU4A 1IGDA 3AMZA 2AX5A 2WP9B 2WU5B 2H88B 1V97A 1RFKA 4XDCA 5H8YE 1KH0A 4XWTA 1B1ZA 1N5WA 4MM3B 1NYQA 3TUOA 3VR9B 1JWBD 4YT0B 3U52E 2L83A 3AE2B 2KAJA 2AQ2B 2WXJA 4ZYSA 5BMIA 4HEA1 1XXGA 2JXTA 2GI9A 2BS2B 5HFYA 2BT6A 3HRDD 1SJHD 4RF0A 3SFDB 3PZ7A 1ZDVA 1UNSA 4JWUC 1BUIC 1TJEA 2BS4B 1FNUA 4YTNB 4YWGG 3ABVB 2G1EA 3R2TA 2E6XA 1TKYA 1C4AA 1E0ZA 3I9V1 5EE1A 1PFDA 4LLGM 3RPFC 1TY0A 2K0PA 1JRPA 3AE5B 2M56B 3P4QB 1VDVA 2GB1A 1EWCA 2CU3A 1TZOA 1V1PA 3AE9B 4YSZB 1RM6C 2WLBA 2Y3AA 2LMCA 1QOGA 2BW2A 4GLSC 1HZ5A 1I4XA 4H2AA 4RGTA 2L32A 1FXIA 3AEAB 1DOXA 3HUIA 3NZ3A 2BBCA 1J7CA 1EM7A 1J7AA 3Q8EA 3R8BA 3IT6B 3MJ5A 1D4BA 3BWUD 1SE3A 1L0VB 2YEPF 1CZPA 1NYRA 3H8HA 4JX1C 3V3XA 5D7GA 2K5PA 1ESFA 1WWTA 3V05A 4TQ1A 2XNAC 4YSYB 4AQ7A 3CIRB 1XF5L 3L4PA 1KTKA 1KLUD 4B0MA 2JX5A 2LEKA 2V4IB 1FRDA 1L0YB 1VJKA 1C78A 3TEZA 3ZGZA 1FCCC 1GB4A 2MEKA 4DXGA 1NENB 3IAM1 5HG2A 1CQVA 1YMHE 5H92C 1YN5A 3NRZA 3FAHA 1HZ6A 1ET9A 2X38A 1WXQA 2NTSA 4ZOHC 2G9HD 4GDKB 1JW9D 1XLQA 1HQRD 4UDUC 2LHEA 2WDVB 2CJOA 1MPEA 2N9LA 3AEBB 2EKIA 1LO5D 4WWMA 2DWQA 3Q69A 3CWIA 3W9CB 3LXFA 3E9SA 3NVWA 1BMLC 1Q10A 2QILA 4RGNA 1N5XA 1GB1A 2WQYB 4WAFA 2W54A 3ZQ4A 2KN4A 3ETRA 4OHJA 2KMMA 3P63A 2KQ4X 2QJLA 2YEPB 2SEBD 1ZUD2 1MHHE 1YNTE 3DWGC 1GAQB 1QOAA 1TYGB 1J7BA 1FFUA 4HKZE 4JE3B 2WXRA 1QOBA 2JZPA 4R3DA 1V8CA 1HEZE 4TMAB 3W5VB 3C8YA 1FNVA 1MI0A 1JWUD 4KKIA 1FD6A 1XEEA 2K9XA 2WXFA 3TEXA 3BK1A 2BYTA 1A70A 4FXCA 1YN3A 2MJ3A 3B9JA 4PT5A 5HHDG 1DOIA 5AUIA 2B76B 1MHXA 5FKAC 3BVGA 1GOZA 1I7HA 2K3UA 1ZOYB 1I4PA 5JXVA 1I4QA 3W5UB 2W55A 2MH7A 1QT9A 5I4DA 2E3TA 3BVMA 1TY2A 3FILA 5BYQA 2PKOA 4HRSA 2D5GA 5C2TB 1C9FA 1JWAD 4O1NA 3E56A 2JYEA 5GXGB 2GRIA 2WS3B 3IAS1 1K53A 1VZ8A 2RPVA 3HVDA 4USAA 1E7PB 2PVOD 3BYTB 2EELA 5EE0A 1R7SA 2H89B 1IBXA 1QF6A 2KWDA 4MACA 2XN9C 1WYGA 3AV8A 2HTME 4RGMA 2KDMA 5FR3A 3VRAB 2DYOA 2BS3B 4NAWB 1WSPA 3KQ4A 1FO4A 1T6BX 5BMGA 2INNE 5TSSA 2N7JA 1JWSD 1KF6B 5C3JB 3TSSA 2LUMA 2JSVX 1UWMA 2QEJC 1L6VA 1FCLA 4WURA 5FK9C 4TSSA 1ZP0B 1FEHA 1PDXA 2Y5CA 2M0AA 3GB1A 3U7ZA 3SR6A 1K50A 1F77A 1L4DB 4NZLB 3UI3A 2V0GA 1V1OA 1QQRA 2WXHA 4ZHOA 2PTLA 2Q5WD 4L23A 3HVZA 1SE4A 3PZ8A 5EE3A 3URYA 2BTEA 4HKQA 3VR8B 2RMMA 3P4SB 1DOYA 2R61A 2NTTA 2V3PA 1SB3C 1T3QA 3EA6A 1B9RA 1XLOA 2K22A 1ENFA 4AS1A 2DLBA 5D3IB 1VZ6A 5D3DA 4A90A 3I57A 4J3OD 4YSXB 3AEDB 2OHFA 1XLPA 1HA5A 3FILB 1NEKB 3AE1B 2INPE 4DXFA 3Q8BA 4OZCA 1AYFA 2FBWB 4IKGA 1DGJA 1AN8A 1QOFA 2NMQA 5AUKA 4KGSA 1ZDXA 1TS4A 2ONQA 3MHZA 1FIQA 2WU2B 2AQ1B 1E6EB 2WXIA 1XO3A 1IBXB 3U4EG 1IUEA 1FM0D 2WXOA 4RF1A 3N9YC 1FMAD 1FFVA 1F0ZA 1SE2A 3Q8AA 1ET6A 1I4HA 1XLNA 1K51A 1UGJA 2LHDA 1ROEA 3W1SA 5EE9A 4Q2JA 3U2SC 2ICIA 2IJ0A 4P16A 4LK0M 2WXMA 4RCOA 2ON8A 4KKJA 1HXYD 4P6VF 2WXPA 1PGAA 3IXSA 5BYRA 3TEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CJE A;  1JRP A;  3AE5 B;  4WQM A;  2M56 B;  2B76 B;  1FRR A;  3P4Q B;  1VDV A;  1I7H A;  1RYJ A;  2CU3 A;  2QIE B;  1NVI D;  1ZOY B;  1EWY C;  3FC4 A;  3NVZ A;  3AE9 B;  4YSZ B;  3W5U B;  1RM6 C;  2W55 A;  2MH7 A;  2WLB A;  1QT9 A;  2E3T A;  1QOG A;  3AE8 B;  4N6E B;  2PKO A;  4HRS A;  5C2T B;  1VLB A;  1OQR A;  2MJD A;  1JWA D;  4LTU A;  4HRO A;  3EUB 2;  1KRH A;  1WRI A;  1JQ4 A;  5MPO A;  1FXI A;  3AEE B;  3AEA B;  3P4R B;  5GXG B;  2DBY A;  2WS3 B;  1DOX A;  4USA A;  1E7P B;  2PVO D;  2ACZ B;  3HUI A;  1L6U A;  5EE0 A;  3VRB B;  4A9A A;  1R7S A;  2H89 B;  1J7C A;  1QF6 A;  1J7A A;  1JRO A;  1JAL A;  1WYG A;  3AV8 A;  2HTM E;  3AE6 B;  1L0V B;  3VRA B;  4US8 A;  1CZP A;  1NYR A;  1YJJ A;  2M19 A;  3LB8 C;  4JX1 C;  2BS3 B;  1FO4 A;  2K5P A;  1WWT A;  4C7Y A;  4YSY B;  1KF6 B;  3CIR B;  5C3J B;  1PUT A;  4YTP B;  3AEF B;  3L4P A;  2WDQ B;  4YXD B;  1UWM A;  2MJE A;  1AWD A;  1QLB B;  1YQ4 B;  3B2G A;  1E9M A;  1L6V A;  1WGK A;  2JQR B;  2JX5 A;  2LEK A;  2L52 A;  1FRD A;  3AE4 B;  3BII D;  3ZYY X;  1VJK A;  1ZP0 B;  3AH7 A;  1PDX A;  1TKG A;  2Y5C A;  4IDI A;  3SFE B;  3AM9 A;  3AE7 B;  3SR6 A;  1NEN B;  1NI3 A;  3WCQ A;  2CJN A;  5H92 C;  1N60 A;  3NRZ A;  3FAH A;  3NVY A;  4WWM A;  4C80 A;  4ZHO A;  2Q5W D;  5G5H A;  1L5P A;  3HVZ A;  5EE3 A;  1WXQ A;  2W3S A;  3NS1 A;  4ZOH C;  3VR8 B;  1JW9 D;  1FXA A;  1XLQ A;  3P4S B;  3NVV A;  5G5G A;  1DOY A;  3P1M A;  1TKE A;  1KFY B;  4JWS C;  1B9R A;  1SB3 C;  1T3Q A;  1YQ3 B;  2WDV B;  1XLO A;  2CJO A;  3AEB B;  2EKI A;  2K22 A;  4US9 A;  2W3R A;  3AN1 A;  1OFF A;  1SIJ A;  2DWQ A;  3AEG B;  3AMZ A;  3CWI A;  3PO0 A;  4N59 A;  3KWL A;  2AX5 A;  3LXF A;  3W9C B;  2WP9 B;  3NVW A;  4YSX B;  3AED B;  2OHF A;  1XLP A;  2WU5 B;  2H88 B;  1V97 A;  1RFK A;  1N5X A;  2WQY B;  3B2F A;  5H8Y E;  2W54 A;  1N61 A;  1NEK B;  1N5W A;  3AE1 B;  3ETR A;  1NYQ A;  2N0S B;  4YTM B;  1N63 A;  2PVG C;  1AYF A;  2FBW B;  1YJI A;  1JWB D;  3AEC B;  1QOF A;  1DGJ A;  4YT0 B;  3VR9 B;  2KMM A;  1GPX A;  5AUK A;  3P63 A;  2QJL A;  4C7Z A;  2L83 A;  3AE2 B;  2KAJ A;  4ZHP A;  1ZUD 2;  1FIQ A;  2WU2 B;  1ZXI A;  1RWS A;  1E6E B;  1XO3 A;  1IUE A;  1FM0 D;  2BS2 B;  3DWG C;  1GAQ B;  1QOA A;  1TYG B;  1FMA D;  2BT6 A;  3HRD D;  1FFV A;  1J7B A;  1FFU A;  4ITK A;  1F0Z A;  3SFD B;  4KX6 B;  1XLN A;  4JWU C;  1QOB A;  1OQQ A;  1TJE A;  2BS4 B;  2WDR B;  3P4P B;  1V8C A;  1ROE A;  3DWM A;  3W5V B;  4YTN B;  3AE3 B;  5EE9 A;  3ABV B;  4N58 A;  2G1E A;  1N62 A;  3AB5 A;  1SF0 A;  1E10 A;  1TKY A;  2K9X A;  1A70 A;  4P6V F;  1E0Z A;  4FXC A;  2MJ3 A;  2PIA A;  3B9J A;  5EE1 A;  1PFD A;  3RPF C;  1DOI A;  5AUI A; 
#chains in the Genus database with same CATH topology
 1CJE A;  2KO3 A;  4MH8 A;  4KIK B;  3A1Q B;  1WFY A;  1Q0W B;  3L54 A;  2KNB A;  3AE8 B;  1IGC A;  3NUH B;  3ZNZ B;  2V3N A;  2MJD A;  5BYS A;  1CK1 A;  3NG0 A;  1JQ4 A;  1Y8R C;  3AEE B;  4W9H A;  1TZ1 A;  3TMP B;  2DNF A;  3CSF A;  4IUM B;  5BO4 B;  3SD5 A;  4KDL B;  2QDF A;  3ZTD A;  3Q6B A;  1SJE D;  2BYV E;  3AE6 B;  2WXG A;  1YJJ A;  2CHW A;  2C7M B;  2DAF A;  4HXD A;  4HJG E;  1UEL A;  1SXT A;  2RDH A;  1PUT A;  3DBH B;  2D3B A;  2MJE A;  4MJS A;  4ARC A;  3ONS A;  2NVU I;  1WI0 A;  2ZZP B;  1EU3 A;  4W9G A;  3WCQ A;  2L1A A;  5AZF A;  4K3B A;  4MSQ B;  1D5X C;  5G5G A;  3ZRC A;  5FR6 A;  1QZE A;  1CMX B;  4WWP A;  3WIM A;  4OVV A;  4C56 C;  1C4P A;  3W2D A;  3KWL A;  4F8C B;  4DWF A;  3LDZ E;  1WIA A;  3TEY A;  1GC6 A;  2KDB A;  1N63 A;  3AEC B;  4JGH B;  2WXQ A;  3B08 A;  1XD3 B;  3QX1 A;  4C7Z A;  4ZHP A;  2K8C A;  4W9E A;  1NDD A;  1FPY A;  1RLF A;  3SEB A;  4MDK E;  2HDE A;  2QMT A;  4A8X C;  4HDO A;  1WGH A;  2G3Q B;  3AE3 B;  3QWZ B;  1VZ7 A;  3AB5 A;  1F9J A;  1E10 A;  3ENE A;  2J0M A;  3L17 A;  2M8S A;  3V61 A;  5BMH A;  4MJS B;  2DYB A;  3P42 A;  2Y5P A;  1KJT A;  3BZD B;  5CX3 A;  3X0W A;  5HI1 A;  3VH4 B;  3PPA A;  2YVC A;  1ZPS A;  1VCB A;  1MVK A;  4KGT A;  4EKU A;  4II3 B;  3DBR I;  1C3T A;  2WX0 A;  4M8M A;  4HRO A;  2KXJ A;  2C7H A;  4MT5 A;  2KWV B;  2N4F A;  2PPH A;  2J4X A;  3R7Q A;  1KLG D;  4L1B A;  4E74 A;  2ACZ B;  3PGE A;  3EFC A;  2WXK A;  4G50 A;  1ZE3 D;  1JAL A;  3MP9 A;  2DX5 B;  4ZRQ A;  3RNB C;  1KLV A;  4HVB A;  2Y5B B;  1PGX A;  1YQB A;  2IPK D;  4C7Y A;  2V3S A;  4W9D A;  4YXD B;  1YN4 A;  2AQ3 B;  4BKS A;  3Q8F A;  4M01 A;  3AM9 A;  2PW9 A;  2WYQ A;  3AE7 B;  2KMA A;  1SGH A;  2ZW0 A;  4MSM B;  1K52 A;  1N60 A;  3U7D A;  3UIO B;  3Q8C A;  1C4C A;  2I38 A;  3AMZ A;  3V60 A;  2WP9 B;  4LJO B;  1RFK A;  4W9C A;  1LM8 B;  4MGZ E;  4XWT A;  5H8Y E;  4BZA A;  4W9K A;  3VR9 B;  4YT0 B;  4BFR A;  3U52 E;  1L2N A;  2DZJ A;  5KHO A;  2KTF A;  2PE9 A;  5BMI A;  2GBJ A;  2D3G A;  4GN1 A;  3ZDM C;  3HRD D;  1SJH D;  4RF0 A;  4CHK A;  1EF5 A;  2BS4 B;  4G3X B;  1SIF A;  4K7U A;  3TJP A;  2FAZ A;  4HLE A;  2BYF A;  2D3A A;  5AZG A;  2E6X A;  1HE8 A;  5JZE B;  2LRW A;  4QAY A;  3I9V 1;  3RPF C;  2K0P A;  5IAA C;  2KKC A;  2FCS A;  2MX2 A;  5JHB A;  1VDV A;  2CU3 A;  2KC2 A;  1TZO A;  1RM6 C;  4GLS C;  4H2A A;  2L32 A;  4ICU A;  3AEA B;  1E5W A;  1WF9 A;  3CMM B;  4B6W A;  3HUI A;  1WGY A;  1X1M A;  2BBC A;  3IHP C;  1J7A A;  3HK0 A;  2OOB B;  5L83 A;  3NHE B;  1CZP A;  3H8H A;  5D94 A;  5J2R A;  2XNA C;  4I6P A;  4BVU C;  1D3Z A;  1XF5 L;  2LZ6 A;  1KTK A;  2J0K A;  2V4I B;  2LEK A;  1FRD A;  3JYU A;  1C78 A;  3TEZ A;  1FCC C;  1GB4 A;  1NEN B;  2QCZ A;  3TIX A;  3IAM 1;  1YMH E;  3FAH A;  2X38 A;  3Q14 C;  4K7S A;  4MH0 E;  1WX8 A;  4UDU C;  1MPE A;  3AEB B;  3ZO5 B;  3TCA A;  3V62 A;  3W9C B;  3LXF A;  3E9S A;  1ZKH A;  2QIL A;  4LDT B;  1N5X A;  2WQY B;  3A9J A;  4WAF A;  2W54 A;  2N7D A;  3PSE B;  3ETR A;  3ZQ4 A;  2KK8 A;  4GU2 A;  2KQ4 X;  2YEP B;  1R4M B;  4EEW A;  1ZUD 2;  2KJH B;  1YNT E;  3DWG C;  3GE8 C;  1Z5S B;  2IO1 B;  1J7B A;  1FFU A;  1WM2 A;  4HKZ E;  4JE3 B;  5DPW A;  2WXR A;  4MGK E;  2JZP A;  4R3D A;  4AP4 C;  5LXH A;  3RD2 A;  3C8Y A;  3RNF C;  1FNV A;  1MI0 A;  4BOS C;  1JRU A;  2WXF A;  3QJZ A;  1A70 A;  4FXC A;  1YN3 A;  5HHD G;  1DOI A;  2L7R A;  2A5U A;  4E71 A;  2ZPY A;  3OAW A;  4F1S A;  1R4N B;  3BVG A;  4G11 A;  2C9W B;  5JXV A;  1I4Q A;  3W5U B;  2MH7 A;  1QT9 A;  1K8R B;  2IND C;  2DEN B;  1JWA D;  3T8M A;  3EFU A;  2WS3 B;  3M95 A;  1K53 A;  3HVD A;  1E7P B;  5EE0 A;  1IBX A;  1WXA A;  2KWD A;  4J6I A;  1WYG A;  3AV8 A;  3U30 A;  3DOW A;  1RFA A;  3VRA B;  1LQB A;  2K6D B;  1FO4 A;  1UBI A;  3DBS A;  1V6E A;  3BY4 B;  5TSS A;  4S17 A;  3WAM A;  1UWM A;  2QEJ C;  2LXA A;  4WUR A;  5JH5 C;  3UGB B;  1PDX A;  4MGY E;  3V6C B;  4NQK E;  1WGR A;  1S3S G;  2V0G A;  1V1O A;  1QQR A;  2PTL A;  5EE3 A;  2BTE A;  1WR1 A;  4HKQ A;  2N9P C;  1B9R A;  2K22 A;  4AS1 A;  5DCN A;  4A90 A;  3I57 A;  4BBN C;  2BKF A;  4HPM B;  3Q8B A;  4OZC A;  3N1Y C;  1AYF A;  1DGJ A;  3VDZ A;  4EZL A;  4KGS A;  1ZDX A;  1TS4 A;  2ONQ A;  3MHZ A;  5E6P A;  2WU2 B;  3ZXR A;  2N1V A;  2WXI A;  4KDI C;  1IBX B;  3U4E G;  3NS8 A;  3DBL B;  1SE2 A;  4HPP A;  2N9E B;  1UGJ A;  2LHD A;  4DHJ B;  3AU5 A;  2KX3 A;  2ICI A;  2IJ0 A;  4P16 A;  4LK0 M;  3R66 C;  2J7Q B;  4BAX A;  2WXP A;  1MG8 A;  3IXS A;  4ZRJ A;  3FKY A;  2C60 A;  2IGD A;  3HIZ A;  2G4D B;  2XEW A;  4ARI A;  1VR9 A;  3FC4 A;  3NVZ A;  3IFW B;  4GDL B;  4C4V A;  4XZ4 A;  3L0W B;  3TBL D;  2MP2 A;  2WGS A;  1XCQ L;  4JLC A;  2L76 A;  2BB5 A;  2BF8 B;  1V49 A;  1PYW D;  4WH4 A;  2BB6 A;  1WY8 A;  1E90 A;  3MJW A;  4IWQ A;  4ASW C;  1C77 A;  3APC A;  2FNJ B;  2O6V D;  3GS2 A;  2LXC A;  1SSN A;  3OWE B;  1E8X A;  2CHZ A;  3J9C A;  2RSU A;  2J52 A;  3B2G A;  4M0W A;  1I4G A;  1E9M A;  2BGF A;  2JQR B;  2KHW B;  3OJ4 B;  4EUT A;  4TKN A;  1TKG A;  1PGB A;  4I6N B;  2RPQ A;  1STE A;  5IKC M;  2KWC A;  2FCN A;  2W3S A;  1WXM A;  2GBN A;  5J18 A;  2IDY A;  4LNN A;  1KFY B;  1YQ3 B;  1IPG A;  2KOX A;  3DHH C;  1WRD B;  4N9F 4;  2FUG 1;  4RNA A;  1SIJ A;  3W1Y A;  3MFG A;  5G55 A;  2KQ7 A;  3D32 A;  3QA8 A;  2L0F A;  2M1M A;  2MP2 B;  2N0S B;  4KIK A;  3GZN B;  4FBJ B;  2IO3 B;  4A6Q A;  1RWS A;  5T8I A;  3JVZ X;  4W9J A;  3OJ3 A;  1TS2 A;  2KT7 A;  3T9L A;  1AW7 A;  4KX6 B;  2OED A;  2KWU B;  2WDR B;  4PS7 A;  3QAQ A;  2INC C;  1VD2 A;  2W82 A;  2KDF B;  1IYF A;  4IW0 A;  4IWO A;  4M0W B;  3DVG X;  3W1S C;  4L2Y A;  1FRR A;  2YLM A;  3A33 B;  4XC2 A;  1RYJ A;  4XE0 A;  2QIE B;  1NVI D;  2IO0 B;  1EO6 A;  1OQY A;  1T5X D;  4W9F A;  4M00 A;  3H9D A;  2GBK A;  1YJ1 A;  1VLB A;  1OQR A;  2NR2 A;  3EUB 2;  1KRH A;  5MPO A;  4WJO A;  3IG3 A;  3PRP B;  1L6U A;  1C76 A;  1YX5 B;  3RI7 C;  2UYZ B;  2JRH A;  4REZ A;  3WA0 A;  2PE6 B;  3VQI A;  2KDE B;  2K8B A;  2JVC A;  4US8 A;  3RZW C;  2J53 A;  3KUZ A;  2LWP A;  1D6E C;  3P2B A;  1AWD A;  1WGK A;  2MRP A;  2L52 A;  3BII D;  4BBN F;  2BKR B;  3Q3M C;  2JWU A;  3SFE B;  2QC8 A;  1OGW A;  4OZB A;  3M63 B;  1NI3 A;  4ANW A;  1AAR A;  1ZXH A;  4ZYN A;  3NVY A;  2DZI A;  3DVN V;  1T0S C;  3PHX B;  4ANU A;  3KH0 A;  3Q3F A;  3VTW A;  1JWM D;  2MBO A;  2JU6 X;  1UUP A;  4MEL A;  1EU4 A;  1IGD A;  2AX5 A;  3I5J C;  3ZUN A;  2WU5 B;  2H88 B;  1J19 A;  4XDC A;  1B1Z A;  1N5W A;  2RD0 A;  2RGF A;  5EDS A;  5LXI B;  4B9K A;  2AQ2 B;  2FUH B;  4HEA 1;  3A4S C;  2BS2 B;  1G6J A;  1BUI C;  1PQS A;  3Q3O C;  1FXT B;  4YTN B;  4YWG G;  1NI2 A;  3ABV B;  2JXX A;  1C4A A;  2K8H A;  1E0Z A;  5IN7 A;  5EE1 A;  1HTO A;  1H8C A;  2M4N A;  3P4Q B;  2GB1 A;  5AEK B;  3AE9 B;  3MC9 A;  3VUX A;  1QOG A;  4KZC A;  2KVR A;  4FLH A;  4FJY A;  4P1B C;  4WJN A;  5HKH A;  2M0X A;  3L08 A;  3HHM A;  2JPH A;  4PS3 A;  1J7C A;  1EM7 A;  3ML9 A;  3R8B A;  3IT6 B;  2ZCB A;  2YEP F;  4JIO U;  1NYR A;  2AL3 A;  4JX1 C;  2K5P A;  4ACF A;  2IBI B;  2B3A A;  2BVC A;  2ZVO A;  1WR6 E;  3L4P A;  2JX5 A;  2AL6 A;  3DCG A;  3AUL A;  2MW5 A;  1WH3 A;  4AOF A;  4NQL B;  4DXG A;  2MQJ A;  2D11 A;  1HZ6 A;  2MWS B;  2L05 A;  1WXQ A;  2G9H D;  1XLQ A;  2JWZ A;  2LHE A;  2N9L A;  5JHA A;  4MGI E;  3CWI A;  3NVW A;  1BML C;  2LAS A;  1Q10 A;  1UGM A;  4A3O A;  2CR5 A;  2LGY A;  3DVG Y;  3C19 A;  3P63 A;  3RNA C;  2K6Q A;  1RAX A;  1GAQ B;  1QOA A;  1WE6 A;  2K25 A;  3APD A;  1V8C A;  3W5V B;  1ZW7 A;  3OLM D;  1JWU D;  4BOZ B;  1Q1O A;  1FD6 A;  2K9X A;  4C00 A;  2MA9 B;  3BK1 A;  3TEX A;  2MJ3 A;  4GMV A;  4W9L A;  2B76 B;  3PLV A;  5FKA C;  1I7H A;  2KN5 A;  2K3U A;  1ZOY B;  2O2V A;  1I4P A;  1GUA B;  2KD0 A;  3FIL A;  2ZJD A;  2PJH A;  1TTN A;  1C9F A;  1IP9 A;  3E56 A;  2MBH A;  4FHJ A;  2NBV B;  3IAS 1;  3VAW A;  1R7S A;  4FUL A;  2HTH A;  3NZU A;  1QF6 A;  4MAC A;  4GGQ A;  4A3P A;  2KDM A;  2DYO A;  4M8N A;  5BMG A;  2DHZ A;  2ZEQ A;  1F52 A;  2INN E;  2LRU A;  2N7J A;  1JWS D;  5C3J B;  4LJP B;  1L6V A;  1FCL A;  2BWE S;  3GB1 A;  5D2M B;  2Y5C A;  1R4N I;  3DBR B;  1K50 A;  3OG5 A;  1LGR A;  1F77 A;  1L4D B;  3X23 A;  3BIN A;  2XBB C;  3VFK A;  4ZHO A;  3PT2 B;  1GJZ A;  3PZ8 A;  4XYC A;  3P4S B;  2CU1 A;  4NNJ B;  1DOY A;  2RR9 A;  4KSK C;  5AZH A;  2LVQ A;  1E8Z A;  2IZV B;  2DLB A;  1UH6 A;  2O2V B;  3L16 A;  4KZ0 A;  4URK A;  4IG7 B;  4BKS D;  3FIL B;  2INP E;  4IM2 A;  3VTV A;  1T0Q C;  1QOF A;  5AUK A;  4WWN A;  1FIQ A;  4WAA A;  4RF1 A;  2LI5 A;  1WZ0 A;  3N9Y C;  1GC7 A;  2ZCC A;  4ICV A;  3Q8A A;  1I4H A;  4FJV B;  1ROE A;  1XT9 B;  3W1S A;  3L13 A;  3QC8 B;  3DVN U;  2REX A;  1HTQ A;  2ON8 A;  1L7Y A;  5IP4 D;  4K81 A;  4KKJ A;  4HK2 A;  5D6J B;  4E3C A;  1JML A;  1OTR B;  1OEY J;  3DPD A;  2HJ8 A;  2WWZ A;  2IGH A;  2DZK A;  2N7E A;  1DYQ A;  3PZD A;  2Z8L A;  3RFZ B;  5IOI A;  1KOT A;  4CYE A;  2JYT A;  3O13 A;  4WIP A;  4XWW A;  1L0X B;  2KJ6 A;  3BK2 A;  3VRB B;  3DBL I;  3QCA A;  1C1Y B;  4F7Z A;  3RMK C;  4II2 B;  3EGR A;  4RH6 A;  2FCQ A;  3MHS D;  2K1F A;  3N1X C;  3ZJT A;  2VRR B;  2ZNV C;  3I3T B;  3GP7 A;  2J42 A;  2KZR A;  2KAC A;  2WXL A;  3AI5 A;  2V4L A;  3BYY B;  4EFO A;  2MHJ A;  2BPS A;  3Q3J A;  4DQO C;  2L0T A;  5G5H A;  2OJR A;  5J17 A;  2FIF A;  4RMA A;  2VZK D;  3P1M A;  4JWS C;  2ASQ A;  3K9O B;  3RYT A;  2KMC A;  3MC0 B;  3ZJU A;  2N9K A;  2EMS A;  4US9 A;  1OFF A;  3AEG B;  4ANX A;  2PMV A;  1WM3 A;  2LGD A;  4FA6 A;  3B2F A;  2MBB B;  1BXT A;  4G0N B;  1N61 A;  3ZNI D;  1UD7 A;  2PVG C;  2GLS A;  4ZRP A;  1GPX A;  1C79 A;  4GDL A;  2WDT B;  5LNK 1;  4XGA B;  5L95 C;  2MSE D;  4HCN B;  1YOV B;  3DWM A;  2ZPN A;  4N58 A;  4RGO S;  1MJD A;  1SF0 A;  4A20 A;  2WNM A;  2PIA A;  5CHF A;  2R2Q A;  2IGG A;  2KYW A;  5CHW A;  4GIV A;  4NJC A;  3PTF C;  2JUO A;  1T0Y A;  1Y56 A;  4KVG B;  1YX6 B;  1I42 A;  4S0R A;  3O65 B;  4LTU A;  1WXS A;  1TS3 A;  1XCT L;  2W9N A;  3RNC C;  2DBY A;  4JQW C;  4A9A A;  1TT5 B;  3VTU A;  1F2R I;  4IWP A;  3ZLZ A;  2LGI A;  4B0E A;  3IT4 B;  2I2Y A;  4OVU A;  5E6N A;  3V6E B;  4EZJ A;  2MLB A;  1V1P B;  2O6V B;  3AEF B;  3N30 A;  4YTP B;  1QLB B;  3RUL A;  3T3O A;  4GSW A;  2NCN A;  4NJ7 A;  3AE4 B;  3WAN A;  3AH7 A;  3ZDT A;  3PRM B;  2JZ3 B;  3VHT C;  4D2K A;  1WXV A;  2G4S A;  3H7P A;  2Z0D B;  3AXC A;  1FXA A;  2LJI A;  3R3M A;  1M4V A;  3T3N A;  2R2O A;  1T0R C;  3PO0 A;  2PLP A;  3U8Z A;  2GBR A;  2CKH B;  2QHO A;  4NJ6 A;  1V97 A;  2OJW A;  5CTR C;  3QIJ A;  3I63 C;  1NYQ A;  2V1Y A;  4IM0 A;  3TUO A;  4AJW A;  1XQQ A;  4K1R B;  3AE2 B;  2WXJ A;  4ZYS A;  2JXT A;  2GI9 A;  4LNO A;  3SFD B;  3CST A;  2N9X A;  2JRI B;  3Q3N C;  3PVL A;  2G1E A;  2FCM A;  1MG4 A;  2Z59 B;  4LNF A;  4TUU A;  2Z0E B;  1TY0 A;  3EC8 A;  1E8W A;  3AE5 B;  2M56 B;  1J8C A;  3DBH I;  4YSZ B;  2LMC A;  3H7P B;  2BW2 A;  1N6Z A;  1UZX B;  1V5T A;  3IBE A;  4FHK A;  4NPN A;  4RGT A;  4HJK A;  1FXI A;  3NY5 A;  1DOX A;  1RRB A;  3NZ3 A;  2LJ5 A;  4ZRI A;  4XX5 A;  3ZVV A;  3MJ5 A;  1D4B A;  1L0V B;  3V3X A;  1UBQ A;  4YSY B;  3ECI A;  3CIR B;  3PS6 A;  5KHQ A;  3SDL C;  1VJK A;  3ZW3 A;  5C23 A;  3ZGZ A;  1E8Y A;  2MEK A;  2KTR A;  3H7S A;  1V9J A;  2KLC A;  3NRZ A;  1WE7 A;  1WJN A;  3H1U A;  2NTS A;  4GDK B;  1HQR D;  3VH3 B;  3ZIM A;  3N20 C;  2WDV B;  2EKI A;  2BYE A;  4WWM A;  3Q69 A;  1H4R A;  4IC7 B;  3KYD D;  2M17 A;  3ZKJ C;  2KN4 A;  2WX1 A;  4OHJ A;  3WAL A;  1Z2M A;  4DHZ E;  2C5L C;  2QJL A;  4HCP B;  1MHH E;  3TL5 A;  1TYG B;  2HE7 A;  4WJQ A;  3WAO A;  4YL8 A;  4KKI A;  2KQS A;  3K9P B;  2BWF A;  2BYT A;  1EF1 A;  4DHZ B;  1MHX A;  2NPT A;  1GOZ A;  2KTR B;  3VUW A;  4DK5 A;  3N1Z C;  5BYQ A;  2PKO A;  4HRS A;  2D5G A;  5C2T B;  4RM8 A;  4WQO B;  3UQA A;  1NBF C;  3HM6 X;  3N32 A;  2RPV A;  4USA A;  2PVO D;  2CHX A;  3BYT B;  3RZF A;  5LLI A;  2VH1 A;  4LNK A;  2GBM A;  1V2Y A;  3UQB A;  3KQ4 A;  1T6B X;  1KF6 B;  3RUI B;  2KDI A;  4TSS A;  4LCD E;  5E6O A;  3RNG C;  3SR6 A;  1P3Q U;  2WXH A;  4L23 A;  4DBG A;  3HVZ A;  3URY A;  2G45 B;  2V3P A;  1SB3 C;  1T3Q A;  2KC1 A;  3EA6 A;  1XLO A;  2AYO B;  2LVP A;  2NPT B;  4KSL C;  5D3D A;  4J3O D;  2LGX A;  2IYD B;  1WX7 A;  1LFD A;  3ZNH B;  4PS8 A;  3VVW B;  3B1L X;  1AN8 A;  2LD9 A;  4IM3 A;  1YD8 U;  1E7V A;  3PV1 A;  2AQ1 B;  1XO3 A;  1IUE A;  1FM0 D;  1FMA D;  1FFV A;  3RN9 C;  1ET6 A;  2ZNV B;  4NY0 A;  1K51 A;  2MCN B;  3DHG C;  5CHV C;  5EE9 A;  4Q2J A;  3M62 B;  2WXM A;  4RCO A;  1HXY D;  4EOY A;  5BYR A;  3TEW A;  2LGS A;  3HM3 A;  3SU8 X;  1F2R C;  1D5Z C;  5IA7 A;  1UWX A;  2FE8 A;  3GOE A;  1P7F A;  1VRA B;  1YIW A;  4B95 A;  1WRI A;  1SBB B;  4GXB A;  4PYZ A;  4WJP A;  3IVF A;  4OVZ A;  2RDB C;  2DZM A;  3VUY A;  3DHI C;  1FNW A;  4DXA B;  3DQV A;  4GOC A;  3LB8 C;  1Q5W B;  5TR5 A;  1U4A A;  4KGR A;  1I4R A;  1V5O A;  2WDQ B;  2V9H A;  3BVZ A;  1ISN A;  5DPS A;  1EUV B;  1R4M I;  2KFK A;  2WXN A;  1D5M C;  4JPS A;  3KUD B;  4C80 A;  3KLS X;  3EEC A;  4NAM A;  3PRE A;  3B0A A;  5DPT A;  3NVV A;  1TKE A;  3ZJV A;  1TIF A;  1QKZ A;  2DAJ A;  1L4Z B;  1V81 A;  2W3R A;  5C1Z A;  2IO2 B;  3C0R B;  4N59 A;  1KM7 A;  3QQ8 B;  3M3J A;  2MBQ A;  4OW0 A;  3EHV A;  3KYC D;  1V80 A;  2A4Z A;  4YTM B;  1YJI A;  2EMT A;  1P9D U;  4BKG A;  5GMV A;  1TS5 A;  2IY1 B;  1ZXI A;  2TSS A;  1WX9 A;  1WZ3 A;  4ZDV A;  4ITK A;  1J0G A;  4IOI E;  2CS4 A;  4ZRK A;  3P4P B;  1OQQ A;  4ANV A;  4OZA A;  1WGG A;  1N62 A;  2LFI A;  2AEH A;  4TQ0 A;  3H6N A;  2ZVN A;  4JL9 A;  4WQM A;  3A4R A;  2D3C A;  3ZXV A;  2KFK B;  3DDC B;  1EWY C;  4XDD A;  4CQN A;  1P7E A;  2KFJ A;  3MTN B;  4N6E B;  3ZTC A;  1SEB D;  4MM3 A;  1ACC A;  3P4R B;  3PHW B;  5E6J A;  2QSD A;  4EE2 A;  3JSV A;  1P1A A;  2JY6 A;  1JRO A;  4I6L B;  4WWO A;  3UIN B;  4RFB A;  2M19 A;  1JCK B;  3KWV A;  2N1W A;  3A9K A;  2RDG A;  4A55 A;  2JZZ A;  2ZW1 A;  1GG3 A;  3R2I A;  1YQ4 B;  3ZYY X;  4HPL B;  4IDI A;  4PYU A;  4K3C A;  2CJN A;  2EKE C;  2FID A;  2PEA A;  3SHQ A;  4GB9 A;  2KJR A;  1L5P A;  4X57 B;  1QIL A;  2SAK A;  3NS1 A;  2DYM A;  4KV2 A;  3LYY A;  1SE9 A;  2VZK B;  3AN1 A;  4LDT D;  3AU4 A;  2HD5 B;  2KX0 A;  2KAN A;  1KH0 A;  2I1J A;  1I35 A;  3UIP B;  4MM3 B;  3VXW A;  1JWB D;  3GE3 C;  2L83 A;  2KAJ A;  1WMH A;  3JSV B;  1XXG A;  5HFY A;  2BT6 A;  4K7W A;  3PZ7 A;  1ZDV A;  1UNS A;  4JWU C;  1TJE A;  1MFW A;  4FAD A;  1FNU A;  2I1K A;  2D2Q A;  3R2T A;  3LJ3 A;  2GOW A;  1TKY A;  3A9K B;  4P1C C;  1PFD A;  4LLG M;  2AWT A;  3A9J B;  1JRP A;  3RCZ A;  1EWC A;  1WYW B;  1V1P A;  2O6V A;  3R7R A;  2WLB A;  2Y3A A;  1HZ5 A;  1M94 A;  2MBE A;  3KUC B;  1I4X A;  1WGD A;  2HJ1 A;  4BKT A;  2VH2 A;  3KVF B;  2XK5 A;  3Q8E A;  2LVO A;  3BWU D;  1SE3 A;  4LNI A;  3ML8 A;  1TGZ B;  1V86 A;  3ALB A;  5D7G A;  1ESF A;  1WWT A;  3V05 A;  4TQ1 A;  1UF0 A;  4AQ7 A;  2L8J A;  1WMH B;  2X8X X;  1KLU D;  3GZN I;  4B0M A;  3N3K B;  1L0Y B;  1WJU A;  3RNE C;  5HG2 A;  1CQV A;  5H92 C;  2JT4 B;  1YN5 A;  2L00 B;  1ET9 A;  1GNU A;  4ZOH C;  2D10 A;  4TV3 A;  1JW9 D;  3NJT A;  1WJ6 A;  3ZNG C;  2CJO A;  2WHI A;  2LUE A;  1LO5 D;  2DWQ A;  1TBE A;  3PRZ A;  2NS5 A;  2NBU A;  4RGN A;  1GB1 A;  4RM9 A;  2K39 A;  4NAW A;  2J0J A;  2KMM A;  2KVZ A;  4DDI D;  2SEB D;  3QAR A;  4AUQ C;  2XK5 B;  4DHJ D;  2GMI C;  1OEY A;  3JW0 X;  3L10 B;  4DDG D;  1P0R A;  1QOB A;  2L3Z A;  5DPR A;  1HEZ E;  4TMA B;  1ZGU B;  1XEE A;  3RT3 B;  3B9J A;  4PT5 A;  2C7N B;  4HDQ A;  5AUI A;  2UU7 A;  4P7I A;  2IY0 B;  2W55 A;  5I4D A;  2E3T A;  3BVM A;  1TY2 A;  4O1N A;  3QHT A;  2JYE A;  1F1H A;  5GXG B;  2GRI A;  1VZ8 A;  1LXD A;  2EEL A;  3Q2A C;  3PLU A;  4GDK A;  2BQQ A;  2H89 B;  2NBW B;  4FJZ A;  2XN9 C;  2HTM E;  4RGM A;  5FR3 A;  3QK0 A;  2BS3 B;  4NAW B;  1WSP A;  5G2N A;  3TSS A;  2D07 B;  2LUM A;  2JSV X;  4C4V B;  5FK9 C;  1A5R A;  4EZK A;  1ZP0 B;  1FEH A;  2M0A A;  3U7Z A;  2UWQ A;  3A1Q A;  4NZL B;  3UI3 A;  4PK1 A;  1E7U A;  3WAP A;  2Q5W D;  1SE4 A;  2JF5 A;  3VR8 B;  4W9I A;  2RMM A;  2R61 A;  2NTT A;  1S1Q B;  3APF A;  3MC8 A;  3ZRF A;  1ENF A;  5D3I B;  1VZ6 A;  2KLG A;  3CF6 E;  1WJ4 A;  4YSX B;  3AED B;  2OHF A;  1XLP A;  1HA5 A;  5IO9 A;  1NEK B;  3AE1 B;  3KW5 B;  4HWI B;  4DXF A;  3S2A A;  2FBW B;  4IKG A;  2NMQ A;  1P98 A;  1BT0 A;  1E6E B;  4CO7 A;  2WXO A;  1F0Z A;  3NZS A;  1XLN A;  3NOB A;  4FN2 A;  4M02 A;  3U2S C;  3UF8 A;  4AJY B;  4P6V F;  4AWJ A;  1PGA A;  4MEM A; 
#chains in the Genus database with same CATH homology
 1CJE A;  1JML A;  2IGD A;  4MH8 A;  4ARI A;  1VR9 A;  3FC4 A;  3NVZ A;  1F2R C;  1D5Z C;  2IGH A;  4GDL B;  1UWX A;  2FE8 A;  3AE8 B;  1IGC A;  3NUH B;  1DYQ A;  1P7F A;  2MJD A;  2V3N A;  5BYS A;  1VRA B;  2Z8L A;  3RFZ B;  1CK1 A;  1WRI A;  1JQ4 A;  1XCQ L;  3AEE B;  1SBB B;  2JYT A;  3O13 A;  4WIP A;  2BB5 A;  1L0X B;  3BK2 A;  4XWW A;  1PYW D;  4WH4 A;  3VRB B;  2BB6 A;  4OVZ A;  1SJE D;  3EGR A;  3AE6 B;  1FNW A;  4RH6 A;  2WXG A;  1YJJ A;  3LB8 C;  1C77 A;  3GS2 A;  1SSN A;  4KGR A;  3ZJT A;  4HJG E;  1I4R A;  3GP7 A;  2J42 A;  3OWE B;  1SXT A;  2RDH A;  1PUT A;  2KAC A;  2WXL A;  4M0W A;  2WDQ B;  3J9C A;  2J52 A;  2MJE A;  3B2G A;  1I4G A;  1E9M A;  3BVZ A;  2JQR B;  3BYY B;  4ARC A;  1TKG A;  1EU3 A;  1PGB A;  1STE A;  2WXN A;  1D5M C;  2L1A A;  3WCQ A;  4JPS A;  4DQO C;  4C80 A;  3KLS X;  5G5H A;  2W3S A;  4NAM A;  1D5X C;  5G5G A;  2IDY A;  3NVV A;  2VZK D;  3P1M A;  1TKE A;  1KFY B;  4JWS C;  3ZJV A;  1YQ3 B;  1QKZ A;  3MC0 B;  3ZJU A;  2N9K A;  1L4Z B;  4US9 A;  2W3R A;  2FUG 1;  4RNA A;  4C56 C;  1OFF A;  1SIJ A;  3AEG B;  1C4P A;  3W2D A;  2PMV A;  4N59 A;  3KWL A;  3MFG A;  4OW0 A;  3B2F A;  1BXT A;  3TEY A;  1N61 A;  2N0S B;  4YTM B;  1N63 A;  2PVG C;  1YJI A;  3AEC B;  4ZRP A;  1GPX A;  1C79 A;  2WXQ A;  1TS5 A;  4C7Z A;  4A6Q A;  4ZHP A;  5LNK 1;  1ZXI A;  1RWS A;  2TSS A;  5T8I A;  3SEB A;  2HDE A;  4ITK A;  4IOI E;  1TS2 A;  2QMT A;  4A8X C;  1AW7 A;  4KX6 B;  2OED A;  3P4P B;  1OQQ A;  2WDR B;  3DWM A;  3AE3 B;  4OZA A;  4N58 A;  4RGO S;  1VZ7 A;  1N62 A;  2W82 A;  3AB5 A;  1SF0 A;  2LFI A;  2WNM A;  1E10 A;  4TQ0 A;  2PIA A;  5BMH A;  4L2Y A;  2IGG A;  3P42 A;  2Y5P A;  3BZD B;  4WQM A;  5HI1 A;  1FRR A;  4NJC A;  1RYJ A;  1ZPS A;  4XE0 A;  2QIE B;  1NVI D;  1EWY C;  4XDD A;  4CQN A;  1T5X D;  1P7E A;  1Y56 A;  1MVK A;  4KGT A;  4N6E B;  1VLB A;  1OQR A;  1SEB D;  4LTU A;  4HRO A;  1TS3 A;  1XCT L;  1ACC A;  3EUB 2;  1KRH A;  5MPO A;  4MT5 A;  3P4R B;  2DBY A;  2J4X A;  5E6J A;  2QSD A;  1KLG D;  4L1B A;  4EE2 A;  2ACZ B;  1L6U A;  1C76 A;  4A9A A;  1F2R I;  2WXK A;  4REZ A;  1JRO A;  1ZE3 D;  1JAL A;  3VQI A;  3MP9 A;  4RFB A;  4ZRQ A;  4US8 A;  2M19 A;  1JCK B;  3KWV A;  2LGI A;  4B0E A;  3IT4 B;  2I2Y A;  1PGX A;  2J53 A;  2IPK D;  4C7Y A;  2RDG A;  4A55 A;  1D6E C;  1V1P B;  4YTP B;  3AEF B;  2ZW1 A;  4YXD B;  3R2I A;  1AWD A;  1QLB B;  1YQ4 B;  1YN4 A;  2AQ3 B;  3ZYY X;  1WGK A;  3T3O A;  3Q8F A;  2L52 A;  3AE4 B;  3BII D;  3AH7 A;  2JWU A;  4IDI A;  3SFE B;  3AM9 A;  2PW9 A;  3AE7 B;  4OZB A;  2ZW0 A;  1NI3 A;  1K52 A;  2CJN A;  4D2K A;  1N60 A;  1ZXH A;  3NVY A;  1L5P A;  1QIL A;  2SAK A;  3NS1 A;  1FXA A;  2DYM A;  2LJI A;  1JWM D;  1M4V A;  3Q8C A;  1C4C A;  2I38 A;  2JU6 X;  3LYY A;  2VZK B;  3T3N A;  3AN1 A;  1UUP A;  3PO0 A;  2PLP A;  1EU4 A;  1IGD A;  3AMZ A;  2AX5 A;  2WP9 B;  2WU5 B;  2H88 B;  1V97 A;  1RFK A;  4XDC A;  5H8Y E;  1KH0 A;  4XWT A;  1B1Z A;  1N5W A;  4MM3 B;  1NYQ A;  3TUO A;  3VR9 B;  1JWB D;  4YT0 B;  3U52 E;  2L83 A;  3AE2 B;  2KAJ A;  2AQ2 B;  2WXJ A;  4ZYS A;  5BMI A;  4HEA 1;  1XXG A;  2JXT A;  2GI9 A;  2BS2 B;  5HFY A;  2BT6 A;  3HRD D;  1SJH D;  4RF0 A;  3SFD B;  3PZ7 A;  1ZDV A;  1UNS A;  4JWU C;  1BUI C;  1TJE A;  2BS4 B;  1FNU A;  4YTN B;  4YWG G;  3ABV B;  2G1E A;  3R2T A;  2E6X A;  1TKY A;  1C4A A;  1E0Z A;  3I9V 1;  5EE1 A;  1PFD A;  4LLG M;  3RPF C;  1TY0 A;  2K0P A;  1JRP A;  3AE5 B;  2M56 B;  3P4Q B;  1VDV A;  2GB1 A;  1EWC A;  2CU3 A;  1TZO A;  1V1P A;  3AE9 B;  4YSZ B;  1RM6 C;  2WLB A;  2Y3A A;  2LMC A;  1QOG A;  2BW2 A;  4GLS C;  1HZ5 A;  1I4X A;  4H2A A;  4RGT A;  2L32 A;  1FXI A;  3AEA B;  1DOX A;  3HUI A;  3NZ3 A;  2BBC A;  1J7C A;  1EM7 A;  1J7A A;  3Q8E A;  3R8B A;  3IT6 B;  3MJ5 A;  1D4B A;  3BWU D;  1SE3 A;  1L0V B;  2YEP F;  1CZP A;  1NYR A;  3H8H A;  4JX1 C;  3V3X A;  5D7G A;  2K5P A;  1ESF A;  1WWT A;  3V05 A;  4TQ1 A;  2XNA C;  4YSY B;  4AQ7 A;  3CIR B;  1XF5 L;  3L4P A;  1KTK A;  1KLU D;  4B0M A;  2JX5 A;  2LEK A;  2V4I B;  1FRD A;  1L0Y B;  1VJK A;  1C78 A;  3TEZ A;  3ZGZ A;  1FCC C;  1GB4 A;  2MEK A;  4DXG A;  1NEN B;  3IAM 1;  5HG2 A;  1CQV A;  1YMH E;  5H92 C;  1YN5 A;  3NRZ A;  3FAH A;  1HZ6 A;  1ET9 A;  2X38 A;  1WXQ A;  2NTS A;  4ZOH C;  2G9H D;  4GDK B;  1JW9 D;  1XLQ A;  1HQR D;  4UDU C;  2LHE A;  2WDV B;  2CJO A;  1MPE A;  2N9L A;  3AEB B;  2EKI A;  1LO5 D;  4WWM A;  2DWQ A;  3Q69 A;  3CWI A;  3W9C B;  3LXF A;  3E9S A;  3NVW A;  1BML C;  1Q10 A;  2QIL A;  4RGN A;  1N5X A;  1GB1 A;  2WQY B;  4WAF A;  2W54 A;  3ZQ4 A;  2KN4 A;  3ETR A;  4OHJ A;  2KMM A;  3P63 A;  2KQ4 X;  2QJL A;  2YEP B;  2SEB D;  1ZUD 2;  1MHH E;  1YNT E;  3DWG C;  1GAQ B;  1QOA A;  1TYG B;  1J7B A;  1FFU A;  4HKZ E;  4JE3 B;  2WXR A;  1QOB A;  2JZP A;  4R3D A;  1V8C A;  1HEZ E;  4TMA B;  3W5V B;  3C8Y A;  1FNV A;  1MI0 A;  1JWU D;  4KKI A;  1FD6 A;  1XEE A;  2K9X A;  2WXF A;  3TEX A;  3BK1 A;  2BYT A;  1A70 A;  4FXC A;  1YN3 A;  2MJ3 A;  3B9J A;  4PT5 A;  5HHD G;  1DOI A;  5AUI A;  2B76 B;  1MHX A;  5FKA C;  3BVG A;  1GOZ A;  1I7H A;  2K3U A;  1ZOY B;  1I4P A;  5JXV A;  1I4Q A;  3W5U B;  2W55 A;  2MH7 A;  1QT9 A;  5I4D A;  2E3T A;  3BVM A;  1TY2 A;  3FIL A;  5BYQ A;  2PKO A;  4HRS A;  2D5G A;  5C2T B;  1C9F A;  1JWA D;  4O1N A;  3E56 A;  2JYE A;  5GXG B;  2GRI A;  2WS3 B;  3IAS 1;  1K53 A;  1VZ8 A;  2RPV A;  3HVD A;  4USA A;  1E7P B;  2PVO D;  3BYT B;  2EEL A;  5EE0 A;  1R7S A;  2H89 B;  1IBX A;  1QF6 A;  2KWD A;  4MAC A;  2XN9 C;  1WYG A;  3AV8 A;  2HTM E;  4RGM A;  2KDM A;  5FR3 A;  3VRA B;  2DYO A;  2BS3 B;  4NAW B;  1WSP A;  3KQ4 A;  1FO4 A;  1T6B X;  5BMG A;  2INN E;  5TSS A;  2N7J A;  1JWS D;  1KF6 B;  5C3J B;  3TSS A;  2LUM A;  2JSV X;  1UWM A;  2QEJ C;  1L6V A;  1FCL A;  4WUR A;  5FK9 C;  4TSS A;  1ZP0 B;  1FEH A;  1PDX A;  2Y5C A;  2M0A A;  3GB1 A;  3U7Z A;  3SR6 A;  1K50 A;  1F77 A;  1L4D B;  4NZL B;  3UI3 A;  2V0G A;  1V1O A;  1QQR A;  2WXH A;  4ZHO A;  2PTL A;  2Q5W D;  4L23 A;  3HVZ A;  1SE4 A;  3PZ8 A;  5EE3 A;  3URY A;  2BTE A;  4HKQ A;  3VR8 B;  2RMM A;  3P4S B;  1DOY A;  2R61 A;  2NTT A;  2V3P A;  1SB3 C;  1T3Q A;  3EA6 A;  1B9R A;  1XLO A;  2K22 A;  1ENF A;  4AS1 A;  2DLB A;  5D3I B;  1VZ6 A;  5D3D A;  4A90 A;  3I57 A;  4J3O D;  4YSX B;  3AED B;  2OHF A;  1XLP A;  1HA5 A;  3FIL B;  1NEK B;  3AE1 B;  2INP E;  4DXF A;  3Q8B A;  4OZC A;  1AYF A;  2FBW B;  4IKG A;  1DGJ A;  1AN8 A;  1QOF A;  2NMQ A;  5AUK A;  4KGS A;  1ZDX A;  1TS4 A;  2ONQ A;  3MHZ A;  1FIQ A;  2WU2 B;  2AQ1 B;  1E6E B;  2WXI A;  1XO3 A;  1IBX B;  3U4E G;  1IUE A;  1FM0 D;  2WXO A;  4RF1 A;  3N9Y C;  1FMA D;  1FFV A;  1F0Z A;  1SE2 A;  3Q8A A;  1ET6 A;  1I4H A;  1XLN A;  1K51 A;  1UGJ A;  2LHD A;  1ROE A;  3W1S A;  5EE9 A;  4Q2J A;  3U2S C;  2ICI A;  2IJ0 A;  4P16 A;  4LK0 M;  2WXM A;  4RCO A;  2ON8 A;  4KKJ A;  1HXY D;  4P6V F;  2WXP A;  1PGA A;  3IXS A;  5BYR A;  3TEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...