3CWIA

Crystal structure of thiamine biosynthesis protein (this) from geobacter metallireducens. northeast structural genomics consortium target gmr137
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
69
structure length
69
Chain Sequence
MNLTVNGKPSTVDGAESLNVTELLSALKVAQAEYVTVELNGEVLEREAFDATTVKDGDAVEFLYFMGGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of thiamine biosynthesis protein (ThiS) from Geobacter metallireducens.
rcsb
source organism Geobacter metallireducens gs-15
molecule tags Biosynthetic protein
molecule keywords Thiamine-biosynthesis protein ThiS
total genus 15
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2008-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3cwiA00
5C3JB 3B2GA 2G1EA 1JALA 1QT9A 2HTME 4YT0B 1J7CA 3AE1B 2WLBA 3HUIA 1DGJA 2CJOA 2MJDA 4P6VF 1XLPA 1OQRA 1YJJA 3ABVB 4YTNB 1ZOYB 2PIAA 3VRBB 1GPXA 5EE9A 1AWDA 2BS3B 2KMMA 1T3QA 2EKIA 2PVOD 4US8A 2PVGC 5G5HA 2PKOA 1L6VA 1VJKA 4FXCA 1VDVA 2QIEB 4YSZB 3VR8B 2QJLA 4JWUC 2JQRB 3AE4B 4USAA 3DWMA 1ZP0B 1JRPA 2ACZB 3W9CB 1FRRA 3PO0A 4C7YA 1E10A 1YQ3B 1RYJA 1XO3A 3NRZA 1F0ZA 1YQ4B 1ZXIA 2CU3A 2B76B 1XLOA 2W3SA 3EUB2 1WWTA 1J7BA 3NVYA 1NEKB 3AE3B 1QF6A 2L83A 3W5VB 1GAQB 4ZHPA 1PFDA 1QOAA 3RPFC 2L52A 1QOBA 1FXIA 1JW9D 2MJEA 1FO4A 2K5PA 4ITKA 1JWBD 1KRHA 1N61A 3AB5A 1R7SA 5C2TB 4YSYB 3HVZA 2N0SB 2M56B 3P1MA 3NS1A 1TKEA 2KAJA 2MJ3A 3AE6B 5AUIA 3SR6A 1NI3A 1JROA 1FFUA 3NVZA 4WQMA 1QLBB 4US9A 3AE8B 3AE7B 1J7AA 2WP9B 3HRDD 3P4QB 5EE1A 5G5GA 2WU2B 1SIJA 3AE5B 3AECB 1YJIA 1ROEA 1TJEA 3AEGB 3NVWA 3DWGC 1QOFA 2Q5WD 2WDVB 3AM9A 3P63A 5EE0A 5EE3A 1EWYC 1FFVA 2AX5A 1QOGA 1OFFA 2CJNA 1RM6C 2K22A 3P4SB 1B9RA 2W3RA 1E6EB 1CJEA 1DOXA 1N5XA 2WDQB 1A70A 1E0ZA 1N60A 2E3TA 3SFDB 1N62A 2W55A 1E7PB 1FXAA 1L6UA 4YXDB 2FBWB 2BT6A 1TKGA 3AE9B 3AN1A 5GXGB 3P4PB 4YSXB 1E9MA 2WS3B 3W5UB 1PDXA 1KF6B 2DBYA 1NENB 4YTMB 1SB3C 1JQ4A 1SF0A 1FMAD 4HROA 1XLNA 4ZHOA 3AEDB 4YTPB 1N63A 3AE2B 1FM0D 1L0VB 1PUTA 1I7HA 3AEAB 3P4RB 3LXFA 4N59A 2DWQA 3SFEB 3AMZA 4C7ZA 2MH7A 1TYGB 1IUEA 1KFYB 2H89B 2M19A 1RFKA 2OHFA 3ETRA 1L5PA 1WGKA 1V97A 3FAHA 1DOYA 4LTUA 3CWIA 3VR9B 1JWAD 4JX1C 1WYGA 1FIQA 1NYQA 1NVID 1V8CA 2H88B 4IDIA 4WWMA 5H92C 2WDRB 2WU5B 4HRSA 3WCQA 4N6EB 3AEEB 3AEBB 1DOIA 3BIID 1TKYA 3AV8A 2JX5A 3B2FA 5AUKA 1UWMA 2W54A 3LB8C 1RWSA 3CIRB 3NVVA 1WRIA 3AEFB 5MPOA 1OQQA 2Y5CA 3AH7A 2WQYB 1NYRA 4KX6B 1N5WA 1VLBA 3L4PA 4N58A 3ZYYX 3KWLA 2BS2B 1CZPA 4JWSC 4A9AA 2K9XA 1XLQA 1ZUD2 2BS4B 4C80A 3B9JA 3VRAB 4ZOHC 5H8YE 1FRDA 1WXQA 3FC4A 1AYFA 2LEKA
chains in the Genus database with same CATH superfamily
3AE1B 4NY0A 3V60A 1SE4A 3T8MA 1T3QA 2PVGC 3SDLC 4ZDVA 3ZJVA 5G5HA 3UIPB 2KK8A 2DZIA 3NZSA 2EKEC 1KOTA 4XWTA 2INCC 2DYOA 1XLOA 3NVYA 3R3MA 2MWSB 1WJUA 4LCDE 2L52A 1QOBA 3DBLB 2OEDA 5HHDG 1TBEA 1R7SA 3H7SA 4P1BC 5FR3A 3NS1A 1NDDA 4M01A 3DVGY 2WP9B 3HRDD 3A4RA 1P9DU 3AE5B 3NVWA 1QOFA 2DAJA 2MRPA 4RM9A 1WE7A 4IUMB 4MT5A 4XE0A 2K22A 1TS4A 4KGSA 3OAWA 4HVBA 2KWUB 5IKCM 1SF0A 2Z0DB 3DVGX 4GN1A 2AL6A 5JHBA 1WM2A 2AQ1B 2NTTA 1KLGD 1FNVA 1XQQA 2D5GA 4DHZE 3PZ8A 1L5PA 2KVRA 4FJVB 4LTUA 2Z0EB 1JWAD 2RDBC 2KWCA 3GP7A 3RCZA 4G3XB 1P7EA 3AEBB 1R4MB 2W54A 4WJQA 3PPAA 2KQ4X 3X23A 1OQQA 3VRBB 3ZYYX 4LDTD 3L4PA 2K0PA 3VUXA 4C80A 5IAAC 4S17A 3TEWA 1VD2A 4MH8A 2M0AA 1P1AA 3ECIA 1PQSA 3N1YC 3LYYA 2WLBA 1NI2A 2D2QA 3U52E 2XEWA 2V3SA 2EKIA 4LNNA 1VJKA 4MDKE 4GDKB 2LD9A 3DWMA 1JRPA 2BW2A 1E10A 2WXMA 4HPPA 1RYJA 3V6EB 2CU3A 1I4QA 2KWVB 1QF6A 4LDTB 3FILA 2MJEA 1WFYA 2KO3A 4BKSD 1MVKA 4L2YA 2WXRA 4XDDA 2QDFA 1TKEA 1GB4A 4ZRPA 4EKUA 3ZXVA 3V3XA 1FNUA 1V81A 1WX7A 3NVZA 3KW5B 3Q2AC 2ZPYA 1TY2A 2L7RA 2Y3AA 1SJHD 1JWMD 5IA7A 1FNWA 3JW0X 5EE0A 2G9HD 3BK1A 2N9KA 3DCGA 1T0RC 4CQNA 3UQBA 3RI7C 1D5MC 4DHJD 4YTMB 1SB3C 2KDIA 4OW0A 2KC1A 4KSLC 5LNK1 1P3QU 1TYGB 1KFYB 1VRAB 2QCZA 3H1UA 3PREA 2LVOA 1DOIA 4D2KA 4HCNB 1AN8A 2XK5B 1UBQA 4RGNA 1R4MI 3HM6X 4NJCA 5LXHA 1ZKHA 4P1CC 2IO3B 2KFJA 1WXQA 1E8ZA 2O2VB 3PZ7A 4GSWA 1K50A 4HWIB 3P42A 2GBRA 3N3KB 2MCNB 3R2IA 1LO5D 4M0WB 1H8CA 2L0TA 4IWOA 4I6NB 2K8CA 3ZRFA 4W9LA 2ZVNA 4GDKA 4DXGA 1SSNA 1YN5A 1WIAA 4IM0A 2VH1A 3AULA 4M02A 1Q10A 1WWTA 2ASQA 1NEKB 2GI9A 3L0WB 2IGDA 3VTWA 2MP2A 2IO2B 1T6BX 1FCCC 3BY4B 3I3TB 3U2SC 2K8BA 2W9NA 3IBEA 4A6QA 4RGTA 3EFCA 1V1PA 3SR6A 1IBXA 2BVCA 4IC7B 1ZDVA 2D3BA 4LNIA 2LGYA 1BUIC 1OFFA 4GDLB 4KZ0A 3HIZA 4IKGA 3RNGC 1GUAB 2WDTB 3DQVA 4KGTA 4K3CA 4B9KA 1FXAA 1MFWA 3PZDA 1KH0A 3X0WA 2INPE 5AEKB 2IYDB 1WXVA 3HM3A 2M19A 2DZKA 2NVUI 2H88B 4TV3A 2O6VD 2KDMA 2JXXA 1HTOA 4NAMA 3R8BA 3QCAA 3VVWB 1Q1OA 1WZ3A 3SD5A 2JZ3B 1WRIA 1GNUA 3DHHC 2WQYB 1NYRA 3CMMB 2LASA 3A33B 4EUTA 4WJNA 3B9JA 5H8YE 4W9FA 1PGAA 2PTLA 4H2AA 2WXIA 2DLBA 1K8RB 1UF0A 2CKHB 2XBBC 5L83A 3V05A 1WGRA 1YX5B 3DBRB 3BYTB 2OOBB 1F2RI 3AE4B 2WXJA 2Y5PA 1C9FA 2LJIA 2L76A 2M4NA 4GLSC 2GMIC 4EOYA 1WGGA 3VFKA 4HXDA 4ANUA 1WI0A 2NBUA 1WR6E 2JVCA 3I57A 3WANA 1LQBA 2INNE 2LGSA 4HPLB 4ACFA 2D3CA 4YSYB 3HVZA 4AUQC 4HCPB 2HJ1A 2CU1A 2D3GA 1MI0A 3GE8C 3ZKJC 3AE8B 3P4QB 2KN4A 1KM7A 2HDEA 2ON8A 4HDQA 5KHQA 1E8YA 1EM7A 2KJRA 1JMLA 2CJNA 3TL5A 1WM3A 1WXMA 2IZVB 2MBQA 4EE2A 2W55A 4KDLB 2BT6A 3P4PB 4REZA 3N30A 5KHOA 3SEBA 1KTKA 4NNJB 3AMZA 3Q8FA 4MGYE 1IUEA 3L08A 5G2NA 1WSPA 2XNAC 2V4IB 5HKHA 2ZW0A 2WHIA 3NZ3A 2J0KA 4HRSA 3WCQA 4RGOS 2G4DB 1K53A 2KLGA 3CIRB 4RNAA 2ZCBA 2LVPA 1VZ6A 1CZPA 2JRHA 1PYWD 2QMTA 3MJ5A 1I42A 4BVUC 3K9OB 3B2GA 3VDZA 1J7CA 1E7UA 1KLVA 4YTNB 3ZNGC 1GG3A 4WJOA 1LXDA 4RH6A 2WXHA 4LJOB 3HVDA 4E71A 4S0RA 5DPRA 4HDOA 2K25A 5BYQA 2RDHA 5EDSA 1FO4A 4ITKA 5D94A 3E56A 1CQVA 3VTVA 4WAAA 3GZNI 3Q3OC 2MJ3A 5C23A 2L0FA 1I35A 2KN5A 2LFIA 4WQOB 3IAS1 1PGXA 1I4XA 2DYMA 5CX3A 1EWYC 2UYZB 1ET9A 1TTNA 3UQAA 2W3RA 4MJSA 2BYFA 2R2QA 2UWQA 3RD2A 3ZW3A 4K7WA 1KF6B 3DHIC 4XDCA 4OVVA 3WA0A 1I4GA 1FM0D 4GMVA 3DBLI 2K8HA 3MHZA 2H89B 1RAXA 1NYQA 5H92C 4IDIA 2LVQA 3CSTA 3AU5A 2KACA 3ZO5B 5DPTA 2GBKA 1WE6A 2C60A 3Q8CA 4E3CA 3KLSX 4AP4C 4HEA1 2YLMA 1LM8B 4GDLA 3LJ3A 3M62B 2WWZA 2KFKB 3U7DA 2R61A 1F9JA 2QSDA 2FIDA 2ICIA 1R4NB 3PLUA 3A9KB 3VUYA 3QK0A 4US8A 4AQ7A 4KKJA 1FPYA 1ZP0B 5CHWA 4K7SA 3QQ8B 4RMAA 1YQ3B 2QC8A 4NZLB 1YQ4B 2D3AA 2KQ7A 1JWBD 2N7JA 3Q8BA 1X1MA 3Q3MC 5JZEB 3D32A 2N7EA 2NPTA 5E6NA 4WQMA 2KKCA 3NUHB 2N1VA 1K51A 2L3ZA 2RMMA 3H8HA 3NHEB 4IW0A 1RM6C 2JT4B 3B1LX 1OTRB 1C1YB 1A70A 2MEKA 1E0ZA 4W9CA 4FN2A 4YXDB 4YSXB 2KANA 1MHXA 3RNCC 1XCTL 1ZXHA 3C0RB 4N59A 4C7ZA 1UUPA 1KLUD 1D5XC 1V97A 1WGKA 4DQOC 1WYGA 3PT2B 4G50A 2NTSA 4F8CB 1IBXB 3BIID 4OZAA 1UELA 3KYDD 5MPOA 4WWNA 3QAQA 3QX1A 3N32A 4DK5A 1FRDA 4KGRA 1AYFA 1CMXB 4M0WA 3WALA 5AZFA 3UGBB 1AARA 3A9KA 2LUMA 3H9DA 1LGRA 4MJSB 3HK0A 3DOWA 2NCNA 3QJZA 4DXFA 4GOCA 1JWUD 4YSZB 1HXYD 3R2TA 3VR8B 4USAA 4C00A 3TEZA 2O6VA 4IG7B 2WYQA 3QC8B 3H7PA 1TGZB 4M8NA 5FR6A 2BWFA 4W9JA 3M3JA 4P16A 2KOXA 1JW9D 1WF9A 3KYCD 4DWFA 2K5PA 4MH0E 4P7IA 2J0MA 2NPTB 4WJPA 1G6JA 3BYYB 2KC2A 4MACA 4FA6A 3GOEA 4IM2A 3PHXB 5FK9C 3ZTCA 1V80A 5G5GA 3TMPB 2LZ6A 1EF5A 2WXLA 3AEGB 2KFKA 4LK0M 3DWGC 2D10A 3GE3C 3AU4A 3VUWA 3P4SB 3V62A 1CJEA 3N9YC 2EMSA 2V4LA 2KJHB 2E3TA 1E7PB 1FD6A 4C56C 3HHMA 4CHKA 1JQ4A 1NENB 1AW7A 4MSMB 1I7HA 1SIFA 2JU6X 3KUDB 4OZCA 3DBRI 1VCBA 1UH6A 2ZPNA 1UNSA 5LLIA 1E7VA 3TBLD 3PLVA 3I63C 4IOIE 4MGIE 1V8CA 2XK5A 2YEPF 3Q3FA 3H7PB 4BKGA 3ZJUA 2NR2A 3JYUA 2M8SA 5CHVC 3RYTA 3W1YA 4DDID 2KDFB 2KYWA 3P2BA 5LXIB 4K7UA 1DYQA 1ET6A 2VRRB 4ZOHC 2JUOA 1A5RA 1QT9A 4YT0B 5D7GA 1C78A 1DGJA 1MJDA 4BKTA 4RFBA 2C7MB 4HKZE 4BBNC 3OLMD 5JHAA 2KMMA 2O6VB 1YMHE 1EWCA 3BVZA 4A3PA 3RULA 2LMCA 3VH3B 1YN4A 4IWPA 3PO0A 1NBFC 4K3BA 4A55A 3AE3B 2BTEA 2LRUA 1QOAA 1FXIA 3PRZA 5HFYA 4JIOU 4RCOA 2K6QA 2D07B 4TQ0A 2MLBA 4XWWA 2M56B 2X38A 2FIFA 3U7ZA 4GU2A 2RR9A 4YL8A 4OHJA 2JPHA 3B0AA 2K3UA 4R3DA 3PVLA 5E6OA 3AECB 1V9JA 4EZJA 3RFZB 1T5XD 3BK2A 5T8IA 3SFDB 4ZYNA 1TKGA 3NJTA 2WS3B 5JXVA 1SGHA 2DBYA 3KQ4A 3AEDB 3AEAB 3VXWA 2E6XA 2N9PC 2FAZA 3UIOB 1WX8A 5AZHA 2M17A 2V3PA 2OHFA 2HTHA 2N9LA 2D11A 3CF6E 3PHWB 4WWMA 3RZFA 2QHOA 1C79A 5AUKA 1GC6A 3IG3A 4PT5A 3LB8C 2G4SA 2RPVA 3Q6BA 4A9AA 4BOSC 1XLQA 4W9DA 2CHZA 1HTQA 2CS4A 3B08A 5FKAC 4II2B 1JALA 2HTME 2WXFA 3W1SC 1ZW7A 3RUIB 2BB5A 3EHVA 3ZUNA 2MBOA 3L16A 1EU4A 1Z5SB 2WX1A 4GGQA 1FRRA 3NRZA 1ZXIA 2I38A 1BMLC 2WNMA 3U8ZA 1I4RA 3BINA 1WJ4A 2Y5BB 2C9WB 1Y8RC 5C2TB 4BZAA 1D5ZC 2KAJA 3PSEB 1M94A 1NI3A 2KMCA 3RNEC 1T0SC 1UGJA 4A90A 2Q5WD 1QOGA 3DVNV 3ZQ4A 1UWXA 1L2NA 1P7FA 4A20A 4II3B 1N5XA 2M1MA 3CSFA 4UDUC 2DYBA 4L23A 4G0NB 3A4SC 3SU8X 1WJ6A 1YIWA 1WZ0A 4KV2A 2AL3A 3IAM1 3BWUD 3C19A 1FMAD 2HD5B 1WJNA 3M63B 3UF8A 3ML9A 1IYFA 4X57B 3A1QA 1H4RA 2JF5A 4DHJB 3IFWB 1YQBA 3Q8AA 1Q0WB 2C5LC 2LGXA 1FIQA 3VHTC 1QKZA 1HZ6A 3ZJTA 4K1RB 2CR5A 2A4ZA 3KUCB 4CO7A 3PS6A 1TKYA 3B2FA 2WXGA 2KTRB 1SE2A 2FCQA 3IT6B 2BWES 1OGWA 2KLCA 2MSED 1XCQL 2KTFA 1ZUD2 3RZWC 3V61A 3VRAB 2KDEB 4MM3B 2K1FA 2IGGA 3PV1A 4B95A 3ONSA 4P6VF 4AS1A 2AQ2B 4BAXA 4KDIC 3QWZB 2PKOA 2JZPA 3NG0A 3RNBC 1ZGUB 2BGFA 2IY0B 2KWDA 4NAWB 2VZKB 4PYZA 1TT5B 2KMAA 2PMVA 3RNFC 3ZRCA 3IHPC 1OEYA 4MEMA 4ICVA 3I9V1 2V1YA 3QA8A 4KVGB 4A3OA 2RD0A 4BKSA 2N0SB 3PGEA 2MHJA 2PW9A 3Q3JA 1FCLA 2NMQA 4KKIA 5TR5A 3RNAC 3ZIMA 4US9A 1QLBB 1J7AA 1OQYA 2JY6A 4O1NA 1YJIA 3DVNU 5EE3A 4FLHA 1FFVA 3N20C 1E6EB 1ZPSA 2WDQB 1CK1A 2RGFA 3O13A 4BOZB 1VZ8A 4F1SA 3AE9B 2ZEQA 1PDXA 3MC0B 3DBSA 4LJPB 5D3DA 3TIXA 4HJKA 4TKNA 4XX5A 4DHZB 3N1ZC 1RFKA 2LWPA 3ETRA 3Q3NC 4QAYA 3FKYA 2IY1B 2KTRA 1MG8A 2MBBB 5D2MB 4LLGM 4W9IA 4W9GA 1HE8A 1L0XB 4KX6B 1YN3A 4E74A 2OJRA 1D6EC 3FC4A 4ASWC 2LEKA 1JWSD 5C3JB 2DZJA 2YVCA 3BVGA 2MA9B 3R7QA 3EA6A 5C1ZA 1GPXA 3KUZA 1ZOYB 5EE9A 4J6IA 2JYEA 2PLPA 1FXTB 1E8XA 3OWEB 5BMGA 1VDVA 3ALBA 3OJ4B 1MHHE 1V86A 4C4VA 4FULA 3RT3B 1EU3A 2B76B 1I4HA 2BF8B 2UU7A 1IGDA 1TS2A 3A1QB 5BO4B 1QQRA 1TS3A 1BXTA 2PPHA 1WMHB 2J52A 4LNKA 1KRHA 2LHDA 3MHSD 1WXAA 3VAWA 4Q2JA 3ZVVA 2BKFA 3OJ3A 3UI3A 3PTFC 2AEHA 2LXAA 1D4BA 3C8YA 2WXOA 1E5WA 3AM9A 2YEPB 2G3QB 4ZRJA 3T3OA 4WURA 2TSSA 2MBEA 4KSKC 2LXCA 1WGYA 1J19A 1Q5WB 2KZRA 4NPNA 2N7DA 1XLNA 3O65B 2KNBA 1N6ZA 4ZRQA 4EEWA 1SE3A 4HKQA 1HA5A 1DOYA 3FAHA 3ZXRA 3MP9A 4C4VB 3VR9B 2L00B 4W9KA 4ZRIA 3WAPA 5TSSA 4YWGG 2BYVE 3MC8A 2KVZA 1C76A 1F77A 1VLBA 1SBBB 3PRMB 3RMKC 2DENB 4WH4A 2RSUA 4RM8A 1OEYJ 4BBNF 4CYEA 2PE6B 4TQ1A 1BT0A 5E6PA 2AWTA 2X8XX 2KX3A 2CJOA 3KH0A 1SEBD 3N1XC 1EF1A 2JRIB 1STEA 1UGMA 4FXCA 2QJLA 2IPKD 4F7ZA 5JH5C 4OVZA 4OZBA 1YOVB 1UD7A 1F0ZA 1TY0A 1WMHA 3S2AA 2JWUA 2M0XA 4PYUA 4ZHPA 1PFDA 4URKA 2NBWB 4A8XC 1T0QC 5BYSA 3A9JA 1GB1A 3AB5A 5IO9A 2FUHB 2ZW1A 2DHZA 2GBMA 1L0YB 2LJ5A 3ZGZA 1TZOA 2PEAA 5AUIA 2GBJA 4MSQB 3TJPA 1FFUA 3T9LA 2WXQA 1SIJA 1ROEA 1TJEA 2AX5A 4M00A 4ARCA 2N1WA 2KXJA 3APDA 3I5JC 4J3OD 1LFDA 3R7RA 3MFGA 3L13A 4ZHOA 5CTRC 3P4RB 2IJ0A 4FBJB 2VH2A 1L4DB 2K39A 1Z2MA 4TUUA 5BMIA 1E8WA 2GBNA 3KWVA 2WU5B 4IWQA 4WWPA 3MC9A 3APCA 2JXTA 3WIMA 4N58A 1IGCA 2BYTA 3KWLA 2BS2B 3L10B 2REXA 1K52A 2GRIA 1HZ5A 1JRUA 3DDCB 4MM3A 4ZYSA 1C77A 2MJDA 1E90A 1UZXB 3ABVB 4WIPA 1MPEA 1XEEA 4DXAB 2RPQA 4M8MA 3W1SA 1L6VA 4JWUC 4L1BA 2R2OA 2ACZB 3W9CB 4C7YA 2MW5A 4KZCA 4RF0A 3DHGC 3MJWA 2BB6A 3L54A 1J8CA 3ZDTA 1SE9A 3W5VB 4AJWA 3NZUA 1WXSA 1FEHA 1N61A 1XF5L 3U30A 5IOIA 2AQ3B 2V0GA 1YJ1A 4WAFA 3U4EG 1WGHA 3Q8EA 3H6NA 2FCMA 1WRDB 2L32A 2WXPA 2LRWA 1S1QB 2J42A 2QEJC 2FE8A 1F52A 4FHKA 4W9HA 1DOXA 1N62A 1L6UA 3AN1A 3RN9C 5HI1A 4N9F4 4GIVA 1L0VB 5E6JA 2CHXA 2MBHA 4B6WA 4XYCA 3VTUA 1NVID 4JLCA 4K81A 3AEEB 5DPWA 4B0MA 2IDYA 1S3SG 3AV8A 4NJ6A 1V49A 5DCNA 2BQQA 2V9HA 5CHFA 4JE3B 4JWSC 3ENEA 2K9XA 2DAFA 5AZGA 4I6PA 3GB1A 5GMVA 1RLFA 4KIKA 2INDC 5BMHA 3IT4B 4BFRA 2O2VA 1YJJA 2JWZA 3UINB 5G55A 2L1AA 2IBIB 3L17A 2I1KA 3WAMA 2JQRB 2DZMA 3EGRA 1C4AA 3QHTA 2EELA 2I1JA 1B1ZA 1V5TA 2LGDA 2RDGA 3MTNB 2J7QB 1J7BA 3R66C 4ANWA 4HLEA 5IP4D 2SEBD 4WWOA 2DX5B 3RPFC 2Z8LA 4XZ4A 1UBIA 4GXBA 3ML8A 2AYOB 3TSSA 2Z59B 3GZNB 1M4VA 3P1MA 4ANVA 2MX2A 1P0RA 1F1HA 1TS5A 3W2DA 2KX0A 3T3NA 2LUEA 4FHJA 2ZNVB 1YNTE 2JYTA 2OJWA 3NOBA 3AE7B 3ZNID 5EE1A 1YD8U 1V1PB 2WU2B 2IO0B 2GLSA 1V5OA 3P63A 4JGHB 2VZKD 2K6DB 3ZNZB 1R4NI 1WH3A 4ICUA 2IGHA 3Q69A 3WAOA 4MELA 2WXKA 1E9MA 4PK1A 2NS5A 1N63A 1PUTA 2FUG1 2IO1B 2XN9C 3SFEB 2ZZPB 1XT9B 3JSVA 1I4PA 3JSVB 3A9JB 3CWIA 4RGMA 2KT7A 2WX0A 3ZLZA 2V3NA 3EFUA 3KVFB 1UWMA 2PE9A 1VR9A 1RWSA 4MGKE 3NVVA 3AEFB 3GS2A 2J0JA 2Y5CA 3JVZX 4EZLA 4JL9A 2BS4B 5L95C 1GOZA 2JSVX 3TUOA 2EMTA 4PS3A 4EZKA 3J9CA 3PRPB 5HG2A 3HUIA 1PGBA 2KJ6A 1QILA 2PIAA 1V1OA 1HEZE 2PJHA 1WR1A 3ZTDA 2QIEB 2QILA 1TIFA 4RF1A 3OG5A 3DBHI 1XO3A 2ZNVC 1C4PA 3FILB 1GAQB 1WY8A 1XD3B 2KDBA 1GC7A 3TEYA 2GOWA 1V6EA 3AXCA 2MP2B 1D3ZA 2HJ8A 2GB1A 3AE6B 4JPSA 2CHWA 3M95A 1GJZA 1EO6A 2BKRB 1IPGA 5DPSA 1WGDA 1ZDXA 3APFA 2SAKA 2WDVB 4TSSA 3BZDB 3TEXA 2FCSA 4ANXA 4AJYB 3ZNHB 4HJGE 4XGAB 2HE7A 3LDZE 3E9SA 1C4CA 1ZE3D 4LNOA 5J17A 2ONQA 2FBWB 5GXGB 4AWJA 3NY5A 3VQIA 4ARIA 4YTPB 3AE2B 4TMAB 3QIJA 2DWQA 4NAWA 2MH7A 2LHEA 3TCAA 4JX1C 3NS8A 4FJZA 5D3IB 1EUVB 4IM3A 2A5UA 2LI5A 1ESFA 1ENFA 1P98A 3AH7A 3DPDA 2WXNA 2MQJA 3Q14C 5J18A 2G1EA 2C7NB 5J2RA 2N9EB 1L4ZB 3SHQA 1XLPA 3K9PB 1OQRA 4DDGD 1AWDA 2J53A 2BS3B 2PVOD 1J0GA 1IP9A 3EC8A 4W9EA 1SXTA 2BBCA 1ISNA 4DBGA 2KQSA 1F2RC 1TZ1A 4B0EA 2W3SA 3EUB2 3BVMA 2KD0A 4JQWC 4NQLB 2L83A 1YX6B 4NQKE 3URYA 5IN7A 2L05A 2L8JA 4PS8A 3VH4B 3QARA 4HK2A 2WGSA 4FADA 2FNJB 2N4FA 4NJ7A 2W82A 4I6LB 1QZEA 1KJTA 2I2YA 1JROA 3IVFA 4KIKB 2FCNA 1JCKB 1HQRD 2DNFA 4PS7A 3EECA 1WYWB 2LGIA 2KHWB 3ZDMC 4FJYA 2ZJDA 1B9RA 1Y56A 1XXGA 1V2YA 1N60A 2NBVB 2C7HA 2J4XA 3W5UB 2N9XA 1MG4A 3AI5A 3DBHB 4HROA 5BYRA 2BPSA 3LXFA 3IXSA 1SJED 1WX9A 4EFOA 5I4DA 1VZ7A 4AOFA 4G11A 4HPMB 5D6JB 4ZRKA 2WDRB 1T0YA 1C3TA 4LNFA 4OVUA 1U4AA 4N6EB 3V6CB 2JX5A 4MGZE 1L7YA 4XC2A 2ZVOA 1N5WA 4GB9A 2JZZA 1ACCA 2ZCCA 2BYEA 2G45B 2B3AA 1RRBA 1RFAA
chains in the Genus database with same CATH topology
3B2GA 5FKAC 1JALA 2HTME 2WXFA 1J7CA 3AE1B 1C77A 4ZYSA 1SE4A 2MJDA 3ABVB 4YTNB 4WIPA 2BB5A 1MPEA 1XEEA 1T3QA 2PVGC 3ZJVA 5G5HA 4RH6A 3W1SA 1L6VA 2WXHA 1EU4A 3HVDA 4JWUC 4L1BA 2ACZB 3W9CB 1FRRA 4C7YA 4RF0A 4XWTA 2BB6A 3NRZA 1ZXIA 2I38A 2DYOA 1XLOA 1BMLC 3NVYA 3W5VB 2WNMA 2L52A 1QOBA 1I4RA 5BYQA 2OEDA 2RDHA 1FO4A 4ITKA 1FEHA 3E56A 1CQVA 5HHDG 1N61A 1XF5L 2AQ3B 2V0GA 1R7SA 4WAFA 5C2TB 5FR3A 3U4EG 1D5ZC 3NS1A 2KAJA 2MJ3A 1NI3A 3Q8EA 2WP9B 3HRDD 2L32A 1UGJA 2LFIA 2WXPA 3AE5B 3IAS1 3NVWA 4A90A 1PGXA 1I4XA 1QOFA 2DYMA 2Q5WD 2J42A 1EWYC 2QEJC 1QOGA 4MT5A 2FE8A 1ET9A 3ZQ4A 4XE0A 1UWXA 1TS4A 2K22A 1P7FA 2W3RA 4KGSA 1DOXA 1N5XA 1N62A 4UDUC 4L23A 1L6UA 3AN1A 1KF6B 3IAM1 5HI1A 3BWUD 1SF0A 1FMAD 4XDCA 2AQ1B 1I4GA 1FM0D 1L0VB 2NTTA 5E6JA 1KLGD 1FNVA 2D5GA 3MHZA 2H89B 3PZ8A 1L5PA 3Q8AA 4LTUA 1JWAD 1FIQA 1NYQA 1NVID 4IDIA 5H92C 1QKZA 3GP7A 1HZ6A 3ZJTA 3AEEB 4B0MA 1P7EA 2IDYA 3AEBB 1TKYA 3AV8A 3B2FA 2KACA 2WXGA 2W54A 1SE2A 3IT6B 2KQ4X 3Q8CA 1OQQA 3VRBB 3ZYYX 3L4PA 1XCQL 3KLSX 4JE3B 4JWSC 2K0PA 2K9XA 1ZUD2 4HEA1 4C80A 3VRAB 3TEWA 3GB1A 4MH8A 2M0AA 4MM3B 2R61A 2IGGA 2QSDA 3LYYA 2ICIA 5BMHA 2WLBA 3IT4B 4P6VF 1YJJA 4AS1A 2AQ2B 3U52E 2L1AA 2EKIA 4US8A 2PKOA 4AQ7A 1VJKA 2JZPA 4KKJA 2JQRB 4GDKB 3DWMA 1ZP0B 1JRPA 2BW2A 3EGRA 1C4AA 2KWDA 2WXMA 1E10A 1YQ3B 1RYJA 4NZLB 2EELA 1YQ4B 2CU3A 4NAWB 1B1ZA 2RDGA 2VZKB 1I4QA 1J7BA 2PMVA 1QF6A 2SEBD 3FILA 3RPFC 2MJEA 2Z8LA 3I9V1 1JWBD 2N7JA 3Q8BA 1MVKA 3TSSA 4L2YA 2N0SB 2WXRA 1M4VA 4XDDA 3P1MA 2PW9A 1FCLA 1TKEA 2NMQA 1GB4A 1TS5A 3W2DA 4ZRPA 3T3NA 4KKIA 3V3XA 1FNUA 1YNTE 3NVZA 4WQMA 1QLBB 2JYTA 4US9A 3AE7B 1TY2A 1J7AA 3NUHB 5EE1A 2Y3AA 1SJHD 1JWMD 1K51A 1V1PB 4O1NA 2WU2B 2RMMA 1YJIA 3H8HA 1FNWA 3P63A 5EE0A 5EE3A 2VZKD 1FFVA 2G9HD 3BK1A 2N9KA 1RM6C 1E6EB 2IGHA 3Q69A 1ZPSA 2WDQB 1A70A 2MEKA 1E0ZA 1CK1A 4CQNA 3O13A 4YXDB 1D5MC 1VZ8A 2WXKA 3AE9B 4YSXB 1E9MA 1PDXA 4YTMB 3MC0B 1MHXA 1SB3C 1XCTL 4OW0A 1ZXHA 5D3DA 1N63A 5LNK1 1PUTA 2FUG1 4N59A 2XN9C 3SFEB 4C7ZA 1TYGB 1KFYB 1UUPA 1VRAB 1I4PA 1KLUD 1RFKA 1D5XC 3ETRA 1V97A 1WGKA 4DQOC 3CWIA 4RGMA 1WYGA 2NTSA 1IBXB 1DOIA 2V3NA 3BIID 4D2KA 4LLGM 1AN8A 4RGNA 4OZAA 1UWMA 1VR9A 1RWSA 3NVVA 4NJCA 3AEFB 3GS2A 5MPOA 2Y5CA 1L0XB 4KX6B 1YN3A 2BS4B 1FRDA 4KGRA 1D6EC 1GOZA 1WXQA 2JSVX 3FC4A 3TUOA 1AYFA 2LEKA 1JWSD 5C3JB 3PZ7A 4M0WA 3BVGA 3J9CA 5HG2A 1K50A 3HUIA 3EA6A 1PGBA 3P42A 1QILA 2LUMA 1ZOYB 1LO5D 2PIAA 3R2IA 1V1OA 1HEZE 5EE9A 1GPXA 2JYEA 2PLPA 4DXFA 1JWUD 3OWEB 5BMGA 1VDVA 2QIEB 4DXGA 1HXYD 3R2TA 3VR8B 4USAA 2QILA 4YSZB 1SSNA 4RF1A 3TEZA 1YN5A 1MHHE 1XO3A 1Q10A 1EU3A 1C4PA 1I4HA 2B76B 1IGDA 1TS2A 1WWTA 3FILB 1NEKB 1QQRA 1GAQB 4P16A 2GI9A 1JW9D 1TS3A 1BXTA 2IGDA 3TEYA 2J52A 2K5PA 1T6BX 1FCCC 1KRHA 3U2SC 2LHDA 3BYYB 4A6QA 4MACA 4RGTA 2GB1A 1V1PA 3AE6B 4Q2JA 3SR6A 4JPSA 1IBXA 3UI3A 5FK9C 1ZDXA 5G5GA 1D4BA 1ZDVA 2WXLA 3C8YA 3AEGB 2SAKA 2WXOA 4LK0M 3DWGC 2WDVB 3AM9A 2YEPB 4TSSA 3BZDB 3TEXA 3T3OA 1BUIC 4WURA 1OFFA 4GDLB 4HJGE 3P4SB 2TSSA 4IKGA 1CJEA 3N9YC 3E9SA 1C4CA 4KGTA 1ZE3D 2E3TA 1E7PB 1FXAA 2ONQA 1FD6A 2FBWB 5GXGB 1KH0A 4C56C 1JQ4A 1NENB 3VQIA 4ARIA 1AW7A 1XLNA 4YTPB 2INPE 3AE2B 1I7HA 4TMAB 2DWQA 2JU6X 4ZRQA 4OZCA 2MH7A 2LHEA 1SE3A 4HKQA 1UNSA 2M19A 1HA5A 1DOYA 3FAHA 3MP9A 3VR9B 4JX1C 4IOIE 1V8CA 2YEPF 2H88B 5TSSA 3ZJUA 4YWGG 2KDMA 5D3IB 4NAMA 3R8BA 1ESFA 1C76A 1WRIA 1ENFA 1F77A 2WQYB 1NYRA 3AH7A 1VLBA 1SBBB 2WXNA 4WH4A 1DYQA 3B9JA 1ET6A 4ZOHC 5H8YE 4TQ1A 1PGAA 2G1EA 1QT9A 4YT0B 5D7GA 2PTLA 1C78A 2WXIA 4H2AA 2DLBA 1DGJA 2CJOA 1L4ZB 1XLPA 1OQRA 4RFBA 1SEBD 1AWDA 4HKZE 2J53A 2BS3B 2KMMA 1STEA 2PVOD 3V05A 1YMHE 1EWCA 3BVZA 3BYTB 4FXCA 2LMCA 1F2RI 2QJLA 2IPKD 3AE4B 1SXTA 2WXJA 1YN4A 4OVZA 2BBCA 2Y5PA 4OZBA 2LJIA 3PO0A 1C9FA 4GLSC 1F0ZA 1F2RC 1TY0A 4B0EA 2JWUA 2W3SA 3EUB2 3BVMA 4A55A 3AE3B 2L83A 4ZHPA 2BTEA 1PFDA 1QOAA 1FXIA 3URYA 4A8XC 5BYSA 5HFYA 4RCOA 3I57A 1GB1A 2INNE 4TQ0A 3AB5A 2ZW1A 4XWWA 4YSYB 3HVZA 1L0YB 2M56B 2X38A 3ZGZA 3U7ZA 2W82A 1TZOA 5AUIA 1MI0A 2I2YA 4OHJA 1JROA 1FFUA 2K3UA 3AE8B 4R3DA 3P4QB 2KN4A 2WXQA 3AECB 1SIJA 1ROEA 1JCKB 1TJEA 2HDEA 2ON8A 1HQRD 2AX5A 1EM7A 2LGIA 1JMLA 2CJNA 3RFZB 1B9RA 1Y56A 1T5XD 3BK2A 5T8IA 1XXGA 4ARCA 1N60A 3SFDB 4EE2A 2W55A 2J4XA 2BT6A 1TKGA 3P4PB 2WS3B 3W5UB 4REZA 5JXVA 2DBYA 4J3OD 4HROA 5BYRA 3SEBA 3KQ4A 3AEDB 3MFGA 4ZHOA 3AEAB 2E6XA 1KTKA 3P4RB 3LXFA 3IXSA 2IJ0A 3AMZA 1SJED 3Q8FA 5I4DA 1IUEA 1L4DB 2V3PA 2OHFA 1WSPA 2N9LA 2XNAC 2V4IB 1VZ7A 2ZW0A 3NZ3A 5BMIA 4WWMA 3KWVA 2WDRB 2WU5B 4HRSA 3WCQA 1C79A 4N6EB 4RGOS 2JX5A 5AUKA 1K53A 4PT5A 3LB8C 3CIRB 2JXTA 4RNAA 1IGCA 4N58A 2BYTA 1N5WA 2RPVA 1VZ6A 2BS2B 1CZPA 3KWLA 4A9AA 1XLQA 1ACCA 1K52A 1PYWD 2GRIA 2QMTA 1HZ5A 3MJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C3J B;  3B2G A;  2G1E A;  1JAL A;  1QT9 A;  2HTM E;  4YT0 B;  1J7C A;  3AE1 B;  2WLB A;  3HUI A;  1DGJ A;  2CJO A;  2MJD A;  4P6V F;  1XLP A;  1OQR A;  1YJJ A;  3ABV B;  4YTN B;  1ZOY B;  2PIA A;  3VRB B;  1GPX A;  5EE9 A;  1AWD A;  2BS3 B;  2KMM A;  1T3Q A;  2EKI A;  2PVO D;  4US8 A;  2PVG C;  5G5H A;  2PKO A;  1L6V A;  1VJK A;  4FXC A;  1VDV A;  2QIE B;  4YSZ B;  3VR8 B;  2QJL A;  4JWU C;  2JQR B;  3AE4 B;  4USA A;  3DWM A;  1ZP0 B;  1JRP A;  2ACZ B;  3W9C B;  1FRR A;  3PO0 A;  4C7Y A;  1E10 A;  1YQ3 B;  1RYJ A;  1XO3 A;  3NRZ A;  1F0Z A;  1YQ4 B;  1ZXI A;  2CU3 A;  2B76 B;  1XLO A;  2W3S A;  3EUB 2;  1WWT A;  1J7B A;  3NVY A;  1NEK B;  3AE3 B;  1QF6 A;  2L83 A;  3W5V B;  1GAQ B;  4ZHP A;  1PFD A;  1QOA A;  3RPF C;  2L52 A;  1QOB A;  1FXI A;  1JW9 D;  2MJE A;  1FO4 A;  2K5P A;  4ITK A;  1JWB D;  1KRH A;  1N61 A;  3AB5 A;  1R7S A;  5C2T B;  4YSY B;  3HVZ A;  2N0S B;  2M56 B;  3P1M A;  3NS1 A;  1TKE A;  2KAJ A;  2MJ3 A;  3AE6 B;  5AUI A;  3SR6 A;  1NI3 A;  1JRO A;  1FFU A;  3NVZ A;  4WQM A;  1QLB B;  4US9 A;  3AE8 B;  3AE7 B;  1J7A A;  2WP9 B;  3HRD D;  3P4Q B;  5EE1 A;  5G5G A;  2WU2 B;  1SIJ A;  3AE5 B;  3AEC B;  1YJI A;  1ROE A;  1TJE A;  3AEG B;  3NVW A;  3DWG C;  1QOF A;  2Q5W D;  2WDV B;  3AM9 A;  3P63 A;  5EE0 A;  5EE3 A;  1EWY C;  1FFV A;  2AX5 A;  1QOG A;  1OFF A;  2CJN A;  1RM6 C;  2K22 A;  3P4S B;  1B9R A;  2W3R A;  1E6E B;  1CJE A;  1DOX A;  1N5X A;  2WDQ B;  1A70 A;  1E0Z A;  1N60 A;  2E3T A;  3SFD B;  1N62 A;  2W55 A;  1E7P B;  1FXA A;  1L6U A;  4YXD B;  2FBW B;  2BT6 A;  1TKG A;  3AE9 B;  3AN1 A;  5GXG B;  3P4P B;  4YSX B;  1E9M A;  2WS3 B;  3W5U B;  1PDX A;  1KF6 B;  2DBY A;  1NEN B;  4YTM B;  1SB3 C;  1JQ4 A;  1SF0 A;  1FMA D;  4HRO A;  1XLN A;  4ZHO A;  3AED B;  4YTP B;  1N63 A;  3AE2 B;  1FM0 D;  1L0V B;  1PUT A;  1I7H A;  3AEA B;  3P4R B;  3LXF A;  4N59 A;  2DWQ A;  3SFE B;  3AMZ A;  4C7Z A;  2MH7 A;  1TYG B;  1IUE A;  1KFY B;  2H89 B;  2M19 A;  1RFK A;  2OHF A;  3ETR A;  1L5P A;  1WGK A;  1V97 A;  3FAH A;  1DOY A;  4LTU A;  3CWI A;  3VR9 B;  1JWA D;  4JX1 C;  1WYG A;  1FIQ A;  1NYQ A;  1NVI D;  1V8C A;  2H88 B;  4IDI A;  4WWM A;  5H92 C;  2WDR B;  2WU5 B;  4HRS A;  3WCQ A;  4N6E B;  3AEE B;  3AEB B;  1DOI A;  3BII D;  1TKY A;  3AV8 A;  2JX5 A;  3B2F A;  5AUK A;  1UWM A;  2W54 A;  3LB8 C;  1RWS A;  3CIR B;  3NVV A;  1WRI A;  3AEF B;  5MPO A;  1OQQ A;  2Y5C A;  3AH7 A;  2WQY B;  1NYR A;  4KX6 B;  1N5W A;  1VLB A;  3L4P A;  4N58 A;  3ZYY X;  3KWL A;  2BS2 B;  1CZP A;  4JWS C;  4A9A A;  2K9X A;  1XLQ A;  1ZUD 2;  2BS4 B;  4C80 A;  3B9J A;  3VRA B;  4ZOH C;  5H8Y E;  1FRD A;  1WXQ A;  3FC4 A;  1AYF A;  2LEK A; 
#chains in the Genus database with same CATH topology
 3AE1 B;  4NY0 A;  3V60 A;  1SE4 A;  3T8M A;  1T3Q A;  2PVG C;  3SDL C;  4ZDV A;  3ZJV A;  5G5H A;  3UIP B;  2KK8 A;  2DZI A;  3NZS A;  2EKE C;  1KOT A;  4XWT A;  2INC C;  2DYO A;  1XLO A;  3NVY A;  3R3M A;  2MWS B;  1WJU A;  4LCD E;  2L52 A;  1QOB A;  3DBL B;  2OED A;  5HHD G;  1TBE A;  1R7S A;  3H7S A;  4P1B C;  5FR3 A;  3NS1 A;  1NDD A;  4M01 A;  3DVG Y;  2WP9 B;  3HRD D;  3A4R A;  1P9D U;  3AE5 B;  3NVW A;  1QOF A;  2DAJ A;  2MRP A;  4RM9 A;  1WE7 A;  4IUM B;  4MT5 A;  4XE0 A;  2K22 A;  1TS4 A;  4KGS A;  3OAW A;  4HVB A;  2KWU B;  5IKC M;  1SF0 A;  2Z0D B;  3DVG X;  4GN1 A;  2AL6 A;  5JHB A;  1WM2 A;  2AQ1 B;  2NTT A;  1KLG D;  1FNV A;  1XQQ A;  2D5G A;  4DHZ E;  3PZ8 A;  1L5P A;  2KVR A;  4FJV B;  4LTU A;  2Z0E B;  1JWA D;  2RDB C;  2KWC A;  3GP7 A;  3RCZ A;  4G3X B;  1P7E A;  3AEB B;  1R4M B;  2W54 A;  4WJQ A;  3PPA A;  2KQ4 X;  3X23 A;  1OQQ A;  3VRB B;  3ZYY X;  4LDT D;  3L4P A;  2K0P A;  3VUX A;  4C80 A;  5IAA C;  4S17 A;  3TEW A;  1VD2 A;  4MH8 A;  2M0A A;  1P1A A;  3ECI A;  1PQS A;  3N1Y C;  3LYY A;  2WLB A;  1NI2 A;  2D2Q A;  3U52 E;  2XEW A;  2V3S A;  2EKI A;  4LNN A;  1VJK A;  4MDK E;  4GDK B;  2LD9 A;  3DWM A;  1JRP A;  2BW2 A;  1E10 A;  2WXM A;  4HPP A;  1RYJ A;  3V6E B;  2CU3 A;  1I4Q A;  2KWV B;  1QF6 A;  4LDT B;  3FIL A;  2MJE A;  1WFY A;  2KO3 A;  4BKS D;  1MVK A;  4L2Y A;  2WXR A;  4XDD A;  2QDF A;  1TKE A;  1GB4 A;  4ZRP A;  4EKU A;  3ZXV A;  3V3X A;  1FNU A;  1V81 A;  1WX7 A;  3NVZ A;  3KW5 B;  3Q2A C;  2ZPY A;  1TY2 A;  2L7R A;  2Y3A A;  1SJH D;  1JWM D;  5IA7 A;  1FNW A;  3JW0 X;  5EE0 A;  2G9H D;  3BK1 A;  2N9K A;  3DCG A;  1T0R C;  4CQN A;  3UQB A;  3RI7 C;  1D5M C;  4DHJ D;  4YTM B;  1SB3 C;  2KDI A;  4OW0 A;  2KC1 A;  4KSL C;  5LNK 1;  1P3Q U;  1TYG B;  1KFY B;  1VRA B;  2QCZ A;  3H1U A;  3PRE A;  2LVO A;  1DOI A;  4D2K A;  4HCN B;  1AN8 A;  2XK5 B;  1UBQ A;  4RGN A;  1R4M I;  3HM6 X;  4NJC A;  5LXH A;  1ZKH A;  4P1C C;  2IO3 B;  2KFJ A;  1WXQ A;  1E8Z A;  2O2V B;  3PZ7 A;  4GSW A;  1K50 A;  4HWI B;  3P42 A;  2GBR A;  3N3K B;  2MCN B;  3R2I A;  1LO5 D;  4M0W B;  1H8C A;  2L0T A;  4IWO A;  4I6N B;  2K8C A;  3ZRF A;  4W9L A;  2ZVN A;  4GDK A;  4DXG A;  1SSN A;  1YN5 A;  1WIA A;  4IM0 A;  2VH1 A;  3AUL A;  4M02 A;  1Q10 A;  1WWT A;  2ASQ A;  1NEK B;  2GI9 A;  3L0W B;  2IGD A;  3VTW A;  2MP2 A;  2IO2 B;  1T6B X;  1FCC C;  3BY4 B;  3I3T B;  3U2S C;  2K8B A;  2W9N A;  3IBE A;  4A6Q A;  4RGT A;  3EFC A;  1V1P A;  3SR6 A;  1IBX A;  2BVC A;  4IC7 B;  1ZDV A;  2D3B A;  4LNI A;  2LGY A;  1BUI C;  1OFF A;  4GDL B;  4KZ0 A;  3HIZ A;  4IKG A;  3RNG C;  1GUA B;  2WDT B;  3DQV A;  4KGT A;  4K3C A;  4B9K A;  1FXA A;  1MFW A;  3PZD A;  1KH0 A;  3X0W A;  2INP E;  5AEK B;  2IYD B;  1WXV A;  3HM3 A;  2M19 A;  2DZK A;  2NVU I;  2H88 B;  4TV3 A;  2O6V D;  2KDM A;  2JXX A;  1HTO A;  4NAM A;  3R8B A;  3QCA A;  3VVW B;  1Q1O A;  1WZ3 A;  3SD5 A;  2JZ3 B;  1WRI A;  1GNU A;  3DHH C;  2WQY B;  1NYR A;  3CMM B;  2LAS A;  3A33 B;  4EUT A;  4WJN A;  3B9J A;  5H8Y E;  4W9F A;  1PGA A;  2PTL A;  4H2A A;  2WXI A;  2DLB A;  1K8R B;  1UF0 A;  2CKH B;  2XBB C;  5L83 A;  3V05 A;  1WGR A;  1YX5 B;  3DBR B;  3BYT B;  2OOB B;  1F2R I;  3AE4 B;  2WXJ A;  2Y5P A;  1C9F A;  2LJI A;  2L76 A;  2M4N A;  4GLS C;  2GMI C;  4EOY A;  1WGG A;  3VFK A;  4HXD A;  4ANU A;  1WI0 A;  2NBU A;  1WR6 E;  2JVC A;  3I57 A;  3WAN A;  1LQB A;  2INN E;  2LGS A;  4HPL B;  4ACF A;  2D3C A;  4YSY B;  3HVZ A;  4AUQ C;  4HCP B;  2HJ1 A;  2CU1 A;  2D3G A;  1MI0 A;  3GE8 C;  3ZKJ C;  3AE8 B;  3P4Q B;  2KN4 A;  1KM7 A;  2HDE A;  2ON8 A;  4HDQ A;  5KHQ A;  1E8Y A;  1EM7 A;  2KJR A;  1JML A;  2CJN A;  3TL5 A;  1WM3 A;  1WXM A;  2IZV B;  2MBQ A;  4EE2 A;  2W55 A;  4KDL B;  2BT6 A;  3P4P B;  4REZ A;  3N30 A;  5KHO A;  3SEB A;  1KTK A;  4NNJ B;  3AMZ A;  3Q8F A;  4MGY E;  1IUE A;  3L08 A;  5G2N A;  1WSP A;  2XNA C;  2V4I B;  5HKH A;  2ZW0 A;  2WHI A;  3NZ3 A;  2J0K A;  4HRS A;  3WCQ A;  4RGO S;  2G4D B;  1K53 A;  2KLG A;  3CIR B;  4RNA A;  2ZCB A;  2LVP A;  1VZ6 A;  1CZP A;  2JRH A;  1PYW D;  2QMT A;  3MJ5 A;  1I42 A;  4BVU C;  3K9O B;  3B2G A;  3VDZ A;  1J7C A;  1E7U A;  1KLV A;  4YTN B;  3ZNG C;  1GG3 A;  4WJO A;  1LXD A;  4RH6 A;  2WXH A;  4LJO B;  3HVD A;  4E71 A;  4S0R A;  5DPR A;  4HDO A;  2K25 A;  5BYQ A;  2RDH A;  5EDS A;  1FO4 A;  4ITK A;  5D94 A;  3E56 A;  1CQV A;  3VTV A;  4WAA A;  3GZN I;  3Q3O C;  2MJ3 A;  5C23 A;  2L0F A;  1I35 A;  2KN5 A;  2LFI A;  4WQO B;  3IAS 1;  1PGX A;  1I4X A;  2DYM A;  5CX3 A;  1EWY C;  2UYZ B;  1ET9 A;  1TTN A;  3UQA A;  2W3R A;  4MJS A;  2BYF A;  2R2Q A;  2UWQ A;  3RD2 A;  3ZW3 A;  4K7W A;  1KF6 B;  3DHI C;  4XDC A;  4OVV A;  3WA0 A;  1I4G A;  1FM0 D;  4GMV A;  3DBL I;  2K8H A;  3MHZ A;  2H89 B;  1RAX A;  1NYQ A;  5H92 C;  4IDI A;  2LVQ A;  3CST A;  3AU5 A;  2KAC A;  3ZO5 B;  5DPT A;  2GBK A;  1WE6 A;  2C60 A;  3Q8C A;  4E3C A;  3KLS X;  4AP4 C;  4HEA 1;  2YLM A;  1LM8 B;  4GDL A;  3LJ3 A;  3M62 B;  2WWZ A;  2KFK B;  3U7D A;  2R61 A;  1F9J A;  2QSD A;  2FID A;  2ICI A;  1R4N B;  3PLU A;  3A9K B;  3VUY A;  3QK0 A;  4US8 A;  4AQ7 A;  4KKJ A;  1FPY A;  1ZP0 B;  5CHW A;  4K7S A;  3QQ8 B;  4RMA A;  1YQ3 B;  2QC8 A;  4NZL B;  1YQ4 B;  2D3A A;  2KQ7 A;  1JWB D;  2N7J A;  3Q8B A;  1X1M A;  3Q3M C;  5JZE B;  3D32 A;  2N7E A;  2NPT A;  5E6N A;  4WQM A;  2KKC A;  3NUH B;  2N1V A;  1K51 A;  2L3Z A;  2RMM A;  3H8H A;  3NHE B;  4IW0 A;  1RM6 C;  2JT4 B;  3B1L X;  1OTR B;  1C1Y B;  1A70 A;  2MEK A;  1E0Z A;  4W9C A;  4FN2 A;  4YXD B;  4YSX B;  2KAN A;  1MHX A;  3RNC C;  1XCT L;  1ZXH A;  3C0R B;  4N59 A;  4C7Z A;  1UUP A;  1KLU D;  1D5X C;  1V97 A;  1WGK A;  4DQO C;  1WYG A;  3PT2 B;  4G50 A;  2NTS A;  4F8C B;  1IBX B;  3BII D;  4OZA A;  1UEL A;  3KYD D;  5MPO A;  4WWN A;  3QAQ A;  3QX1 A;  3N32 A;  4DK5 A;  1FRD A;  4KGR A;  1AYF A;  1CMX B;  4M0W A;  3WAL A;  5AZF A;  3UGB B;  1AAR A;  3A9K A;  2LUM A;  3H9D A;  1LGR A;  4MJS B;  3HK0 A;  3DOW A;  2NCN A;  3QJZ A;  4DXF A;  4GOC A;  1JWU D;  4YSZ B;  1HXY D;  3R2T A;  3VR8 B;  4USA A;  4C00 A;  3TEZ A;  2O6V A;  4IG7 B;  2WYQ A;  3QC8 B;  3H7P A;  1TGZ B;  4M8N A;  5FR6 A;  2BWF A;  4W9J A;  3M3J A;  4P16 A;  2KOX A;  1JW9 D;  1WF9 A;  3KYC D;  4DWF A;  2K5P A;  4MH0 E;  4P7I A;  2J0M A;  2NPT B;  4WJP A;  1G6J A;  3BYY B;  2KC2 A;  4MAC A;  4FA6 A;  3GOE A;  4IM2 A;  3PHX B;  5FK9 C;  3ZTC A;  1V80 A;  5G5G A;  3TMP B;  2LZ6 A;  1EF5 A;  2WXL A;  3AEG B;  2KFK A;  4LK0 M;  3DWG C;  2D10 A;  3GE3 C;  3AU4 A;  3VUW A;  3P4S B;  3V62 A;  1CJE A;  3N9Y C;  2EMS A;  2V4L A;  2KJH B;  2E3T A;  1E7P B;  1FD6 A;  4C56 C;  3HHM A;  4CHK A;  1JQ4 A;  1NEN B;  1AW7 A;  4MSM B;  1I7H A;  1SIF A;  2JU6 X;  3KUD B;  4OZC A;  3DBR I;  1VCB A;  1UH6 A;  2ZPN A;  1UNS A;  5LLI A;  1E7V A;  3TBL D;  3PLV A;  3I63 C;  4IOI E;  4MGI E;  1V8C A;  2XK5 A;  2YEP F;  3Q3F A;  3H7P B;  4BKG A;  3ZJU A;  2NR2 A;  3JYU A;  2M8S A;  5CHV C;  3RYT A;  3W1Y A;  4DDI D;  2KDF B;  2KYW A;  3P2B A;  5LXI B;  4K7U A;  1DYQ A;  1ET6 A;  2VRR B;  4ZOH C;  2JUO A;  1A5R A;  1QT9 A;  4YT0 B;  5D7G A;  1C78 A;  1DGJ A;  1MJD A;  4BKT A;  4RFB A;  2C7M B;  4HKZ E;  4BBN C;  3OLM D;  5JHA A;  2KMM A;  2O6V B;  1YMH E;  1EWC A;  3BVZ A;  4A3P A;  3RUL A;  2LMC A;  3VH3 B;  1YN4 A;  4IWP A;  3PO0 A;  1NBF C;  4K3B A;  4A55 A;  3AE3 B;  2BTE A;  2LRU A;  1QOA A;  1FXI A;  3PRZ A;  5HFY A;  4JIO U;  4RCO A;  2K6Q A;  2D07 B;  4TQ0 A;  2MLB A;  4XWW A;  2M56 B;  2X38 A;  2FIF A;  3U7Z A;  4GU2 A;  2RR9 A;  4YL8 A;  4OHJ A;  2JPH A;  3B0A A;  2K3U A;  4R3D A;  3PVL A;  5E6O A;  3AEC B;  1V9J A;  4EZJ A;  3RFZ B;  1T5X D;  3BK2 A;  5T8I A;  3SFD B;  4ZYN A;  1TKG A;  3NJT A;  2WS3 B;  5JXV A;  1SGH A;  2DBY A;  3KQ4 A;  3AED B;  3AEA B;  3VXW A;  2E6X A;  2N9P C;  2FAZ A;  3UIO B;  1WX8 A;  5AZH A;  2M17 A;  2V3P A;  2OHF A;  2HTH A;  2N9L A;  2D11 A;  3CF6 E;  3PHW B;  4WWM A;  3RZF A;  2QHO A;  1C79 A;  5AUK A;  1GC6 A;  3IG3 A;  4PT5 A;  3LB8 C;  2G4S A;  2RPV A;  3Q6B A;  4A9A A;  4BOS C;  1XLQ A;  4W9D A;  2CHZ A;  1HTQ A;  2CS4 A;  3B08 A;  5FKA C;  4II2 B;  1JAL A;  2HTM E;  2WXF A;  3W1S C;  1ZW7 A;  3RUI B;  2BB5 A;  3EHV A;  3ZUN A;  2MBO A;  3L16 A;  1EU4 A;  1Z5S B;  2WX1 A;  4GGQ A;  1FRR A;  3NRZ A;  1ZXI A;  2I38 A;  1BML C;  2WNM A;  3U8Z A;  1I4R A;  3BIN A;  1WJ4 A;  2Y5B B;  2C9W B;  1Y8R C;  5C2T B;  4BZA A;  1D5Z C;  2KAJ A;  3PSE B;  1M94 A;  1NI3 A;  2KMC A;  3RNE C;  1T0S C;  1UGJ A;  4A90 A;  2Q5W D;  1QOG A;  3DVN V;  3ZQ4 A;  1UWX A;  1L2N A;  1P7F A;  4A20 A;  4II3 B;  1N5X A;  2M1M A;  3CSF A;  4UDU C;  2DYB A;  4L23 A;  4G0N B;  3A4S C;  3SU8 X;  1WJ6 A;  1YIW A;  1WZ0 A;  4KV2 A;  2AL3 A;  3IAM 1;  3BWU D;  3C19 A;  1FMA D;  2HD5 B;  1WJN A;  3M63 B;  3UF8 A;  3ML9 A;  1IYF A;  4X57 B;  3A1Q A;  1H4R A;  2JF5 A;  4DHJ B;  3IFW B;  1YQB A;  3Q8A A;  1Q0W B;  2C5L C;  2LGX A;  1FIQ A;  3VHT C;  1QKZ A;  1HZ6 A;  3ZJT A;  4K1R B;  2CR5 A;  2A4Z A;  3KUC B;  4CO7 A;  3PS6 A;  1TKY A;  3B2F A;  2WXG A;  2KTR B;  1SE2 A;  2FCQ A;  3IT6 B;  2BWE S;  1OGW A;  2KLC A;  2MSE D;  1XCQ L;  2KTF A;  1ZUD 2;  3RZW C;  3V61 A;  3VRA B;  2KDE B;  4MM3 B;  2K1F A;  2IGG A;  3PV1 A;  4B95 A;  3ONS A;  4P6V F;  4AS1 A;  2AQ2 B;  4BAX A;  4KDI C;  3QWZ B;  2PKO A;  2JZP A;  3NG0 A;  3RNB C;  1ZGU B;  2BGF A;  2IY0 B;  2KWD A;  4NAW B;  2VZK B;  4PYZ A;  1TT5 B;  2KMA A;  2PMV A;  3RNF C;  3ZRC A;  3IHP C;  1OEY A;  4MEM A;  4ICV A;  3I9V 1;  2V1Y A;  3QA8 A;  4KVG B;  4A3O A;  2RD0 A;  4BKS A;  2N0S B;  3PGE A;  2MHJ A;  2PW9 A;  3Q3J A;  1FCL A;  2NMQ A;  4KKI A;  5TR5 A;  3RNA C;  3ZIM A;  4US9 A;  1QLB B;  1J7A A;  1OQY A;  2JY6 A;  4O1N A;  1YJI A;  3DVN U;  5EE3 A;  4FLH A;  1FFV A;  3N20 C;  1E6E B;  1ZPS A;  2WDQ B;  1CK1 A;  2RGF A;  3O13 A;  4BOZ B;  1VZ8 A;  4F1S A;  3AE9 B;  2ZEQ A;  1PDX A;  3MC0 B;  3DBS A;  4LJP B;  5D3D A;  3TIX A;  4HJK A;  4TKN A;  4XX5 A;  4DHZ B;  3N1Z C;  1RFK A;  2LWP A;  3ETR A;  3Q3N C;  4QAY A;  3FKY A;  2IY1 B;  2KTR A;  1MG8 A;  2MBB B;  5D2M B;  4LLG M;  4W9I A;  4W9G A;  1HE8 A;  1L0X B;  4KX6 B;  1YN3 A;  4E74 A;  2OJR A;  1D6E C;  3FC4 A;  4ASW C;  2LEK A;  1JWS D;  5C3J B;  2DZJ A;  2YVC A;  3BVG A;  2MA9 B;  3R7Q A;  3EA6 A;  5C1Z A;  1GPX A;  3KUZ A;  1ZOY B;  5EE9 A;  4J6I A;  2JYE A;  2PLP A;  1FXT B;  1E8X A;  3OWE B;  5BMG A;  1VDV A;  3ALB A;  3OJ4 B;  1MHH E;  1V86 A;  4C4V A;  4FUL A;  3RT3 B;  1EU3 A;  2B76 B;  1I4H A;  2BF8 B;  2UU7 A;  1IGD A;  1TS2 A;  3A1Q B;  5BO4 B;  1QQR A;  1TS3 A;  1BXT A;  2PPH A;  1WMH B;  2J52 A;  4LNK A;  1KRH A;  2LHD A;  3MHS D;  1WXA A;  3VAW A;  4Q2J A;  3ZVV A;  2BKF A;  3OJ3 A;  3UI3 A;  3PTF C;  2AEH A;  2LXA A;  1D4B A;  3C8Y A;  2WXO A;  1E5W A;  3AM9 A;  2YEP B;  2G3Q B;  4ZRJ A;  3T3O A;  4WUR A;  2TSS A;  2MBE A;  4KSK C;  2LXC A;  1WGY A;  1J19 A;  1Q5W B;  2KZR A;  4NPN A;  2N7D A;  1XLN A;  3O65 B;  2KNB A;  1N6Z A;  4ZRQ A;  4EEW A;  1SE3 A;  4HKQ A;  1HA5 A;  1DOY A;  3FAH A;  3ZXR A;  3MP9 A;  4C4V B;  3VR9 B;  2L00 B;  4W9K A;  4ZRI A;  3WAP A;  5TSS A;  4YWG G;  2BYV E;  3MC8 A;  2KVZ A;  1C76 A;  1F77 A;  1VLB A;  1SBB B;  3PRM B;  3RMK C;  2DEN B;  4WH4 A;  2RSU A;  4RM8 A;  1OEY J;  4BBN F;  4CYE A;  2PE6 B;  4TQ1 A;  1BT0 A;  5E6P A;  2AWT A;  2X8X X;  2KX3 A;  2CJO A;  3KH0 A;  1SEB D;  3N1X C;  1EF1 A;  2JRI B;  1STE A;  1UGM A;  4FXC A;  2QJL A;  2IPK D;  4F7Z A;  5JH5 C;  4OVZ A;  4OZB A;  1YOV B;  1UD7 A;  1F0Z A;  1TY0 A;  1WMH A;  3S2A A;  2JWU A;  2M0X A;  4PYU A;  4ZHP A;  1PFD A;  4URK A;  2NBW B;  4A8X C;  1T0Q C;  5BYS A;  3A9J A;  1GB1 A;  3AB5 A;  5IO9 A;  2FUH B;  2ZW1 A;  2DHZ A;  2GBM A;  1L0Y B;  2LJ5 A;  3ZGZ A;  1TZO A;  2PEA A;  5AUI A;  2GBJ A;  4MSQ B;  3TJP A;  1FFU A;  3T9L A;  2WXQ A;  1SIJ A;  1ROE A;  1TJE A;  2AX5 A;  4M00 A;  4ARC A;  2N1W A;  2KXJ A;  3APD A;  3I5J C;  4J3O D;  1LFD A;  3R7R A;  3MFG A;  3L13 A;  4ZHO A;  5CTR C;  3P4R B;  2IJ0 A;  4FBJ B;  2VH2 A;  1L4D B;  2K39 A;  1Z2M A;  4TUU A;  5BMI A;  1E8W A;  2GBN A;  3KWV A;  2WU5 B;  4IWQ A;  4WWP A;  3MC9 A;  3APC A;  2JXT A;  3WIM A;  4N58 A;  1IGC A;  2BYT A;  3KWL A;  2BS2 B;  3L10 B;  2REX A;  1K52 A;  2GRI A;  1HZ5 A;  1JRU A;  3DDC B;  4MM3 A;  4ZYS A;  1C77 A;  2MJD A;  1E90 A;  1UZX B;  3ABV B;  4WIP A;  1MPE A;  1XEE A;  4DXA B;  2RPQ A;  4M8M A;  3W1S A;  1L6V A;  4JWU C;  4L1B A;  2R2O A;  2ACZ B;  3W9C B;  4C7Y A;  2MW5 A;  4KZC A;  4RF0 A;  3DHG C;  3MJW A;  2BB6 A;  3L54 A;  1J8C A;  3ZDT A;  1SE9 A;  3W5V B;  4AJW A;  3NZU A;  1WXS A;  1FEH A;  1N61 A;  1XF5 L;  3U30 A;  5IOI A;  2AQ3 B;  2V0G A;  1YJ1 A;  4WAF A;  3U4E G;  1WGH A;  3Q8E A;  3H6N A;  2FCM A;  1WRD B;  2L32 A;  2WXP A;  2LRW A;  1S1Q B;  2J42 A;  2QEJ C;  2FE8 A;  1F52 A;  4FHK A;  4W9H A;  1DOX A;  1N62 A;  1L6U A;  3AN1 A;  3RN9 C;  5HI1 A;  4N9F 4;  4GIV A;  1L0V B;  5E6J A;  2CHX A;  2MBH A;  4B6W A;  4XYC A;  3VTU A;  1NVI D;  4JLC A;  4K81 A;  3AEE B;  5DPW A;  4B0M A;  2IDY A;  1S3S G;  3AV8 A;  4NJ6 A;  1V49 A;  5DCN A;  2BQQ A;  2V9H A;  5CHF A;  4JE3 B;  4JWS C;  3ENE A;  2K9X A;  2DAF A;  5AZG A;  4I6P A;  3GB1 A;  5GMV A;  1RLF A;  4KIK A;  2IND C;  5BMH A;  3IT4 B;  4BFR A;  2O2V A;  1YJJ A;  2JWZ A;  3UIN B;  5G55 A;  2L1A A;  2IBI B;  3L17 A;  2I1K A;  3WAM A;  2JQR B;  2DZM A;  3EGR A;  1C4A A;  3QHT A;  2EEL A;  2I1J A;  1B1Z A;  1V5T A;  2LGD A;  2RDG A;  3MTN B;  2J7Q B;  1J7B A;  3R66 C;  4ANW A;  4HLE A;  5IP4 D;  2SEB D;  4WWO A;  2DX5 B;  3RPF C;  2Z8L A;  4XZ4 A;  1UBI A;  4GXB A;  3ML8 A;  2AYO B;  3TSS A;  2Z59 B;  3GZN B;  1M4V A;  3P1M A;  4ANV A;  2MX2 A;  1P0R A;  1F1H A;  1TS5 A;  3W2D A;  2KX0 A;  3T3N A;  2LUE A;  4FHJ A;  2ZNV B;  1YNT E;  2JYT A;  2OJW A;  3NOB A;  3AE7 B;  3ZNI D;  5EE1 A;  1YD8 U;  1V1P B;  2WU2 B;  2IO0 B;  2GLS A;  1V5O A;  3P63 A;  4JGH B;  2VZK D;  2K6D B;  3ZNZ B;  1R4N I;  1WH3 A;  4ICU A;  2IGH A;  3Q69 A;  3WAO A;  4MEL A;  2WXK A;  1E9M A;  4PK1 A;  2NS5 A;  1N63 A;  1PUT A;  2FUG 1;  2IO1 B;  2XN9 C;  3SFE B;  2ZZP B;  1XT9 B;  3JSV A;  1I4P A;  3JSV B;  3A9J B;  3CWI A;  4RGM A;  2KT7 A;  2WX0 A;  3ZLZ A;  2V3N A;  3EFU A;  3KVF B;  1UWM A;  2PE9 A;  1VR9 A;  1RWS A;  4MGK E;  3NVV A;  3AEF B;  3GS2 A;  2J0J A;  2Y5C A;  3JVZ X;  4EZL A;  4JL9 A;  2BS4 B;  5L95 C;  1GOZ A;  2JSV X;  3TUO A;  2EMT A;  4PS3 A;  4EZK A;  3J9C A;  3PRP B;  5HG2 A;  3HUI A;  1PGB A;  2KJ6 A;  1QIL A;  2PIA A;  1V1O A;  1HEZ E;  2PJH A;  1WR1 A;  3ZTD A;  2QIE B;  2QIL A;  1TIF A;  4RF1 A;  3OG5 A;  3DBH I;  1XO3 A;  2ZNV C;  1C4P A;  3FIL B;  1GAQ B;  1WY8 A;  1XD3 B;  2KDB A;  1GC7 A;  3TEY A;  2GOW A;  1V6E A;  3AXC A;  2MP2 B;  1D3Z A;  2HJ8 A;  2GB1 A;  3AE6 B;  4JPS A;  2CHW A;  3M95 A;  1GJZ A;  1EO6 A;  2BKR B;  1IPG A;  5DPS A;  1WGD A;  1ZDX A;  3APF A;  2SAK A;  2WDV B;  4TSS A;  3BZD B;  3TEX A;  2FCS A;  4ANX A;  4AJY B;  3ZNH B;  4HJG E;  4XGA B;  2HE7 A;  3LDZ E;  3E9S A;  1C4C A;  1ZE3 D;  4LNO A;  5J17 A;  2ONQ A;  2FBW B;  5GXG B;  4AWJ A;  3NY5 A;  3VQI A;  4ARI A;  4YTP B;  3AE2 B;  4TMA B;  3QIJ A;  2DWQ A;  4NAW A;  2MH7 A;  2LHE A;  3TCA A;  4JX1 C;  3NS8 A;  4FJZ A;  5D3I B;  1EUV B;  4IM3 A;  2A5U A;  2LI5 A;  1ESF A;  1ENF A;  1P98 A;  3AH7 A;  3DPD A;  2WXN A;  2MQJ A;  3Q14 C;  5J18 A;  2G1E A;  2C7N B;  5J2R A;  2N9E B;  1L4Z B;  3SHQ A;  1XLP A;  3K9P B;  1OQR A;  4DDG D;  1AWD A;  2J53 A;  2BS3 B;  2PVO D;  1J0G A;  1IP9 A;  3EC8 A;  4W9E A;  1SXT A;  2BBC A;  1ISN A;  4DBG A;  2KQS A;  1F2R C;  1TZ1 A;  4B0E A;  2W3S A;  3EUB 2;  3BVM A;  2KD0 A;  4JQW C;  4NQL B;  2L83 A;  1YX6 B;  4NQK E;  3URY A;  5IN7 A;  2L05 A;  2L8J A;  4PS8 A;  3VH4 B;  3QAR A;  4HK2 A;  2WGS A;  4FAD A;  2FNJ B;  2N4F A;  4NJ7 A;  2W82 A;  4I6L B;  1QZE A;  1KJT A;  2I2Y A;  1JRO A;  3IVF A;  4KIK B;  2FCN A;  1JCK B;  1HQR D;  2DNF A;  4PS7 A;  3EEC A;  1WYW B;  2LGI A;  2KHW B;  3ZDM C;  4FJY A;  2ZJD A;  1B9R A;  1Y56 A;  1XXG A;  1V2Y A;  1N60 A;  2NBV B;  2C7H A;  2J4X A;  3W5U B;  2N9X A;  1MG4 A;  3AI5 A;  3DBH B;  4HRO A;  5BYR A;  2BPS A;  3LXF A;  3IXS A;  1SJE D;  1WX9 A;  4EFO A;  5I4D A;  1VZ7 A;  4AOF A;  4G11 A;  4HPM B;  5D6J B;  4ZRK A;  2WDR B;  1T0Y A;  1C3T A;  4LNF A;  4OVU A;  1U4A A;  4N6E B;  3V6C B;  2JX5 A;  4MGZ E;  1L7Y A;  4XC2 A;  2ZVO A;  1N5W A;  4GB9 A;  2JZZ A;  1ACC A;  2ZCC A;  2BYE A;  2G45 B;  2B3A A;  1RRB A;  1RFA A; 
#chains in the Genus database with same CATH homology
 3B2G A;  5FKA C;  1JAL A;  2HTM E;  2WXF A;  1J7C A;  3AE1 B;  1C77 A;  4ZYS A;  1SE4 A;  2MJD A;  3ABV B;  4YTN B;  4WIP A;  2BB5 A;  1MPE A;  1XEE A;  1T3Q A;  2PVG C;  3ZJV A;  5G5H A;  4RH6 A;  3W1S A;  1L6V A;  2WXH A;  1EU4 A;  3HVD A;  4JWU C;  4L1B A;  2ACZ B;  3W9C B;  1FRR A;  4C7Y A;  4RF0 A;  4XWT A;  2BB6 A;  3NRZ A;  1ZXI A;  2I38 A;  2DYO A;  1XLO A;  1BML C;  3NVY A;  3W5V B;  2WNM A;  2L52 A;  1QOB A;  1I4R A;  5BYQ A;  2OED A;  2RDH A;  1FO4 A;  4ITK A;  1FEH A;  3E56 A;  1CQV A;  5HHD G;  1N61 A;  1XF5 L;  2AQ3 B;  2V0G A;  1R7S A;  4WAF A;  5C2T B;  5FR3 A;  3U4E G;  1D5Z C;  3NS1 A;  2KAJ A;  2MJ3 A;  1NI3 A;  3Q8E A;  2WP9 B;  3HRD D;  2L32 A;  1UGJ A;  2LFI A;  2WXP A;  3AE5 B;  3IAS 1;  3NVW A;  4A90 A;  1PGX A;  1I4X A;  1QOF A;  2DYM A;  2Q5W D;  2J42 A;  1EWY C;  2QEJ C;  1QOG A;  4MT5 A;  2FE8 A;  1ET9 A;  3ZQ4 A;  4XE0 A;  1UWX A;  1TS4 A;  2K22 A;  1P7F A;  2W3R A;  4KGS A;  1DOX A;  1N5X A;  1N62 A;  4UDU C;  4L23 A;  1L6U A;  3AN1 A;  1KF6 B;  3IAM 1;  5HI1 A;  3BWU D;  1SF0 A;  1FMA D;  4XDC A;  2AQ1 B;  1I4G A;  1FM0 D;  1L0V B;  2NTT A;  5E6J A;  1KLG D;  1FNV A;  2D5G A;  3MHZ A;  2H89 B;  3PZ8 A;  1L5P A;  3Q8A A;  4LTU A;  1JWA D;  1FIQ A;  1NYQ A;  1NVI D;  4IDI A;  5H92 C;  1QKZ A;  3GP7 A;  1HZ6 A;  3ZJT A;  3AEE B;  4B0M A;  1P7E A;  2IDY A;  3AEB B;  1TKY A;  3AV8 A;  3B2F A;  2KAC A;  2WXG A;  2W54 A;  1SE2 A;  3IT6 B;  2KQ4 X;  3Q8C A;  1OQQ A;  3VRB B;  3ZYY X;  3L4P A;  1XCQ L;  3KLS X;  4JE3 B;  4JWS C;  2K0P A;  2K9X A;  1ZUD 2;  4HEA 1;  4C80 A;  3VRA B;  3TEW A;  3GB1 A;  4MH8 A;  2M0A A;  4MM3 B;  2R61 A;  2IGG A;  2QSD A;  3LYY A;  2ICI A;  5BMH A;  2WLB A;  3IT4 B;  4P6V F;  1YJJ A;  4AS1 A;  2AQ2 B;  3U52 E;  2L1A A;  2EKI A;  4US8 A;  2PKO A;  4AQ7 A;  1VJK A;  2JZP A;  4KKJ A;  2JQR B;  4GDK B;  3DWM A;  1ZP0 B;  1JRP A;  2BW2 A;  3EGR A;  1C4A A;  2KWD A;  2WXM A;  1E10 A;  1YQ3 B;  1RYJ A;  4NZL B;  2EEL A;  1YQ4 B;  2CU3 A;  4NAW B;  1B1Z A;  2RDG A;  2VZK B;  1I4Q A;  1J7B A;  2PMV A;  1QF6 A;  2SEB D;  3FIL A;  3RPF C;  2MJE A;  2Z8L A;  3I9V 1;  1JWB D;  2N7J A;  3Q8B A;  1MVK A;  3TSS A;  4L2Y A;  2N0S B;  2WXR A;  1M4V A;  4XDD A;  3P1M A;  2PW9 A;  1FCL A;  1TKE A;  2NMQ A;  1GB4 A;  1TS5 A;  3W2D A;  4ZRP A;  3T3N A;  4KKI A;  3V3X A;  1FNU A;  1YNT E;  3NVZ A;  4WQM A;  1QLB B;  2JYT A;  4US9 A;  3AE7 B;  1TY2 A;  1J7A A;  3NUH B;  5EE1 A;  2Y3A A;  1SJH D;  1JWM D;  1K51 A;  1V1P B;  4O1N A;  2WU2 B;  2RMM A;  1YJI A;  3H8H A;  1FNW A;  3P63 A;  5EE0 A;  5EE3 A;  2VZK D;  1FFV A;  2G9H D;  3BK1 A;  2N9K A;  1RM6 C;  1E6E B;  2IGH A;  3Q69 A;  1ZPS A;  2WDQ B;  1A70 A;  2MEK A;  1E0Z A;  1CK1 A;  4CQN A;  3O13 A;  4YXD B;  1D5M C;  1VZ8 A;  2WXK A;  3AE9 B;  4YSX B;  1E9M A;  1PDX A;  4YTM B;  3MC0 B;  1MHX A;  1SB3 C;  1XCT L;  4OW0 A;  1ZXH A;  5D3D A;  1N63 A;  5LNK 1;  1PUT A;  2FUG 1;  4N59 A;  2XN9 C;  3SFE B;  4C7Z A;  1TYG B;  1KFY B;  1UUP A;  1VRA B;  1I4P A;  1KLU D;  1RFK A;  1D5X C;  3ETR A;  1V97 A;  1WGK A;  4DQO C;  3CWI A;  4RGM A;  1WYG A;  2NTS A;  1IBX B;  1DOI A;  2V3N A;  3BII D;  4D2K A;  4LLG M;  1AN8 A;  4RGN A;  4OZA A;  1UWM A;  1VR9 A;  1RWS A;  3NVV A;  4NJC A;  3AEF B;  3GS2 A;  5MPO A;  2Y5C A;  1L0X B;  4KX6 B;  1YN3 A;  2BS4 B;  1FRD A;  4KGR A;  1D6E C;  1GOZ A;  1WXQ A;  2JSV X;  3FC4 A;  3TUO A;  1AYF A;  2LEK A;  1JWS D;  5C3J B;  3PZ7 A;  4M0W A;  3BVG A;  3J9C A;  5HG2 A;  1K50 A;  3HUI A;  3EA6 A;  1PGB A;  3P42 A;  1QIL A;  2LUM A;  1ZOY B;  1LO5 D;  2PIA A;  3R2I A;  1V1O A;  1HEZ E;  5EE9 A;  1GPX A;  2JYE A;  2PLP A;  4DXF A;  1JWU D;  3OWE B;  5BMG A;  1VDV A;  2QIE B;  4DXG A;  1HXY D;  3R2T A;  3VR8 B;  4USA A;  2QIL A;  4YSZ B;  1SSN A;  4RF1 A;  3TEZ A;  1YN5 A;  1MHH E;  1XO3 A;  1Q10 A;  1EU3 A;  1C4P A;  1I4H A;  2B76 B;  1IGD A;  1TS2 A;  1WWT A;  3FIL B;  1NEK B;  1QQR A;  1GAQ B;  4P16 A;  2GI9 A;  1JW9 D;  1TS3 A;  1BXT A;  2IGD A;  3TEY A;  2J52 A;  2K5P A;  1T6B X;  1FCC C;  1KRH A;  3U2S C;  2LHD A;  3BYY B;  4A6Q A;  4MAC A;  4RGT A;  2GB1 A;  1V1P A;  3AE6 B;  4Q2J A;  3SR6 A;  4JPS A;  1IBX A;  3UI3 A;  5FK9 C;  1ZDX A;  5G5G A;  1D4B A;  1ZDV A;  2WXL A;  3C8Y A;  3AEG B;  2SAK A;  2WXO A;  4LK0 M;  3DWG C;  2WDV B;  3AM9 A;  2YEP B;  4TSS A;  3BZD B;  3TEX A;  3T3O A;  1BUI C;  4WUR A;  1OFF A;  4GDL B;  4HJG E;  3P4S B;  2TSS A;  4IKG A;  1CJE A;  3N9Y C;  3E9S A;  1C4C A;  4KGT A;  1ZE3 D;  2E3T A;  1E7P B;  1FXA A;  2ONQ A;  1FD6 A;  2FBW B;  5GXG B;  1KH0 A;  4C56 C;  1JQ4 A;  1NEN B;  3VQI A;  4ARI A;  1AW7 A;  1XLN A;  4YTP B;  2INP E;  3AE2 B;  1I7H A;  4TMA B;  2DWQ A;  2JU6 X;  4ZRQ A;  4OZC A;  2MH7 A;  2LHE A;  1SE3 A;  4HKQ A;  1UNS A;  2M19 A;  1HA5 A;  1DOY A;  3FAH A;  3MP9 A;  3VR9 B;  4JX1 C;  4IOI E;  1V8C A;  2YEP F;  2H88 B;  5TSS A;  3ZJU A;  4YWG G;  2KDM A;  5D3I B;  4NAM A;  3R8B A;  1ESF A;  1C76 A;  1WRI A;  1ENF A;  1F77 A;  2WQY B;  1NYR A;  3AH7 A;  1VLB A;  1SBB B;  2WXN A;  4WH4 A;  1DYQ A;  3B9J A;  1ET6 A;  4ZOH C;  5H8Y E;  4TQ1 A;  1PGA A;  2G1E A;  1QT9 A;  4YT0 B;  5D7G A;  2PTL A;  1C78 A;  2WXI A;  4H2A A;  2DLB A;  1DGJ A;  2CJO A;  1L4Z B;  1XLP A;  1OQR A;  4RFB A;  1SEB D;  1AWD A;  4HKZ E;  2J53 A;  2BS3 B;  2KMM A;  1STE A;  2PVO D;  3V05 A;  1YMH E;  1EWC A;  3BVZ A;  3BYT B;  4FXC A;  2LMC A;  1F2R I;  2QJL A;  2IPK D;  3AE4 B;  1SXT A;  2WXJ A;  1YN4 A;  4OVZ A;  2BBC A;  2Y5P A;  4OZB A;  2LJI A;  3PO0 A;  1C9F A;  4GLS C;  1F0Z A;  1F2R C;  1TY0 A;  4B0E A;  2JWU A;  2W3S A;  3EUB 2;  3BVM A;  4A55 A;  3AE3 B;  2L83 A;  4ZHP A;  2BTE A;  1PFD A;  1QOA A;  1FXI A;  3URY A;  4A8X C;  5BYS A;  5HFY A;  4RCO A;  3I57 A;  1GB1 A;  2INN E;  4TQ0 A;  3AB5 A;  2ZW1 A;  4XWW A;  4YSY B;  3HVZ A;  1L0Y B;  2M56 B;  2X38 A;  3ZGZ A;  3U7Z A;  2W82 A;  1TZO A;  5AUI A;  1MI0 A;  2I2Y A;  4OHJ A;  1JRO A;  1FFU A;  2K3U A;  3AE8 B;  4R3D A;  3P4Q B;  2KN4 A;  2WXQ A;  3AEC B;  1SIJ A;  1ROE A;  1JCK B;  1TJE A;  2HDE A;  2ON8 A;  1HQR D;  2AX5 A;  1EM7 A;  2LGI A;  1JML A;  2CJN A;  3RFZ B;  1B9R A;  1Y56 A;  1T5X D;  3BK2 A;  5T8I A;  1XXG A;  4ARC A;  1N60 A;  3SFD B;  4EE2 A;  2W55 A;  2J4X A;  2BT6 A;  1TKG A;  3P4P B;  2WS3 B;  3W5U B;  4REZ A;  5JXV A;  2DBY A;  4J3O D;  4HRO A;  5BYR A;  3SEB A;  3KQ4 A;  3AED B;  3MFG A;  4ZHO A;  3AEA B;  2E6X A;  1KTK A;  3P4R B;  3LXF A;  3IXS A;  2IJ0 A;  3AMZ A;  1SJE D;  3Q8F A;  5I4D A;  1IUE A;  1L4D B;  2V3P A;  2OHF A;  1WSP A;  2N9L A;  2XNA C;  2V4I B;  1VZ7 A;  2ZW0 A;  3NZ3 A;  5BMI A;  4WWM A;  3KWV A;  2WDR B;  2WU5 B;  4HRS A;  3WCQ A;  1C79 A;  4N6E B;  4RGO S;  2JX5 A;  5AUK A;  1K53 A;  4PT5 A;  3LB8 C;  3CIR B;  2JXT A;  4RNA A;  1IGC A;  4N58 A;  2BYT A;  1N5W A;  2RPV A;  1VZ6 A;  2BS2 B;  1CZP A;  3KWL A;  4A9A A;  1XLQ A;  1ACC A;  1K52 A;  1PYW D;  2GRI A;  2QMT A;  1HZ5 A;  3MJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...