3CWIA

Crystal structure of thiamine biosynthesis protein (this) from geobacter metallireducens. northeast structural genomics consortium target gmr137
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
69
structure length
69
Chain Sequence
MNLTVNGKPSTVDGAESLNVTELLSALKVAQAEYVTVELNGEVLEREAFDATTVKDGDAVEFLYFMGGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiamine-biosynthesis protein ThiS
publication title Crystal structure of thiamine biosynthesis protein (ThiS) from Geobacter metallireducens.
rcsb
source organism Geobacter metallireducens gs-15
molecule tags Biosynthetic protein
total genus 15
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2008-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3cwiA00
1YJJA 3NVWA 1ZUD2 4USAA 3FC4A 2K22A 1XLNA 3ABVB 1VLBA 1N61A 4JX1C 1F0ZA 3NVZA 1N5WA 5G5HA 1FMAD 1AWDA 1QOGA 1TJEA 1ZXIA 3CWIA 5G5GA 1ZP0B 1PDXA 3SR6A 3HUIA 3AM9A 1QT9A 1ZOYB 3VR9B 2L52A 4ITKA 3W5UB 1WWTA 4HRSA 1NEKB 1J7BA 1R7SA 4ZHOA 1J7CA 2DWQA 1QOFA 2H88B 1JW9D 1SB3C 3AEEB 3ETRA 1DGJA 2CJNA 5EE1A 2BS3B 1RFKA 1L5PA 3AMZA 4KX6B 4ZOHC 4YSYB 1OFFA 1FFVA 1QOBA 4C7ZA 3B9JA 1GPXA 1E0ZA 3KWLA 2W3RA 1WYGA 1VJKA 3AE3B 2KAJA 3AEDB 3NRZA 1XLPA 4WWMA 3W9CB 1DOIA 3AB5A 1N60A 1FFUA 3AEGB 3EUB2 3B2GA 1FXIA 1JROA 4P6VF 1YQ3B 3VRBB 1N62A 1E9MA 2HTME 2W55A 2WQYB 2BT6A 1XLOA 3AE5B 3AE8B 3DWMA 4US8A 1YQ4B 2Q5WD 1KF6B 3SFDB 2QIEB 1RYJA 2WDRB 2WU5B 4N58A 2DBYA 4N59A 1TKGA 2WU2B 1FM0D 1NYRA 4HROA 1EWYC 3FAHA 1GAQB 4IDIA 1WRIA 4WQMA 4US9A 1YJIA 3AH7A 2MJDA 1J7AA 3NVVA 3AE6B 2Y5CA 3AEBB 3RPFC 2ACZB 2BS4B 2QJLA 3VRAB 1I7HA 2E3TA 4YTPB 1FO4A 1QF6A 2EKIA 5EE3A 3AEFB 1QOAA 5EE9A 5C2TB 1E6EB 1TYGB 1V8CA 1KRHA 1WXQA 2PIAA 4ZHPA 2K9XA 1OQRA 1L6VA 2M19A 2WDVB 2W3SA 1OQQA 3WCQA 3AE2B 1N5XA 1L0VB 2JQRB 3P4SB 4LTUA 1PUTA 2AX5A 2LEKA 3NS1A 1FIQA 1SIJA 3P4QB 5C3JB 1JQ4A 2L83A 1JWAD 1IUEA 2BS2B 3AE7B 3AECB 1KFYB 3P4PB 3ZYYX 1E7PB 4YT0B 1UWMA 5AUIA 3W5VB 1FXAA 1QLBB 2WLBA 1NENB 4C7YA 2WDQB 5H92C 1ROEA 2PVOD 4C80A 1DOXA 3P63A 1CZPA 1SF0A 2PKOA 3NVYA 1JALA 2OHFA 2W54A 2MJ3A 1JRPA 1DOYA 4YTNB 5H8YE 4N6EB 3AN1A 1NVID 1FRDA 1N63A 3AEAB 3HRDD 1AYFA 3CIRB 1PFDA 1XO3A 2FBWB 3AE1B 2WP9B 1NI3A 1WGKA 1JWBD 2PVGC 5AUKA 1T3QA 4JWSC 1VDVA 3B2FA 2MH7A 3AV8A 3HVZA 4YSZB 3P4RB 4YXDB 2WS3B 4YTMB 1TKEA 4A9AA 3P1MA 3AE4B 2M56B 3AE9B 2CJOA 2N0SB 5EE0A 2JX5A 1XLQA 3BIID 2KMMA 1V97A 2CU3A 3LXFA 4JWUC 5MPOA 1E10A 3L4PA 3SFEB 1RM6C 1CJEA 5GXGB 1L6UA 3DWGC 2B76B 1RWSA 2G1EA 2K5PA 4FXCA 1NYQA 3PO0A 2H89B 3VR8B 1B9RA 1FRRA 1A70A 2MJEA 3LB8C 4YSXB 1TKYA
chains in the Genus database with same CATH superfamily
1L2NA 1N5WA 1FMAD 1QOGA 3N9YC 3I3TB 1I35A 2IYDB 2L0FA 4QAYA 3TSSA 2KFKB 1EF1A 1TS4A 3O13A 1WJUA 4W9IA 4HRSA 2PPHA 4WAAA 4ASWC 4AJWA 1JW9D 1J0GA 3WALA 1PGBA 4HEA1 3UF8A 2N9XA 4KX6B 2KDIA 4GLSC 4FBJB 5I4DA 1JMLA 4IWPA 1D6EC 3PLVA 3GE3C 1HTQA 1AARA 2KNBA 2J0KA 2AL3A 2V3NA 1RYJA 3ZNID 1YNTE 2BB5A 4MGYE 1NYRA 4GDLB 2K8CA 2KX3A 4JPSA 2LZ6A 1FO4A 1VRAB 1FEHA 2FIDA 3U7DA 2Z0EB 1QQRA 3RNGC 3EFUA 4C4VB 3IT6B 1P0RA 4B6WA 3P4QB 1XF5L 3PLUA 4ARCA 3NY5A 3ZNZB 2KLCA 1MG4A 3AECB 2BF8B 2JXXA 1KFYB 2A4ZA 4GDKB 4RMAA 4CYEA 1V2YA 2G3QB 2FIFA 1FXTB 2OHFA 4XWTA 4JIOU 1L4DB 3X0WA 4KIKB 3R66C 2EELA 1T3QA 3APFA 1VDVA 4KGRA 1R4NI 3R2TA 4TQ0A 1MJDA 3B1LX 3AE4B 3GOEA 4M8MA 3RT3B 1WR1A 5BMGA 1J8CA 1VD2A 2D07B 1WFYA 3BVGA 3NUHB 4NPNA 4LDTB 4HK2A 5FK9C 1N61A 1F0ZA 3ZGZA 3CWIA 3MHSD 1XT9B 4M0WA 1E8YA 2L52A 1SE9A 1C3TA 2BS3B 3AMZA 1QOBA 2KDEB 2E6XA 2W3RA 1D5ZC 4NY0A 2EMSA 2HTME 3Q69A 2N9EB 4KVGB 1FM0D 1P7FA 1J19A 1FCCC 3BK2A 4WIPA 4AS1A 2HDEA 1OGWA 4DQOC 2IO2B 3VUWA 2VRRB 4FHKA 4HDOA 1TS2A 3EHVA 1LXDA 4RGNA 1I4QA 2LEKA 3QA8A 2O6VA 2DZJA 3W5VB 2N1WA 3A33B 4HCPB 4WH4A 4EUTA 1GC7A 4D2KA 2JVCA 1D5XC 2NS5A 4DDGD 3PS6A 1JWSD 2N7JA 2N9PC 3AE1B 1T0RC 2BYVE 2VH2A 5E6OA 2K0PA 2O2VB 2KO3A 1HE8A 2KMMA 2J4XA 2DHZA 2LGIA 1WGHA 3RNFC 1TGZB 1QILA 1A70A 4JGHB 2AX5A 2NVUI 2EKEC 3HM3A 2V9HA 4GSWA 4LK0M 3APDA 4W9EA 2MHJA 3R3MA 2IDYA 4EOYA 3Q8EA 4W9CA 4XX5A 3WANA 1P3QU 1F9JA 3TBLD 2Y5BB 2KQ4X 3T9LA 4R3DA 1FXIA 4P6VF 3VRBB 4B95A 2MX2A 2KC1A 2KDFB 1NI2A 3U8ZA 3PRZA 4W9KA 1G6JA 2KC2A 4LDTD 1UBIA 2KDBA 4WQMA 4HROA 4II2B 4K1RB 5DCNA 1AN8A 5D7GA 2KN4A 2MSED 1J7AA 3HIZA 5C1ZA 1RRBA 3LYYA 5E6NA 2HJ8A 4HVBA 3U52E 4ZHPA 5LXHA 4AWJA 3AE2B 2WWZA 4IWQA 2GMIC 2D3AA 3ZJUA 3UQAA 2RPQA 3Q6BA 3Q3FA 1YN4A 1L0XB 1C76A 4WWNA 5TSSA 2LRWA 2WXMA 2FUHB 1E8WA 4N6EB 2I1JA 1UF0A 4RH6A 3ZO5B 1WX9A 1MPEA 2K6DB 4ZRKA 3L13A 3A1QB 4TKNA 1IBXB 4HPLB 3GZNB 4GB9A 4A9AA 4MM3A 3U2SC 3ZLZA 4YL8A 2WNMA 1WE6A 1XEEA 3VFKA 3PT2B 5MPOA 1WYWB 4TUUA 5HHDG 1RWSA 2K5PA 2ZCCA 3JSVA 4HXDA 2K22A 1IGDA 4Q2JA 1LQBA 2PEAA 1TJEA 1GNUA 3DBHI 2NMQA 4ZHOA 1J7CA 2DYBA 2IGDA 2D3CA 1BMLC 2J53A 4GGQA 4FJVB 1ISNA 4FADA 3KWLA 4LNFA 2G4SA 3EUB2 4WWPA 3BY4B 2JYEA 2KTRB 4G0NB 2WU5B 3DPDA 4MGKE 5JXVA 5L83A 4NAWB 4GDLA 1YOVB 4JE3B 3OJ4B 3ZXVA 2KLGA 4IC7B 3TCAA 2I1KA 3PHXB 2NPTB 3PVLA 3C19A 2L00B 1EWCA 4C4VA 4BVUC 3NJTA 3BK1A 3VUXA 2MLBA 2KFJA 2D11A 3ALBA 1FIQA 1Y8RC 1R4MI 2BS2B 1IUEA 4GDKA 3ZIMA 1Q5WB 1OEYJ 4YT0B 5J17A 1BT0A 4MT5A 2M0AA 4GN1A 3H1UA 2L1AA 3KLSX 1ROEA 2INNE 2BYEA 1H8CA 3P63A 2BYTA 4LNIA 1I4HA 4F1SA 1FNVA 4KIKA 3AN1A 2KN5A 1SE4A 1GB4A 2KXJA 2JWUA 4ANXA 4YTMB 2PW9A 2BQQA 1N6ZA 3MC8A 2MRPA 2C7MB 5L95C 2JX5A 2X8XX 2KJ6A 2LGYA 3L4PA 4NAMA 1CJEA 1UWXA 2C5LC 3NZ3A 4XDDA 3R8BA 4MH8A 4FLHA 1ZXHA 4WURA 2B3AA 4ZDVA 2LHDA 3QK0A 3MTNB 1E8XA 2FUG1 2GBRA 3ML8A 3UGBB 2V3PA 3Q8CA 3HK0A 3RNCC 1L7YA 4ZYSA 4FHJA 3TEXA 1J7BA 1EO6A 5E6PA 1FD6A 3IVFA 2JY6A 4NQLB 3B9JA 3H8HA 1NBFC 2MEKA 4RCOA 1UZXB 1FFUA 2RDGA 3KUCB 2WXKA 5T8IA 3DWMA 1YN3A 1YQ4B 1TY0A 1ENFA 3PHWB 2WDRB 2ZVOA 4N59A 1TKGA 3NVVA 2CHWA 1GOZA 2Y5CA 3C8YA 2RPVA 1WZ0A 2INCC 1JRUA 2NTTA 2TSSA 1QOAA 1TYGB 2N1VA 4HWIB 2JT4B 3H7PA 5CHWA 1OQRA 4ACFA 4HKZE 3W1SA 1IGCA 1I4PA 1V1PA 3SU8X 3R7RA 3V05A 1VZ8A 1MHXA 4FJYA 2J52A 2V1YA 4ZRIA 1SEBD 1E7UA 1LFDA 2L76A 1KLGD 5BYRA 3DBRB 4OZCA 5IP4D 3VTUA 3UI3A 3W2DA 1NVID 3RZFA 2FAZA 4XE0A 4JWSC 2O2VA 2PLPA 2UU7A 3AV8A 1FNUA 4YSZB 2ZVNA 4X57B 4CHKA 4L2YA 1EUVB 1V97A 1WRDB 5DPTA 2WXRA 2R61A 5GXGB 5J18A 3PREA 3QJZA 3QWZB 3M95A 2KX0A 2LFIA 2L0TA 1XLNA 2JXTA 1H4RA 1AWDA 4XC2A 4XDCA 1MHHE 1STEA 2A5UA 2Z0DB 1NEKB 4RGMA 2DWQA 3MJWA 1SB3C 1DGJA 4KSLC 4IWOA 1V5OA 4I6LB 1A5RA 5CHFA 3AE3B 1WYGA 2WXNA 2MQJA 2LRUA 3B2GA 4KKJA 3B0AA 1YQ3B 4RGTA 2WQYB 3DBLB 4I6PA 1PYWD 2KWDA 3ZNHB 1YIWA 1E5WA 4BKSD 2K39A 4S0RA 1EU3A 3RPFC 4BOZB 1MVKA 3IT4B 5HKHA 3BZDB 2ZNVC 3B08A 1GUAB 3AEFB 3N1YC 5KHOA 1D5MC 4FA6A 3IFWB 2AWTA 2KTFA 2AYOB 4LTUA 3KUDB 1T5XD 3RNEC 3MP9A 4KDIC 4TMAB 4A20A 1FXAA 2IZVB 2WLBA 2N9LA 1SBBB 1TIFA 2FCNA 1CZPA 2I38A 4RGOS 3NVYA 1LO5D 5JHBA 1FRDA 2KWCA 4LNOA 4AOFA 2SEBD 3A9JB 5IOIA 2ZPYA 2KKCA 2WXGA 1YD8U 4JWUC 4LNKA 3DOWA 3RFZB 1WE7A 2B76B 3Q3NC 3PO0A 2D5GA 1Q10A 4FJZA 2PE6B 3ABVB 1VLBA 3DVNV 1V1OA 5G5HA 3A9KB 2M1MA 2PMVA 5DPRA 2ZEQA 3W5UB 1R7SA 4BKTA 2H88B 3T8MA 1WM3A 1L5PA 4YSYB 3DHIC 3N1ZC 3VDZA 2M0XA 4BAXA 3WIMA 3PZDA 2W55A 2L32A 5LNK1 3N1XC 2GRIA 1WIAA 2QIEB 1GG3A 4YWGG 4FN2A 1T0YA 2LJIA 2DZMA 2XK5B 4A55A 3PTFC 2NPTA 2GB1A 2BWFA 2K3UA 2E3TA 4YTPB 2RSUA 5DPWA 2AQ2B 4K3BA 5EE9A 1WX7A 3IBEA 4GIVA 2M17A 3WCQA 2BKFA 3K9PB 3NS1A 1JQ4A 1UELA 1WSPA 1E7PB 1UGJA 2LGXA 4E3CA 5AUIA 1L4ZB 3T3OA 4RF0A 5GMVA 4W9LA 3BYTB 2LGSA 2QC8A 2ASQA 2MBHA 2C9WB 4A6QA 2ZZPB 2V4LA 1UGMA 2WX0A 1T6BX 2G45B 2HD5B 2WXOA 1WZ3A 4W9DA 2N9KA 2WXHA 5IA7A 3VH4B 2SAKA 4LJPB 2D10A 2BW2A 4GXBA 3SHQA 2LI5A 2M56B 4RF1A 5E6JA 2N0SB 3MFGA 2UWQA 4WAFA 1F2RI 3CSFA 1TY2A 4WQOB 2BWES 2JWZA 3C0RB 2D3BA 1UBQA 4MGIE 2IPKD 1ET9A 1V80A 2BVCA 3DVGX 2KWUB 3ZRCA 4C7ZA 3UINB 1ZW7A 4K81A 4GU2A 1MG8A 4KKIA 2MBOA 2KQ7A 3VUYA 2DYOA 3GZNI 3WAMA 5EDSA 3HHMA 5FR3A 3NOBA 2FNJB 4J3OD 1WR6E 4KGSA 4AQ7A 3VRAB 3DHHC 4XZ4A 4C00A 1EU4A 2PIAA 1OQQA 2WYQA 4NJ6A 2KJHB 2DNFA 2J0JA 3MHZA 4K7SA 1V49A 3VTWA 2W82A 5G2NA 4F8CB 3HVDA 5JHAA 2XEWA 4ICUA 2INPE 3ZRFA 2JRIB 4AUQC 1DOXA 2YEPF 4BBNC 1GB1A 1PGAA 4W9HA 3V60A 3NS8A 1OTRB 2K6QA 3FILA 1WJ4A 4IG7B 4W9GA 4ZYNA 1XD3B 4LLGM 2N7EA 4H2AA 2WXIA 3BIID 3E9SA 1E10A 5AZFA 2H89B 3PRPB 4WJNA 3ENEA 3NVWA 1ZXIA 2RDHA 5G5GA 4AJYB 1D3ZA 2D3GA 3ZXRA 1RFKA 1WJNA 1K51A 2IO3B 4OVUA 1VJKA 4DK5A 1K8RB 3QHTA 1Y56A 4C56C 1E9MA 2L7RA 3PSEB 4US8A 1WH3A 3CSTA 4IM2A 2C60A 1P1AA 1HQRD 1AW7A 2J42A 2CU1A 5D3DA 1OEYA 1QKZA 2KFKA 3A4SC 1EWYC 5G55A 2MJDA 4ARIA 3AE6B 1DYQA 1WI0A 5EE3A 1E6EB 5HI1A 2JZZA 1L6VA 3MJ5A 2JUOA 4NZLB 2FCSA 4ICVA 4NQKE 4A8XC 3ZUNA 1L0YB 5C3JB 3QIJA 2WXQA 3N20C 1UNSA 2L3ZA 4RNAA 2ZW0A 3P2BA 2FCMA 4HJGE 4BBNF 1I42A 3OAWA 2PVOD 4C80A 2IGHA 2ZNVB 4MH0E 4OW0A 1JALA 1JRPA 3PGEA 5H8YE 4ANWA 1K50A 1CMXB 3A9JA 3U30A 2MP2B 4M0WB 4HJKA 3HVZA 3L10B 1WF9A 3P4RB 2LGDA 3Q8FA 4P1BC 3D32A 4J6IA 3ZTCA 4PYUA 3R7QA 4IM3A 1Z2MA 2JRHA 3DWGC 1YX6B 3VR8B 3QCAA 3W1SC 1NYQA 4LNNA 1Z5SB 4YSXB 1FCLA 1C77A 5IO9A 4JLCA 3HUIA 3DBRI 3VAWA 4URKA 2GOWA 4ITKA 4M02A 1XCTL 2LMCA 3UIOB 2CJNA 5EE1A 2LD9A 4KZCA 2ZW1A 1CQVA 2EMTA 1F1HA 1IPGA 2LVPA 2L05A 5JH5C 2D2QA 2QDFA 3EC8A 4KV2A 1WGGA 1WM2A 2RMMA 2XK5A 5CHVC 3WAOA 2XBBC 3Q8BA 4F7ZA 3JVZX 1PQSA 5BMHA 1EM7A 3KYDD 2BS4B 2QJLA 1I7HA 1QF6A 1KRHA 3R2IA 2K9XA 1I4RA 3I63C 2M19A 2WXLA 3VHTC 4RM8A 1L0VB 2GBJA 1HTOA 3P4SB 4PYZA 5CX3A 1B1ZA 3Q8AA 4B0EA 1TTNA 2QSDA 5IN7A 1KM7A 2CHZA 3S2AA 4C7YA 2KT7A 3TEZA 3V6CB 1IYFA 3DBLI 4DHJB 2DZKA 2Y3AA 2MJ3A 3FKYA 4YTNB 5D6JB 4HKQA 3M3JA 3SEBA 3AEAB 3HRDD 1AYFA 2J0MA 2LJ5A 3QAQA 5AZHA 4LCDE 4OVVA 1MI0A 1YN5A 3LXFA 1YMHE 2JSVX 1WY8A 3NZSA 1SSNA 1F2RC 1KH0A 3HM6X 2PVGC 3DQVA 3APCA 3DBSA 3H7SA 3EA6A 3FC4A 2WXFA 1C79A 3VQIA 3KYCD 4G11A 2DLBA 4II3B 3MC9A 1QOFA 1WJ6A 3AEEB 3DCGA 2DAJA 3ZJTA 2LHEA 4MEMA 3N3KB 4XYCA 1XLPA 3CMMB 3N30A 1V81A 4PK1A 3Q3OC 1XLOA 1FNWA 1JWMD 4KSKC 2XNAC 3RCZA 1C1YB 4P7IA 1I4GA 3PRMB 1SJED 4HPPA 3M63B 4NJ7A 4DWFA 2CKHB 5C2TB 2FCQA 1GJZA 4P16A 1VZ7A 2BYFA 1X1MA 1JWAD 4DBGA 2JPHA 3P4PB 2LWPA 1SIFA 4ZRPA 2BPSA 3TJPA 1QLBB 2LXCA 2GBMA 2C7HA 2WDQB 2ON8A 2J7QB 1GC6A 1WGDA 2JZPA 1SF0A 3V6EB 5DPSA 1DOYA 1V86A 3DVNU 3OJ3A 1PFDA 1BXTA 4CO7A 1JWBD 1SE3A 4L1BA 1TKEA 5EE0A 2ICIA 5LLIA 2V0GA 3KWVA 2G1EA 1FRRA 4P1CC 3BVZA 3PZ7A 3RD2A 4DHJD 1K53A 4RM9A 3AXCA 1ZUD2 4JX1C 3NVZA 1RFAA 3A1QA 2KK8A 1PDXA 2JF5A 1IBXA 1QT9A 2QILA 2BB6A 1FFVA 1GPXA 5AEKB 3NRZA 2ONQA 3ZDMC 3AB5A 3RMKC 2N4FA 2NR2A 4BZAA 5JZEB 2BT6A 2DX5B 1C4PA 5LXIB 3P42A 4N58A 2DBYA 2WU2B 2BTEA 4US9A 4ANVA 2WXJA 4MJSB 3AH7A 4FULA 4DXAB 3BINA 4BFRA 1TZOA 1SE2A 1V8CA 1WMHB 3EFCA 2WDVB 1OQYA 1TBEA 2JQRB 3A4RA 2IGGA 2KTRA 1PUTA 4EZKA 1SIJA 1BUIC 4OVZA 4NAWA 4MACA 3UQBA 3ZYYX 1P98A 2IJ0A 3Q2AC 1UWMA 3WAPA 4MELA 2IY0B 2IO1B 4K7WA 1E90A 4M8NA 2RD0A 3KW5B 4HLEA 2REXA 2Y5PA 1C9FA 4ZRQA 3AU5A 1YJ1A 2ZPNA 1ESFA 2PJHA 2BBCA 4OZAA 2MP2A 2I2YA 5KHQA 1MFWA 3OG5A 3B2FA 3GS2A 1ZDVA 3RULA 3JW0X 3AE9B 2QHOA 4PS7A 2K8HA 2MW5A 1RM6C 1KLUD 2G9HD 2HJ1A 2CR5A 3QX1A 2Z59B 4NNJB 4WJOA 3H6NA 2L8JA 1ACCA 1S1QB 5C23A 4O1NA 4USAA 4ANUA 5D94A 3L16A 3ZTDA 5D2MB 4G3XB 3KUZA 2KMCA 4B0MA 1VR9A 3AM9A 1C4AA 4OHJA 1D4BA 1ZDXA 5FR6A 4N9F4 2GI9A 1UUPA 3ETRA 3ZDTA 1OFFA 4DXFA 1P9DU 2WX1A 4A90A 1XQQA 3W9CB 1HA5A 3H7PB 4BKGA 4BKSA 2OJRA 1P7EA 1YQBA 1Q0WB 2Q5WD 1V1PB 2MBBB 3SFDB 1TT5B 3TUOA 2R2QA 3RZWC 1F77A 2IY1B 3CF6E 4IDIA 2JYTA 1LGRA 2MBQA 2LASA 3O65B 1T0QC 3L08A 4IKGA 2ACZB 2M4NA 1HZ6A 1R4NB 3QARA 5IKCM 4JL9A 3QQ8B 5BYSA 1PGXA 2V3SA 3RN9C 2W3SA 3E56A 1WXMA 3NG0A 3VTVA 2AQ1B 3ZKJC 3KH0A 2AL6A 2L83A 3AU4A 3AE7B 4E71A 2RGFA 2LVOA 4EKUA 1QZEA 4HDQA 1WGYA 1K52A 5H92C 1RLFA 3QC8B 2LXAA 3URYA 3BVMA 2W54A 1Q1OA 4E74A 3T3NA 1SGHA 2KVZA 1E8ZA 2KDMA 1KOTA 4W9FA 3RUIB 2FBWB 2XN9C 3L54A 3LJ3A 4MSMB 2NTSA 4K7UA 2M8SA 2UYZB 2DYMA 3UIPB 1M4VA 5FKAC 2CS4A 2DAFA 4KGTA 4PS3A 2JZ3B 1L6UA 2R2OA 4G50A 1WXVA 1ZPSA 2NBVB 4TV3A 4UDUC 2RR9A 3ZNGC 3IXSA 1ZP0B 3SDLC 3IHPC 1HEZE 1WWTA 4IUMB 1T0SC 2IBIB 4PT5A 2WDTB 3OWEB 4WWMA 1N60A 2PTLA 3AEGB 2WXPA 3AE8B 3I57A 1KJTA 4BOSC 3RYTA 2G4DB 1WGRA 3Q3JA 4EZLA 2AEHA 5CTRC 3BYYB 2QCZA 1GAQB 1WRIA 3AEBB 1VCBA 1XXGA 4KZ0A 3H9DA 4JQWC 3RI7C 3ONSA 3OLMD 1V9JA 1TZ1A 1JWUD 2KHWB 3L17A 2PKOA 3AI5A 2VZKB 1KTKA 2LUEA 3KVFB 5BO4B 2RDBC 1M94A 1C78A 4DDID 4GOCA 4W9JA 4AP4C 1XO3A 2MWSB 2FE8A 2WP9B 2WHIA 5AUKA 4EZJA 3V3XA 3Q3MC 4YXDB 2OOBB 1UH6A 4A3OA 2NBWB 2MBEA 2CU3A 2KJRA 3DDCB 2MJEA 5D3IB 2GLSA 5J2RA 3PV1A 2V4IB 5AZGA 1ZGUB 1EF5A 2C7NB 4MDKE 3SR6A 3VR9B 3IG3A 2NBUA 3KQ4A 4WJPA 4ZOHC 3K9OB 2VH1A 4NJCA 3AEDB 1DOIA 2CHXA 2JU6X 4EE2A 1JROA 4A3PA 1N62A 1NDDA 2IO0B 3LDZE 2ZCBA 1RAXA 3V61A 2K25A 4B9KA 3A9KA 4GMVA 4MJSA 2BGFA 3ZW3A 3N32A 4DHZE 3VXWA 3IAS1 1WMHA 3EGRA 1WXQA 1HZ5A 1WX8A 3GB1A 2NCNA 1UD7A 3RNAC 2W9NA 3Q14C 3EECA 1N5XA 3MC0B 1C4CA 2GBKA 3ECIA 3PZ8A 3GP7A 3V62A 1LM8B 3TL5A 2GBNA 2KWVB 2O6VB 1V6EA 2KACA 4PS8A 2QEJC 4I6NB 4XGAB 3BWUD 3DBHB 3DVGY 4IOIE 4WWOA 3AULA 3DHGC 3GE8C 3W1YA 1I4XA 1N63A 1NI3A 2KD0A 1WXAA 2MH7A 1VZ6A 3L0WB 1FPYA 2YLMA 4REZA 4KDLB 3P1MA 3TMPB 5IAAC 2HTHA 2OJWA 3J9CA 2N7DA 4MGZE 2KVRA 3X23A 3SFEB 4XWWA 2Z8LA 2QMTA 1F52A 3NHEB 5TR5A 1TKYA 5BMIA 2VZKD 3ML9A 1TS3A 1YJJA 1WXSA 3M62B 4OZBA 5BYQA 1ZOYB 3ZJVA 1V5TA 2KANA 4HPMB 3JYUA 4IW0A 1R4MB 1ET6A 1E0ZA 2DZIA 2KAJA 3SD5A 1U4AA 3IAM1 1IP9A 4EFOA 3AE5B 2YEPB 2MCNB 3TIXA 1KF6B 4DXGA 1TS5A 3U4EG 1CK1A 3FAHA 5HG2A 1YJIA 3TEWA 1XCQL 2KZRA 3VVWB 2INDC 2OEDA 4IM0A 2HE7A 3ZQ4A 2EKIA 3ZVVA 4MSQB 2KOXA 4RFBA 4EEWA 5HFYA 4K3CA 2KYWA 2WGSA 3I9V1 1S3SG 2DENB 3WA0A 4M01A 2MA9B 4ZRJA 4WJQA 3TEYA 4TQ1A 1YX5B 3FILB 3RNBC 4CQNA 1NENB 4L23A 4LJOB 2K1FA 2PE9A 1KLVA 4M00A 2ZJDA 2K8BA 4DHZB 2YVCA 2X38A 3NZUA 1JCKB 2AQ3B 2BKRB 3CIRB 1SXTA 3PPAA 1WGKA 4HCNB 1SJHD 3I5JC 3U7ZA 1HXYD 2LUMA 2WS3B 4S17A 4TSSA 2LVQA 1ZE3D 1ZKHA 2CJOA 4MM3B 1XLQA 2O6VD 2KMAA 3VH3B 2KQSA 1E7VA 4FXCA 1B9RA 3JSVB 3LB8C
chains in the Genus database with same CATH topology
4O1NA 1ZXHA 3NVWA 4USAA 4WURA 2LHDA 1N5WA 1FMAD 1QOGA 1ZXIA 2FUG1 2RDHA 3N9YC 5G5GA 4B0MA 2V3PA 1VR9A 3AM9A 1C4AA 3Q8CA 4OHJA 3TSSA 4ZYSA 1D4BA 1TS4A 1ZDXA 3O13A 3TEXA 4HRSA 1J7BA 2GI9A 1UUPA 1FD6A 1JW9D 3ETRA 1PGBA 4HEA1 1RFKA 1K51A 4KX6B 1OFFA 4DXFA 3B9JA 4GLSC 4A90A 1VJKA 3H8HA 3W9CB 5I4DA 1JMLA 1HA5A 2MEKA 4RCOA 1FFUA 1Y56A 4C56C 1D6EC 2RDGA 2WXKA 1E9MA 5T8IA 3DWMA 4US8A 1YN3A 1P7EA 1YQ4B 2V3NA 1TY0A 2Q5WD 1V1PB 3SFDB 1ENFA 1HQRD 1RYJA 1AW7A 2WDRB 1YNTE 3TUOA 2J42A 2BB5A 5D3DA 4N59A 1QKZA 1F77A 1TKGA 1NYRA 4IDIA 1EWYC 2JYTA 4GDLB 2MJDA 4ARIA 3NVVA 3AE6B 4JPSA 1GOZA 2Y5CA 3C8YA 4IKGA 2ACZB 2RPVA 1DYQA 1HZ6A 1FO4A 2NTTA 5EE3A 2TSSA 1QOAA 1VRAB 1E6EB 1TYGB 5HI1A 1FEHA 5BYSA 1OQRA 1PGXA 1L6VA 3MJ5A 4HKZE 1QQRA 2W3SA 3E56A 3W1SA 1IGCA 1I4PA 4NZLB 4A8XC 2AQ1B 3IT6B 1V1PA 1L0YB 5C3JB 3P4QB 1XF5L 4ARCA 2L83A 3V05A 3AECB 3AE7B 1VZ8A 2WXQA 1KFYB 1MHXA 2J52A 1UNSA 4RNAA 4GDKB 2ZW0A 1K52A 1SEBD 4HJGE 5H92C 2PVOD 4C80A 1KLGD 5BYRA 2IGHA 4OZCA 3URYA 3BVMA 4OW0A 1JALA 2OHFA 2W54A 1JRPA 4XWTA 3UI3A 5H8YE 1L4DB 3W2DA 3T3NA 1NVID 2KDMA 2FBWB 1K50A 2XN9C 2EELA 2NTSA 1T3QA 4JWSC 4XE0A 1VDVA 2PLPA 4KGRA 3AV8A 3R2TA 1FNUA 3HVZA 4TQ0A 3P4RB 4YSZB 3Q8FA 2DYMA 3AE4B 4L2YA 1M4VA 5FKAC 4KGTA 1V97A 2WXRA 2R61A 5GXGB 5BMGA 1L6UA 3DWGC 3VR8B 1NYQA 1ZPSA 3BVGA 3NUHB 4YSXB 2LFIA 1XLNA 4UDUC 2JXTA 1N61A 5FK9C 1F0ZA 3ZGZA 1AWDA 3IXSA 1C77A 3CWIA 1FCLA 1ZP0B 4M0WA 4XDCA 3HUIA 1MHHE 1STEA 2L52A 1HEZE 4ITKA 1WWTA 1NEKB 4RGMA 2DWQA 1XCTL 1SB3C 2LMCA 1DGJA 2CJNA 5EE1A 2BS3B 4PT5A 3AMZA 1QOBA 2E6XA 2ZW1A 2W3RA 1WYGA 3AE3B 1D5ZC 3OWEB 4WWMA 1CQVA 2WXNA 1N60A 2PTLA 3AEGB 3B2GA 4KKJA 1YQ3B 2WXPA 2HTME 2WQYB 4RGTA 3AE8B 3I57A 3Q69A 2RMMA 1PYWD 2KWDA 1EU3A 3BYYB 3Q8BA 3RPFC 1FM0D 1P7FA 1MVKA 1GAQB 1WRIA 3IT4B 1FCCC 3BK2A 5BMHA 1EM7A 3BZDB 4WIPA 2HDEA 4AS1A 3AEBB 4DQOC 2BS4B 2QJLA 1I7HA 1XXGA 1QF6A 3AEFB 1D5MC 1KRHA 3R2IA 2K9XA 1I4RA 2M19A 2WXLA 1L0VB 1TS2A 3P4SB 4LTUA 4RGNA 1I4QA 2LEKA 1B1ZA 1T5XD 3Q8AA 4B0EA 3MP9A 2QSDA 1JWUD 4TMAB 3W5VB 1FXAA 4C7YA 2WLBA 4WH4A 3TEZA 2N9LA 1SBBB 2I38A 1CZPA 2Y3AA 4RGOS 2PKOA 2VZKB 3NVYA 1KTKA 4D2KA 2MJ3A 4HKQA 1D5XC 4YTNB 1LO5D 1C78A 3SEBA 1JWSD 1FRDA 2N7JA 3AEAB 3HRDD 1AYFA 1XO3A 3AE1B 2FE8A 2WP9B 5AUKA 2SEBD 3V3XA 2K0PA 4YXDB 2WXGA 1MI0A 1YN5A 2KMMA 4JWUC 2CU3A 2J4XA 3LXFA 1YMHE 2JSVX 3RFZB 2LGIA 1SSNA 2B76B 1F2RC 3PO0A 1QILA 1A70A 1KH0A 2MJEA 5D3IB 2D5GA 2AX5A 1Q10A 2PVGC 2V4IB 3EA6A 3FC4A 3ABVB 1VLBA 2WXFA 1V1OA 4LK0M 5G5HA 1C79A 3SR6A 2PMVA 3VQIA 3VR9B 2DLBA 3W5UB 1R7SA 1QOFA 2H88B 2IDYA 3AEEB 3KQ4A 3Q8EA 1L5PA 4ZOHC 4YSYB 3ZJTA 4NJCA 2LHEA 2KQ4X 3AEDB 1XLPA 1DOIA 2JU6X 4R3DA 1FXIA 1JROA 4P6VF 4EE2A 3VRBB 1N62A 2W55A 2L32A 1XLOA 5LNK1 2GRIA 2QIEB 4YWGG 1FNWA 1JWMD 2LJIA 2XNAC 4WQMA 4HROA 4A55A 1AN8A 5D7GA 2KN4A 1J7AA 1I4GA 1SJED 3LYYA 2GB1A 2K3UA 2E3TA 3IAS1 4YTPB 3EGRA 2AQ2B 5C2TB 5EE9A 1WXQA 1HZ5A 3U52E 3GB1A 4P16A 4ZHPA 1VZ7A 3WCQA 3AE2B 1N5XA 3MC0B 1C4CA 3NS1A 1JQ4A 3ZJUA 1JWAD 3PZ8A 3GP7A 1WSPA 3P4PB 1E7PB 1UGJA 4ZRPA 1YN4A 5AUIA 1L0XB 1C76A 1QLBB 2KACA 1L4ZB 2WDQB 3T3OA 2ON8A 4RF0A 5TSSA 2JZPA 2QEJC 1SF0A 3BYTB 3BWUD 2WXMA 4IOIE 1DOYA 4N6EB 1I4XA 4A6QA 1N63A 4RH6A 1PFDA 1T6BX 1BXTA 1NI3A 2WXOA 1JWBD 1MPEA 2N9KA 2WXHA 1SE3A 2MH7A 4L1BA 1IBXB 1VZ6A 2SAKA 2BW2A 1TKEA 4REZA 4A9AA 3P1MA 2M56B 3U2SC 4RF1A 2WNMA 5E6JA 2N0SB 5EE0A 3MFGA 1XEEA 2ICIA 4WAFA 1F2RI 3J9CA 5MPOA 2V0GA 3SFEB 4XWWA 2Z8LA 2QMTA 3KWVA 5HHDG 1TY2A 2G1EA 1RWSA 2K5PA 1FRRA 3BVZA 3PZ7A 1TKYA 5BMIA 2VZKD 1K53A 1TS3A 1YJJA 1ZUD2 2K22A 1IGDA 4Q2JA 2IPKD 4JX1C 3NVZA 1ET9A 1TJEA 4OZBA 1PDXA 1IBXA 5BYQA 1QT9A 1ZOYB 3ZJVA 2NMQA 4ZHOA 1J7CA 2QILA 2IGDA 2BB6A 1BMLC 2J53A 1ET6A 1FFVA 4C7ZA 1GPXA 1E0ZA 3KWLA 3NRZA 2KAJA 4KKIA 2ONQA 3AB5A 3EUB2 3IAM1 2JYEA 2BT6A 3AE5B 2DYOA 2YEPB 1C4PA 1KF6B 4DXGA 1TS5A 2WU5B 5FR3A 4J3OD 3U4EG 5JXVA 1CK1A 3P42A 4KGSA 2DBYA 4N58A 4NAWB 4AQ7A 2WU2B 2BTEA 4US9A 3FAHA 5HG2A 2WXJA 1YJIA 3TEWA 3AH7A 1XCQL 4JE3B 2OEDA 3VRAB 3ZQ4A 2EKIA 1TZOA 1SE2A 1V8CA 4RFBA 1EU4A 2PIAA 5HFYA 1EWCA 2WDVB 1OQQA 3I9V1 3BK1A 2JQRB 2IGGA 3MHZA 3TEYA 1PUTA 4TQ1A 1FIQA 1SIJA 1BUIC 4OVZA 2BS2B 1IUEA 4MACA 3FILB 3ZYYX 2W82A 2IJ0A 4YT0B 1UWMA 3HVDA 4MT5A 4CQNA 2M0AA 1NENB 4L23A 2INPE 2L1AA 3KLSX 1ROEA 2INNE 1DOXA 3P63A 2BYTA 2YEPF 1I4HA 1GB1A 1FNVA 2Y5PA 2X38A 1C9FA 1PGAA 4ZRQA 3AN1A 1SE4A 1GB4A 1JCKB 2AQ3B 3CIRB 1ESFA 1SXTA 2BBCA 4OZAA 2I2YA 1WGKA 2JWUA 1SJHD 3FILA 3B2FA 3U7ZA 1HXYD 2LUMA 3GS2A 4YTMB 1ZDVA 2PW9A 2WS3B 4TSSA 4LLGM 3AE9B 4H2AA 1ZE3D 2CJOA 2WXIA 4MM3B 2JX5A 1XLQA 3BIID 3E9SA 1E10A 3L4PA 1RM6C 4NAMA 1CJEA 1KLUD 2G9HD 1UWXA 4FXCA 3NZ3A 2H89B 1B9RA 4XDDA 3R8BA 4MH8A 3LB8C 1ACCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJJ A;  3NVW A;  1ZUD 2;  4USA A;  3FC4 A;  2K22 A;  1XLN A;  3ABV B;  1VLB A;  1N61 A;  4JX1 C;  1F0Z A;  3NVZ A;  1N5W A;  5G5H A;  1FMA D;  1AWD A;  1QOG A;  1TJE A;  1ZXI A;  3CWI A;  5G5G A;  1ZP0 B;  1PDX A;  3SR6 A;  3HUI A;  3AM9 A;  1QT9 A;  1ZOY B;  3VR9 B;  2L52 A;  4ITK A;  3W5U B;  1WWT A;  4HRS A;  1NEK B;  1J7B A;  1R7S A;  4ZHO A;  1J7C A;  2DWQ A;  1QOF A;  2H88 B;  1JW9 D;  1SB3 C;  3AEE B;  3ETR A;  1DGJ A;  2CJN A;  5EE1 A;  2BS3 B;  1RFK A;  1L5P A;  3AMZ A;  4KX6 B;  4ZOH C;  4YSY B;  1OFF A;  1FFV A;  1QOB A;  4C7Z A;  3B9J A;  1GPX A;  1E0Z A;  3KWL A;  2W3R A;  1WYG A;  1VJK A;  3AE3 B;  2KAJ A;  3AED B;  3NRZ A;  1XLP A;  4WWM A;  3W9C B;  1DOI A;  3AB5 A;  1N60 A;  1FFU A;  3AEG B;  3EUB 2;  3B2G A;  1FXI A;  1JRO A;  4P6V F;  1YQ3 B;  3VRB B;  1N62 A;  1E9M A;  2HTM E;  2W55 A;  2WQY B;  2BT6 A;  1XLO A;  3AE5 B;  3AE8 B;  3DWM A;  4US8 A;  1YQ4 B;  2Q5W D;  1KF6 B;  3SFD B;  2QIE B;  1RYJ A;  2WDR B;  2WU5 B;  4N58 A;  2DBY A;  4N59 A;  1TKG A;  2WU2 B;  1FM0 D;  1NYR A;  4HRO A;  1EWY C;  3FAH A;  1GAQ B;  4IDI A;  1WRI A;  4WQM A;  4US9 A;  1YJI A;  3AH7 A;  2MJD A;  1J7A A;  3NVV A;  3AE6 B;  2Y5C A;  3AEB B;  3RPF C;  2ACZ B;  2BS4 B;  2QJL A;  3VRA B;  1I7H A;  2E3T A;  4YTP B;  1FO4 A;  1QF6 A;  2EKI A;  5EE3 A;  3AEF B;  1QOA A;  5EE9 A;  5C2T B;  1E6E B;  1TYG B;  1V8C A;  1KRH A;  1WXQ A;  2PIA A;  4ZHP A;  2K9X A;  1OQR A;  1L6V A;  2M19 A;  2WDV B;  2W3S A;  1OQQ A;  3WCQ A;  3AE2 B;  1N5X A;  1L0V B;  2JQR B;  3P4S B;  4LTU A;  1PUT A;  2AX5 A;  2LEK A;  3NS1 A;  1FIQ A;  1SIJ A;  3P4Q B;  5C3J B;  1JQ4 A;  2L83 A;  1JWA D;  1IUE A;  2BS2 B;  3AE7 B;  3AEC B;  1KFY B;  3P4P B;  3ZYY X;  1E7P B;  4YT0 B;  1UWM A;  5AUI A;  3W5V B;  1FXA A;  1QLB B;  2WLB A;  1NEN B;  4C7Y A;  2WDQ B;  5H92 C;  1ROE A;  2PVO D;  4C80 A;  1DOX A;  3P63 A;  1CZP A;  1SF0 A;  2PKO A;  3NVY A;  1JAL A;  2OHF A;  2W54 A;  2MJ3 A;  1JRP A;  1DOY A;  4YTN B;  5H8Y E;  4N6E B;  3AN1 A;  1NVI D;  1FRD A;  1N63 A;  3AEA B;  3HRD D;  1AYF A;  3CIR B;  1PFD A;  1XO3 A;  2FBW B;  3AE1 B;  2WP9 B;  1NI3 A;  1WGK A;  1JWB D;  2PVG C;  5AUK A;  1T3Q A;  4JWS C;  1VDV A;  3B2F A;  2MH7 A;  3AV8 A;  3HVZ A;  4YSZ B;  3P4R B;  4YXD B;  2WS3 B;  4YTM B;  1TKE A;  4A9A A;  3P1M A;  3AE4 B;  2M56 B;  3AE9 B;  2CJO A;  2N0S B;  5EE0 A;  2JX5 A;  1XLQ A;  3BII D;  2KMM A;  1V97 A;  2CU3 A;  3LXF A;  4JWU C;  5MPO A;  1E10 A;  3L4P A;  3SFE B;  1RM6 C;  1CJE A;  5GXG B;  1L6U A;  3DWG C;  2B76 B;  1RWS A;  2G1E A;  2K5P A;  4FXC A;  1NYQ A;  3PO0 A;  2H89 B;  3VR8 B;  1B9R A;  1FRR A;  1A70 A;  2MJE A;  3LB8 C;  4YSX B;  1TKY A; 
#chains in the Genus database with same CATH topology
 1L2N A;  1N5W A;  1FMA D;  1QOG A;  3N9Y C;  3I3T B;  1I35 A;  2IYD B;  2L0F A;  4QAY A;  3TSS A;  2KFK B;  1EF1 A;  1TS4 A;  3O13 A;  1WJU A;  4W9I A;  4HRS A;  2PPH A;  4WAA A;  4ASW C;  4AJW A;  1JW9 D;  1J0G A;  3WAL A;  1PGB A;  4HEA 1;  3UF8 A;  2N9X A;  4KX6 B;  2KDI A;  4GLS C;  4FBJ B;  5I4D A;  1JML A;  4IWP A;  1D6E C;  3PLV A;  3GE3 C;  1HTQ A;  1AAR A;  2KNB A;  2J0K A;  2AL3 A;  2V3N A;  1RYJ A;  3ZNI D;  1YNT E;  2BB5 A;  4MGY E;  1NYR A;  4GDL B;  2K8C A;  2KX3 A;  4JPS A;  2LZ6 A;  1FO4 A;  1VRA B;  1FEH A;  2FID A;  3U7D A;  2Z0E B;  1QQR A;  3RNG C;  3EFU A;  4C4V B;  3IT6 B;  1P0R A;  4B6W A;  3P4Q B;  1XF5 L;  3PLU A;  4ARC A;  3NY5 A;  3ZNZ B;  2KLC A;  1MG4 A;  3AEC B;  2BF8 B;  2JXX A;  1KFY B;  2A4Z A;  4GDK B;  4RMA A;  4CYE A;  1V2Y A;  2G3Q B;  2FIF A;  1FXT B;  2OHF A;  4XWT A;  4JIO U;  1L4D B;  3X0W A;  4KIK B;  3R66 C;  2EEL A;  1T3Q A;  3APF A;  1VDV A;  4KGR A;  1R4N I;  3R2T A;  4TQ0 A;  1MJD A;  3B1L X;  3AE4 B;  3GOE A;  4M8M A;  3RT3 B;  1WR1 A;  5BMG A;  1J8C A;  1VD2 A;  2D07 B;  1WFY A;  3BVG A;  3NUH B;  4NPN A;  4LDT B;  4HK2 A;  5FK9 C;  1N61 A;  1F0Z A;  3ZGZ A;  3CWI A;  3MHS D;  1XT9 B;  4M0W A;  1E8Y A;  2L52 A;  1SE9 A;  1C3T A;  2BS3 B;  3AMZ A;  1QOB A;  2KDE B;  2E6X A;  2W3R A;  1D5Z C;  4NY0 A;  2EMS A;  2HTM E;  3Q69 A;  2N9E B;  4KVG B;  1FM0 D;  1P7F A;  1J19 A;  1FCC C;  3BK2 A;  4WIP A;  4AS1 A;  2HDE A;  1OGW A;  4DQO C;  2IO2 B;  3VUW A;  2VRR B;  4FHK A;  4HDO A;  1TS2 A;  3EHV A;  1LXD A;  4RGN A;  1I4Q A;  2LEK A;  3QA8 A;  2O6V A;  2DZJ A;  3W5V B;  2N1W A;  3A33 B;  4HCP B;  4WH4 A;  4EUT A;  1GC7 A;  4D2K A;  2JVC A;  1D5X C;  2NS5 A;  4DDG D;  3PS6 A;  1JWS D;  2N7J A;  2N9P C;  3AE1 B;  1T0R C;  2BYV E;  2VH2 A;  5E6O A;  2K0P A;  2O2V B;  2KO3 A;  1HE8 A;  2KMM A;  2J4X A;  2DHZ A;  2LGI A;  1WGH A;  3RNF C;  1TGZ B;  1QIL A;  1A70 A;  4JGH B;  2AX5 A;  2NVU I;  2EKE C;  3HM3 A;  2V9H A;  4GSW A;  4LK0 M;  3APD A;  4W9E A;  2MHJ A;  3R3M A;  2IDY A;  4EOY A;  3Q8E A;  4W9C A;  4XX5 A;  3WAN A;  1P3Q U;  1F9J A;  3TBL D;  2Y5B B;  2KQ4 X;  3T9L A;  4R3D A;  1FXI A;  4P6V F;  3VRB B;  4B95 A;  2MX2 A;  2KC1 A;  2KDF B;  1NI2 A;  3U8Z A;  3PRZ A;  4W9K A;  1G6J A;  2KC2 A;  4LDT D;  1UBI A;  2KDB A;  4WQM A;  4HRO A;  4II2 B;  4K1R B;  5DCN A;  1AN8 A;  5D7G A;  2KN4 A;  2MSE D;  1J7A A;  3HIZ A;  5C1Z A;  1RRB A;  3LYY A;  5E6N A;  2HJ8 A;  4HVB A;  3U52 E;  4ZHP A;  5LXH A;  4AWJ A;  3AE2 B;  2WWZ A;  4IWQ A;  2GMI C;  2D3A A;  3ZJU A;  3UQA A;  2RPQ A;  3Q6B A;  3Q3F A;  1YN4 A;  1L0X B;  1C76 A;  4WWN A;  5TSS A;  2LRW A;  2WXM A;  2FUH B;  1E8W A;  4N6E B;  2I1J A;  1UF0 A;  4RH6 A;  3ZO5 B;  1WX9 A;  1MPE A;  2K6D B;  4ZRK A;  3L13 A;  3A1Q B;  4TKN A;  1IBX B;  4HPL B;  3GZN B;  4GB9 A;  4A9A A;  4MM3 A;  3U2S C;  3ZLZ A;  4YL8 A;  2WNM A;  1WE6 A;  1XEE A;  3VFK A;  3PT2 B;  5MPO A;  1WYW B;  4TUU A;  5HHD G;  1RWS A;  2K5P A;  2ZCC A;  3JSV A;  4HXD A;  2K22 A;  1IGD A;  4Q2J A;  1LQB A;  2PEA A;  1TJE A;  1GNU A;  3DBH I;  2NMQ A;  4ZHO A;  1J7C A;  2DYB A;  2IGD A;  2D3C A;  1BML C;  2J53 A;  4GGQ A;  4FJV B;  1ISN A;  4FAD A;  3KWL A;  4LNF A;  2G4S A;  3EUB 2;  4WWP A;  3BY4 B;  2JYE A;  2KTR B;  4G0N B;  2WU5 B;  3DPD A;  4MGK E;  5JXV A;  5L83 A;  4NAW B;  4GDL A;  1YOV B;  4JE3 B;  3OJ4 B;  3ZXV A;  2KLG A;  4IC7 B;  3TCA A;  2I1K A;  3PHX B;  2NPT B;  3PVL A;  3C19 A;  2L00 B;  1EWC A;  4C4V A;  4BVU C;  3NJT A;  3BK1 A;  3VUX A;  2MLB A;  2KFJ A;  2D11 A;  3ALB A;  1FIQ A;  1Y8R C;  1R4M I;  2BS2 B;  1IUE A;  4GDK A;  3ZIM A;  1Q5W B;  1OEY J;  4YT0 B;  5J17 A;  1BT0 A;  4MT5 A;  2M0A A;  4GN1 A;  3H1U A;  2L1A A;  3KLS X;  1ROE A;  2INN E;  2BYE A;  1H8C A;  3P63 A;  2BYT A;  4LNI A;  1I4H A;  4F1S A;  1FNV A;  4KIK A;  3AN1 A;  2KN5 A;  1SE4 A;  1GB4 A;  2KXJ A;  2JWU A;  4ANX A;  4YTM B;  2PW9 A;  2BQQ A;  1N6Z A;  3MC8 A;  2MRP A;  2C7M B;  5L95 C;  2JX5 A;  2X8X X;  2KJ6 A;  2LGY A;  3L4P A;  4NAM A;  1CJE A;  1UWX A;  2C5L C;  3NZ3 A;  4XDD A;  3R8B A;  4MH8 A;  4FLH A;  1ZXH A;  4WUR A;  2B3A A;  4ZDV A;  2LHD A;  3QK0 A;  3MTN B;  1E8X A;  2FUG 1;  2GBR A;  3ML8 A;  3UGB B;  2V3P A;  3Q8C A;  3HK0 A;  3RNC C;  1L7Y A;  4ZYS A;  4FHJ A;  3TEX A;  1J7B A;  1EO6 A;  5E6P A;  1FD6 A;  3IVF A;  2JY6 A;  4NQL B;  3B9J A;  3H8H A;  1NBF C;  2MEK A;  4RCO A;  1UZX B;  1FFU A;  2RDG A;  3KUC B;  2WXK A;  5T8I A;  3DWM A;  1YN3 A;  1YQ4 B;  1TY0 A;  1ENF A;  3PHW B;  2WDR B;  2ZVO A;  4N59 A;  1TKG A;  3NVV A;  2CHW A;  1GOZ A;  2Y5C A;  3C8Y A;  2RPV A;  1WZ0 A;  2INC C;  1JRU A;  2NTT A;  2TSS A;  1QOA A;  1TYG B;  2N1V A;  4HWI B;  2JT4 B;  3H7P A;  5CHW A;  1OQR A;  4ACF A;  4HKZ E;  3W1S A;  1IGC A;  1I4P A;  1V1P A;  3SU8 X;  3R7R A;  3V05 A;  1VZ8 A;  1MHX A;  4FJY A;  2J52 A;  2V1Y A;  4ZRI A;  1SEB D;  1E7U A;  1LFD A;  2L76 A;  1KLG D;  5BYR A;  3DBR B;  4OZC A;  5IP4 D;  3VTU A;  3UI3 A;  3W2D A;  1NVI D;  3RZF A;  2FAZ A;  4XE0 A;  4JWS C;  2O2V A;  2PLP A;  2UU7 A;  3AV8 A;  1FNU A;  4YSZ B;  2ZVN A;  4X57 B;  4CHK A;  4L2Y A;  1EUV B;  1V97 A;  1WRD B;  5DPT A;  2WXR A;  2R61 A;  5GXG B;  5J18 A;  3PRE A;  3QJZ A;  3QWZ B;  3M95 A;  2KX0 A;  2LFI A;  2L0T A;  1XLN A;  2JXT A;  1H4R A;  1AWD A;  4XC2 A;  4XDC A;  1MHH E;  1STE A;  2A5U A;  2Z0D B;  1NEK B;  4RGM A;  2DWQ A;  3MJW A;  1SB3 C;  1DGJ A;  4KSL C;  4IWO A;  1V5O A;  4I6L B;  1A5R A;  5CHF A;  3AE3 B;  1WYG A;  2WXN A;  2MQJ A;  2LRU A;  3B2G A;  4KKJ A;  3B0A A;  1YQ3 B;  4RGT A;  2WQY B;  3DBL B;  4I6P A;  1PYW D;  2KWD A;  3ZNH B;  1YIW A;  1E5W A;  4BKS D;  2K39 A;  4S0R A;  1EU3 A;  3RPF C;  4BOZ B;  1MVK A;  3IT4 B;  5HKH A;  3BZD B;  2ZNV C;  3B08 A;  1GUA B;  3AEF B;  3N1Y C;  5KHO A;  1D5M C;  4FA6 A;  3IFW B;  2AWT A;  2KTF A;  2AYO B;  4LTU A;  3KUD B;  1T5X D;  3RNE C;  3MP9 A;  4KDI C;  4TMA B;  4A20 A;  1FXA A;  2IZV B;  2WLB A;  2N9L A;  1SBB B;  1TIF A;  2FCN A;  1CZP A;  2I38 A;  4RGO S;  3NVY A;  1LO5 D;  5JHB A;  1FRD A;  2KWC A;  4LNO A;  4AOF A;  2SEB D;  3A9J B;  5IOI A;  2ZPY A;  2KKC A;  2WXG A;  1YD8 U;  4JWU C;  4LNK A;  3DOW A;  3RFZ B;  1WE7 A;  2B76 B;  3Q3N C;  3PO0 A;  2D5G A;  1Q10 A;  4FJZ A;  2PE6 B;  3ABV B;  1VLB A;  3DVN V;  1V1O A;  5G5H A;  3A9K B;  2M1M A;  2PMV A;  5DPR A;  2ZEQ A;  3W5U B;  1R7S A;  4BKT A;  2H88 B;  3T8M A;  1WM3 A;  1L5P A;  4YSY B;  3DHI C;  3N1Z C;  3VDZ A;  2M0X A;  4BAX A;  3WIM A;  3PZD A;  2W55 A;  2L32 A;  5LNK 1;  3N1X C;  2GRI A;  1WIA A;  2QIE B;  1GG3 A;  4YWG G;  4FN2 A;  1T0Y A;  2LJI A;  2DZM A;  2XK5 B;  4A55 A;  3PTF C;  2NPT A;  2GB1 A;  2BWF A;  2K3U A;  2E3T A;  4YTP B;  2RSU A;  5DPW A;  2AQ2 B;  4K3B A;  5EE9 A;  1WX7 A;  3IBE A;  4GIV A;  2M17 A;  3WCQ A;  2BKF A;  3K9P B;  3NS1 A;  1JQ4 A;  1UEL A;  1WSP A;  1E7P B;  1UGJ A;  2LGX A;  4E3C A;  5AUI A;  1L4Z B;  3T3O A;  4RF0 A;  5GMV A;  4W9L A;  3BYT B;  2LGS A;  2QC8 A;  2ASQ A;  2MBH A;  2C9W B;  4A6Q A;  2ZZP B;  2V4L A;  1UGM A;  2WX0 A;  1T6B X;  2G45 B;  2HD5 B;  2WXO A;  1WZ3 A;  4W9D A;  2N9K A;  2WXH A;  5IA7 A;  3VH4 B;  2SAK A;  4LJP B;  2D10 A;  2BW2 A;  4GXB A;  3SHQ A;  2LI5 A;  2M56 B;  4RF1 A;  5E6J A;  2N0S B;  3MFG A;  2UWQ A;  4WAF A;  1F2R I;  3CSF A;  1TY2 A;  4WQO B;  2BWE S;  2JWZ A;  3C0R B;  2D3B A;  1UBQ A;  4MGI E;  2IPK D;  1ET9 A;  1V80 A;  2BVC A;  3DVG X;  2KWU B;  3ZRC A;  4C7Z A;  3UIN B;  1ZW7 A;  4K81 A;  4GU2 A;  1MG8 A;  4KKI A;  2MBO A;  2KQ7 A;  3VUY A;  2DYO A;  3GZN I;  3WAM A;  5EDS A;  3HHM A;  5FR3 A;  3NOB A;  2FNJ B;  4J3O D;  1WR6 E;  4KGS A;  4AQ7 A;  3VRA B;  3DHH C;  4XZ4 A;  4C00 A;  1EU4 A;  2PIA A;  1OQQ A;  2WYQ A;  4NJ6 A;  2KJH B;  2DNF A;  2J0J A;  3MHZ A;  4K7S A;  1V49 A;  3VTW A;  2W82 A;  5G2N A;  4F8C B;  3HVD A;  5JHA A;  2XEW A;  4ICU A;  2INP E;  3ZRF A;  2JRI B;  4AUQ C;  1DOX A;  2YEP F;  4BBN C;  1GB1 A;  1PGA A;  4W9H A;  3V60 A;  3NS8 A;  1OTR B;  2K6Q A;  3FIL A;  1WJ4 A;  4IG7 B;  4W9G A;  4ZYN A;  1XD3 B;  4LLG M;  2N7E A;  4H2A A;  2WXI A;  3BII D;  3E9S A;  1E10 A;  5AZF A;  2H89 B;  3PRP B;  4WJN A;  3ENE A;  3NVW A;  1ZXI A;  2RDH A;  5G5G A;  4AJY B;  1D3Z A;  2D3G A;  3ZXR A;  1RFK A;  1WJN A;  1K51 A;  2IO3 B;  4OVU A;  1VJK A;  4DK5 A;  1K8R B;  3QHT A;  1Y56 A;  4C56 C;  1E9M A;  2L7R A;  3PSE B;  4US8 A;  1WH3 A;  3CST A;  4IM2 A;  2C60 A;  1P1A A;  1HQR D;  1AW7 A;  2J42 A;  2CU1 A;  5D3D A;  1OEY A;  1QKZ A;  2KFK A;  3A4S C;  1EWY C;  5G55 A;  2MJD A;  4ARI A;  3AE6 B;  1DYQ A;  1WI0 A;  5EE3 A;  1E6E B;  5HI1 A;  2JZZ A;  1L6V A;  3MJ5 A;  2JUO A;  4NZL B;  2FCS A;  4ICV A;  4NQK E;  4A8X C;  3ZUN A;  1L0Y B;  5C3J B;  3QIJ A;  2WXQ A;  3N20 C;  1UNS A;  2L3Z A;  4RNA A;  2ZW0 A;  3P2B A;  2FCM A;  4HJG E;  4BBN F;  1I42 A;  3OAW A;  2PVO D;  4C80 A;  2IGH A;  2ZNV B;  4MH0 E;  4OW0 A;  1JAL A;  1JRP A;  3PGE A;  5H8Y E;  4ANW A;  1K50 A;  1CMX B;  3A9J A;  3U30 A;  2MP2 B;  4M0W B;  4HJK A;  3HVZ A;  3L10 B;  1WF9 A;  3P4R B;  2LGD A;  3Q8F A;  4P1B C;  3D32 A;  4J6I A;  3ZTC A;  4PYU A;  3R7Q A;  4IM3 A;  1Z2M A;  2JRH A;  3DWG C;  1YX6 B;  3VR8 B;  3QCA A;  3W1S C;  1NYQ A;  4LNN A;  1Z5S B;  4YSX B;  1FCL A;  1C77 A;  5IO9 A;  4JLC A;  3HUI A;  3DBR I;  3VAW A;  4URK A;  2GOW A;  4ITK A;  4M02 A;  1XCT L;  2LMC A;  3UIO B;  2CJN A;  5EE1 A;  2LD9 A;  4KZC A;  2ZW1 A;  1CQV A;  2EMT A;  1F1H A;  1IPG A;  2LVP A;  2L05 A;  5JH5 C;  2D2Q A;  2QDF A;  3EC8 A;  4KV2 A;  1WGG A;  1WM2 A;  2RMM A;  2XK5 A;  5CHV C;  3WAO A;  2XBB C;  3Q8B A;  4F7Z A;  3JVZ X;  1PQS A;  5BMH A;  1EM7 A;  3KYD D;  2BS4 B;  2QJL A;  1I7H A;  1QF6 A;  1KRH A;  3R2I A;  2K9X A;  1I4R A;  3I63 C;  2M19 A;  2WXL A;  3VHT C;  4RM8 A;  1L0V B;  2GBJ A;  1HTO A;  3P4S B;  4PYZ A;  5CX3 A;  1B1Z A;  3Q8A A;  4B0E A;  1TTN A;  2QSD A;  5IN7 A;  1KM7 A;  2CHZ A;  3S2A A;  4C7Y A;  2KT7 A;  3TEZ A;  3V6C B;  1IYF A;  3DBL I;  4DHJ B;  2DZK A;  2Y3A A;  2MJ3 A;  3FKY A;  4YTN B;  5D6J B;  4HKQ A;  3M3J A;  3SEB A;  3AEA B;  3HRD D;  1AYF A;  2J0M A;  2LJ5 A;  3QAQ A;  5AZH A;  4LCD E;  4OVV A;  1MI0 A;  1YN5 A;  3LXF A;  1YMH E;  2JSV X;  1WY8 A;  3NZS A;  1SSN A;  1F2R C;  1KH0 A;  3HM6 X;  2PVG C;  3DQV A;  3APC A;  3DBS A;  3H7S A;  3EA6 A;  3FC4 A;  2WXF A;  1C79 A;  3VQI A;  3KYC D;  4G11 A;  2DLB A;  4II3 B;  3MC9 A;  1QOF A;  1WJ6 A;  3AEE B;  3DCG A;  2DAJ A;  3ZJT A;  2LHE A;  4MEM A;  3N3K B;  4XYC A;  1XLP A;  3CMM B;  3N30 A;  1V81 A;  4PK1 A;  3Q3O C;  1XLO A;  1FNW A;  1JWM D;  4KSK C;  2XNA C;  3RCZ A;  1C1Y B;  4P7I A;  1I4G A;  3PRM B;  1SJE D;  4HPP A;  3M63 B;  4NJ7 A;  4DWF A;  2CKH B;  5C2T B;  2FCQ A;  1GJZ A;  4P16 A;  1VZ7 A;  2BYF A;  1X1M A;  1JWA D;  4DBG A;  2JPH A;  3P4P B;  2LWP A;  1SIF A;  4ZRP A;  2BPS A;  3TJP A;  1QLB B;  2LXC A;  2GBM A;  2C7H A;  2WDQ B;  2ON8 A;  2J7Q B;  1GC6 A;  1WGD A;  2JZP A;  1SF0 A;  3V6E B;  5DPS A;  1DOY A;  1V86 A;  3DVN U;  3OJ3 A;  1PFD A;  1BXT A;  4CO7 A;  1JWB D;  1SE3 A;  4L1B A;  1TKE A;  5EE0 A;  2ICI A;  5LLI A;  2V0G A;  3KWV A;  2G1E A;  1FRR A;  4P1C C;  3BVZ A;  3PZ7 A;  3RD2 A;  4DHJ D;  1K53 A;  4RM9 A;  3AXC A;  1ZUD 2;  4JX1 C;  3NVZ A;  1RFA A;  3A1Q A;  2KK8 A;  1PDX A;  2JF5 A;  1IBX A;  1QT9 A;  2QIL A;  2BB6 A;  1FFV A;  1GPX A;  5AEK B;  3NRZ A;  2ONQ A;  3ZDM C;  3AB5 A;  3RMK C;  2N4F A;  2NR2 A;  4BZA A;  5JZE B;  2BT6 A;  2DX5 B;  1C4P A;  5LXI B;  3P42 A;  4N58 A;  2DBY A;  2WU2 B;  2BTE A;  4US9 A;  4ANV A;  2WXJ A;  4MJS B;  3AH7 A;  4FUL A;  4DXA B;  3BIN A;  4BFR A;  1TZO A;  1SE2 A;  1V8C A;  1WMH B;  3EFC A;  2WDV B;  1OQY A;  1TBE A;  2JQR B;  3A4R A;  2IGG A;  2KTR A;  1PUT A;  4EZK A;  1SIJ A;  1BUI C;  4OVZ A;  4NAW A;  4MAC A;  3UQB A;  3ZYY X;  1P98 A;  2IJ0 A;  3Q2A C;  1UWM A;  3WAP A;  4MEL A;  2IY0 B;  2IO1 B;  4K7W A;  1E90 A;  4M8N A;  2RD0 A;  3KW5 B;  4HLE A;  2REX A;  2Y5P A;  1C9F A;  4ZRQ A;  3AU5 A;  1YJ1 A;  2ZPN A;  1ESF A;  2PJH A;  2BBC A;  4OZA A;  2MP2 A;  2I2Y A;  5KHQ A;  1MFW A;  3OG5 A;  3B2F A;  3GS2 A;  1ZDV A;  3RUL A;  3JW0 X;  3AE9 B;  2QHO A;  4PS7 A;  2K8H A;  2MW5 A;  1RM6 C;  1KLU D;  2G9H D;  2HJ1 A;  2CR5 A;  3QX1 A;  2Z59 B;  4NNJ B;  4WJO A;  3H6N A;  2L8J A;  1ACC A;  1S1Q B;  5C23 A;  4O1N A;  4USA A;  4ANU A;  5D94 A;  3L16 A;  3ZTD A;  5D2M B;  4G3X B;  3KUZ A;  2KMC A;  4B0M A;  1VR9 A;  3AM9 A;  1C4A A;  4OHJ A;  1D4B A;  1ZDX A;  5FR6 A;  4N9F 4;  2GI9 A;  1UUP A;  3ETR A;  3ZDT A;  1OFF A;  4DXF A;  1P9D U;  2WX1 A;  4A90 A;  1XQQ A;  3W9C B;  1HA5 A;  3H7P B;  4BKG A;  4BKS A;  2OJR A;  1P7E A;  1YQB A;  1Q0W B;  2Q5W D;  1V1P B;  2MBB B;  3SFD B;  1TT5 B;  3TUO A;  2R2Q A;  3RZW C;  1F77 A;  2IY1 B;  3CF6 E;  4IDI A;  2JYT A;  1LGR A;  2MBQ A;  2LAS A;  3O65 B;  1T0Q C;  3L08 A;  4IKG A;  2ACZ B;  2M4N A;  1HZ6 A;  1R4N B;  3QAR A;  5IKC M;  4JL9 A;  3QQ8 B;  5BYS A;  1PGX A;  2V3S A;  3RN9 C;  2W3S A;  3E56 A;  1WXM A;  3NG0 A;  3VTV A;  2AQ1 B;  3ZKJ C;  3KH0 A;  2AL6 A;  2L83 A;  3AU4 A;  3AE7 B;  4E71 A;  2RGF A;  2LVO A;  4EKU A;  1QZE A;  4HDQ A;  1WGY A;  1K52 A;  5H92 C;  1RLF A;  3QC8 B;  2LXA A;  3URY A;  3BVM A;  2W54 A;  1Q1O A;  4E74 A;  3T3N A;  1SGH A;  2KVZ A;  1E8Z A;  2KDM A;  1KOT A;  4W9F A;  3RUI B;  2FBW B;  2XN9 C;  3L54 A;  3LJ3 A;  4MSM B;  2NTS A;  4K7U A;  2M8S A;  2UYZ B;  2DYM A;  3UIP B;  1M4V A;  5FKA C;  2CS4 A;  2DAF A;  4KGT A;  4PS3 A;  2JZ3 B;  1L6U A;  2R2O A;  4G50 A;  1WXV A;  1ZPS A;  2NBV B;  4TV3 A;  4UDU C;  2RR9 A;  3ZNG C;  3IXS A;  1ZP0 B;  3SDL C;  3IHP C;  1HEZ E;  1WWT A;  4IUM B;  1T0S C;  2IBI B;  4PT5 A;  2WDT B;  3OWE B;  4WWM A;  1N60 A;  2PTL A;  3AEG B;  2WXP A;  3AE8 B;  3I57 A;  1KJT A;  4BOS C;  3RYT A;  2G4D B;  1WGR A;  3Q3J A;  4EZL A;  2AEH A;  5CTR C;  3BYY B;  2QCZ A;  1GAQ B;  1WRI A;  3AEB B;  1VCB A;  1XXG A;  4KZ0 A;  3H9D A;  4JQW C;  3RI7 C;  3ONS A;  3OLM D;  1V9J A;  1TZ1 A;  1JWU D;  2KHW B;  3L17 A;  2PKO A;  3AI5 A;  2VZK B;  1KTK A;  2LUE A;  3KVF B;  5BO4 B;  2RDB C;  1M94 A;  1C78 A;  4DDI D;  4GOC A;  4W9J A;  4AP4 C;  1XO3 A;  2MWS B;  2FE8 A;  2WP9 B;  2WHI A;  5AUK A;  4EZJ A;  3V3X A;  3Q3M C;  4YXD B;  2OOB B;  1UH6 A;  4A3O A;  2NBW B;  2MBE A;  2CU3 A;  2KJR A;  3DDC B;  2MJE A;  5D3I B;  2GLS A;  5J2R A;  3PV1 A;  2V4I B;  5AZG A;  1ZGU B;  1EF5 A;  2C7N B;  4MDK E;  3SR6 A;  3VR9 B;  3IG3 A;  2NBU A;  3KQ4 A;  4WJP A;  4ZOH C;  3K9O B;  2VH1 A;  4NJC A;  3AED B;  1DOI A;  2CHX A;  2JU6 X;  4EE2 A;  1JRO A;  4A3P A;  1N62 A;  1NDD A;  2IO0 B;  3LDZ E;  2ZCB A;  1RAX A;  3V61 A;  2K25 A;  4B9K A;  3A9K A;  4GMV A;  4MJS A;  2BGF A;  3ZW3 A;  3N32 A;  4DHZ E;  3VXW A;  3IAS 1;  1WMH A;  3EGR A;  1WXQ A;  1HZ5 A;  1WX8 A;  3GB1 A;  2NCN A;  1UD7 A;  3RNA C;  2W9N A;  3Q14 C;  3EEC A;  1N5X A;  3MC0 B;  1C4C A;  2GBK A;  3ECI A;  3PZ8 A;  3GP7 A;  3V62 A;  1LM8 B;  3TL5 A;  2GBN A;  2KWV B;  2O6V B;  1V6E A;  2KAC A;  4PS8 A;  2QEJ C;  4I6N B;  4XGA B;  3BWU D;  3DBH B;  3DVG Y;  4IOI E;  4WWO A;  3AUL A;  3DHG C;  3GE8 C;  3W1Y A;  1I4X A;  1N63 A;  1NI3 A;  2KD0 A;  1WXA A;  2MH7 A;  1VZ6 A;  3L0W B;  1FPY A;  2YLM A;  4REZ A;  4KDL B;  3P1M A;  3TMP B;  5IAA C;  2HTH A;  2OJW A;  3J9C A;  2N7D A;  4MGZ E;  2KVR A;  3X23 A;  3SFE B;  4XWW A;  2Z8L A;  2QMT A;  1F52 A;  3NHE B;  5TR5 A;  1TKY A;  5BMI A;  2VZK D;  3ML9 A;  1TS3 A;  1YJJ A;  1WXS A;  3M62 B;  4OZB A;  5BYQ A;  1ZOY B;  3ZJV A;  1V5T A;  2KAN A;  4HPM B;  3JYU A;  4IW0 A;  1R4M B;  1ET6 A;  1E0Z A;  2DZI A;  2KAJ A;  3SD5 A;  1U4A A;  3IAM 1;  1IP9 A;  4EFO A;  3AE5 B;  2YEP B;  2MCN B;  3TIX A;  1KF6 B;  4DXG A;  1TS5 A;  3U4E G;  1CK1 A;  3FAH A;  5HG2 A;  1YJI A;  3TEW A;  1XCQ L;  2KZR A;  3VVW B;  2IND C;  2OED A;  4IM0 A;  2HE7 A;  3ZQ4 A;  2EKI A;  3ZVV A;  4MSQ B;  2KOX A;  4RFB A;  4EEW A;  5HFY A;  4K3C A;  2KYW A;  2WGS A;  3I9V 1;  1S3S G;  2DEN B;  3WA0 A;  4M01 A;  2MA9 B;  4ZRJ A;  4WJQ A;  3TEY A;  4TQ1 A;  1YX5 B;  3FIL B;  3RNB C;  4CQN A;  1NEN B;  4L23 A;  4LJO B;  2K1F A;  2PE9 A;  1KLV A;  4M00 A;  2ZJD A;  2K8B A;  4DHZ B;  2YVC A;  2X38 A;  3NZU A;  1JCK B;  2AQ3 B;  2BKR B;  3CIR B;  1SXT A;  3PPA A;  1WGK A;  4HCN B;  1SJH D;  3I5J C;  3U7Z A;  1HXY D;  2LUM A;  2WS3 B;  4S17 A;  4TSS A;  2LVQ A;  1ZE3 D;  1ZKH A;  2CJO A;  4MM3 B;  1XLQ A;  2O6V D;  2KMA A;  3VH3 B;  2KQS A;  1E7V A;  4FXC A;  1B9R A;  3JSV B;  3LB8 C; 
#chains in the Genus database with same CATH homology
 4O1N A;  1ZXH A;  3NVW A;  4USA A;  4WUR A;  2LHD A;  1N5W A;  1FMA D;  1QOG A;  1ZXI A;  2FUG 1;  2RDH A;  3N9Y C;  5G5G A;  4B0M A;  2V3P A;  1VR9 A;  3AM9 A;  1C4A A;  3Q8C A;  4OHJ A;  3TSS A;  4ZYS A;  1D4B A;  1TS4 A;  1ZDX A;  3O13 A;  3TEX A;  4HRS A;  1J7B A;  2GI9 A;  1UUP A;  1FD6 A;  1JW9 D;  3ETR A;  1PGB A;  4HEA 1;  1RFK A;  1K51 A;  4KX6 B;  1OFF A;  4DXF A;  3B9J A;  4GLS C;  4A90 A;  1VJK A;  3H8H A;  3W9C B;  5I4D A;  1JML A;  1HA5 A;  2MEK A;  4RCO A;  1FFU A;  1Y56 A;  4C56 C;  1D6E C;  2RDG A;  2WXK A;  1E9M A;  5T8I A;  3DWM A;  4US8 A;  1YN3 A;  1P7E A;  1YQ4 B;  2V3N A;  1TY0 A;  2Q5W D;  1V1P B;  3SFD B;  1ENF A;  1HQR D;  1RYJ A;  1AW7 A;  2WDR B;  1YNT E;  3TUO A;  2J42 A;  2BB5 A;  5D3D A;  4N59 A;  1QKZ A;  1F77 A;  1TKG A;  1NYR A;  4IDI A;  1EWY C;  2JYT A;  4GDL B;  2MJD A;  4ARI A;  3NVV A;  3AE6 B;  4JPS A;  1GOZ A;  2Y5C A;  3C8Y A;  4IKG A;  2ACZ B;  2RPV A;  1DYQ A;  1HZ6 A;  1FO4 A;  2NTT A;  5EE3 A;  2TSS A;  1QOA A;  1VRA B;  1E6E B;  1TYG B;  5HI1 A;  1FEH A;  5BYS A;  1OQR A;  1PGX A;  1L6V A;  3MJ5 A;  4HKZ E;  1QQR A;  2W3S A;  3E56 A;  3W1S A;  1IGC A;  1I4P A;  4NZL B;  4A8X C;  2AQ1 B;  3IT6 B;  1V1P A;  1L0Y B;  5C3J B;  3P4Q B;  1XF5 L;  4ARC A;  2L83 A;  3V05 A;  3AEC B;  3AE7 B;  1VZ8 A;  2WXQ A;  1KFY B;  1MHX A;  2J52 A;  1UNS A;  4RNA A;  4GDK B;  2ZW0 A;  1K52 A;  1SEB D;  4HJG E;  5H92 C;  2PVO D;  4C80 A;  1KLG D;  5BYR A;  2IGH A;  4OZC A;  3URY A;  3BVM A;  4OW0 A;  1JAL A;  2OHF A;  2W54 A;  1JRP A;  4XWT A;  3UI3 A;  5H8Y E;  1L4D B;  3W2D A;  3T3N A;  1NVI D;  2KDM A;  2FBW B;  1K50 A;  2XN9 C;  2EEL A;  2NTS A;  1T3Q A;  4JWS C;  4XE0 A;  1VDV A;  2PLP A;  4KGR A;  3AV8 A;  3R2T A;  1FNU A;  3HVZ A;  4TQ0 A;  3P4R B;  4YSZ B;  3Q8F A;  2DYM A;  3AE4 B;  4L2Y A;  1M4V A;  5FKA C;  4KGT A;  1V97 A;  2WXR A;  2R61 A;  5GXG B;  5BMG A;  1L6U A;  3DWG C;  3VR8 B;  1NYQ A;  1ZPS A;  3BVG A;  3NUH B;  4YSX B;  2LFI A;  1XLN A;  4UDU C;  2JXT A;  1N61 A;  5FK9 C;  1F0Z A;  3ZGZ A;  1AWD A;  3IXS A;  1C77 A;  3CWI A;  1FCL A;  1ZP0 B;  4M0W A;  4XDC A;  3HUI A;  1MHH E;  1STE A;  2L52 A;  1HEZ E;  4ITK A;  1WWT A;  1NEK B;  4RGM A;  2DWQ A;  1XCT L;  1SB3 C;  2LMC A;  1DGJ A;  2CJN A;  5EE1 A;  2BS3 B;  4PT5 A;  3AMZ A;  1QOB A;  2E6X A;  2ZW1 A;  2W3R A;  1WYG A;  3AE3 B;  1D5Z C;  3OWE B;  4WWM A;  1CQV A;  2WXN A;  1N60 A;  2PTL A;  3AEG B;  3B2G A;  4KKJ A;  1YQ3 B;  2WXP A;  2HTM E;  2WQY B;  4RGT A;  3AE8 B;  3I57 A;  3Q69 A;  2RMM A;  1PYW D;  2KWD A;  1EU3 A;  3BYY B;  3Q8B A;  3RPF C;  1FM0 D;  1P7F A;  1MVK A;  1GAQ B;  1WRI A;  3IT4 B;  1FCC C;  3BK2 A;  5BMH A;  1EM7 A;  3BZD B;  4WIP A;  2HDE A;  4AS1 A;  3AEB B;  4DQO C;  2BS4 B;  2QJL A;  1I7H A;  1XXG A;  1QF6 A;  3AEF B;  1D5M C;  1KRH A;  3R2I A;  2K9X A;  1I4R A;  2M19 A;  2WXL A;  1L0V B;  1TS2 A;  3P4S B;  4LTU A;  4RGN A;  1I4Q A;  2LEK A;  1B1Z A;  1T5X D;  3Q8A A;  4B0E A;  3MP9 A;  2QSD A;  1JWU D;  4TMA B;  3W5V B;  1FXA A;  4C7Y A;  2WLB A;  4WH4 A;  3TEZ A;  2N9L A;  1SBB B;  2I38 A;  1CZP A;  2Y3A A;  4RGO S;  2PKO A;  2VZK B;  3NVY A;  1KTK A;  4D2K A;  2MJ3 A;  4HKQ A;  1D5X C;  4YTN B;  1LO5 D;  1C78 A;  3SEB A;  1JWS D;  1FRD A;  2N7J A;  3AEA B;  3HRD D;  1AYF A;  1XO3 A;  3AE1 B;  2FE8 A;  2WP9 B;  5AUK A;  2SEB D;  3V3X A;  2K0P A;  4YXD B;  2WXG A;  1MI0 A;  1YN5 A;  2KMM A;  4JWU C;  2CU3 A;  2J4X A;  3LXF A;  1YMH E;  2JSV X;  3RFZ B;  2LGI A;  1SSN A;  2B76 B;  1F2R C;  3PO0 A;  1QIL A;  1A70 A;  1KH0 A;  2MJE A;  5D3I B;  2D5G A;  2AX5 A;  1Q10 A;  2PVG C;  2V4I B;  3EA6 A;  3FC4 A;  3ABV B;  1VLB A;  2WXF A;  1V1O A;  4LK0 M;  5G5H A;  1C79 A;  3SR6 A;  2PMV A;  3VQI A;  3VR9 B;  2DLB A;  3W5U B;  1R7S A;  1QOF A;  2H88 B;  2IDY A;  3AEE B;  3KQ4 A;  3Q8E A;  1L5P A;  4ZOH C;  4YSY B;  3ZJT A;  4NJC A;  2LHE A;  2KQ4 X;  3AED B;  1XLP A;  1DOI A;  2JU6 X;  4R3D A;  1FXI A;  1JRO A;  4P6V F;  4EE2 A;  3VRB B;  1N62 A;  2W55 A;  2L32 A;  1XLO A;  5LNK 1;  2GRI A;  2QIE B;  4YWG G;  1FNW A;  1JWM D;  2LJI A;  2XNA C;  4WQM A;  4HRO A;  4A55 A;  1AN8 A;  5D7G A;  2KN4 A;  1J7A A;  1I4G A;  1SJE D;  3LYY A;  2GB1 A;  2K3U A;  2E3T A;  3IAS 1;  4YTP B;  3EGR A;  2AQ2 B;  5C2T B;  5EE9 A;  1WXQ A;  1HZ5 A;  3U52 E;  3GB1 A;  4P16 A;  4ZHP A;  1VZ7 A;  3WCQ A;  3AE2 B;  1N5X A;  3MC0 B;  1C4C A;  3NS1 A;  1JQ4 A;  3ZJU A;  1JWA D;  3PZ8 A;  3GP7 A;  1WSP A;  3P4P B;  1E7P B;  1UGJ A;  4ZRP A;  1YN4 A;  5AUI A;  1L0X B;  1C76 A;  1QLB B;  2KAC A;  1L4Z B;  2WDQ B;  3T3O A;  2ON8 A;  4RF0 A;  5TSS A;  2JZP A;  2QEJ C;  1SF0 A;  3BYT B;  3BWU D;  2WXM A;  4IOI E;  1DOY A;  4N6E B;  1I4X A;  4A6Q A;  1N63 A;  4RH6 A;  1PFD A;  1T6B X;  1BXT A;  1NI3 A;  2WXO A;  1JWB D;  1MPE A;  2N9K A;  2WXH A;  1SE3 A;  2MH7 A;  4L1B A;  1IBX B;  1VZ6 A;  2SAK A;  2BW2 A;  1TKE A;  4REZ A;  4A9A A;  3P1M A;  2M56 B;  3U2S C;  4RF1 A;  2WNM A;  5E6J A;  2N0S B;  5EE0 A;  3MFG A;  1XEE A;  2ICI A;  4WAF A;  1F2R I;  3J9C A;  5MPO A;  2V0G A;  3SFE B;  4XWW A;  2Z8L A;  2QMT A;  3KWV A;  5HHD G;  1TY2 A;  2G1E A;  1RWS A;  2K5P A;  1FRR A;  3BVZ A;  3PZ7 A;  1TKY A;  5BMI A;  2VZK D;  1K53 A;  1TS3 A;  1YJJ A;  1ZUD 2;  2K22 A;  1IGD A;  4Q2J A;  2IPK D;  4JX1 C;  3NVZ A;  1ET9 A;  1TJE A;  4OZB A;  1PDX A;  1IBX A;  5BYQ A;  1QT9 A;  1ZOY B;  3ZJV A;  2NMQ A;  4ZHO A;  1J7C A;  2QIL A;  2IGD A;  2BB6 A;  1BML C;  2J53 A;  1ET6 A;  1FFV A;  4C7Z A;  1GPX A;  1E0Z A;  3KWL A;  3NRZ A;  2KAJ A;  4KKI A;  2ONQ A;  3AB5 A;  3EUB 2;  3IAM 1;  2JYE A;  2BT6 A;  3AE5 B;  2DYO A;  2YEP B;  1C4P A;  1KF6 B;  4DXG A;  1TS5 A;  2WU5 B;  5FR3 A;  4J3O D;  3U4E G;  5JXV A;  1CK1 A;  3P42 A;  4KGS A;  2DBY A;  4N58 A;  4NAW B;  4AQ7 A;  2WU2 B;  2BTE A;  4US9 A;  3FAH A;  5HG2 A;  2WXJ A;  1YJI A;  3TEW A;  3AH7 A;  1XCQ L;  4JE3 B;  2OED A;  3VRA B;  3ZQ4 A;  2EKI A;  1TZO A;  1SE2 A;  1V8C A;  4RFB A;  1EU4 A;  2PIA A;  5HFY A;  1EWC A;  2WDV B;  1OQQ A;  3I9V 1;  3BK1 A;  2JQR B;  2IGG A;  3MHZ A;  3TEY A;  1PUT A;  4TQ1 A;  1FIQ A;  1SIJ A;  1BUI C;  4OVZ A;  2BS2 B;  1IUE A;  4MAC A;  3FIL B;  3ZYY X;  2W82 A;  2IJ0 A;  4YT0 B;  1UWM A;  3HVD A;  4MT5 A;  4CQN A;  2M0A A;  1NEN B;  4L23 A;  2INP E;  2L1A A;  3KLS X;  1ROE A;  2INN E;  1DOX A;  3P63 A;  2BYT A;  2YEP F;  1I4H A;  1GB1 A;  1FNV A;  2Y5P A;  2X38 A;  1C9F A;  1PGA A;  4ZRQ A;  3AN1 A;  1SE4 A;  1GB4 A;  1JCK B;  2AQ3 B;  3CIR B;  1ESF A;  1SXT A;  2BBC A;  4OZA A;  2I2Y A;  1WGK A;  2JWU A;  1SJH D;  3FIL A;  3B2F A;  3U7Z A;  1HXY D;  2LUM A;  3GS2 A;  4YTM B;  1ZDV A;  2PW9 A;  2WS3 B;  4TSS A;  4LLG M;  3AE9 B;  4H2A A;  1ZE3 D;  2CJO A;  2WXI A;  4MM3 B;  2JX5 A;  1XLQ A;  3BII D;  3E9S A;  1E10 A;  3L4P A;  1RM6 C;  4NAM A;  1CJE A;  1KLU D;  2G9H D;  1UWX A;  4FXC A;  3NZ3 A;  2H89 B;  1B9R A;  4XDD A;  3R8B A;  4MH8 A;  3LB8 C;  1ACC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...