3CWIA

Crystal structure of thiamine biosynthesis protein (this) from geobacter metallireducens. northeast structural genomics consortium target gmr137
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
69
structure length
69
Chain Sequence
MNLTVNGKPSTVDGAESLNVTELLSALKVAQAEYVTVELNGEVLEREAFDATTVKDGDAVEFLYFMGGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of thiamine biosynthesis protein (ThiS) from Geobacter metallireducens.
rcsb
source organism Geobacter metallireducens gs-15
molecule tags Biosynthetic protein
molecule keywords Thiamine-biosynthesis protein ThiS
total genus 15
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2008-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3cwiA00
4YTNB 2WS3B 2WU5B 3VRBB 3DWGC 4C7ZA 3ABVB 3NS1A 3P4SB 4YT0B 5EE1A 1N5XA 2HTME 2MH7A 1FRRA 3BIID 1NVID 1DOIA 1TYGB 3AEAB 1NI3A 4N6EB 2CU3A 4HROA 3AEEB 2L52A 5EE0A 1TKEA 2H88B 3EUB2 1WRIA 2PIAA 2Q5WD 4JWUC 5C2TB 3HUIA 2W54A 1DGJA 1SF0A 1XLQA 4N58A 1TKGA 4ZOHC 1L0VB 1QLBB 1ZXIA 4LTUA 1NYQA 2W55A 1J7BA 2M56B 2H89B 2KAJA 3PO0A 5EE9A 4FXCA 1E10A 2K22A 4A9AA 1E9MA 1EWYC 2DBYA 1WWTA 3VRAB 3SFDB 1L6VA 2WU2B 1FFUA 1NYRA 2M19A 3AE7B 3AEDB 1FO4A 4YXDB 5H8YE 3P63A 3SFEB 3AE4B 3AEGB 3W5VB 1QOBA 3L4PA 3P1MA 1FXIA 3LB8C 1V97A 1JW9D 2B76B 5C3JB 2MJEA 1RWSA 2PVOD 4N59A 5MPOA 1VLBA 1YJJA 1N5WA 2N0SB 2QJLA 2MJDA 4JWSC 1OQQA 2DWQA 1DOXA 5G5HA 1KF6B 1N60A 3P4RB 4ZHOA 3HRDD 2KMMA 1B9RA 2ACZB 1GPXA 1YQ3B 1E7PB 1QOAA 1XLPA 2W3RA 1XLNA 1KFYB 2BS4B 1PDXA 2WLBA 3AM9A 2QIEB 1WXQA 2BS3B 1JALA 1JRPA 1J7CA 2JQRB 3AEFB 4YSXB 3P4QB 1WYGA 1KRHA 3AE5B 2WP9B 3VR9B 1JWBD 3AV8A 3AH7A 1CZPA 2W3SA 3AECB 4C80A 2PVGC 2OHFA 1GAQB 2MJ3A 2WDRB 1QOFA 1QOGA 1ZOYB 1TKYA 2BT6A 2G1EA 1FRDA 1WGKA 1NEKB 1SB3C 2L83A 3AEBB 3B2GA 3FC4A 1FFVA 3WCQA 2EKIA 3AE1B 1JQ4A 5AUKA 4ZHPA 1JWAD 1A70A 4USAA 4US9A 4YTMB 2BS2B 3KWLA 3W5UB 1F0ZA 5G5GA 3AB5A 1IUEA 2AX5A 1E0ZA 1ROEA 5GXGB 1N63A 3CWIA 3NVVA 1YJIA 1V8CA 3NRZA 1T3QA 1OFFA 2PKOA 4IDIA 2K9XA 3B2FA 4YSYB 5H92C 2CJNA 3HVZA 3DWMA 1E6EB 2E3TA 1XLOA 3NVZA 2Y5CA 4JX1C 1YQ4B 3CIRB 3ZYYX 1N62A 1J7AA 2LEKA 3ETRA 3AN1A 3W9CB 3FAHA 1TJEA 3RPFC 4US8A 1AYFA 1XO3A 5AUIA 3NVYA 1PUTA 1ZP0B 1FM0D 1FIQA 3AE3B 1R7SA 1SIJA 1JROA 3B9JA 4WQMA 1QF6A 4HRSA 1L5PA 4ITKA 4WWMA 3VR8B 1VJKA 3NVWA 4YTPB 2K5PA 4YSZB 3AE8B 1NENB 1OQRA 2FBWB 3AE9B 3SR6A 3AE2B 5EE3A 1N61A 1RYJA 1QT9A 1CJEA 1FMAD 1FXAA 2WQYB 1AWDA 1I7HA 1RFKA 1ZUD2 2WDVB 3AMZA 3LXFA 4P6VF 1L6UA 1RM6C 2WDQB 1PFDA 1VDVA 4KX6B 2JX5A 3P4PB 4C7YA 1DOYA 2CJOA 1UWMA 3AE6B
chains in the Genus database with same CATH superfamily
3IXSA 3SFDB 2ICIA 4RH6A 4OHJA 1YX5B 2BYFA 2L52A 3U30A 1XLQA 1Q1OA 3RT3B 1FNVA 2KZRA 1L0VB 1GC7A 2H89B 2WXOA 3B0AA 2Y5PA 2K22A 1SJED 3P63A 2DYMA 2IO3B 4JIOU 2FIDA 2LUMA 1WM3A 4EKUA 4KKIA 1EF1A 4TQ1A 1T0YA 2GBRA 1KF6B 4IWOA 2LASA 3ZTDA 1WYWB 2WLBA 3N20C 3MC9A 3UF8A 1JALA 3NZSA 3AEFB 1Y8RC 3P4QB 2GRIA 4M00A 3VR9B 2JXTA 4DBGA 1I4QA 1RAXA 1CZPA 4KZCA 5AUKA 5G55A 1MVKA 4GDLA 2FIFA 2MBEA 2WXHA 4LNIA 3ZGZA 1TZOA 1QILA 4RNAA 5JH5C 2IPKD 3QC8B 1GB1A 2ZPYA 4KDLB 4DHJD 3BVGA 1G6JA 3RZFA 5FKAC 5D3DA 4AS1A 2GOWA 3JSVA 4HLEA 4ANUA 3C19A 2IYDB 3ZJUA 2PJHA 3KYDD 4NPNA 3AMZA 4I6PA 3DHGC 2N7DA 1D5ZC 1VR9A 3DWGC 3UQBA 1NVID 1NI3A 2BF8B 1HTQA 1WXSA 1TS4A 2KMCA 1SF0A 2KN4A 5EE9A 1NYQA 1J7BA 5BYSA 2N1VA 4B0EA 2HD5B 4M0WB 3RD2A 1BT0A 3MFGA 4ARCA 2YEPF 3AEGB 3RNFC 2KX3A 2NCNA 1LXDA 1R4MB 1YN4A 3RNAC 3BVMA 4NQLB 4EZLA 3DVNU 2RDBC 4A20A 2KLGA 1V49A 4ZYSA 2PPHA 1P98A 3NOBA 1E7PB 4JQWC 1M94A 4MELA 3GE3C 4TQ0A 2BVCA 1YOVB 5I4DA 2DZMA 3HM6X 2JQRB 3PVLA 4ZDVA 2KDEB 4MM3A 2K0PA 2K25A 2KFKB 4II2B 5JHBA 2DZJA 4MDKE 1WGKA 2W82A 3QQ8B 1MJDA 2LHEA 3WCQA 2D2QA 2LD9A 1WX9A 2DAFA 2V3NA 4HJGE 2WXQA 1YMHE 4WAFA 3WAOA 1YN5A 1V8CA 3Q8AA 5D2MB 5H92C 2GMIC 3DWMA 3CIRB 3PRPB 4W9HA 2ZVNA 2M17A 1TJEA 2L76A 2NPTA 1J8CA 4G3XB 3ZO5B 4HRSA 3UINB 3EA6A 1C79A 4WWMA 5KHOA 3PREA 2K5PA 5HHDG 3K9PB 4ZRIA 1UZXB 3IT6B 4PYZA 4K3BA 1UWMA 2XBBC 2V1YA 3MTNB 2M0AA 1JWMD 2R2QA 2R61A 2M1MA 3BZDB 3BIID 1VRAB 4FN2A 4N6EB 3LYYA 4HROA 3KH0A 2KJHB 1KH0A 1IPGA 1QLBB 2W9NA 1E9MA 4KSKC 3IT4B 3PS6A 3ML9A 1K8RB 3TJPA 3KUCB 4RGOS 1FCCC 4K1RB 1ZW7A 1PQSA 2KQSA 2O2VB 1YD8U 1DYQA 4LNKA 5C3JB 1ZDVA 1HE8A 3EC8A 1CK1A 3S2AA 4M02A 2OJRA 2HE7A 2VH1A 2PTLA 3P4RB 3L17A 4GN1A 4OVZA 3VH3B 3TEZA 5JHAA 4RGNA 1U4AA 3AXCA 4PT5A 3RNBC 4EEWA 5HG2A 3VTUA 4II3B 4LNFA 4M0WA 1YNTE 4IUMB 1GC6A 2WX1A 1FRDA 3B2GA 3TUOA 1XCTL 3H6NA 2WWZA 2NS5A 1N63A 3MJWA 2JWZA 2PLPA 3VHTC 2LGYA 1UBQA 4BZAA 1V1PB 2V3SA 1IBXB 2WX0A 3TL5A 3DVNV 4BKGA 4MGYE 3RPFC 3TEYA 3NVYA 2CU1A 1SE4A 4F8CB 2L8JA 4BBNF 2QDFA 2ZCCA 3ECIA 4YSZB 4HCNB 1C4PA 1TZ1A 1GUAB 1V1OA 5KHQA 1AWDA 1ZUD2 3APCA 2BB6A 1F9JA 2INNE 4BFRA 3N1XC 1DOYA 2C7MB 2OOBB 1WM2A 2JY6A 2KOXA 3FKYA 5C2TB 1DGJA 3ZXVA 3DCGA 4LLGM 1ZPSA 3DHIC 1X1MA 5GMVA 1TTNA 4EE2A 4FHJA 1AARA 2M19A 2MX2A 5D94A 2WXNA 5H8YE 2X8XX 2MBHA 3N32A 2HTHA 3A1QA 2NR2A 4KZ0A 2KN5A 1XCQL 3QARA 5G5HA 4ZHOA 4TSSA 2GB1A 3O13A 1CMXB 3ZJVA 5DCNA 2Y3AA 2CS4A 3A9JB 3JYUA 4FHKA 4XE0A 5HFYA 4CO7A 4WJPA 4IWPA 2BT6A 2JXXA 4DXFA 3AEBB 2YLMA 1EU3A 1F77A 2N9PC 1D4BA 3AB5A 3RYTA 2G3QB 2LVQA 1WGRA 4JGHB 3AU4A 4AQ7A 2VH2A 3H7PB 2CHWA 2KXJA 4LK0M 2IY1B 3IHPC 1C76A 1H4RA 2R2OA 3U4EG 3ZRCA 1TY2A 2BTEA 3M3JA 3MHSD 2FUG1 2JVCA 4W9EA 1ZDXA 2FBWB 3P2BA 2A4ZA 1WFYA 4I6NB 1R4NI 3L10B 1I7HA 2KKCA 3OJ3A 1EM7A 3R3MA 3HIZA 3IG3A 1P9DU 1FCLA 1AN8A 5IN7A 2BKRB 3A4RA 2AQ2B 2FCSA 4W9GA 5EE1A 2MH7A 3Q69A 1KM7A 5IP4D 2MSED 1KLGD 1TKEA 2W54A 1ZXIA 1JWSD 2KAJA 2KYWA 3TMPB 4ACFA 4L1BA 1L4DB 3MHZA 3SEBA 4E71A 2JF5A 3SFEB 3R66C 4WQOB 2MCNB 1E90A 3CF6E 2O6VA 1WR1A 3JW0X 2XN9C 3TIXA 5DPWA 3I3TB 1YQ3B 1V6EA 4FA6A 4FJVB 4E74A 3I9V1 1T0QC 4KSLC 4E3CA 3WIMA 3PTFC 2ON8A 4RM9A 2ZNVB 2HDEA 1SE3A 4A8XC 1ZXHA 3FC4A 3B08A 4YTMB 3KWLA 5CHWA 4XWWA 1M4VA 1T3QA 2K9XA 3E56A 3ZYYX 3MP9A 2XK5A 5BMGA 3Q14C 2K6DB 1Z5SB 3SU8X 4AUQC 3U8ZA 2DAJA 2N7JA 1WSPA 2AEHA 1WXVA 2LI5A 3WALA 4W9CA 1FXAA 2J0MA 2WDVB 1V80A 2BGFA 3WAMA 4UDUC 3AE6B 1C9FA 4LJPB 3ABVB 3AEAB 3L0WB 2QHOA 5CX3A 4PYUA 5L83A 1KLVA 2KWDA 2M4NA 4XDDA 1EWYC 2QMTA 3AE7B 3DHHC 3V61A 2BKFA 3BY4B 1T0RC 1C4AA 2AQ3B 2MEKA 2PMVA 2V4IB 1RWSA 3DBLI 1F52A 3PT2B 3PV1A 4MM3B 3VXWA 3UIOB 4GOCA 3OJ4B 3APDA 3WAPA 2FE8A 1WH3A 1HA5A 3RNCC 2KTRA 2ZW0A 2BS3B 4HDOA 4ZRQA 2Z59B 3N1YC 1OTRB 1EU4A 4MSQB 3AV8A 3AH7A 2OHFA 4AJWA 4N9F4 3SDLC 1WXMA 2N9LA 3QHTA 5TSSA 4K3CA 2JPHA 1ET6A 2J4XA 5GXGB 2WNMA 4DHZE 2MP2A 2C5LC 4F1SA 3ZDTA 1WR6E 3JSVB 1E8WA 1WJUA 2BYVE 2FNJB 2JYTA 4AOFA 1PGXA 4M8MA 2GBNA 3RZWC 1QKZA 4WJOA 2KHWB 3UQAA 2EMTA 4US8A 3ZNGC 2MBQA 1XO3A 2ZNVC 1R7SA 3FILA 4G50A 1TY0A 2KVZA 5BMHA 1L5PA 2LJIA 4ITKA 3VR8B 2EMSA 1WF9A 4BKSA 2KJ6A 2O6VB 4EUTA 4W9FA 1FMAD 1BMLC 3PHWB 2D3BA 4C7YA 2XEWA 3BYYB 3W2DA 3W1SA 3AU5A 1HEZE 2N9EB 3EFUA 1ESFA 2Q5WD 3Q3OC 3RNEC 2X38A 4IM0A 5J18A 1MPEA 2KWCA 1UWXA 1UUPA 4NJ7A 4TV3A 3ZTCA 4WURA 2B76B 3NG0A 2NPTB 4GDKB 5CTRC 2HJ1A 4FJYA 2MBOA 1DOXA 4EZKA 3NUHB 2JT4B 4LNNA 2KLCA 4MT5A 2C7HA 3R2TA 1Z2MA 1FXTB 1UF0A 2PE9A 1MG4A 2NBWB 5FK9C 4BBNC 2HJ8A 4PS8A 2MJ3A 4BAXA 5JZEB 4RGTA 3RULA 3IFWB 2SEBD 2J52A 2D3CA 3Q2AC 3C8YA 1KLUD 3LDZE 2CHXA 4ZRJA 2KFKA 5IKCM 3W5UB 3URYA 2KC1A 2PKOA 2KDIA 3B2FA 4YSYB 2CJNA 4IG7B 1XLOA 4HJKA 4A55A 1J7AA 3HK0A 2IJ0A 1WGHA 1B1ZA 1IYFA 5DPRA 3H9DA 3NS8A 2OEDA 1SIJA 2TSSA 1SGHA 3JVZX 3DBRI 2KDFB 2RPVA 3HM3A 4IW0A 2UYZB 1K53A 1V9JA 1CJEA 1LGRA 2LWPA 3ZIMA 3SD5A 4P6VF 4KX6B 1V2YA 4MSMB 3NVZA 2WS3B 3VDZA 1ENFA 2CKHB 5BMIA 2FCMA 1N5XA 1DOIA 3DBSA 1C3TA 3M95A 3Q3JA 2BBCA 5T8IA 2DBYA 3NJTA 2KQ7A 4DDID 2WU2B 3AEDB 3AI5A 4YXDB 3V6CB 5BO4B 3AE4B 2D3AA 3UI3A 1T6BX 4H2AA 2LRUA 1FXIA 3U52E 1V97A 1FPYA 2PVOD 4BOSC 1XD3B 1I42A 2DWQA 5E6OA 1N60A 2L3ZA 3RI7C 1VZ6A 2RSUA 2REXA 4HCPB 3TEWA 3AM9A 3Q3NC 3QIJA 1JRPA 1A5RA 1GNUA 2WXLA 3ALBA 4ZYNA 3PZ8A 3I63C 2JZ3B 2L00B 4ICVA 3A9KA 2M8SA 3BYTB 4B95A 5AEKB 4YWGG 2IY0B 3U7ZA 3NVVA 4LDTB 1P7FA 2WXRA 4LNOA 4S0RA 1L0XB 4RGMA 1YN3A 2MHJA 3ZJTA 2AL6A 4HPPA 4AJYB 1ZP0B 3QCAA 1UGJA 4IM3A 1FEHA 3UIPB 3U2SC 3O65B 2M0XA 5LXHA 4J3OD 1VJKA 2GBKA 2YEPB 4YTPB 3EHVA 3GS2A 4CYEA 1FNUA 3RNGC 1ZKHA 2O2VA 4JPSA 2LXAA 4AP4C 1OEYA 1WGGA 2CJOA 1STEA 2KACA 3M62B 3ZQ4A 1MG8A 1FRRA 2L32A 4URKA 2WHIA 2CU3A 2H88B 2K8BA 2PIAA 4C4VA 4XX5A 2KWUB 2EKEC 3VUXA 2LRWA 1ZGUB 2W55A 2KX0A 4YL8A 1IGCA 1C77A 2Z0EB 2BW2A 2WXGA 2BB5A 2DX5B 2NMQA 1C78A 1TS5A 4AWJA 4GB9A 1FNWA 4HPLB 3A9JA 4GSWA 2LXCA 2N7EA 1UBIA 2IZVB 2VZKD 3PSEB 2N0SB 2XNAC 1D5XC 2KQ4X 3ZW3A 4W9KA 3BWUD 1QOAA 2K8CA 5FR3A 2BS4B 1PDXA 4HDQA 1IBXA 1E8XA 2N9KA 3I5JC 1YQBA 4P7IA 1QOGA 2C9WB 1I4HA 3J9CA 2L83A 1FFVA 1A70A 2INDC 5G5GA 2K3UA 2JZZA 2QC8A 1N6ZA 2V4LA 3NRZA 4KKJA 2G4DB 4IDIA 3H1UA 2KMAA 4MACA 1HTOA 3ETRA 4XWTA 3AN1A 1I4XA 2SAKA 4MJSB 4PS7A 4QAYA 1MHXA 1FM0D 4HK2A 2BYTA 2PE6B 3QX1A 1V5TA 2WYQA 4D2KA 4DHJB 2D10A 2ZPNA 2MP2B 1VCBA 1P3QU 3MC8A 2AL3A 3VTVA 2FCNA 3LXFA 1RM6C 3PRMB 2JX5A 1TGZB 2C60A 4ZRKA 2WU5B 3VRBB 4C7ZA 3T3NA 2MLBA 4C56C 5HKHA 1SIFA 5AZFA 1TKGA 3VQIA 2QCZA 4DK5A 2LMCA 2ZW1A 5IOIA 1F2RI 4C00A 2K6QA 3ZVVA 4DWFA 3NZUA 4FJZA 2MWSB 5MPOA 2QJLA 2N4FA 4A3PA 1WI0A 3ZXRA 1TS2A 3ONSA 3ZKJC 4NNJB 2A5UA 3MC0B 3NY5A 4OZAA 4YSXB 4XYCA 3RCZA 2DYBA 4C80A 1WX7A 2WDRB 3ZNZB 1UH6A 2G45B 4M8NA 4BOZB 4MGZE 1L0YB 1WGYA 1NEKB 4FBJB 1V5OA 3DBHB 4TMAB 1JWAD 4XGAB 2LHDA 2BS2B 4G11A 4RFBA 4ARIA 4CQNA 2N1WA 2BWES 4IKGA 3HVZA 1MHHE 5LNK1 3W9CB 3FAHA 2JUOA 3ENEA 1NDDA 2LUEA 4JL9A 4PS3A 1PUTA 2N9XA 1FIQA 3H7SA 1JROA 3H8HA 3ZNID 2DHZA 1F1HA 1I4PA 1WGDA 1OGWA 1T0SC 2INPE 1OQRA 4KGRA 3BINA 2BPSA 5EE3A 5EDSA 2J53A 1L6UA 2INCC 3A1QB 4O1NA 2XK5B 4F7ZA 5DPSA 2NBUA 4WWOA 4DXGA 4ZOHC 3QWZB 2J0KA 3L16A 1V86A 5L95C 1HZ6A 3MJ5A 1FD6A 1FFUA 4REZA 1EWCA 5BYRA 2KC2A 2MQJA 1L2NA 1XXGA 4OZCA 1F2RC 2CR5A 2D3GA 3X23A 4P1CC 4WAAA 1WJ4A 3RN9C 2JU6X 1WRDB 4RF1A 3Q3MC 1GPXA 3LJ3A 1XLPA 5LLIA 2LFIA 2QIEB 1WXQA 1KRHA 1WXAA 4HEA1 2MRPA 3U7DA 1ZE3D 2LGIA 4GMVA 4W9IA 3VVWB 1HZ5A 4NAWB 1P1AA 1TS3A 2DYOA 3P42A 3W1SC 1XT9B 3GOEA 2QILA 3KQ4A 1E8ZA 2I2YA 1PGBA 4P1BC 1VD2A 2KJRA 1QZEA 4GGQA 1OFFA 1PYWD 2KD0A 1I4GA 2PEAA 3DBLB 1N62A 1LFDA 1SXTA 1Q0WB 4R3DA 4TUUA 4W9LA 2J42A 3APFA 5HI1A 3AE3B 1R4MI 2KDMA 2IO1B 5E6JA 4K81A 4HPMB 3R7RA 4G0NB 2WXPA 3AE9B 3V62A 2I38A 1ACCA 3IAM1 4GIVA 4ANVA 4WIPA 1RFKA 2UWQA 1WMHB 2D5GA 1JMLA 1PFDA 3KLSX 2L0TA 3P4SB 2O6VD 1TYGB 4HKQA 1WRIA 4JWUC 2NTSA 1EO6A 4N58A 2DZIA 4L23A 1FO4A 2JZPA 2V3PA 4CHKA 1T5XD 3RUIB 3KW5B 3P1MA 2BWFA 4KDIC 2IDYA 1VLBA 2RGFA 5J2RA 2KWVB 2KO3A 4TKNA 3E9SA 1GG3A 2V0GA 2KK8A 2V9HA 1WZ3A 1J0GA 4MH0E 4MGKE 4WJQA 1QOFA 1ZOYB 3V3XA 2ZZPB 1SB3C 3PPAA 1F0ZA 5TR5A 1GOZA 3V6EB 1HXYD 4MH8A 4JX1C 1Q10A 1E8YA 1I4RA 5E6NA 2LGXA 2VZKB 5CHVC 2IO2B 2L0FA 3CMMB 4I6LB 2GLSA 4BKSD 2ZVOA 1BUIC 3L08A 2E6XA 1S1QB 1N61A 4B0MA 3CSTA 1E10A 3SHQA 3GP7A 2WDQB 2AQ1B 2KTFA 1Q5WB 4ASWC 5D3IB 1J19A 2CHZA 1E7UA 2WXKA 4NAWA 1V1PA 2G9HD 3KUZA 2BYEA 3VTWA 2GBJA 3GZNB 1WZ0A 2NBVB 3TEXA 1SSNA 1HQRD 3VRAB 4ICUA 4DQOC 1EUVB 3A9KB 2PW9A 4NZLB 3DBHI 5G2NA 1QOBA 1E5WA 2EELA 2KT7A 2WDTB 2Z8LA 4JLCA 1YX6B 2IGHA 1SE9A 2KFJA 3KWVA 3N30A 4KV2A 4S17A 3DOWA 4HVBA 3T3OA 1GJZA 3GB1A 3R2IA 4KIKA 4HWIB 2DENB 1SEBD 2AWTA 3BK1A 3H7PA 3Q8FA 4KGTA 2K1FA 1XQQA 3IBEA 3L13A 3DVGX 2FCQA 1KJTA 2KNBA 5JXVA 1UELA 4ANWA 2G1EA 3N1ZC 2JYEA 4FADA 4OVVA 2RPQA 4USAA 3DDCB 4K7WA 3VH4B 3VUWA 3CWIA 1D6EC 2KDBA 2JSVX 2Z0DB 1GB4A 3DPDA 3V05A 4ANXA 4HXDA 1UNSA 3ML8A 1RLFA 4GDKA 1Y56A 4RMAA 3AE8B 3R8BA 1YIWA 4A3OA 1P7EA 2IO0B 3V60A 3HRDD 3IVFA 4YTNB 4K7UA 3C0RB 5IA7A 3NS1A 3UGBB 2HTME 3A33B 4A90A 1RFAA 5CHFA 2WXIA 5EE0A 2WXMA 1WMHA 4J6IA 1TT5B 2VRRB 3PLUA 3T9LA 2Y5BB 4C4VB 1L6VA 3OG5A 3CSFA 1UD7A 2FUHB 5C1ZA 4GU2A 4Q2JA 1IP9A 2LGDA 3LB8C 1L4ZB 4N59A 3OLMD 1ET9A 4OZBA 1K50A 1N5WA 1YJJA 3ZUNA 4LDTD 3W1YA 1OQQA 4ZRPA 4MEMA 4JE3B 1B9RA 4X57B 1I35A 1KFYB 3PZ7A 2MA9B 1K52A 3DBRB 2ZCBA 3N9YC 5C23A 4NQKE 3Q8BA 4LJOB 1JWBD 3PZDA 2W3SA 3AECB 3N3KB 3QAQA 1JWUD 3WA0A 4GLSC 5D6JB 3R7QA 1P0RA 3AE1B 2LGSA 1MFWA 4US9A 1E0ZA 4BVUC 2GBMA 5AZGA 2E3TA 2IBIB 3X0WA 1AYFA 2DLBA 1ISNA 1VZ7A 1V81A 1QF6A 3B9JA 1WJ6A 3EECA 4KIKB 1XF5L 3HHMA 3PGEA 4IC7B 3NVWA 3EGRA 1NI2A 3FILB 2JRIB 3SR6A 1RYJA 2QEJC 4B9KA 2WQYB 2I1KA 1VDVA 2DNFA 2RD0A 5J17A 4DXAB 4MJSA 2UU7A 2JWUA 1QQRA 3DVGY 1OEYJ 2D11A 3HUIA 4MGIE 2J7QB 1TIFA 2M56B 2WGSA 1WIAA 4FXCA 1WWTA 2IGDA 3VAWA 2K8HA 4RF0A 2KANA 3W5VB 2RR9A 1L7YA 3L4PA 2I1JA 1JW9D 4W9DA 2MJEA 3AULA 4OW0A 5D7GA 1RRBA 3K9OB 2MJDA 4JWSC 1WE7A 5BYQA 2FAZA 2D07B 1WY8A 4NY0A 3RFZB 2W3RA 1XLNA 3L54A 3OAWA 1D3ZA 1IGDA 3QK0A 2G4SA 3TSSA 1J7CA 4IWQA 1WYGA 2WP9B 2DZKA 4EOYA 2LVOA 2PVGC 1GAQB 2ASQA 4P16A 1TKYA 4HKZE 1YJ1A 4WWPA 4DDGD 4A6QA 1KOTA 2EKIA 4PK1A 1C1YB 1H8CA 2AX5A 3PLVA 4L2YA 2GI9A 3OWEB 1YJIA 1K51A 3I57A 2B3AA 1E6EB 5AZHA 3M63B 2Y5CA 3D32A 2LEKA 4EFOA 3ZRFA 3VFKA 3WANA 3KUDB 2ONQA 3QJZA 5AUIA 2RDGA 2WXFA 4WQMA 4IOIE 3B1LX 1VZ8A 3TBLD 3HVDA 1D5MC 1SBBB 2QSDA 4EZJA 3BVZA 1BXTA 2L7RA 1NENB 3VUYA 2K39A 2JRHA 3BK2A 5IAAC 4OVUA 3P4PB 4RM8A 3IAS1 3AE2B 4GXBA 2L1AA 4K7SA 2KVRA 4YT0B 1WJNA 1MI0A 3AEEB 2MBBB 3EUB2 3A4SC 1EF5A 1WE6A 4NJ6A 1OQYA 4LTUA 3PO0A 5LXIB 2BQQA 4A9AA 1LM8B 1NYRA 3PRZA 1NBFC 4WH4A 4B6WA 2AYOB 3Q8CA 2L05A 1C4CA 3NZ3A 1R4NB 2IGGA 1KTKA 2LZ6A 1JCKB 5FR6A 2NTTA 2RDHA 2J0JA 1JRUA 2KMMA 2ACZB 2RMMA 2ZJDA 4WWNA 3Q3FA 4XZ4A 3T8MA 1LO5D 4M01A 2YVCA 2OJWA 3AE5B 3Q6BA 2C7NB 4GDLB 1UGMA 4FLHA 2WXJA 4WJNA 3ZNHB 2LJ5A 5E6PA 3TCAA 4DHZB 1JQ4A 4ZHPA 1SE2A 3Q8EA 4KGSA 1IUEA 1ROEA 3QA8A 2LVPA 2NVUI 4LCDE 4KVGB 5DPTA 4XC2A 3KYCD 3GE8C 1YQ4B 1S3SG 3NHEB 1XEEA 3DQVA 4BKTA 3GZNI 2MW5A 4NJCA 4XDCA 5IO9A 4RCOA 4IM2A 3PHXB 1SJHD 1PGAA 3EFCA 1WX8A 1AW7A 2KTRB 1TBEA 1CQVA 3KVFB 1QT9A 3ZDMC 2ZEQA 3ZLZA 4W9JA 4NAMA 4FULA 1LQBA 1E7VA 3RMKC
chains in the Genus database with same CATH topology
1STEA 5D3IB 3IXSA 2AQ2B 2KACA 3ZQ4A 3SFDB 2WXKA 5EE1A 2MH7A 2ICIA 1FRRA 1V1PA 3Q69A 2G9HD 2L32A 4RH6A 4OHJA 2CU3A 2L52A 1KLGD 1TKEA 2H88B 2PIAA 2W54A 1XLQA 1FNVA 1L0VB 1ZXIA 3TEXA 2W55A 1JWSD 2H89B 2KAJA 2WXOA 2Y5PA 1SSNA 2K22A 1HQRD 3VRAB 1SJED 1L4DB 4L1BA 1IGCA 1C77A 3MHZA 4DQOC 3SEBA 2BW2A 2PW9A 2WXGA 2BB5A 3P63A 4NZLB 3SFEB 2DYMA 1QOBA 2EELA 2NMQA 1C78A 1TS5A 1FNWA 2LUMA 2Z8LA 2IGHA 2VZKD 4KKIA 2N0SB 3KWVA 2XNAC 4TQ1A 1D5XC 2XN9C 1KF6B 3T3OA 2KQ4X 3GB1A 3R2IA 1YQ3B 3BWUD 1QOAA 1SEBD 3BK1A 5FR3A 2BS4B 1PDXA 2WLBA 3Q8FA 4KGTA 1IBXA 1JALA 3AEFB 3I9V1 3P4QB 2GRIA 2N9KA 3VR9B 2JXTA 1I4QA 1CZPA 2ON8A 2HDEA 5JXVA 1QOGA 1I4HA 1SE3A 2G1EA 4A8XC 1ZXHA 3J9CA 2L83A 3FC4A 1FFVA 2JYEA 5AUKA 1A70A 4USAA 1MVKA 4YTMB 3KWLA 5G5GA 2K3UA 4XWWA 3CWIA 1M4VA 3NRZA 2WXHA 4KKJA 1T3QA 3ZGZA 1TZOA 1QILA 4IDIA 4RNAA 2K9XA 1D6EC 2IPKD 4MACA 3E56A 3ZYYX 2JSVX 3ETRA 4XWTA 3AN1A 3MP9A 5BMGA 1GB1A 1I4XA 2SAKA 1GB4A 3V05A 3BVGA 1MHXA 1FM0D 5FKAC 1UNSA 2BYTA 5D3DA 4AS1A 2N7JA 1Y56A 1WSPA 3AE8B 4D2KA 3R8BA 3ZJUA 1FXAA 3AMZA 2WDVB 1P7EA 3LXFA 1RM6C 2JX5A 3HRDD 4UDUC 3AE6B 1D5ZC 1VR9A 4YTNB 1C9FA 2WU5B 3VRBB 3DWGC 4C7ZA 3ABVB 3NS1A 3T3NA 2HTME 4A90A 4C56C 1NVID 3AEAB 1NI3A 2WXIA 5EE0A 1TS4A 2WXMA 1SF0A 1TKGA 3VQIA 2KN4A 2KWDA 1NYQA 5EE9A 1J7BA 5BYSA 4B0EA 2LMCA 2ZW1A 4XDDA 1EWYC 1F2RI 2QMTA 1L6VA 3AE7B 3MFGA 4ARCA 2YEPF 3AEGB 1YN4A 1C4AA 3BVMA 2AQ3B 2MEKA 2PMVA 3LB8C 4Q2JA 2V4IB 1L4ZB 4N59A 1RWSA 5MPOA 1ET9A 4OZBA 1K50A 1N5WA 1YJJA 2QJLA 1OQQA 4ZRPA 4MM3B 4ZYSA 1TS2A 4JE3B 1B9RA 2FE8A 1E7PB 1HA5A 1KFYB 3PZ7A 4TQ0A 2ZW0A 2BS3B 3MC0B 1K52A 4ZRQA 5I4DA 4OZAA 2JQRB 3N9YC 4YSXB 3Q8BA 1EU4A 2K0PA 1JWBD 3AV8A 3AH7A 4C80A 2W3SA 3AECB 2WDRB 2OHFA 1JWUD 2N9LA 1L0YB 4GLSC 1WGKA 1NEKB 2W82A 5TSSA 2LHEA 4TMAB 3WCQA 3AE1B 1JWAD 4US9A 2LHDA 1ET6A 2BS2B 2J4XA 2V3NA 4RFBA 4ARIA 4HJGE 1E0ZA 2WXQA 1YMHE 5GXGB 2WNMA 4WAFA 1YN5A 1V8CA 3Q8AA 4CQNA 4IKGA 5H92C 3HVZA 1MHHE 2JYTA 3DWMA 2E3TA 1PGXA 3CIRB 5LNK1 1QKZA 3W9CB 3FAHA 1TJEA 4US8A 1AYFA 1XO3A 2DLBA 1VZ7A 1PUTA 1FIQA 1QF6A 1R7SA 3B9JA 1JROA 3FILA 3H8HA 4HRSA 1TY0A 5BMHA 3EA6A 1L5PA 2LJIA 1C79A 4ITKA 4WWMA 1I4PA 1XF5L 3VR8B 3NVWA 2K5PA 3EGRA 2INPE 3FILB 1OQRA 5HHDG 4KGRA 3SR6A 5EE3A 1RYJA 2QEJC 1FMAD 1BMLC 3IT6B 2WQYB 2J53A 1L6UA 1VDVA 4C7YA 3BYYB 3W2DA 4O1NA 1UWMA 3W1SA 2M0AA 1JWMD 1HEZE 2R61A 2JWUA 1QQRA 3BZDB 3BIID 1VRAB 4N6EB 3LYYA 4HROA 1ESFA 1KH0A 4DXGA 2Q5WD 3HUIA 4ZOHC 1QLBB 2X38A 2M56B 1HZ6A 4FXCA 1MPEA 3MJ5A 1FD6A 1E9MA 1WWTA 2IGDA 3IT4B 1UWXA 1FFUA 4REZA 4RF0A 1UUPA 1EWCA 5BYRA 3W5VB 4RGOS 1FCCC 4WURA 1XXGA 3L4PA 4OZCA 1F2RC 1DYQA 1JW9D 2B76B 5C3JB 1ZDVA 2MJEA 4OW0A 5D7GA 1CK1A 4GDKB 5HI1A 2MJDA 2JU6X 4JWSC 4RF1A 1DOXA 5BYQA 2PTLA 3P4RB 4OVZA 3NUHB 1GPXA 3TEZA 3RFZB 1XLPA 2W3RA 1XLNA 1IGDA 2LFIA 2QIEB 1WXQA 4MT5A 4RGNA 3R2TA 3TSSA 1J7CA 4PT5A 1WYGA 1KRHA 2WP9B 5FK9C 4HEA1 5HG2A 1ZE3D 2LGIA 2PVGC 1GAQB 2MJ3A 4P16A 4RGTA 1TKYA 1YNTE 1HZ5A 2SEBD 2J52A 4M0WA 4NAWB 4HKZE 1FRDA 3B2GA 1TS3A 2DYOA 3P42A 4A6QA 2EKIA 3C8YA 3TUOA 1KLUD 2QILA 3KQ4A 2I2YA 3W5UB 1PGBA 1XCTL 2AX5A 4L2YA 1N63A 2GI9A 3OWEB 1YJIA 3URYA 1OFFA 1PYWD 1K51A 2PKOA 2PLPA 3B2FA 4YSYB 3I57A 1I4GA 2CJNA 1E6EB 1XLOA 2Y5CA 4A55A 1N62A 1J7AA 2LEKA 1V1PB 2IJ0A 1IBXB 1SXTA 1B1ZA 4R3DA 3RPFC 2J42A 3TEYA 2ONQA 5AUIA 2RDGA 3NVYA 1SE4A 2WXFA 2OEDA 3AE3B 1VZ8A 4IOIE 1SIJA 2TSSA 2KDMA 4WQMA 3HVDA 1D5MC 5E6JA 1SBBB 2QSDA 3BVZA 1BXTA 2RPVA 4YSZB 2WXPA 1C4PA 1K53A 1NENB 3AE9B 2I38A 1ACCA 3IAM1 1V1OA 1CJEA 4WIPA 3BK2A 1AWDA 1RFKA 1ZUD2 2INNE 2BB6A 4P6VF 2D5GA 1JMLA 1PFDA 4KX6B 3P4PB 3IAS1 3AE2B 1DOYA 3NVZA 2L1AA 2WS3B 1ENFA 3KLSX 5BMIA 3P4SB 4YT0B 1N5XA 1DOIA 1TYGB 1MI0A 3AEEB 4HKQA 5C2TB 3EUB2 1WRIA 4JWUC 2NTSA 1DGJA 4N58A 4LTUA 4LLGM 1ZPSA 3PO0A 4L23A 2BBCA 5T8IA 4A9AA 2DBYA 4EE2A 2WU2B 1NYRA 2M19A 3AEDB 1FO4A 4YXDB 2WXNA 5H8YE 2JZPA 3AE4B 4WH4A 2V3PA 3UI3A 1T5XD 1T6BX 3P1MA 4H2AA 3Q8CA 1FXIA 3U52E 1V97A 1C4CA 3NZ3A 2IDYA 2PVOD 2IGGA 1VLBA 1KTKA 1JCKB 2DWQA 1XCQL 2NTTA 1N60A 3E9SA 2RDHA 5G5HA 4ZHOA 2KMMA 2V0GA 2ACZB 2RMMA 4TSSA 1VZ6A 2GB1A 3O13A 3TEWA 3AM9A 3ZJVA 2Y3AA 1JRPA 1LO5D 4XE0A 5HFYA 2WXLA 3AE5B 3PZ8A 4GDLB 1QOFA 1ZOYB 2WXJA 3V3XA 2BT6A 3BYTB 4DXFA 3AEBB 1SB3C 1EU3A 1JQ4A 1F77A 4ZHPA 1SE2A 3Q8EA 4YWGG 3U7ZA 1F0ZA 4KGSA 3AB5A 1IUEA 1D4BA 1ROEA 1GOZA 3NVVA 1P7FA 2WXRA 4AQ7A 1L0XB 4RGMA 1HXYD 4LK0M 1C76A 1YN3A 1YQ4B 4JX1C 4MH8A 1XEEA 3U4EG 3ZJTA 1Q10A 1I4RA 4NJCA 4XDCA 1TY2A 2BTEA 2VZKB 1ZP0B 4RCOA 1UGJA 1FEHA 2FUG1 1SJHD 3U2SC 1PGAA 4J3OD 1VJKA 1ZDXA 2YEPB 4YTPB 1AW7A 2FBWB 1BUIC 3GS2A 1CQVA 2E6XA 1N61A 1FNUA 1QT9A 4B0MA 1I7HA 4JPSA 1E10A 3GP7A 1EM7A 2WDQB 2AQ1B 4NAMA 1FCLA 1AN8A 2CJOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YTN B;  2WS3 B;  2WU5 B;  3VRB B;  3DWG C;  4C7Z A;  3ABV B;  3NS1 A;  3P4S B;  4YT0 B;  5EE1 A;  1N5X A;  2HTM E;  2MH7 A;  1FRR A;  3BII D;  1NVI D;  1DOI A;  1TYG B;  3AEA B;  1NI3 A;  4N6E B;  2CU3 A;  4HRO A;  3AEE B;  2L52 A;  5EE0 A;  1TKE A;  2H88 B;  3EUB 2;  1WRI A;  2PIA A;  2Q5W D;  4JWU C;  5C2T B;  3HUI A;  2W54 A;  1DGJ A;  1SF0 A;  1XLQ A;  4N58 A;  1TKG A;  4ZOH C;  1L0V B;  1QLB B;  1ZXI A;  4LTU A;  1NYQ A;  2W55 A;  1J7B A;  2M56 B;  2H89 B;  2KAJ A;  3PO0 A;  5EE9 A;  4FXC A;  1E10 A;  2K22 A;  4A9A A;  1E9M A;  1EWY C;  2DBY A;  1WWT A;  3VRA B;  3SFD B;  1L6V A;  2WU2 B;  1FFU A;  1NYR A;  2M19 A;  3AE7 B;  3AED B;  1FO4 A;  4YXD B;  5H8Y E;  3P63 A;  3SFE B;  3AE4 B;  3AEG B;  3W5V B;  1QOB A;  3L4P A;  3P1M A;  1FXI A;  3LB8 C;  1V97 A;  1JW9 D;  2B76 B;  5C3J B;  2MJE A;  1RWS A;  2PVO D;  4N59 A;  5MPO A;  1VLB A;  1YJJ A;  1N5W A;  2N0S B;  2QJL A;  2MJD A;  4JWS C;  1OQQ A;  2DWQ A;  1DOX A;  5G5H A;  1KF6 B;  1N60 A;  3P4R B;  4ZHO A;  3HRD D;  2KMM A;  1B9R A;  2ACZ B;  1GPX A;  1YQ3 B;  1E7P B;  1QOA A;  1XLP A;  2W3R A;  1XLN A;  1KFY B;  2BS4 B;  1PDX A;  2WLB A;  3AM9 A;  2QIE B;  1WXQ A;  2BS3 B;  1JAL A;  1JRP A;  1J7C A;  2JQR B;  3AEF B;  4YSX B;  3P4Q B;  1WYG A;  1KRH A;  3AE5 B;  2WP9 B;  3VR9 B;  1JWB D;  3AV8 A;  3AH7 A;  1CZP A;  2W3S A;  3AEC B;  4C80 A;  2PVG C;  2OHF A;  1GAQ B;  2MJ3 A;  2WDR B;  1QOF A;  1QOG A;  1ZOY B;  1TKY A;  2BT6 A;  2G1E A;  1FRD A;  1WGK A;  1NEK B;  1SB3 C;  2L83 A;  3AEB B;  3B2G A;  3FC4 A;  1FFV A;  3WCQ A;  2EKI A;  3AE1 B;  1JQ4 A;  5AUK A;  4ZHP A;  1JWA D;  1A70 A;  4USA A;  4US9 A;  4YTM B;  2BS2 B;  3KWL A;  3W5U B;  1F0Z A;  5G5G A;  3AB5 A;  1IUE A;  2AX5 A;  1E0Z A;  1ROE A;  5GXG B;  1N63 A;  3CWI A;  3NVV A;  1YJI A;  1V8C A;  3NRZ A;  1T3Q A;  1OFF A;  2PKO A;  4IDI A;  2K9X A;  3B2F A;  4YSY B;  5H92 C;  2CJN A;  3HVZ A;  3DWM A;  1E6E B;  2E3T A;  1XLO A;  3NVZ A;  2Y5C A;  4JX1 C;  1YQ4 B;  3CIR B;  3ZYY X;  1N62 A;  1J7A A;  2LEK A;  3ETR A;  3AN1 A;  3W9C B;  3FAH A;  1TJE A;  3RPF C;  4US8 A;  1AYF A;  1XO3 A;  5AUI A;  3NVY A;  1PUT A;  1ZP0 B;  1FM0 D;  1FIQ A;  3AE3 B;  1R7S A;  1SIJ A;  1JRO A;  3B9J A;  4WQM A;  1QF6 A;  4HRS A;  1L5P A;  4ITK A;  4WWM A;  3VR8 B;  1VJK A;  3NVW A;  4YTP B;  2K5P A;  4YSZ B;  3AE8 B;  1NEN B;  1OQR A;  2FBW B;  3AE9 B;  3SR6 A;  3AE2 B;  5EE3 A;  1N61 A;  1RYJ A;  1QT9 A;  1CJE A;  1FMA D;  1FXA A;  2WQY B;  1AWD A;  1I7H A;  1RFK A;  1ZUD 2;  2WDV B;  3AMZ A;  3LXF A;  4P6V F;  1L6U A;  1RM6 C;  2WDQ B;  1PFD A;  1VDV A;  4KX6 B;  2JX5 A;  3P4P B;  4C7Y A;  1DOY A;  2CJO A;  1UWM A;  3AE6 B; 
#chains in the Genus database with same CATH topology
 3IXS A;  3SFD B;  2ICI A;  4RH6 A;  4OHJ A;  1YX5 B;  2BYF A;  2L52 A;  3U30 A;  1XLQ A;  1Q1O A;  3RT3 B;  1FNV A;  2KZR A;  1L0V B;  1GC7 A;  2H89 B;  2WXO A;  3B0A A;  2Y5P A;  2K22 A;  1SJE D;  3P63 A;  2DYM A;  2IO3 B;  4JIO U;  2FID A;  2LUM A;  1WM3 A;  4EKU A;  4KKI A;  1EF1 A;  4TQ1 A;  1T0Y A;  2GBR A;  1KF6 B;  4IWO A;  2LAS A;  3ZTD A;  1WYW B;  2WLB A;  3N20 C;  3MC9 A;  3UF8 A;  1JAL A;  3NZS A;  3AEF B;  1Y8R C;  3P4Q B;  2GRI A;  4M00 A;  3VR9 B;  2JXT A;  4DBG A;  1I4Q A;  1RAX A;  1CZP A;  4KZC A;  5AUK A;  5G55 A;  1MVK A;  4GDL A;  2FIF A;  2MBE A;  2WXH A;  4LNI A;  3ZGZ A;  1TZO A;  1QIL A;  4RNA A;  5JH5 C;  2IPK D;  3QC8 B;  1GB1 A;  2ZPY A;  4KDL B;  4DHJ D;  3BVG A;  1G6J A;  3RZF A;  5FKA C;  5D3D A;  4AS1 A;  2GOW A;  3JSV A;  4HLE A;  4ANU A;  3C19 A;  2IYD B;  3ZJU A;  2PJH A;  3KYD D;  4NPN A;  3AMZ A;  4I6P A;  3DHG C;  2N7D A;  1D5Z C;  1VR9 A;  3DWG C;  3UQB A;  1NVI D;  1NI3 A;  2BF8 B;  1HTQ A;  1WXS A;  1TS4 A;  2KMC A;  1SF0 A;  2KN4 A;  5EE9 A;  1NYQ A;  1J7B A;  5BYS A;  2N1V A;  4B0E A;  2HD5 B;  4M0W B;  3RD2 A;  1BT0 A;  3MFG A;  4ARC A;  2YEP F;  3AEG B;  3RNF C;  2KX3 A;  2NCN A;  1LXD A;  1R4M B;  1YN4 A;  3RNA C;  3BVM A;  4NQL B;  4EZL A;  3DVN U;  2RDB C;  4A20 A;  2KLG A;  1V49 A;  4ZYS A;  2PPH A;  1P98 A;  3NOB A;  1E7P B;  4JQW C;  1M94 A;  4MEL A;  3GE3 C;  4TQ0 A;  2BVC A;  1YOV B;  5I4D A;  2DZM A;  3HM6 X;  2JQR B;  3PVL A;  4ZDV A;  2KDE B;  4MM3 A;  2K0P A;  2K25 A;  2KFK B;  4II2 B;  5JHB A;  2DZJ A;  4MDK E;  1WGK A;  2W82 A;  3QQ8 B;  1MJD A;  2LHE A;  3WCQ A;  2D2Q A;  2LD9 A;  1WX9 A;  2DAF A;  2V3N A;  4HJG E;  2WXQ A;  1YMH E;  4WAF A;  3WAO A;  1YN5 A;  1V8C A;  3Q8A A;  5D2M B;  5H92 C;  2GMI C;  3DWM A;  3CIR B;  3PRP B;  4W9H A;  2ZVN A;  2M17 A;  1TJE A;  2L76 A;  2NPT A;  1J8C A;  4G3X B;  3ZO5 B;  4HRS A;  3UIN B;  3EA6 A;  1C79 A;  4WWM A;  5KHO A;  3PRE A;  2K5P A;  5HHD G;  3K9P B;  4ZRI A;  1UZX B;  3IT6 B;  4PYZ A;  4K3B A;  1UWM A;  2XBB C;  2V1Y A;  3MTN B;  2M0A A;  1JWM D;  2R2Q A;  2R61 A;  2M1M A;  3BZD B;  3BII D;  1VRA B;  4FN2 A;  4N6E B;  3LYY A;  4HRO A;  3KH0 A;  2KJH B;  1KH0 A;  1IPG A;  1QLB B;  2W9N A;  1E9M A;  4KSK C;  3IT4 B;  3PS6 A;  3ML9 A;  1K8R B;  3TJP A;  3KUC B;  4RGO S;  1FCC C;  4K1R B;  1ZW7 A;  1PQS A;  2KQS A;  2O2V B;  1YD8 U;  1DYQ A;  4LNK A;  5C3J B;  1ZDV A;  1HE8 A;  3EC8 A;  1CK1 A;  3S2A A;  4M02 A;  2OJR A;  2HE7 A;  2VH1 A;  2PTL A;  3P4R B;  3L17 A;  4GN1 A;  4OVZ A;  3VH3 B;  3TEZ A;  5JHA A;  4RGN A;  1U4A A;  3AXC A;  4PT5 A;  3RNB C;  4EEW A;  5HG2 A;  3VTU A;  4II3 B;  4LNF A;  4M0W A;  1YNT E;  4IUM B;  1GC6 A;  2WX1 A;  1FRD A;  3B2G A;  3TUO A;  1XCT L;  3H6N A;  2WWZ A;  2NS5 A;  1N63 A;  3MJW A;  2JWZ A;  2PLP A;  3VHT C;  2LGY A;  1UBQ A;  4BZA A;  1V1P B;  2V3S A;  1IBX B;  2WX0 A;  3TL5 A;  3DVN V;  4BKG A;  4MGY E;  3RPF C;  3TEY A;  3NVY A;  2CU1 A;  1SE4 A;  4F8C B;  2L8J A;  4BBN F;  2QDF A;  2ZCC A;  3ECI A;  4YSZ B;  4HCN B;  1C4P A;  1TZ1 A;  1GUA B;  1V1O A;  5KHQ A;  1AWD A;  1ZUD 2;  3APC A;  2BB6 A;  1F9J A;  2INN E;  4BFR A;  3N1X C;  1DOY A;  2C7M B;  2OOB B;  1WM2 A;  2JY6 A;  2KOX A;  3FKY A;  5C2T B;  1DGJ A;  3ZXV A;  3DCG A;  4LLG M;  1ZPS A;  3DHI C;  1X1M A;  5GMV A;  1TTN A;  4EE2 A;  4FHJ A;  1AAR A;  2M19 A;  2MX2 A;  5D94 A;  2WXN A;  5H8Y E;  2X8X X;  2MBH A;  3N32 A;  2HTH A;  3A1Q A;  2NR2 A;  4KZ0 A;  2KN5 A;  1XCQ L;  3QAR A;  5G5H A;  4ZHO A;  4TSS A;  2GB1 A;  3O13 A;  1CMX B;  3ZJV A;  5DCN A;  2Y3A A;  2CS4 A;  3A9J B;  3JYU A;  4FHK A;  4XE0 A;  5HFY A;  4CO7 A;  4WJP A;  4IWP A;  2BT6 A;  2JXX A;  4DXF A;  3AEB B;  2YLM A;  1EU3 A;  1F77 A;  2N9P C;  1D4B A;  3AB5 A;  3RYT A;  2G3Q B;  2LVQ A;  1WGR A;  4JGH B;  3AU4 A;  4AQ7 A;  2VH2 A;  3H7P B;  2CHW A;  2KXJ A;  4LK0 M;  2IY1 B;  3IHP C;  1C76 A;  1H4R A;  2R2O A;  3U4E G;  3ZRC A;  1TY2 A;  2BTE A;  3M3J A;  3MHS D;  2FUG 1;  2JVC A;  4W9E A;  1ZDX A;  2FBW B;  3P2B A;  2A4Z A;  1WFY A;  4I6N B;  1R4N I;  3L10 B;  1I7H A;  2KKC A;  3OJ3 A;  1EM7 A;  3R3M A;  3HIZ A;  3IG3 A;  1P9D U;  1FCL A;  1AN8 A;  5IN7 A;  2BKR B;  3A4R A;  2AQ2 B;  2FCS A;  4W9G A;  5EE1 A;  2MH7 A;  3Q69 A;  1KM7 A;  5IP4 D;  2MSE D;  1KLG D;  1TKE A;  2W54 A;  1ZXI A;  1JWS D;  2KAJ A;  2KYW A;  3TMP B;  4ACF A;  4L1B A;  1L4D B;  3MHZ A;  3SEB A;  4E71 A;  2JF5 A;  3SFE B;  3R66 C;  4WQO B;  2MCN B;  1E90 A;  3CF6 E;  2O6V A;  1WR1 A;  3JW0 X;  2XN9 C;  3TIX A;  5DPW A;  3I3T B;  1YQ3 B;  1V6E A;  4FA6 A;  4FJV B;  4E74 A;  3I9V 1;  1T0Q C;  4KSL C;  4E3C A;  3WIM A;  3PTF C;  2ON8 A;  4RM9 A;  2ZNV B;  2HDE A;  1SE3 A;  4A8X C;  1ZXH A;  3FC4 A;  3B08 A;  4YTM B;  3KWL A;  5CHW A;  4XWW A;  1M4V A;  1T3Q A;  2K9X A;  3E56 A;  3ZYY X;  3MP9 A;  2XK5 A;  5BMG A;  3Q14 C;  2K6D B;  1Z5S B;  3SU8 X;  4AUQ C;  3U8Z A;  2DAJ A;  2N7J A;  1WSP A;  2AEH A;  1WXV A;  2LI5 A;  3WAL A;  4W9C A;  1FXA A;  2J0M A;  2WDV B;  1V80 A;  2BGF A;  3WAM A;  4UDU C;  3AE6 B;  1C9F A;  4LJP B;  3ABV B;  3AEA B;  3L0W B;  2QHO A;  5CX3 A;  4PYU A;  5L83 A;  1KLV A;  2KWD A;  2M4N A;  4XDD A;  1EWY C;  2QMT A;  3AE7 B;  3DHH C;  3V61 A;  2BKF A;  3BY4 B;  1T0R C;  1C4A A;  2AQ3 B;  2MEK A;  2PMV A;  2V4I B;  1RWS A;  3DBL I;  1F52 A;  3PT2 B;  3PV1 A;  4MM3 B;  3VXW A;  3UIO B;  4GOC A;  3OJ4 B;  3APD A;  3WAP A;  2FE8 A;  1WH3 A;  1HA5 A;  3RNC C;  2KTR A;  2ZW0 A;  2BS3 B;  4HDO A;  4ZRQ A;  2Z59 B;  3N1Y C;  1OTR B;  1EU4 A;  4MSQ B;  3AV8 A;  3AH7 A;  2OHF A;  4AJW A;  4N9F 4;  3SDL C;  1WXM A;  2N9L A;  3QHT A;  5TSS A;  4K3C A;  2JPH A;  1ET6 A;  2J4X A;  5GXG B;  2WNM A;  4DHZ E;  2MP2 A;  2C5L C;  4F1S A;  3ZDT A;  1WR6 E;  3JSV B;  1E8W A;  1WJU A;  2BYV E;  2FNJ B;  2JYT A;  4AOF A;  1PGX A;  4M8M A;  2GBN A;  3RZW C;  1QKZ A;  4WJO A;  2KHW B;  3UQA A;  2EMT A;  4US8 A;  3ZNG C;  2MBQ A;  1XO3 A;  2ZNV C;  1R7S A;  3FIL A;  4G50 A;  1TY0 A;  2KVZ A;  5BMH A;  1L5P A;  2LJI A;  4ITK A;  3VR8 B;  2EMS A;  1WF9 A;  4BKS A;  2KJ6 A;  2O6V B;  4EUT A;  4W9F A;  1FMA D;  1BML C;  3PHW B;  2D3B A;  4C7Y A;  2XEW A;  3BYY B;  3W2D A;  3W1S A;  3AU5 A;  1HEZ E;  2N9E B;  3EFU A;  1ESF A;  2Q5W D;  3Q3O C;  3RNE C;  2X38 A;  4IM0 A;  5J18 A;  1MPE A;  2KWC A;  1UWX A;  1UUP A;  4NJ7 A;  4TV3 A;  3ZTC A;  4WUR A;  2B76 B;  3NG0 A;  2NPT B;  4GDK B;  5CTR C;  2HJ1 A;  4FJY A;  2MBO A;  1DOX A;  4EZK A;  3NUH B;  2JT4 B;  4LNN A;  2KLC A;  4MT5 A;  2C7H A;  3R2T A;  1Z2M A;  1FXT B;  1UF0 A;  2PE9 A;  1MG4 A;  2NBW B;  5FK9 C;  4BBN C;  2HJ8 A;  4PS8 A;  2MJ3 A;  4BAX A;  5JZE B;  4RGT A;  3RUL A;  3IFW B;  2SEB D;  2J52 A;  2D3C A;  3Q2A C;  3C8Y A;  1KLU D;  3LDZ E;  2CHX A;  4ZRJ A;  2KFK A;  5IKC M;  3W5U B;  3URY A;  2KC1 A;  2PKO A;  2KDI A;  3B2F A;  4YSY B;  2CJN A;  4IG7 B;  1XLO A;  4HJK A;  4A55 A;  1J7A A;  3HK0 A;  2IJ0 A;  1WGH A;  1B1Z A;  1IYF A;  5DPR A;  3H9D A;  3NS8 A;  2OED A;  1SIJ A;  2TSS A;  1SGH A;  3JVZ X;  3DBR I;  2KDF B;  2RPV A;  3HM3 A;  4IW0 A;  2UYZ B;  1K53 A;  1V9J A;  1CJE A;  1LGR A;  2LWP A;  3ZIM A;  3SD5 A;  4P6V F;  4KX6 B;  1V2Y A;  4MSM B;  3NVZ A;  2WS3 B;  3VDZ A;  1ENF A;  2CKH B;  5BMI A;  2FCM A;  1N5X A;  1DOI A;  3DBS A;  1C3T A;  3M95 A;  3Q3J A;  2BBC A;  5T8I A;  2DBY A;  3NJT A;  2KQ7 A;  4DDI D;  2WU2 B;  3AED B;  3AI5 A;  4YXD B;  3V6C B;  5BO4 B;  3AE4 B;  2D3A A;  3UI3 A;  1T6B X;  4H2A A;  2LRU A;  1FXI A;  3U52 E;  1V97 A;  1FPY A;  2PVO D;  4BOS C;  1XD3 B;  1I42 A;  2DWQ A;  5E6O A;  1N60 A;  2L3Z A;  3RI7 C;  1VZ6 A;  2RSU A;  2REX A;  4HCP B;  3TEW A;  3AM9 A;  3Q3N C;  3QIJ A;  1JRP A;  1A5R A;  1GNU A;  2WXL A;  3ALB A;  4ZYN A;  3PZ8 A;  3I63 C;  2JZ3 B;  2L00 B;  4ICV A;  3A9K A;  2M8S A;  3BYT B;  4B95 A;  5AEK B;  4YWG G;  2IY0 B;  3U7Z A;  3NVV A;  4LDT B;  1P7F A;  2WXR A;  4LNO A;  4S0R A;  1L0X B;  4RGM A;  1YN3 A;  2MHJ A;  3ZJT A;  2AL6 A;  4HPP A;  4AJY B;  1ZP0 B;  3QCA A;  1UGJ A;  4IM3 A;  1FEH A;  3UIP B;  3U2S C;  3O65 B;  2M0X A;  5LXH A;  4J3O D;  1VJK A;  2GBK A;  2YEP B;  4YTP B;  3EHV A;  3GS2 A;  4CYE A;  1FNU A;  3RNG C;  1ZKH A;  2O2V A;  4JPS A;  2LXA A;  4AP4 C;  1OEY A;  1WGG A;  2CJO A;  1STE A;  2KAC A;  3M62 B;  3ZQ4 A;  1MG8 A;  1FRR A;  2L32 A;  4URK A;  2WHI A;  2CU3 A;  2H88 B;  2K8B A;  2PIA A;  4C4V A;  4XX5 A;  2KWU B;  2EKE C;  3VUX A;  2LRW A;  1ZGU B;  2W55 A;  2KX0 A;  4YL8 A;  1IGC A;  1C77 A;  2Z0E B;  2BW2 A;  2WXG A;  2BB5 A;  2DX5 B;  2NMQ A;  1C78 A;  1TS5 A;  4AWJ A;  4GB9 A;  1FNW A;  4HPL B;  3A9J A;  4GSW A;  2LXC A;  2N7E A;  1UBI A;  2IZV B;  2VZK D;  3PSE B;  2N0S B;  2XNA C;  1D5X C;  2KQ4 X;  3ZW3 A;  4W9K A;  3BWU D;  1QOA A;  2K8C A;  5FR3 A;  2BS4 B;  1PDX A;  4HDQ A;  1IBX A;  1E8X A;  2N9K A;  3I5J C;  1YQB A;  4P7I A;  1QOG A;  2C9W B;  1I4H A;  3J9C A;  2L83 A;  1FFV A;  1A70 A;  2IND C;  5G5G A;  2K3U A;  2JZZ A;  2QC8 A;  1N6Z A;  2V4L A;  3NRZ A;  4KKJ A;  2G4D B;  4IDI A;  3H1U A;  2KMA A;  4MAC A;  1HTO A;  3ETR A;  4XWT A;  3AN1 A;  1I4X A;  2SAK A;  4MJS B;  4PS7 A;  4QAY A;  1MHX A;  1FM0 D;  4HK2 A;  2BYT A;  2PE6 B;  3QX1 A;  1V5T A;  2WYQ A;  4D2K A;  4DHJ B;  2D10 A;  2ZPN A;  2MP2 B;  1VCB A;  1P3Q U;  3MC8 A;  2AL3 A;  3VTV A;  2FCN A;  3LXF A;  1RM6 C;  3PRM B;  2JX5 A;  1TGZ B;  2C60 A;  4ZRK A;  2WU5 B;  3VRB B;  4C7Z A;  3T3N A;  2MLB A;  4C56 C;  5HKH A;  1SIF A;  5AZF A;  1TKG A;  3VQI A;  2QCZ A;  4DK5 A;  2LMC A;  2ZW1 A;  5IOI A;  1F2R I;  4C00 A;  2K6Q A;  3ZVV A;  4DWF A;  3NZU A;  4FJZ A;  2MWS B;  5MPO A;  2QJL A;  2N4F A;  4A3P A;  1WI0 A;  3ZXR A;  1TS2 A;  3ONS A;  3ZKJ C;  4NNJ B;  2A5U A;  3MC0 B;  3NY5 A;  4OZA A;  4YSX B;  4XYC A;  3RCZ A;  2DYB A;  4C80 A;  1WX7 A;  2WDR B;  3ZNZ B;  1UH6 A;  2G45 B;  4M8N A;  4BOZ B;  4MGZ E;  1L0Y B;  1WGY A;  1NEK B;  4FBJ B;  1V5O A;  3DBH B;  4TMA B;  1JWA D;  4XGA B;  2LHD A;  2BS2 B;  4G11 A;  4RFB A;  4ARI A;  4CQN A;  2N1W A;  2BWE S;  4IKG A;  3HVZ A;  1MHH E;  5LNK 1;  3W9C B;  3FAH A;  2JUO A;  3ENE A;  1NDD A;  2LUE A;  4JL9 A;  4PS3 A;  1PUT A;  2N9X A;  1FIQ A;  3H7S A;  1JRO A;  3H8H A;  3ZNI D;  2DHZ A;  1F1H A;  1I4P A;  1WGD A;  1OGW A;  1T0S C;  2INP E;  1OQR A;  4KGR A;  3BIN A;  2BPS A;  5EE3 A;  5EDS A;  2J53 A;  1L6U A;  2INC C;  3A1Q B;  4O1N A;  2XK5 B;  4F7Z A;  5DPS A;  2NBU A;  4WWO A;  4DXG A;  4ZOH C;  3QWZ B;  2J0K A;  3L16 A;  1V86 A;  5L95 C;  1HZ6 A;  3MJ5 A;  1FD6 A;  1FFU A;  4REZ A;  1EWC A;  5BYR A;  2KC2 A;  2MQJ A;  1L2N A;  1XXG A;  4OZC A;  1F2R C;  2CR5 A;  2D3G A;  3X23 A;  4P1C C;  4WAA A;  1WJ4 A;  3RN9 C;  2JU6 X;  1WRD B;  4RF1 A;  3Q3M C;  1GPX A;  3LJ3 A;  1XLP A;  5LLI A;  2LFI A;  2QIE B;  1WXQ A;  1KRH A;  1WXA A;  4HEA 1;  2MRP A;  3U7D A;  1ZE3 D;  2LGI A;  4GMV A;  4W9I A;  3VVW B;  1HZ5 A;  4NAW B;  1P1A A;  1TS3 A;  2DYO A;  3P42 A;  3W1S C;  1XT9 B;  3GOE A;  2QIL A;  3KQ4 A;  1E8Z A;  2I2Y A;  1PGB A;  4P1B C;  1VD2 A;  2KJR A;  1QZE A;  4GGQ A;  1OFF A;  1PYW D;  2KD0 A;  1I4G A;  2PEA A;  3DBL B;  1N62 A;  1LFD A;  1SXT A;  1Q0W B;  4R3D A;  4TUU A;  4W9L A;  2J42 A;  3APF A;  5HI1 A;  3AE3 B;  1R4M I;  2KDM A;  2IO1 B;  5E6J A;  4K81 A;  4HPM B;  3R7R A;  4G0N B;  2WXP A;  3AE9 B;  3V62 A;  2I38 A;  1ACC A;  3IAM 1;  4GIV A;  4ANV A;  4WIP A;  1RFK A;  2UWQ A;  1WMH B;  2D5G A;  1JML A;  1PFD A;  3KLS X;  2L0T A;  3P4S B;  2O6V D;  1TYG B;  4HKQ A;  1WRI A;  4JWU C;  2NTS A;  1EO6 A;  4N58 A;  2DZI A;  4L23 A;  1FO4 A;  2JZP A;  2V3P A;  4CHK A;  1T5X D;  3RUI B;  3KW5 B;  3P1M A;  2BWF A;  4KDI C;  2IDY A;  1VLB A;  2RGF A;  5J2R A;  2KWV B;  2KO3 A;  4TKN A;  3E9S A;  1GG3 A;  2V0G A;  2KK8 A;  2V9H A;  1WZ3 A;  1J0G A;  4MH0 E;  4MGK E;  4WJQ A;  1QOF A;  1ZOY B;  3V3X A;  2ZZP B;  1SB3 C;  3PPA A;  1F0Z A;  5TR5 A;  1GOZ A;  3V6E B;  1HXY D;  4MH8 A;  4JX1 C;  1Q10 A;  1E8Y A;  1I4R A;  5E6N A;  2LGX A;  2VZK B;  5CHV C;  2IO2 B;  2L0F A;  3CMM B;  4I6L B;  2GLS A;  4BKS D;  2ZVO A;  1BUI C;  3L08 A;  2E6X A;  1S1Q B;  1N61 A;  4B0M A;  3CST A;  1E10 A;  3SHQ A;  3GP7 A;  2WDQ B;  2AQ1 B;  2KTF A;  1Q5W B;  4ASW C;  5D3I B;  1J19 A;  2CHZ A;  1E7U A;  2WXK A;  4NAW A;  1V1P A;  2G9H D;  3KUZ A;  2BYE A;  3VTW A;  2GBJ A;  3GZN B;  1WZ0 A;  2NBV B;  3TEX A;  1SSN A;  1HQR D;  3VRA B;  4ICU A;  4DQO C;  1EUV B;  3A9K B;  2PW9 A;  4NZL B;  3DBH I;  5G2N A;  1QOB A;  1E5W A;  2EEL A;  2KT7 A;  2WDT B;  2Z8L A;  4JLC A;  1YX6 B;  2IGH A;  1SE9 A;  2KFJ A;  3KWV A;  3N30 A;  4KV2 A;  4S17 A;  3DOW A;  4HVB A;  3T3O A;  1GJZ A;  3GB1 A;  3R2I A;  4KIK A;  4HWI B;  2DEN B;  1SEB D;  2AWT A;  3BK1 A;  3H7P A;  3Q8F A;  4KGT A;  2K1F A;  1XQQ A;  3IBE A;  3L13 A;  3DVG X;  2FCQ A;  1KJT A;  2KNB A;  5JXV A;  1UEL A;  4ANW A;  2G1E A;  3N1Z C;  2JYE A;  4FAD A;  4OVV A;  2RPQ A;  4USA A;  3DDC B;  4K7W A;  3VH4 B;  3VUW A;  3CWI A;  1D6E C;  2KDB A;  2JSV X;  2Z0D B;  1GB4 A;  3DPD A;  3V05 A;  4ANX A;  4HXD A;  1UNS A;  3ML8 A;  1RLF A;  4GDK A;  1Y56 A;  4RMA A;  3AE8 B;  3R8B A;  1YIW A;  4A3O A;  1P7E A;  2IO0 B;  3V60 A;  3HRD D;  3IVF A;  4YTN B;  4K7U A;  3C0R B;  5IA7 A;  3NS1 A;  3UGB B;  2HTM E;  3A33 B;  4A90 A;  1RFA A;  5CHF A;  2WXI A;  5EE0 A;  2WXM A;  1WMH A;  4J6I A;  1TT5 B;  2VRR B;  3PLU A;  3T9L A;  2Y5B B;  4C4V B;  1L6V A;  3OG5 A;  3CSF A;  1UD7 A;  2FUH B;  5C1Z A;  4GU2 A;  4Q2J A;  1IP9 A;  2LGD A;  3LB8 C;  1L4Z B;  4N59 A;  3OLM D;  1ET9 A;  4OZB A;  1K50 A;  1N5W A;  1YJJ A;  3ZUN A;  4LDT D;  3W1Y A;  1OQQ A;  4ZRP A;  4MEM A;  4JE3 B;  1B9R A;  4X57 B;  1I35 A;  1KFY B;  3PZ7 A;  2MA9 B;  1K52 A;  3DBR B;  2ZCB A;  3N9Y C;  5C23 A;  4NQK E;  3Q8B A;  4LJO B;  1JWB D;  3PZD A;  2W3S A;  3AEC B;  3N3K B;  3QAQ A;  1JWU D;  3WA0 A;  4GLS C;  5D6J B;  3R7Q A;  1P0R A;  3AE1 B;  2LGS A;  1MFW A;  4US9 A;  1E0Z A;  4BVU C;  2GBM A;  5AZG A;  2E3T A;  2IBI B;  3X0W A;  1AYF A;  2DLB A;  1ISN A;  1VZ7 A;  1V81 A;  1QF6 A;  3B9J A;  1WJ6 A;  3EEC A;  4KIK B;  1XF5 L;  3HHM A;  3PGE A;  4IC7 B;  3NVW A;  3EGR A;  1NI2 A;  3FIL B;  2JRI B;  3SR6 A;  1RYJ A;  2QEJ C;  4B9K A;  2WQY B;  2I1K A;  1VDV A;  2DNF A;  2RD0 A;  5J17 A;  4DXA B;  4MJS A;  2UU7 A;  2JWU A;  1QQR A;  3DVG Y;  1OEY J;  2D11 A;  3HUI A;  4MGI E;  2J7Q B;  1TIF A;  2M56 B;  2WGS A;  1WIA A;  4FXC A;  1WWT A;  2IGD A;  3VAW A;  2K8H A;  4RF0 A;  2KAN A;  3W5V B;  2RR9 A;  1L7Y A;  3L4P A;  2I1J A;  1JW9 D;  4W9D A;  2MJE A;  3AUL A;  4OW0 A;  5D7G A;  1RRB A;  3K9O B;  2MJD A;  4JWS C;  1WE7 A;  5BYQ A;  2FAZ A;  2D07 B;  1WY8 A;  4NY0 A;  3RFZ B;  2W3R A;  1XLN A;  3L54 A;  3OAW A;  1D3Z A;  1IGD A;  3QK0 A;  2G4S A;  3TSS A;  1J7C A;  4IWQ A;  1WYG A;  2WP9 B;  2DZK A;  4EOY A;  2LVO A;  2PVG C;  1GAQ B;  2ASQ A;  4P16 A;  1TKY A;  4HKZ E;  1YJ1 A;  4WWP A;  4DDG D;  4A6Q A;  1KOT A;  2EKI A;  4PK1 A;  1C1Y B;  1H8C A;  2AX5 A;  3PLV A;  4L2Y A;  2GI9 A;  3OWE B;  1YJI A;  1K51 A;  3I57 A;  2B3A A;  1E6E B;  5AZH A;  3M63 B;  2Y5C A;  3D32 A;  2LEK A;  4EFO A;  3ZRF A;  3VFK A;  3WAN A;  3KUD B;  2ONQ A;  3QJZ A;  5AUI A;  2RDG A;  2WXF A;  4WQM A;  4IOI E;  3B1L X;  1VZ8 A;  3TBL D;  3HVD A;  1D5M C;  1SBB B;  2QSD A;  4EZJ A;  3BVZ A;  1BXT A;  2L7R A;  1NEN B;  3VUY A;  2K39 A;  2JRH A;  3BK2 A;  5IAA C;  4OVU A;  3P4P B;  4RM8 A;  3IAS 1;  3AE2 B;  4GXB A;  2L1A A;  4K7S A;  2KVR A;  4YT0 B;  1WJN A;  1MI0 A;  3AEE B;  2MBB B;  3EUB 2;  3A4S C;  1EF5 A;  1WE6 A;  4NJ6 A;  1OQY A;  4LTU A;  3PO0 A;  5LXI B;  2BQQ A;  4A9A A;  1LM8 B;  1NYR A;  3PRZ A;  1NBF C;  4WH4 A;  4B6W A;  2AYO B;  3Q8C A;  2L05 A;  1C4C A;  3NZ3 A;  1R4N B;  2IGG A;  1KTK A;  2LZ6 A;  1JCK B;  5FR6 A;  2NTT A;  2RDH A;  2J0J A;  1JRU A;  2KMM A;  2ACZ B;  2RMM A;  2ZJD A;  4WWN A;  3Q3F A;  4XZ4 A;  3T8M A;  1LO5 D;  4M01 A;  2YVC A;  2OJW A;  3AE5 B;  3Q6B A;  2C7N B;  4GDL B;  1UGM A;  4FLH A;  2WXJ A;  4WJN A;  3ZNH B;  2LJ5 A;  5E6P A;  3TCA A;  4DHZ B;  1JQ4 A;  4ZHP A;  1SE2 A;  3Q8E A;  4KGS A;  1IUE A;  1ROE A;  3QA8 A;  2LVP A;  2NVU I;  4LCD E;  4KVG B;  5DPT A;  4XC2 A;  3KYC D;  3GE8 C;  1YQ4 B;  1S3S G;  3NHE B;  1XEE A;  3DQV A;  4BKT A;  3GZN I;  2MW5 A;  4NJC A;  4XDC A;  5IO9 A;  4RCO A;  4IM2 A;  3PHX B;  1SJH D;  1PGA A;  3EFC A;  1WX8 A;  1AW7 A;  2KTR B;  1TBE A;  1CQV A;  3KVF B;  1QT9 A;  3ZDM C;  2ZEQ A;  3ZLZ A;  4W9J A;  4NAM A;  4FUL A;  1LQB A;  1E7V A;  3RMK C; 
#chains in the Genus database with same CATH homology
 1STE A;  5D3I B;  3IXS A;  2AQ2 B;  2KAC A;  3ZQ4 A;  3SFD B;  2WXK A;  5EE1 A;  2MH7 A;  2ICI A;  1FRR A;  1V1P A;  3Q69 A;  2G9H D;  2L32 A;  4RH6 A;  4OHJ A;  2CU3 A;  2L52 A;  1KLG D;  1TKE A;  2H88 B;  2PIA A;  2W54 A;  1XLQ A;  1FNV A;  1L0V B;  1ZXI A;  3TEX A;  2W55 A;  1JWS D;  2H89 B;  2KAJ A;  2WXO A;  2Y5P A;  1SSN A;  2K22 A;  1HQR D;  3VRA B;  1SJE D;  1L4D B;  4L1B A;  1IGC A;  1C77 A;  3MHZ A;  4DQO C;  3SEB A;  2BW2 A;  2PW9 A;  2WXG A;  2BB5 A;  3P63 A;  4NZL B;  3SFE B;  2DYM A;  1QOB A;  2EEL A;  2NMQ A;  1C78 A;  1TS5 A;  1FNW A;  2LUM A;  2Z8L A;  2IGH A;  2VZK D;  4KKI A;  2N0S B;  3KWV A;  2XNA C;  4TQ1 A;  1D5X C;  2XN9 C;  1KF6 B;  3T3O A;  2KQ4 X;  3GB1 A;  3R2I A;  1YQ3 B;  3BWU D;  1QOA A;  1SEB D;  3BK1 A;  5FR3 A;  2BS4 B;  1PDX A;  2WLB A;  3Q8F A;  4KGT A;  1IBX A;  1JAL A;  3AEF B;  3I9V 1;  3P4Q B;  2GRI A;  2N9K A;  3VR9 B;  2JXT A;  1I4Q A;  1CZP A;  2ON8 A;  2HDE A;  5JXV A;  1QOG A;  1I4H A;  1SE3 A;  2G1E A;  4A8X C;  1ZXH A;  3J9C A;  2L83 A;  3FC4 A;  1FFV A;  2JYE A;  5AUK A;  1A70 A;  4USA A;  1MVK A;  4YTM B;  3KWL A;  5G5G A;  2K3U A;  4XWW A;  3CWI A;  1M4V A;  3NRZ A;  2WXH A;  4KKJ A;  1T3Q A;  3ZGZ A;  1TZO A;  1QIL A;  4IDI A;  4RNA A;  2K9X A;  1D6E C;  2IPK D;  4MAC A;  3E56 A;  3ZYY X;  2JSV X;  3ETR A;  4XWT A;  3AN1 A;  3MP9 A;  5BMG A;  1GB1 A;  1I4X A;  2SAK A;  1GB4 A;  3V05 A;  3BVG A;  1MHX A;  1FM0 D;  5FKA C;  1UNS A;  2BYT A;  5D3D A;  4AS1 A;  2N7J A;  1Y56 A;  1WSP A;  3AE8 B;  4D2K A;  3R8B A;  3ZJU A;  1FXA A;  3AMZ A;  2WDV B;  1P7E A;  3LXF A;  1RM6 C;  2JX5 A;  3HRD D;  4UDU C;  3AE6 B;  1D5Z C;  1VR9 A;  4YTN B;  1C9F A;  2WU5 B;  3VRB B;  3DWG C;  4C7Z A;  3ABV B;  3NS1 A;  3T3N A;  2HTM E;  4A90 A;  4C56 C;  1NVI D;  3AEA B;  1NI3 A;  2WXI A;  5EE0 A;  1TS4 A;  2WXM A;  1SF0 A;  1TKG A;  3VQI A;  2KN4 A;  2KWD A;  1NYQ A;  5EE9 A;  1J7B A;  5BYS A;  4B0E A;  2LMC A;  2ZW1 A;  4XDD A;  1EWY C;  1F2R I;  2QMT A;  1L6V A;  3AE7 B;  3MFG A;  4ARC A;  2YEP F;  3AEG B;  1YN4 A;  1C4A A;  3BVM A;  2AQ3 B;  2MEK A;  2PMV A;  3LB8 C;  4Q2J A;  2V4I B;  1L4Z B;  4N59 A;  1RWS A;  5MPO A;  1ET9 A;  4OZB A;  1K50 A;  1N5W A;  1YJJ A;  2QJL A;  1OQQ A;  4ZRP A;  4MM3 B;  4ZYS A;  1TS2 A;  4JE3 B;  1B9R A;  2FE8 A;  1E7P B;  1HA5 A;  1KFY B;  3PZ7 A;  4TQ0 A;  2ZW0 A;  2BS3 B;  3MC0 B;  1K52 A;  4ZRQ A;  5I4D A;  4OZA A;  2JQR B;  3N9Y C;  4YSX B;  3Q8B A;  1EU4 A;  2K0P A;  1JWB D;  3AV8 A;  3AH7 A;  4C80 A;  2W3S A;  3AEC B;  2WDR B;  2OHF A;  1JWU D;  2N9L A;  1L0Y B;  4GLS C;  1WGK A;  1NEK B;  2W82 A;  5TSS A;  2LHE A;  4TMA B;  3WCQ A;  3AE1 B;  1JWA D;  4US9 A;  2LHD A;  1ET6 A;  2BS2 B;  2J4X A;  2V3N A;  4RFB A;  4ARI A;  4HJG E;  1E0Z A;  2WXQ A;  1YMH E;  5GXG B;  2WNM A;  4WAF A;  1YN5 A;  1V8C A;  3Q8A A;  4CQN A;  4IKG A;  5H92 C;  3HVZ A;  1MHH E;  2JYT A;  3DWM A;  2E3T A;  1PGX A;  3CIR B;  5LNK 1;  1QKZ A;  3W9C B;  3FAH A;  1TJE A;  4US8 A;  1AYF A;  1XO3 A;  2DLB A;  1VZ7 A;  1PUT A;  1FIQ A;  1QF6 A;  1R7S A;  3B9J A;  1JRO A;  3FIL A;  3H8H A;  4HRS A;  1TY0 A;  5BMH A;  3EA6 A;  1L5P A;  2LJI A;  1C79 A;  4ITK A;  4WWM A;  1I4P A;  1XF5 L;  3VR8 B;  3NVW A;  2K5P A;  3EGR A;  2INP E;  3FIL B;  1OQR A;  5HHD G;  4KGR A;  3SR6 A;  5EE3 A;  1RYJ A;  2QEJ C;  1FMA D;  1BML C;  3IT6 B;  2WQY B;  2J53 A;  1L6U A;  1VDV A;  4C7Y A;  3BYY B;  3W2D A;  4O1N A;  1UWM A;  3W1S A;  2M0A A;  1JWM D;  1HEZ E;  2R61 A;  2JWU A;  1QQR A;  3BZD B;  3BII D;  1VRA B;  4N6E B;  3LYY A;  4HRO A;  1ESF A;  1KH0 A;  4DXG A;  2Q5W D;  3HUI A;  4ZOH C;  1QLB B;  2X38 A;  2M56 B;  1HZ6 A;  4FXC A;  1MPE A;  3MJ5 A;  1FD6 A;  1E9M A;  1WWT A;  2IGD A;  3IT4 B;  1UWX A;  1FFU A;  4REZ A;  4RF0 A;  1UUP A;  1EWC A;  5BYR A;  3W5V B;  4RGO S;  1FCC C;  4WUR A;  1XXG A;  3L4P A;  4OZC A;  1F2R C;  1DYQ A;  1JW9 D;  2B76 B;  5C3J B;  1ZDV A;  2MJE A;  4OW0 A;  5D7G A;  1CK1 A;  4GDK B;  5HI1 A;  2MJD A;  2JU6 X;  4JWS C;  4RF1 A;  1DOX A;  5BYQ A;  2PTL A;  3P4R B;  4OVZ A;  3NUH B;  1GPX A;  3TEZ A;  3RFZ B;  1XLP A;  2W3R A;  1XLN A;  1IGD A;  2LFI A;  2QIE B;  1WXQ A;  4MT5 A;  4RGN A;  3R2T A;  3TSS A;  1J7C A;  4PT5 A;  1WYG A;  1KRH A;  2WP9 B;  5FK9 C;  4HEA 1;  5HG2 A;  1ZE3 D;  2LGI A;  2PVG C;  1GAQ B;  2MJ3 A;  4P16 A;  4RGT A;  1TKY A;  1YNT E;  1HZ5 A;  2SEB D;  2J52 A;  4M0W A;  4NAW B;  4HKZ E;  1FRD A;  3B2G A;  1TS3 A;  2DYO A;  3P42 A;  4A6Q A;  2EKI A;  3C8Y A;  3TUO A;  1KLU D;  2QIL A;  3KQ4 A;  2I2Y A;  3W5U B;  1PGB A;  1XCT L;  2AX5 A;  4L2Y A;  1N63 A;  2GI9 A;  3OWE B;  1YJI A;  3URY A;  1OFF A;  1PYW D;  1K51 A;  2PKO A;  2PLP A;  3B2F A;  4YSY B;  3I57 A;  1I4G A;  2CJN A;  1E6E B;  1XLO A;  2Y5C A;  4A55 A;  1N62 A;  1J7A A;  2LEK A;  1V1P B;  2IJ0 A;  1IBX B;  1SXT A;  1B1Z A;  4R3D A;  3RPF C;  2J42 A;  3TEY A;  2ONQ A;  5AUI A;  2RDG A;  3NVY A;  1SE4 A;  2WXF A;  2OED A;  3AE3 B;  1VZ8 A;  4IOI E;  1SIJ A;  2TSS A;  2KDM A;  4WQM A;  3HVD A;  1D5M C;  5E6J A;  1SBB B;  2QSD A;  3BVZ A;  1BXT A;  2RPV A;  4YSZ B;  2WXP A;  1C4P A;  1K53 A;  1NEN B;  3AE9 B;  2I38 A;  1ACC A;  3IAM 1;  1V1O A;  1CJE A;  4WIP A;  3BK2 A;  1AWD A;  1RFK A;  1ZUD 2;  2INN E;  2BB6 A;  4P6V F;  2D5G A;  1JML A;  1PFD A;  4KX6 B;  3P4P B;  3IAS 1;  3AE2 B;  1DOY A;  3NVZ A;  2L1A A;  2WS3 B;  1ENF A;  3KLS X;  5BMI A;  3P4S B;  4YT0 B;  1N5X A;  1DOI A;  1TYG B;  1MI0 A;  3AEE B;  4HKQ A;  5C2T B;  3EUB 2;  1WRI A;  4JWU C;  2NTS A;  1DGJ A;  4N58 A;  4LTU A;  4LLG M;  1ZPS A;  3PO0 A;  4L23 A;  2BBC A;  5T8I A;  4A9A A;  2DBY A;  4EE2 A;  2WU2 B;  1NYR A;  2M19 A;  3AED B;  1FO4 A;  4YXD B;  2WXN A;  5H8Y E;  2JZP A;  3AE4 B;  4WH4 A;  2V3P A;  3UI3 A;  1T5X D;  1T6B X;  3P1M A;  4H2A A;  3Q8C A;  1FXI A;  3U52 E;  1V97 A;  1C4C A;  3NZ3 A;  2IDY A;  2PVO D;  2IGG A;  1VLB A;  1KTK A;  1JCK B;  2DWQ A;  1XCQ L;  2NTT A;  1N60 A;  3E9S A;  2RDH A;  5G5H A;  4ZHO A;  2KMM A;  2V0G A;  2ACZ B;  2RMM A;  4TSS A;  1VZ6 A;  2GB1 A;  3O13 A;  3TEW A;  3AM9 A;  3ZJV A;  2Y3A A;  1JRP A;  1LO5 D;  4XE0 A;  5HFY A;  2WXL A;  3AE5 B;  3PZ8 A;  4GDL B;  1QOF A;  1ZOY B;  2WXJ A;  3V3X A;  2BT6 A;  3BYT B;  4DXF A;  3AEB B;  1SB3 C;  1EU3 A;  1JQ4 A;  1F77 A;  4ZHP A;  1SE2 A;  3Q8E A;  4YWG G;  3U7Z A;  1F0Z A;  4KGS A;  3AB5 A;  1IUE A;  1D4B A;  1ROE A;  1GOZ A;  3NVV A;  1P7F A;  2WXR A;  4AQ7 A;  1L0X B;  4RGM A;  1HXY D;  4LK0 M;  1C76 A;  1YN3 A;  1YQ4 B;  4JX1 C;  4MH8 A;  1XEE A;  3U4E G;  3ZJT A;  1Q10 A;  1I4R A;  4NJC A;  4XDC A;  1TY2 A;  2BTE A;  2VZK B;  1ZP0 B;  4RCO A;  1UGJ A;  1FEH A;  2FUG 1;  1SJH D;  3U2S C;  1PGA A;  4J3O D;  1VJK A;  1ZDX A;  2YEP B;  4YTP B;  1AW7 A;  2FBW B;  1BUI C;  3GS2 A;  1CQV A;  2E6X A;  1N61 A;  1FNU A;  1QT9 A;  4B0M A;  1I7H A;  4JPS A;  1E10 A;  3GP7 A;  1EM7 A;  2WDQ B;  2AQ1 B;  4NAM A;  1FCL A;  1AN8 A;  2CJO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...