3CX5F

Structure of complex iii with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
74
structure length
74
Chain Sequence
VTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHKEDCVEEFFHLQHYLDTATAPRLFDKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 30
structure length 74
sequence length 74
chains with identical sequence Q
ec nomenclature
pdb deposition date 2008-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3cx5F00
1PP9H 2FYUH 3L74H 3CX5F 3L72H 1PPJH 3TGUH 1KYOF 1SQBH 1BGYH 1SQPH 4D6TH 4U3FH 2BCCH 1BCCH 3H1JH 3L70H 3H1HH 1SQQH 1P84F 1L0NH 1SQXH 1EZVH 1NTKH 3L73H 5KLVH 1SQVH 1NTMH 3CWBH 1L0LH 2A06H 3CXHF 3L75H 1NU1H 1NTZH 3L71H 3H1IH 1BE3H 3BCCH 2IBZH 4PD4F 3H1LH 1KB9F 3H1KH
chains in the Genus database with same CATH superfamily
3RT3C 3JARB 1OCRB 3C90A 1NR1A 1XBLA 4DR1O 3K9AA 4YJ2A 1IVSA 5KHKA 1WPBA 2E5LO 3K79A 1Z5WA 2JVDA 3CXHF 2JEXA 3JAKB 4GX1A 2D2CB 4PD4F 1IDSA 1UPGA 1MOFA 1KECA 1GN6A 1XL6A 2PYJA 3I55V 3HR0A 3FB7C 4KHPO 1Z2GA 2HJFC 5LOVB 5A9GA 5CA0B 1X4TA 1HNXB 4F4LA 2YIAA 1SQFA 1NTMH 1M9NA 1U96A 3AK1A 5FPOA 1BQ0A 2Q5ZA 3M7MX 3O65A 3DXRB 1NKDA 5J9PC 2B9ZA 2EIKC 5JVDA 5KHJA 1XNQO 3RYFB 2ZR2A 2RQ6A 5JQGB 1VQOV 1P49A 3AG3B 2CH7B 2XAHA 4LC1A 2QGNA 3CJHA 1I94B 1D2DA 4LF7O 1SQQH 4PDLA 5E1AC 2DWEC 4LFBB 5ITZA 2Y0PA 4ZI7A 4E4EA 1I0HA 2WLLB 5HFLA 5DN6G 1NVPD 1N4CA 1RSOA 1NBMG 1MG1A 2LGWA 5IYCO 2EIMB 1BGYH 4TV9B 4U3FH 2W0XA 1MABG 3TJTA 2ZKOA 2QWQB 4OX9O 3AG2C 3CD6V 3EVKA 1N33O 3KCXA 1V54C 2IBZH 4B3SO 2YDEA 3BEHA 2IH1C 1FXHA 1DK1A 4RAIA 5DEDA 1XL4A 1F4MA 4K8XA 1NZ6A 2F4VO 4PDRA 4TQDA 4O2AA 4LFAO 2D3OW 3T1YB 4DRXA 5BR8B 3BCCH 4DV4B 4O4HB 5IY5C 3LUTB 3GWKC 4JYAO 5HFMA 5LGTA 2A0LA 1O9GA 3HKCA 4X62B 3PN1A 2N05A 1QU7A 3SJCC 1CEZA 3KZIZ 4LWSB 4O4LB 4NR1A 1GM7A 4R50A 1VF5B 3U11A 1SQXH 4GKJB 4JI3O 1TUBA 3CWBH 2ZR3A 3F5WC 1NTZH 1M57C 1V55C 3D36C 1AB3A 1F7YA 1T5EA 5GONB 2LQTA 1I5XA 4JTCB 1PL0A 3JALA 4LP8A 2VQEO 4LF6B 4DUYO 4QIWF 1FXKB 3C3SA 3P3PA 1S5HC 4MT8A 1NR7A 3ETGA 2HVJC 4QGPA 4XDKA 5KLVH 3TK1A 4PHZA 1JOYA 5B1OA 3B8MA 3ZRWA 1R3KC 1DTOA 3JASB 3W7SA 4MVQA 2PF4E 4I0XB 1CP9A 4CC5A 2Z0AA 3D3QA 2Y69B 3ZS8C 4X64B 2RDCA 4MVOA 3HKDA 3HKBA 4DV1B 4NTWA 3HB3B 5B1BC 3E83A 1Y4MA 3AG1C 3N27A 4JI2B 2LP7A 5LHGA 2HKOA 4X20A 2UUCB 1ZL8A 4AQYB 4X1KB 3FD9A 3J81N 5IJ0B 3OTFA 1QVFU 3JAWB 5LMUB 1Y6XA 2P06A 2H3OA 5EZYB 3K08A 1WB7A 2ZNIA 3ABUA 4HYOA 4J9ZB 3CCLV 2Q8VA 2F95B 2UXNA 1OZ0A 4I50B 4I9WA 2XNDG 1VQLV 3DC5A 1CPYA 4TOIA 2HEPA 4IGGA 1IBLO 1XMQO 4AI8A 1ORQC 3ZHRA 1PNKA 3U10A 4K0KB 1H2GA 2BTQA 4GX0A 2BE3A 2JJ2G 2M7WA 3W7WA 3RYIB 2ZE7A 3H9VA 3TETA 1MSDA 2LGQA 2PTMA 3BAAA 2V4DA 4F6EA 1R3JC 3K5MA 5L3GA 1D5NA 5H9CA 5JWPA 3ABKC 4FLZA 2ODMA 2QSAA 1Z5VA 4MTOA 3OUSA 4IHJB 1H8EG 3E22A 4GKKB 1I5YA 2PY5A 5C8YB 4JI6B 2ZIMA 2P90A 2ZDIA 1VMGA 2ITCC 3LNMB 3SPJA 4X1IA 2DE0X 4RWUA 3FYIB 1SQGA 3GVMA 1K5QA 2FYUH 4I7ZB 4FFKA 5KA5A 4PA9A 5J2TA 1VF6C 1YJNV 1IXBA 4FLWA 1YDXA 3MDSA 3FB8C 2HR3A 3E2EA 3JSLA 3N2KA 3ASNC 2BOCC 2VS0A 3LDDA 2GSMB 4X66B 1NT2B 1GM8A 5IYDO 1PNMA 2CTWA 1TUEB 1JJ2U 1PKXA 1XDCA 3OUFA 5CA1A 2EJ7A 4FM0A 3CC4V 4O2BB 4HZ3A 3FAVA 4BR6A 4NXNB 4PA6A 4B3TB 4L8JA 1EZVH 3ZRVA 2ZE8A 3ML0A 2P6JA 1Y67A 4YJ2B 4IYIA 5L3EA 1U97A 3FX7A 1AJPA 2BTOA 3K57A 1WPXA 4H33A 2OCCB 4X65B 1M56B 1PPJH 3E8FA 4CH4A 4DYLA 4DR4O 2UXBO 4I4TA 1N32O 2EIJB 4DV2O 3W7TA 3CCEV 4GCZA 2OIGA 1FAFA 2ZXWB 1AI4A 3UO3A 4UCOA 3IAYA 1TVKA 1MZEA 2CTRA 2GV9A 1KMIZ 4RUEA 5LMNB 1WA8A 3SR2C 3TXSA 1K97A 2QE7G 4YHHB 1I94O 3FYEB 1YJWV 4DK1A 2NN4A 2YICA 4JYYA 2E76B 2EINB 5JVDB 4JF3A 1JFFB 2E3CA 2A06H 1IX9A 4L87A 1IBKB 4CZZA 3CJHB 4NTXA 3ZMUA 1SS3A 1GN4A 3Q4HA 5KA6A 3U0ZA 4O4IA 5ITZB 3FFQA 4WFAV 2Z5UA 3TXQA 5CBFA 4TUYA 2XAGA 1KKCA 1AROP 1RSOB 1Q7YW 1NQTA 1S5LZ 1NU1H 4YJ3A 1QVGU 4FFBB 4DV5O 4JI5B 3HPLC 1TAEA 1XEQA 4H13B 4NXMO 1OCRC 1G1XB 2DWDC 2WLMA 5LP6A 1SA0A 4CC6A 1KUQA 2PUSA 1LNQA 1BCCH 1S0VA 3OD4A 3ZHSA 4FMTA 1YIJV 1LR1A 1K4DC 1N8RW 3H1IH 4QE9A 4JI8O 3VQWA 1PP9H 4JI7O 4O2AB 5L3BA 2LW1A 3ZBHA 3D36A 1XNRB 2UUBO 2LFRA 1ROPA 1WP8A 4DR7B 4I9QA 4DRXB 1XMOO 2HG5C 2Y4UA 3L73H 2ZT9B 3HKCB 2ZD9A 1GM9A 1H2MA 1K3EA 4OPHA 3CRRA 3S3XA 2VQFO 4NB5A 4JAUA 1TUBB 4D7SA 3OGCC 4JV5O 1N36O 4CS3A 1W0JG 3TGUH 3AG3C 1HR0O 1W2BU 2ADQB 3JALB 1J95A 2Q69A 2OWOA 4D6TH 2ZE5A 4GYCB 2RCVA 2QKAA 1GN2A 3CYOA 1R6KA 2YXLA 4JI1B 2ZM6O 1H2SB 2Q0OC 1OCZB 4HAMA 4AHCA 1VARA 2FMLA 3UKMA 1KB9F 2IW5A 4U3JA 2WSSG 3RYHA 1K4CC 3CX5F 1L1FA 1SKVA 3K58A 2EIMC 4AILC 5CBGA 3CPWU 3ZRWB 2UUAO 2JS3A 3A0BZ 4CH3A 3JD4A 2DYRB 1QQCA 2IJJA 1SERA 3RFRA 2UXDO 1UFIA 1VQ9V 4DV7O 1H2KA 2B5UA 3IFXA 5D5QA 4YY3B 3G6BA 1M1KW 4TT3G 3VQXA 4UB6Z 4EKWA 1HNWO 4CBCA 1N34B 3JAMN 4J9YB 2VWKA 3HKDB 3HKBB 2OIEA 1COWG 4DV3O 3OM3B 2ZE6A 3PJSK 3K59A 1Q5OA 4YXWG 4ZOLA 4F6RA 4UV8A 4MVSA 2X7RB 1N0NA 5IJ9A 4X20B 4KFMA 2GDSA 3CCQV 1B3QA 2GTSA 2VWJA 1ZL8B 3DC6A 4CS4A 3WG7C 5AG2A 2JIZG 1QLEB 5LHIA 4WFHA 3R65A 2Q6AA 3CCRV 3SJAC 4W4LA 1Q81W 3CC2V 4WFGA 2BOBC 5FL7G 2HLDG 1VQKV 4CH5A 3ABMB 1GKFA 3ETQA 4J80A 5CA3A 4DV6O 2X0LA 3RYCB 1VQPV 1YF2A 5JCOC 1PD3A 1FXKC 1K9MW 3KKYA 2WPDG 3CCJV 1VEWA 2UU9O 1E1QG 2BTQB 1EN5A 4B3RB 1VQNV 1XREA 4G27B 1JQ0A 3GB7C 2PI5A 3VQVA 1P4RA 3K03A 3N2GA 1BE3H 1B04A 2P4KA 3E8GA 5BMVA 3QO8A 4MVZA 1SQBH 4O4JA 1AR1B 2NNUA 4Z1VA 2Y69C 3B8NA 3K0GA 4P9OA 5JH7A 2IJKA 4UVAA 3FKSG 3ZN0A 1MA1A 1VF6A 1FJGB 1AP6A 1GRJA 4DK0A 1J5EO 4JZGA 2IM9A 1OCOB 4HBNA 4R7CA 2F93B 4IIJB 2JK5C 4X1YA 2IU0A 3OT7A 2F1MA 3BA8A 4X1IB 1B06A 4OGQB 3OGIB 1S3JA 3ABLC 3SJBC 4FPPA 4W4KA 1GTOA 1K34A 3CEIA 5J2TB 1G4YB 1F4NA 3G67A 2W6IG 3P30A 4DO2A 1ZX3A 3JATA 1JVMA 3G80A 4XBFA 2XOKG 4DR2O 1OHHG 4KL1A 1S76D 4QE7A 2Q7HA 3B09A 4PJ0Z 4H37A 2DQ0A 1EM1A 4BAYA 1XHXA 2QM8A 3P32A 5DM6V 3QVNA 1X59A 1M5IA 1TA8A 3T4ZA 4QJFB 5CA1B 3FAVB 2XHBA 2XAFA 3JYCA 5H6QA 4JI0O 2YSUB 3UT5A 1HW7A 3L74H 4P9PA 2GBOA 4DV0B 4DR3O 1VQ6V 3CCVV 4PA7A 4WFFA 3CXCU 1YITV 2Y0IA 1M93A 1NTKH 3QF7A 3ZX6A 5IWAB 4DUZB 1K92A 3SYAA 2HJDA 3VOUA 3DSQA 5GW7A 4JI4O 1BQZA 2B1IA 4FLXA 4LF8O 3ZHUA 2QTOA 4DR5O 4LF4O 2QWOB 1RPOA 2HHHB 5B3SC 5FLXN 2DMXA 3ASOB 1WP7A 1FFTB 4RQEA 1RM1C 3M8AA 3R66A 1WA8B 3SDLA 1ZAUA 1XI1A 3C3TA 1HNZB 1IBMO 1YVWA 2CE4A 5A2QN 1URFA 4IT5A 4NKGB 2LJ2A 4FLYA 2JGDB 4CS2A 2QR4A 4J11A 1BL8A 1AR5A 1SF9A 4B3MB 3E8HA 3JARA 3Q4HB 2UXXA 4O4IB 5B1AB 4I55A 4TUYB 2YUAA 2WAMA 1YTFB 5IYZA 3LDCA 1NH2D 1PV0A 3OTOB 4ZHQA 3K0DA 4YJ3B 2CTQA 4DR1B 4LF9O 4PDVA 2CGOA 3T4DA 5JJEB 4EEQA 3W7UA 2E5LB 2KQXA 2RMKB 5LP6B 4D7TA 2NR5A 3SGIA 1RPRA 2EZOA 4LBEC 4X8AA 3K04A 4UFZA 2FKXA 4LR3A 4DR6O 2KG7A 3STLC 4J10A 4RUFA 2YIBD 4KHPB 1LUWA 1BS3A 2CK3G 4LNUA 1G8MA 2E75B 2UXCO 2EIJC 4FLTA 4LF5O 4XDJA 4KP4A 3OR7C 3HKEB 2YIDA 1YEWA 2CH7A 1KKDA 2ZXWC 2Q4PA 3JSNA 1XNQB 2AHZA 2WLLA 3RW0A 4MW8A 4FIPC 3CCSV 4LF7B 3EXAA 3BABA 4GX2A 2A9HA 4DW0A 5LBQA 4BIZA 3T1HO 3ZHVA 3LSSA 1KYOF 5LXTA 5C93A 3OMIB 3H1JH 4U3JB 2YI9A 1OV9A 3J7AU 4UB8Z 4OX9B 3RWRD 2JJ1G 2Q68A 2Q7EA 3S3WA 2AZ2A 3KG2A 1N33B 3SYOA 3WB0A 4B3SB 2EILB 1KBHA 5B1BB 4UCVA 1RFYA 5J2UA 3AG4C 1IURA 1LUVA 2PGGA 4B7EA 2F43G 4TSFG 2F4VB 5F2VO 3ZMZA 5H2FZ 3UCSC 3P3NA 4LFAB 4LFCB 2OTJV 1DF4A 3RGBA 1NJIW 4UCSA 2JGUA 1P7GA 4ZOLB 4F6RB 3IC9A 2WWWA 4JYAB 1MSWD 2KSDA 1R6NA 2ATKC 4JGSA 1ZLZA 1HNXO 2XTAA 4EFBA 4U7OA 1FXKA 3L70H 4E2LA 3ZMTA 1DGSA 4JI3B 2LW7A 1AR4A 2QKSA 5KMGA 2BSKA 5KX5A 4X89A 1BT8A 2VQEB 1O9HA 3DGEA 2YIBA 4DUYB 1Y76A 2OTLV 3BHPA 5LL6Y 1QNMA 2ETNA 3ZN1A 3H1HH 3A0HZ 4LFBO 1BHAA 1R3IC 3QNEA 2YXHA 3CRMA 1K73W 1IXMA 3ABKB 4I0XA 1E79G 2R72A 2AZ0A 3OMAB 2QDOA 1OCZC 2KB1A 2R9AA 5FNVA 5B66Z 3MHHC 4MTGA 1KU9A 3JD0A 2GUZA 4MS2A 5KUKA 5EK0A 3N2GB 4ZI7B 3H01A 2X6AA 2DYRC 2ZIOA 3EHBB 1MNGA 2H94A 1YXBA 4JTDB 1L0LH 5EYPA 2XAQA 4O4JB 1VIBA 3BFRA 5JH7B 2W0FC 3AK2A 3VQYA 3JD2A 3OEHG 3K06A 3WU2Z 3FB6C 3JAWA 4ASUG 3GWOA 4FJCC 4FZ1A 3G6EV 4IYHA 3CCMV 1S72V 3K5OA 1EFRG 2YS8A 4TV8A 4GUNA 5EBMC 3ASNB 4Q20A 3T1YO 5E79Z 2XAJA 5BR8O 4DV4O 3UQ8A 4WFBV 3E35A 3D3IA 3FB5C 4TWKA 3OFNG 4JYBA 4X62O 3ZMVA 1GK9A 1DLBA 1AJNA 3IJ4A 3K5NA 1I7FA 2WLIA 2XASA 1Q3EA 4PI0A 3JATB 3W7XA 4GKJO 5D5PA 4A5UB 1IBLB 1XMQB 1Q8IA 2N74A 4UCRA 1WAZA 4LF6O 4MVRA 5H5NA 3SYCA 4PV1B 2A79B 3ZEDA 5JJJB 3I5DA 1FFXA 4PA3A 3ETDA 5IYBO 2AXTZ 4K8ZA 1IZ3A 3E8BA 1YCIA 1JX9A 3LSQA 2KKWA 3RN4A 4WF9V 2YEVA 5DECA 5K1XA 3UT5B 2MK3A 3CRQA 3ZCCA 3JCUZ 1I08A 2YXYA 4H44B 5KHHA 1ZWIC 3WB1A 3G4SV 4N21A 3LSUA 4WBNA 1EBOA 4WCEV 1THZA 2L35A 1JR9A 1Y66A 3CSXA 3ETEA 3RVZA 3AK3A 3A0RA 1K5SA 2A3QA 5KAFZ 2DYSB 4X64O 3CRAA 2JS5A 5CN0A 4EFEA 2CTPA 3A2FA 2HFEC 4C7UA 5CB4A 3CC7V 4UVCA 1N0JA 4DV1O 1OCOC 2WA3A 4K3AA 4JASA 2O57A 3B4SA 1AI6A 1NVPB 4JI2O 3L72H 4QPKA 5LYJA 2UUCO 1L8DA 4AQYO 1S5JA 4J7JA 1QLNA 3CP1A 1SESA 5LMUO 1AJQA 3ZRSA 4QNHB 1KP3A 2R9IA 4U7NA 3SPGA 5L3CA 3KCYA 3LDEA 3ZHQA 4I55B 5EC1C 1VF7A 3ICXA 3CE2A 5IYZB 1WLEA 1EN4A 1SQVH 2YI8A 4K0KO 1JCHA 1HP8A 1H8HG 4ZHQB 1XUQA 1KQSU 4P30A 3QTCA 4MVMA 2QWNB 3JD1A 2P5OA 1WB8A 3MHSC 4ZBMA 4BW9A 4I5SA 4BW5A 2JEUA 3WB2A 1M90W 1OCCB 2C2AA 4DR4B 4NTYA 2UXBB 1N32B 2OT5A 3X2QB 2P4VA 4DV2B 1S77D 2RN9A 3CB2A 2KG7B 3AEIA 2IJIA 4GKKO 1F51A 4LNUB 4PDMA 3CMAV 3H1KH 1XHZA 1JFFA 2EZPA 1R1BA 4X88A 1FD9A 4UV9A 1BHBA 4JI6O 1Q6IA 2EJRA 2Q73A 3MD0A 3ASOC 1VP7A 1FYJA 3E22B 2MW2B 2QJ1A 4MVUA 3CMEV 3SYPA 1AI5A 1XILA 3OE7G 4UCTA 1E1RG 2ZCEA 2R9RB 1BZKA 1NI8A 4FFBA 3ZIAG 3JCZA 5KAIZ 1DF5A 1H2LA 3QO7A 1W59A 5B1AC 1K7DA 1R73A 5LXTB 1SZTA 4X66O 2FB5A 4DV5B 4MW3A 5LGNA 2WA4A 2ARHA 4NXMB 4UXNA 3N2KB 1HDJA 4NXNO 4B3TO 4HNAA 2CDYA 2P22C 2L6LA 5LP6C 3OEEG 4LFCO 4ABMA 2ADPA 2Y48A 4GLXA 2K1EA 2WLHA 2JDIG 5J2UB 2OYQA 1NH2B 3EFFK 2DOSA 4B08A 4X65O 4JI8B 3WG7B 2IH3C 1Y74A 4JI7B 2RNBA 3A8TA 4JYCA 1QR8A 4R6ZA 3BA9A 4UUJC 2UUBB 2BCCH 1Q90D 3JD3A 1XMOB 1VQ5V 1WN7A 5CMUA 2F23A 1QCEA 2RJZA 5EC2C 1SETA 5GTIZ 1SC5B 2EIKB 4I4TB 2VQFB 2A7WA 5LMNO 5KMGB 2BSKB 4YHHO 4JV5B 5KX5B 1N36B 5JJNB 2IU3A 3B40A 1HR0B 2Z3YA 1WJZA 4EB6A 3ZHTA 1L0NH 1TVKB 2AHYA 1IBKO 1Y76B 1F23A 5LA6A 3ZMSA 2ZM6B 1GO3F 1K33A 2QWPB 3ABTA 2N04A 5IT9N 3T1CA 1Q82W 4PA4A 4WFEA 5BY1A 4QPJA 2W6JG 4BWAA 3K9SA 3E86A 1YHQV 1JPXA 5FNVB 4GT1A 1Q43A 2JRIA 2UUAB 2QWRB 4XDLA 2ILMA 2V7QG 1Q86W 2GUZB 4B7KA 3BY6A 3AG2B 4JI5O 2UXDB 1PM9A 4DV7B 1V54B 2EILC 2ZQMA 1KD1W 3H1LH 1UJWB 2ZINA 5L3DA 4JPRA 5EYPB 1HNWB 1HWYA 3JAKA 3ABLB 4DV3B 1OJHA 5IE9A 4PELA 2LO1A 4NVPA 2P67A 1VQ7V 1SA0B 4FLUA 5LOVA 3M99B 5CA0A 1R6TA 5IY5B 2DN9A 1MZFA 2OCCC 1M56C 4TV8B 3RYCA 1XNRO 2R70A 4DR7O 2XT9A 3DXRA 5LGUA 4Z1MG 1P84F 3APOA 1MMMA 3RYFA 1SRYA 3L75H 4ZIBA 4BIOA 4DV6B 1M57B 5JQGA 1V55B 1GN3A 2WLIB 1VQMV 5B5EZ 4ICGA 5BXZA 4J41A 1Q6UA 1GH6A 1H38A 4GZRB 3SYQA 5EIBC 2UU9B 2X6BA 1SQPH 4OPAA 2CAZC 2EINC 3E89A 3OW2U 3CCUV 4LH6A 1FFXB 1G6UA 3OAAG 4JI1O 1JJOA 1P7BA 3B77A 4FM1A 2FL4A 3DTUB 3ZRXA 3NXSA 1QBZA 4TV9A 2YEVB 3B2EE 3SPIA 1AI7A 2ZNJA 2AGAA 1PL4A 2EULA 1D5AA 5B3SB 2M6YA 4FK5C 4IIJA 4K35A 4WBNB 1RM1B 4YIOA 1KP2A 3RYHB 3G71V 1YTFD 4YY3O 1M4UA 3CHXA 1V9PA 1J5EB 1JA8A 1GAXA 3SPHA 5LHHA 5K1PA 2YC0A 1AP5A 1N34O 5CB4B 2WLKA 4RQFA 3AG1B 4J42A 1KC8W 4O4HA 2Q7GA 2X6CA 5IDJA 5LYJB 3F7VC 3TCUA 2B1GA 4LWSA 4J7ZA 4O4LA 1BMFG 2HVKC 4LH7A 1H2NA 4J7KA 4DXWA 1JMKC 4DR2B 5BZBA 4YIPA 5IJ9B 5GONA 4FM2A 5JCOA 3ZJZA 2CUGA 1QHTA 3IC7A 4KXRA 4JAAA 2LFSA 1VQ4V 3RBZA 1QR9A 1ZTEA 2DW4A 1US6A 4JI0B 2GHYA 2QM7A 5KHIA 3AG7A 4UCUA 1AILA 4DR3B 2WLJA 2E74B 4MTFA 4B3RO 3J80N 1VQ8V 1SZXA 1PNLA 3QO5A 2DQ3A 4N23A 2XUMA 5CBHA 3JASA 4IL6Z 1Q6HA 3D8CA 3APQA 2NLJC 4JI4B 2QEXV 4LF8B 2P7TC 4JZ2A 4DR5B 2VRZA 4LF4B 4G2KA 1GMGA 2DYSC 4Z2WA 1ENVA 4DW1A 1FPOA 4Q6GA 5GTHZ 1YJ9V 3IGAC 2EX3A 2GTAA 4JAVA 3RVYA 1FJGO 2JGDA 1YI2V 5BMVB 1AVMA 2OCHA 2QM4A 5H6RA 2FTKA 1FXVA 1IBMB 4X1KA 5IJ0A 2G38A 5EBLC 5EZYA 3O9OA 3SJQC 4X1YB 3NR7A 4I50A 4JTAB 3L71H 5FPRA 4G28B 2H8PC 3LNNA 4BIUA 4NYKA 3UO2A 1QLEC 2HP8A 3WFVA 2V1DA 5L3FA 2QA4V 3UM7A 5KHGA 4FVMA 1ZSPA 3AG4B 3VBBA 4LF9B 3RYIA 3ABMC 4OXSA 4RO2A 4ZKIA 2Q67A 1BSMA 3BVOA 5KUMA 2ITDC 4P2ZA 1XQ8A 1A32A 4HNAB 4PI2A 3STZC 1FKAO 4DV0O 5B1NA 3HKEA 1NS1A 5EIBD 3I56V 1W0KG 4UVBA 2PZSA 3K3WA 3K5LA 1OCCC 4IHJA 4DR6B 2Q9LA 5IWAO 4DUZO 2UXCB 4LF5B 3X2QC 4KUMA 1Y74B 1YZBA 3OMNB 5C8YA 2K9PA 5TISZ 2Y4TA 2EBOA 1EN6A 3F5TA 1YSCA 1K8AW 3CRCA 2HHHO 4LCUC 5EBWC 3BPZA 2QTSA 2F66C 2Q0AA 3L9DA 1R3LC 4GX5A 3THOA 1RP3B 4TQFA 2AW9A 1HNZO 2QKCA 1CXZB 4EB6B 3SPCA 2ZDIC 4CH6A 3F7YC 4FZ0A 4FLVA 3T2MA 3CS5A 3T1HB 1EZJA 5LA6B 4X9QA 1WNSA 4B3MO 3BRCA 2PYLA 4MSWC 3QG5A 4H0LB 1ZUQA 2PI4A 4R8CA 1B6QA 3MAQA 2IJHA 2CGNA 2WLNA 4O2BA 2DJVA 1XOUA 1TGOA 3OR6C 4MTXA 3OTOO 1FS0G
chains in the Genus database with same CATH topology
1PP9H 2FYUH 3L74H 3CX5F 3L72H 1PPJH 3TGUH 1KYOF 1SQBH 1BGYH 1SQPH 4D6TH 4U3FH 2BCCH 1BCCH 3H1JH 3L70H 3H1HH 1SQQH 1P84F 1L0NH 1SQXH 1EZVH 1NTKH 3L73H 5KLVH 1SQVH 1NTMH 3CWBH 1L0LH 2A06H 3CXHF 3L75H 1NU1H 1NTZH 3L71H 3H1IH 1BE3H 3BCCH 2IBZH 4PD4F 3H1LH 1KB9F 3H1KH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PP9 H;  2FYU H;  3L74 H;  3CX5 F;  3L72 H;  1PPJ H;  3TGU H;  1KYO F;  1SQB H;  1BGY H;  1SQP H;  4D6T H;  4U3F H;  2BCC H;  1BCC H;  3H1J H;  3L70 H;  3H1H H;  1SQQ H;  1P84 F;  1L0N H;  1SQX H;  1EZV H;  1NTK H;  3L73 H;  5KLV H;  1SQV H;  1NTM H;  3CWB H;  1L0L H;  2A06 H;  3CXH F;  3L75 H;  1NU1 H;  1NTZ H;  3L71 H;  3H1I H;  1BE3 H;  3BCC H;  2IBZ H;  4PD4 F;  3H1L H;  1KB9 F;  3H1K H; 
#chains in the Genus database with same CATH topology
 3RT3 C;  3JAR B;  1OCR B;  3C90 A;  1NR1 A;  1XBL A;  4DR1 O;  3K9A A;  4YJ2 A;  1IVS A;  5KHK A;  1WPB A;  2E5L O;  3K79 A;  1Z5W A;  2JVD A;  3CXH F;  2JEX A;  3JAK B;  4GX1 A;  2D2C B;  4PD4 F;  1IDS A;  1UPG A;  1MOF A;  1KEC A;  1GN6 A;  1XL6 A;  2PYJ A;  3I55 V;  3HR0 A;  3FB7 C;  4KHP O;  1Z2G A;  2HJF C;  5LOV B;  5A9G A;  5CA0 B;  1X4T A;  1HNX B;  4F4L A;  2YIA A;  1SQF A;  1NTM H;  1M9N A;  1U96 A;  3AK1 A;  5FPO A;  1BQ0 A;  2Q5Z A;  3M7M X;  3O65 A;  3DXR B;  1NKD A;  5J9P C;  2B9Z A;  2EIK C;  5JVD A;  5KHJ A;  1XNQ O;  3RYF B;  2ZR2 A;  2RQ6 A;  5JQG B;  1VQO V;  1P49 A;  3AG3 B;  2CH7 B;  2XAH A;  4LC1 A;  2QGN A;  3CJH A;  1I94 B;  1D2D A;  4LF7 O;  1SQQ H;  4PDL A;  5E1A C;  2DWE C;  4LFB B;  5ITZ A;  2Y0P A;  4ZI7 A;  4E4E A;  1I0H A;  2WLL B;  5HFL A;  5DN6 G;  1NVP D;  1N4C A;  1RSO A;  1NBM G;  1MG1 A;  2LGW A;  5IYC O;  2EIM B;  1BGY H;  4TV9 B;  4U3F H;  2W0X A;  1MAB G;  3TJT A;  2ZKO A;  2QWQ B;  4OX9 O;  3AG2 C;  3CD6 V;  3EVK A;  1N33 O;  3KCX A;  1V54 C;  2IBZ H;  4B3S O;  2YDE A;  3BEH A;  2IH1 C;  1FXH A;  1DK1 A;  4RAI A;  5DED A;  1XL4 A;  1F4M A;  4K8X A;  1NZ6 A;  2F4V O;  4PDR A;  4TQD A;  4O2A A;  4LFA O;  2D3O W;  3T1Y B;  4DRX A;  5BR8 B;  3BCC H;  4DV4 B;  4O4H B;  5IY5 C;  3LUT B;  3GWK C;  4JYA O;  5HFM A;  5LGT A;  2A0L A;  1O9G A;  3HKC A;  4X62 B;  3PN1 A;  2N05 A;  1QU7 A;  3SJC C;  1CEZ A;  3KZI Z;  4LWS B;  4O4L B;  4NR1 A;  1GM7 A;  4R50 A;  1VF5 B;  3U11 A;  1SQX H;  4GKJ B;  4JI3 O;  1TUB A;  3CWB H;  2ZR3 A;  3F5W C;  1NTZ H;  1M57 C;  1V55 C;  3D36 C;  1AB3 A;  1F7Y A;  1T5E A;  5GON B;  2LQT A;  1I5X A;  4JTC B;  1PL0 A;  3JAL A;  4LP8 A;  2VQE O;  4LF6 B;  4DUY O;  4QIW F;  1FXK B;  3C3S A;  3P3P A;  1S5H C;  4MT8 A;  1NR7 A;  3ETG A;  2HVJ C;  4QGP A;  4XDK A;  5KLV H;  3TK1 A;  4PHZ A;  1JOY A;  5B1O A;  3B8M A;  3ZRW A;  1R3K C;  1DTO A;  3JAS B;  3W7S A;  4MVQ A;  2PF4 E;  4I0X B;  1CP9 A;  4CC5 A;  2Z0A A;  3D3Q A;  2Y69 B;  3ZS8 C;  4X64 B;  2RDC A;  4MVO A;  3HKD A;  3HKB A;  4DV1 B;  4NTW A;  3HB3 B;  5B1B C;  3E83 A;  1Y4M A;  3AG1 C;  3N27 A;  4JI2 B;  2LP7 A;  5LHG A;  2HKO A;  4X20 A;  2UUC B;  1ZL8 A;  4AQY B;  4X1K B;  3FD9 A;  3J81 N;  5IJ0 B;  3OTF A;  1QVF U;  3JAW B;  5LMU B;  1Y6X A;  2P06 A;  2H3O A;  5EZY B;  3K08 A;  1WB7 A;  2ZNI A;  3ABU A;  4HYO A;  4J9Z B;  3CCL V;  2Q8V A;  2F95 B;  2UXN A;  1OZ0 A;  4I50 B;  4I9W A;  2XND G;  1VQL V;  3DC5 A;  1CPY A;  4TOI A;  2HEP A;  4IGG A;  1IBL O;  1XMQ O;  4AI8 A;  1ORQ C;  3ZHR A;  1PNK A;  3U10 A;  4K0K B;  1H2G A;  2BTQ A;  4GX0 A;  2BE3 A;  2JJ2 G;  2M7W A;  3W7W A;  3RYI B;  2ZE7 A;  3H9V A;  3TET A;  1MSD A;  2LGQ A;  2PTM A;  3BAA A;  2V4D A;  4F6E A;  1R3J C;  3K5M A;  5L3G A;  1D5N A;  5H9C A;  5JWP A;  3ABK C;  4FLZ A;  2ODM A;  2QSA A;  1Z5V A;  4MTO A;  3OUS A;  4IHJ B;  1H8E G;  3E22 A;  4GKK B;  1I5Y A;  2PY5 A;  5C8Y B;  4JI6 B;  2ZIM A;  2P90 A;  2ZDI A;  1VMG A;  2ITC C;  3LNM B;  3SPJ A;  4X1I A;  2DE0 X;  4RWU A;  3FYI B;  1SQG A;  3GVM A;  1K5Q A;  2FYU H;  4I7Z B;  4FFK A;  5KA5 A;  4PA9 A;  5J2T A;  1VF6 C;  1YJN V;  1IXB A;  4FLW A;  1YDX A;  3MDS A;  3FB8 C;  2HR3 A;  3E2E A;  3JSL A;  3N2K A;  3ASN C;  2BOC C;  2VS0 A;  3LDD A;  2GSM B;  4X66 B;  1NT2 B;  1GM8 A;  5IYD O;  1PNM A;  2CTW A;  1TUE B;  1JJ2 U;  1PKX A;  1XDC A;  3OUF A;  5CA1 A;  2EJ7 A;  4FM0 A;  3CC4 V;  4O2B B;  4HZ3 A;  3FAV A;  4BR6 A;  4NXN B;  4PA6 A;  4B3T B;  4L8J A;  1EZV H;  3ZRV A;  2ZE8 A;  3ML0 A;  2P6J A;  1Y67 A;  4YJ2 B;  4IYI A;  5L3E A;  1U97 A;  3FX7 A;  1AJP A;  2BTO A;  3K57 A;  1WPX A;  4H33 A;  2OCC B;  4X65 B;  1M56 B;  1PPJ H;  3E8F A;  4CH4 A;  4DYL A;  4DR4 O;  2UXB O;  4I4T A;  1N32 O;  2EIJ B;  4DV2 O;  3W7T A;  3CCE V;  4GCZ A;  2OIG A;  1FAF A;  2ZXW B;  1AI4 A;  3UO3 A;  4UCO A;  3IAY A;  1TVK A;  1MZE A;  2CTR A;  2GV9 A;  1KMI Z;  4RUE A;  5LMN B;  1WA8 A;  3SR2 C;  3TXS A;  1K97 A;  2QE7 G;  4YHH B;  1I94 O;  3FYE B;  1YJW V;  4DK1 A;  2NN4 A;  2YIC A;  4JYY A;  2E76 B;  2EIN B;  5JVD B;  4JF3 A;  1JFF B;  2E3C A;  2A06 H;  1IX9 A;  4L87 A;  1IBK B;  4CZZ A;  3CJH B;  4NTX A;  3ZMU A;  1SS3 A;  1GN4 A;  3Q4H A;  5KA6 A;  3U0Z A;  4O4I A;  5ITZ B;  3FFQ A;  4WFA V;  2Z5U A;  3TXQ A;  5CBF A;  4TUY A;  2XAG A;  1KKC A;  1ARO P;  1RSO B;  1Q7Y W;  1NQT A;  1S5L Z;  1NU1 H;  4YJ3 A;  1QVG U;  4FFB B;  4DV5 O;  4JI5 B;  3HPL C;  1TAE A;  1XEQ A;  4H13 B;  4NXM O;  1OCR C;  1G1X B;  2DWD C;  2WLM A;  5LP6 A;  1SA0 A;  4CC6 A;  1KUQ A;  2PUS A;  1LNQ A;  1BCC H;  1S0V A;  3OD4 A;  3ZHS A;  4FMT A;  1YIJ V;  1LR1 A;  1K4D C;  1N8R W;  3H1I H;  4QE9 A;  4JI8 O;  3VQW A;  1PP9 H;  4JI7 O;  4O2A B;  5L3B A;  2LW1 A;  3ZBH A;  3D36 A;  1XNR B;  2UUB O;  2LFR A;  1ROP A;  1WP8 A;  4DR7 B;  4I9Q A;  4DRX B;  1XMO O;  2HG5 C;  2Y4U A;  3L73 H;  2ZT9 B;  3HKC B;  2ZD9 A;  1GM9 A;  1H2M A;  1K3E A;  4OPH A;  3CRR A;  3S3X A;  2VQF O;  4NB5 A;  4JAU A;  1TUB B;  4D7S A;  3OGC C;  4JV5 O;  1N36 O;  4CS3 A;  1W0J G;  3TGU H;  3AG3 C;  1HR0 O;  1W2B U;  2ADQ B;  3JAL B;  1J95 A;  2Q69 A;  2OWO A;  4D6T H;  2ZE5 A;  4GYC B;  2RCV A;  2QKA A;  1GN2 A;  3CYO A;  1R6K A;  2YXL A;  4JI1 B;  2ZM6 O;  1H2S B;  2Q0O C;  1OCZ B;  4HAM A;  4AHC A;  1VAR A;  2FML A;  3UKM A;  1KB9 F;  2IW5 A;  4U3J A;  2WSS G;  3RYH A;  1K4C C;  3CX5 F;  1L1F A;  1SKV A;  3K58 A;  2EIM C;  4AIL C;  5CBG A;  3CPW U;  3ZRW B;  2UUA O;  2JS3 A;  3A0B Z;  4CH3 A;  3JD4 A;  2DYR B;  1QQC A;  2IJJ A;  1SER A;  3RFR A;  2UXD O;  1UFI A;  1VQ9 V;  4DV7 O;  1H2K A;  2B5U A;  3IFX A;  5D5Q A;  4YY3 B;  3G6B A;  1M1K W;  4TT3 G;  3VQX A;  4UB6 Z;  4EKW A;  1HNW O;  4CBC A;  1N34 B;  3JAM N;  4J9Y B;  2VWK A;  3HKD B;  3HKB B;  2OIE A;  1COW G;  4DV3 O;  3OM3 B;  2ZE6 A;  3PJS K;  3K59 A;  1Q5O A;  4YXW G;  4ZOL A;  4F6R A;  4UV8 A;  4MVS A;  2X7R B;  1N0N A;  5IJ9 A;  4X20 B;  4KFM A;  2GDS A;  3CCQ V;  1B3Q A;  2GTS A;  2VWJ A;  1ZL8 B;  3DC6 A;  4CS4 A;  3WG7 C;  5AG2 A;  2JIZ G;  1QLE B;  5LHI A;  4WFH A;  3R65 A;  2Q6A A;  3CCR V;  3SJA C;  4W4L A;  1Q81 W;  3CC2 V;  4WFG A;  2BOB C;  5FL7 G;  2HLD G;  1VQK V;  4CH5 A;  3ABM B;  1GKF A;  3ETQ A;  4J80 A;  5CA3 A;  4DV6 O;  2X0L A;  3RYC B;  1VQP V;  1YF2 A;  5JCO C;  1PD3 A;  1FXK C;  1K9M W;  3KKY A;  2WPD G;  3CCJ V;  1VEW A;  2UU9 O;  1E1Q G;  2BTQ B;  1EN5 A;  4B3R B;  1VQN V;  1XRE A;  4G27 B;  1JQ0 A;  3GB7 C;  2PI5 A;  3VQV A;  1P4R A;  3K03 A;  3N2G A;  1BE3 H;  1B04 A;  2P4K A;  3E8G A;  5BMV A;  3QO8 A;  4MVZ A;  1SQB H;  4O4J A;  1AR1 B;  2NNU A;  4Z1V A;  2Y69 C;  3B8N A;  3K0G A;  4P9O A;  5JH7 A;  2IJK A;  4UVA A;  3FKS G;  3ZN0 A;  1MA1 A;  1VF6 A;  1FJG B;  1AP6 A;  1GRJ A;  4DK0 A;  1J5E O;  4JZG A;  2IM9 A;  1OCO B;  4HBN A;  4R7C A;  2F93 B;  4IIJ B;  2JK5 C;  4X1Y A;  2IU0 A;  3OT7 A;  2F1M A;  3BA8 A;  4X1I B;  1B06 A;  4OGQ B;  3OGI B;  1S3J A;  3ABL C;  3SJB C;  4FPP A;  4W4K A;  1GTO A;  1K34 A;  3CEI A;  5J2T B;  1G4Y B;  1F4N A;  3G67 A;  2W6I G;  3P30 A;  4DO2 A;  1ZX3 A;  3JAT A;  1JVM A;  3G80 A;  4XBF A;  2XOK G;  4DR2 O;  1OHH G;  4KL1 A;  1S76 D;  4QE7 A;  2Q7H A;  3B09 A;  4PJ0 Z;  4H37 A;  2DQ0 A;  1EM1 A;  4BAY A;  1XHX A;  2QM8 A;  3P32 A;  5DM6 V;  3QVN A;  1X59 A;  1M5I A;  1TA8 A;  3T4Z A;  4QJF B;  5CA1 B;  3FAV B;  2XHB A;  2XAF A;  3JYC A;  5H6Q A;  4JI0 O;  2YSU B;  3UT5 A;  1HW7 A;  3L74 H;  4P9P A;  2GBO A;  4DV0 B;  4DR3 O;  1VQ6 V;  3CCV V;  4PA7 A;  4WFF A;  3CXC U;  1YIT V;  2Y0I A;  1M93 A;  1NTK H;  3QF7 A;  3ZX6 A;  5IWA B;  4DUZ B;  1K92 A;  3SYA A;  2HJD A;  3VOU A;  3DSQ A;  5GW7 A;  4JI4 O;  1BQZ A;  2B1I A;  4FLX A;  4LF8 O;  3ZHU A;  2QTO A;  4DR5 O;  4LF4 O;  2QWO B;  1RPO A;  2HHH B;  5B3S C;  5FLX N;  2DMX A;  3ASO B;  1WP7 A;  1FFT B;  4RQE A;  1RM1 C;  3M8A A;  3R66 A;  1WA8 B;  3SDL A;  1ZAU A;  1XI1 A;  3C3T A;  1HNZ B;  1IBM O;  1YVW A;  2CE4 A;  5A2Q N;  1URF A;  4IT5 A;  4NKG B;  2LJ2 A;  4FLY A;  2JGD B;  4CS2 A;  2QR4 A;  4J11 A;  1BL8 A;  1AR5 A;  1SF9 A;  4B3M B;  3E8H A;  3JAR A;  3Q4H B;  2UXX A;  4O4I B;  5B1A B;  4I55 A;  4TUY B;  2YUA A;  2WAM A;  1YTF B;  5IYZ A;  3LDC A;  1NH2 D;  1PV0 A;  3OTO B;  4ZHQ A;  3K0D A;  4YJ3 B;  2CTQ A;  4DR1 B;  4LF9 O;  4PDV A;  2CGO A;  3T4D A;  5JJE B;  4EEQ A;  3W7U A;  2E5L B;  2KQX A;  2RMK B;  5LP6 B;  4D7T A;  2NR5 A;  3SGI A;  1RPR A;  2EZO A;  4LBE C;  4X8A A;  3K04 A;  4UFZ A;  2FKX A;  4LR3 A;  4DR6 O;  2KG7 A;  3STL C;  4J10 A;  4RUF A;  2YIB D;  4KHP B;  1LUW A;  1BS3 A;  2CK3 G;  4LNU A;  1G8M A;  2E75 B;  2UXC O;  2EIJ C;  4FLT A;  4LF5 O;  4XDJ A;  4KP4 A;  3OR7 C;  3HKE B;  2YID A;  1YEW A;  2CH7 A;  1KKD A;  2ZXW C;  2Q4P A;  3JSN A;  1XNQ B;  2AHZ A;  2WLL A;  3RW0 A;  4MW8 A;  4FIP C;  3CCS V;  4LF7 B;  3EXA A;  3BAB A;  4GX2 A;  2A9H A;  4DW0 A;  5LBQ A;  4BIZ A;  3T1H O;  3ZHV A;  3LSS A;  1KYO F;  5LXT A;  5C93 A;  3OMI B;  3H1J H;  4U3J B;  2YI9 A;  1OV9 A;  3J7A U;  4UB8 Z;  4OX9 B;  3RWR D;  2JJ1 G;  2Q68 A;  2Q7E A;  3S3W A;  2AZ2 A;  3KG2 A;  1N33 B;  3SYO A;  3WB0 A;  4B3S B;  2EIL B;  1KBH A;  5B1B B;  4UCV A;  1RFY A;  5J2U A;  3AG4 C;  1IUR A;  1LUV A;  2PGG A;  4B7E A;  2F43 G;  4TSF G;  2F4V B;  5F2V O;  3ZMZ A;  5H2F Z;  3UCS C;  3P3N A;  4LFA B;  4LFC B;  2OTJ V;  1DF4 A;  3RGB A;  1NJI W;  4UCS A;  2JGU A;  1P7G A;  4ZOL B;  4F6R B;  3IC9 A;  2WWW A;  4JYA B;  1MSW D;  2KSD A;  1R6N A;  2ATK C;  4JGS A;  1ZLZ A;  1HNX O;  2XTA A;  4EFB A;  4U7O A;  1FXK A;  3L70 H;  4E2L A;  3ZMT A;  1DGS A;  4JI3 B;  2LW7 A;  1AR4 A;  2QKS A;  5KMG A;  2BSK A;  5KX5 A;  4X89 A;  1BT8 A;  2VQE B;  1O9H A;  3DGE A;  2YIB A;  4DUY B;  1Y76 A;  2OTL V;  3BHP A;  5LL6 Y;  1QNM A;  2ETN A;  3ZN1 A;  3H1H H;  3A0H Z;  4LFB O;  1BHA A;  1R3I C;  3QNE A;  2YXH A;  3CRM A;  1K73 W;  1IXM A;  3ABK B;  4I0X A;  1E79 G;  2R72 A;  2AZ0 A;  3OMA B;  2QDO A;  1OCZ C;  2KB1 A;  2R9A A;  5FNV A;  5B66 Z;  3MHH C;  4MTG A;  1KU9 A;  3JD0 A;  2GUZ A;  4MS2 A;  5KUK A;  5EK0 A;  3N2G B;  4ZI7 B;  3H01 A;  2X6A A;  2DYR C;  2ZIO A;  3EHB B;  1MNG A;  2H94 A;  1YXB A;  4JTD B;  1L0L H;  5EYP A;  2XAQ A;  4O4J B;  1VIB A;  3BFR A;  5JH7 B;  2W0F C;  3AK2 A;  3VQY A;  3JD2 A;  3OEH G;  3K06 A;  3WU2 Z;  3FB6 C;  3JAW A;  4ASU G;  3GWO A;  4FJC C;  4FZ1 A;  3G6E V;  4IYH A;  3CCM V;  1S72 V;  3K5O A;  1EFR G;  2YS8 A;  4TV8 A;  4GUN A;  5EBM C;  3ASN B;  4Q20 A;  3T1Y O;  5E79 Z;  2XAJ A;  5BR8 O;  4DV4 O;  3UQ8 A;  4WFB V;  3E35 A;  3D3I A;  3FB5 C;  4TWK A;  3OFN G;  4JYB A;  4X62 O;  3ZMV A;  1GK9 A;  1DLB A;  1AJN A;  3IJ4 A;  3K5N A;  1I7F A;  2WLI A;  2XAS A;  1Q3E A;  4PI0 A;  3JAT B;  3W7X A;  4GKJ O;  5D5P A;  4A5U B;  1IBL B;  1XMQ B;  1Q8I A;  2N74 A;  4UCR A;  1WAZ A;  4LF6 O;  4MVR A;  5H5N A;  3SYC A;  4PV1 B;  2A79 B;  3ZED A;  5JJJ B;  3I5D A;  1FFX A;  4PA3 A;  3ETD A;  5IYB O;  2AXT Z;  4K8Z A;  1IZ3 A;  3E8B A;  1YCI A;  1JX9 A;  3LSQ A;  2KKW A;  3RN4 A;  4WF9 V;  2YEV A;  5DEC A;  5K1X A;  3UT5 B;  2MK3 A;  3CRQ A;  3ZCC A;  3JCU Z;  1I08 A;  2YXY A;  4H44 B;  5KHH A;  1ZWI C;  3WB1 A;  3G4S V;  4N21 A;  3LSU A;  4WBN A;  1EBO A;  4WCE V;  1THZ A;  2L35 A;  1JR9 A;  1Y66 A;  3CSX A;  3ETE A;  3RVZ A;  3AK3 A;  3A0R A;  1K5S A;  2A3Q A;  5KAF Z;  2DYS B;  4X64 O;  3CRA A;  2JS5 A;  5CN0 A;  4EFE A;  2CTP A;  3A2F A;  2HFE C;  4C7U A;  5CB4 A;  3CC7 V;  4UVC A;  1N0J A;  4DV1 O;  1OCO C;  2WA3 A;  4K3A A;  4JAS A;  2O57 A;  3B4S A;  1AI6 A;  1NVP B;  4JI2 O;  3L72 H;  4QPK A;  5LYJ A;  2UUC O;  1L8D A;  4AQY O;  1S5J A;  4J7J A;  1QLN A;  3CP1 A;  1SES A;  5LMU O;  1AJQ A;  3ZRS A;  4QNH B;  1KP3 A;  2R9I A;  4U7N A;  3SPG A;  5L3C A;  3KCY A;  3LDE A;  3ZHQ A;  4I55 B;  5EC1 C;  1VF7 A;  3ICX A;  3CE2 A;  5IYZ B;  1WLE A;  1EN4 A;  1SQV H;  2YI8 A;  4K0K O;  1JCH A;  1HP8 A;  1H8H G;  4ZHQ B;  1XUQ A;  1KQS U;  4P30 A;  3QTC A;  4MVM A;  2QWN B;  3JD1 A;  2P5O A;  1WB8 A;  3MHS C;  4ZBM A;  4BW9 A;  4I5S A;  4BW5 A;  2JEU A;  3WB2 A;  1M90 W;  1OCC B;  2C2A A;  4DR4 B;  4NTY A;  2UXB B;  1N32 B;  2OT5 A;  3X2Q B;  2P4V A;  4DV2 B;  1S77 D;  2RN9 A;  3CB2 A;  2KG7 B;  3AEI A;  2IJI A;  4GKK O;  1F51 A;  4LNU B;  4PDM A;  3CMA V;  3H1K H;  1XHZ A;  1JFF A;  2EZP A;  1R1B A;  4X88 A;  1FD9 A;  4UV9 A;  1BHB A;  4JI6 O;  1Q6I A;  2EJR A;  2Q73 A;  3MD0 A;  3ASO C;  1VP7 A;  1FYJ A;  3E22 B;  2MW2 B;  2QJ1 A;  4MVU A;  3CME V;  3SYP A;  1AI5 A;  1XIL A;  3OE7 G;  4UCT A;  1E1R G;  2ZCE A;  2R9R B;  1BZK A;  1NI8 A;  4FFB A;  3ZIA G;  3JCZ A;  5KAI Z;  1DF5 A;  1H2L A;  3QO7 A;  1W59 A;  5B1A C;  1K7D A;  1R73 A;  5LXT B;  1SZT A;  4X66 O;  2FB5 A;  4DV5 B;  4MW3 A;  5LGN A;  2WA4 A;  2ARH A;  4NXM B;  4UXN A;  3N2K B;  1HDJ A;  4NXN O;  4B3T O;  4HNA A;  2CDY A;  2P22 C;  2L6L A;  5LP6 C;  3OEE G;  4LFC O;  4ABM A;  2ADP A;  2Y48 A;  4GLX A;  2K1E A;  2WLH A;  2JDI G;  5J2U B;  2OYQ A;  1NH2 B;  3EFF K;  2DOS A;  4B08 A;  4X65 O;  4JI8 B;  3WG7 B;  2IH3 C;  1Y74 A;  4JI7 B;  2RNB A;  3A8T A;  4JYC A;  1QR8 A;  4R6Z A;  3BA9 A;  4UUJ C;  2UUB B;  2BCC H;  1Q90 D;  3JD3 A;  1XMO B;  1VQ5 V;  1WN7 A;  5CMU A;  2F23 A;  1QCE A;  2RJZ A;  5EC2 C;  1SET A;  5GTI Z;  1SC5 B;  2EIK B;  4I4T B;  2VQF B;  2A7W A;  5LMN O;  5KMG B;  2BSK B;  4YHH O;  4JV5 B;  5KX5 B;  1N36 B;  5JJN B;  2IU3 A;  3B40 A;  1HR0 B;  2Z3Y A;  1WJZ A;  4EB6 A;  3ZHT A;  1L0N H;  1TVK B;  2AHY A;  1IBK O;  1Y76 B;  1F23 A;  5LA6 A;  3ZMS A;  2ZM6 B;  1GO3 F;  1K33 A;  2QWP B;  3ABT A;  2N04 A;  5IT9 N;  3T1C A;  1Q82 W;  4PA4 A;  4WFE A;  5BY1 A;  4QPJ A;  2W6J G;  4BWA A;  3K9S A;  3E86 A;  1YHQ V;  1JPX A;  5FNV B;  4GT1 A;  1Q43 A;  2JRI A;  2UUA B;  2QWR B;  4XDL A;  2ILM A;  2V7Q G;  1Q86 W;  2GUZ B;  4B7K A;  3BY6 A;  3AG2 B;  4JI5 O;  2UXD B;  1PM9 A;  4DV7 B;  1V54 B;  2EIL C;  2ZQM A;  1KD1 W;  3H1L H;  1UJW B;  2ZIN A;  5L3D A;  4JPR A;  5EYP B;  1HNW B;  1HWY A;  3JAK A;  3ABL B;  4DV3 B;  1OJH A;  5IE9 A;  4PEL A;  2LO1 A;  4NVP A;  2P67 A;  1VQ7 V;  1SA0 B;  4FLU A;  5LOV A;  3M99 B;  5CA0 A;  1R6T A;  5IY5 B;  2DN9 A;  1MZF A;  2OCC C;  1M56 C;  4TV8 B;  3RYC A;  1XNR O;  2R70 A;  4DR7 O;  2XT9 A;  3DXR A;  5LGU A;  4Z1M G;  1P84 F;  3APO A;  1MMM A;  3RYF A;  1SRY A;  3L75 H;  4ZIB A;  4BIO A;  4DV6 B;  1M57 B;  5JQG A;  1V55 B;  1GN3 A;  2WLI B;  1VQM V;  5B5E Z;  4ICG A;  5BXZ A;  4J41 A;  1Q6U A;  1GH6 A;  1H38 A;  4GZR B;  3SYQ A;  5EIB C;  2UU9 B;  2X6B A;  1SQP H;  4OPA A;  2CAZ C;  2EIN C;  3E89 A;  3OW2 U;  3CCU V;  4LH6 A;  1FFX B;  1G6U A;  3OAA G;  4JI1 O;  1JJO A;  1P7B A;  3B77 A;  4FM1 A;  2FL4 A;  3DTU B;  3ZRX A;  3NXS A;  1QBZ A;  4TV9 A;  2YEV B;  3B2E E;  3SPI A;  1AI7 A;  2ZNJ A;  2AGA A;  1PL4 A;  2EUL A;  1D5A A;  5B3S B;  2M6Y A;  4FK5 C;  4IIJ A;  4K35 A;  4WBN B;  1RM1 B;  4YIO A;  1KP2 A;  3RYH B;  3G71 V;  1YTF D;  4YY3 O;  1M4U A;  3CHX A;  1V9P A;  1J5E B;  1JA8 A;  1GAX A;  3SPH A;  5LHH A;  5K1P A;  2YC0 A;  1AP5 A;  1N34 O;  5CB4 B;  2WLK A;  4RQF A;  3AG1 B;  4J42 A;  1KC8 W;  4O4H A;  2Q7G A;  2X6C A;  5IDJ A;  5LYJ B;  3F7V C;  3TCU A;  2B1G A;  4LWS A;  4J7Z A;  4O4L A;  1BMF G;  2HVK C;  4LH7 A;  1H2N A;  4J7K A;  4DXW A;  1JMK C;  4DR2 B;  5BZB A;  4YIP A;  5IJ9 B;  5GON A;  4FM2 A;  5JCO A;  3ZJZ A;  2CUG A;  1QHT A;  3IC7 A;  4KXR A;  4JAA A;  2LFS A;  1VQ4 V;  3RBZ A;  1QR9 A;  1ZTE A;  2DW4 A;  1US6 A;  4JI0 B;  2GHY A;  2QM7 A;  5KHI A;  3AG7 A;  4UCU A;  1AIL A;  4DR3 B;  2WLJ A;  2E74 B;  4MTF A;  4B3R O;  3J80 N;  1VQ8 V;  1SZX A;  1PNL A;  3QO5 A;  2DQ3 A;  4N23 A;  2XUM A;  5CBH A;  3JAS A;  4IL6 Z;  1Q6H A;  3D8C A;  3APQ A;  2NLJ C;  4JI4 B;  2QEX V;  4LF8 B;  2P7T C;  4JZ2 A;  4DR5 B;  2VRZ A;  4LF4 B;  4G2K A;  1GMG A;  2DYS C;  4Z2W A;  1ENV A;  4DW1 A;  1FPO A;  4Q6G A;  5GTH Z;  1YJ9 V;  3IGA C;  2EX3 A;  2GTA A;  4JAV A;  3RVY A;  1FJG O;  2JGD A;  1YI2 V;  5BMV B;  1AVM A;  2OCH A;  2QM4 A;  5H6R A;  2FTK A;  1FXV A;  1IBM B;  4X1K A;  5IJ0 A;  2G38 A;  5EBL C;  5EZY A;  3O9O A;  3SJQ C;  4X1Y B;  3NR7 A;  4I50 A;  4JTA B;  3L71 H;  5FPR A;  4G28 B;  2H8P C;  3LNN A;  4BIU A;  4NYK A;  3UO2 A;  1QLE C;  2HP8 A;  3WFV A;  2V1D A;  5L3F A;  2QA4 V;  3UM7 A;  5KHG A;  4FVM A;  1ZSP A;  3AG4 B;  3VBB A;  4LF9 B;  3RYI A;  3ABM C;  4OXS A;  4RO2 A;  4ZKI A;  2Q67 A;  1BSM A;  3BVO A;  5KUM A;  2ITD C;  4P2Z A;  1XQ8 A;  1A32 A;  4HNA B;  4PI2 A;  3STZ C;  1FKA O;  4DV0 O;  5B1N A;  3HKE A;  1NS1 A;  5EIB D;  3I56 V;  1W0K G;  4UVB A;  2PZS A;  3K3W A;  3K5L A;  1OCC C;  4IHJ A;  4DR6 B;  2Q9L A;  5IWA O;  4DUZ O;  2UXC B;  4LF5 B;  3X2Q C;  4KUM A;  1Y74 B;  1YZB A;  3OMN B;  5C8Y A;  2K9P A;  5TIS Z;  2Y4T A;  2EBO A;  1EN6 A;  3F5T A;  1YSC A;  1K8A W;  3CRC A;  2HHH O;  4LCU C;  5EBW C;  3BPZ A;  2QTS A;  2F66 C;  2Q0A A;  3L9D A;  1R3L C;  4GX5 A;  3THO A;  1RP3 B;  4TQF A;  2AW9 A;  1HNZ O;  2QKC A;  1CXZ B;  4EB6 B;  3SPC A;  2ZDI C;  4CH6 A;  3F7Y C;  4FZ0 A;  4FLV A;  3T2M A;  3CS5 A;  3T1H B;  1EZJ A;  5LA6 B;  4X9Q A;  1WNS A;  4B3M O;  3BRC A;  2PYL A;  4MSW C;  3QG5 A;  4H0L B;  1ZUQ A;  2PI4 A;  4R8C A;  1B6Q A;  3MAQ A;  2IJH A;  2CGN A;  2WLN A;  4O2B A;  2DJV A;  1XOU A;  1TGO A;  3OR6 C;  4MTX A;  3OTO O;  1FS0 G; 
#chains in the Genus database with same CATH homology
 1PP9 H;  2FYU H;  3L74 H;  3CX5 F;  3L72 H;  1PPJ H;  3TGU H;  1KYO F;  1SQB H;  1BGY H;  1SQP H;  4D6T H;  4U3F H;  2BCC H;  1BCC H;  3H1J H;  3L70 H;  3H1H H;  1SQQ H;  1P84 F;  1L0N H;  1SQX H;  1EZV H;  1NTK H;  3L73 H;  5KLV H;  1SQV H;  1NTM H;  3CWB H;  1L0L H;  2A06 H;  3CXH F;  3L75 H;  1NU1 H;  1NTZ H;  3L71 H;  3H1I H;  1BE3 H;  3BCC H;  2IBZ H;  4PD4 F;  3H1L H;  1KB9 F;  3H1K H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...