3CX5F

Structure of complex iii with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
74
structure length
74
Chain Sequence
VTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHKEDCVEEFFHLQHYLDTATAPRLFDKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 30
structure length 74
sequence length 74
chains with identical sequence Q
ec nomenclature
pdb deposition date 2008-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3cx5F00
1SQXH 3H1HH 1P84F 1NTMH 1NTZH 1KB9F 2A06H 3H1JH 2FYUH 5KLVH 1L0NH 4D6TH 1PPJH 1PP9H 1SQVH 2IBZH 3CXHF 3H1LH 1EZVH 1SQQH 1BE3H 3L71H 4PD4F 1NTKH 3BCCH 3TGUH 3L73H 3H1KH 3L74H 1KYOF 3L75H 2BCCH 1BCCH 1SQBH 3CX5F 3CWBH 3H1IH 1NU1H 1BGYH 3L72H 3L70H 1SQPH 1L0LH 4U3FH
chains in the Genus database with same CATH superfamily
2QWOB 1LUVA 1JPXA 4B3MO 2ITCC 4RUFA 4YHHO 2HG5C 1SZTA 4HNAB 2A0LA 3ZHSA 3P3NA 1KP3A 2JEXA 3LDDA 1M57B 4RQFA 3P3PA 4K8ZA 2YEVA 3OTOB 1OZ0A 5BY1A 5LA6B 2QWQB 5B5EZ 2YC0A 3T1CA 4DO2A 2Q67A 2WLLA 4NXNO 2ATKC 4WFGA 4O2BA 5C8YB 3IGAC 5LGUA 2VQEB 1NBMG 4NTXA 4UVCA 4TV9B 3TJTA 4C7UA 2WSSG 3E86A 3FB6C 4JI3B 1NVPD 4GX0A 1B3QA 1MZFA 1N32O 2H3OA 2WLIA 3JASA 4NTWA 1XMQB 2BTQB 1PD3A 5EC2C 4J9ZB 3RYFB 2E3CA 1WP7A 1H8HG 3HKCA 4PDMA 5B3SC 3JATA 4Q20A 4IYIA 1M56C 2RMKB 4DK1A 1EN5A 2N74A 1BQ0A 2X6BA 4LWSB 4X64B 4DV0B 5LP6A 2YUAA 5E79Z 3W7TA 3QO5A 5GONA 3RYIA 1LNQA 1QLEB 4E4EA 4J42A 4I0XB 2CH7B 2WLMA 4IT5A 1BT8A 4TWKA 1ORQC 1P84F 1H38A 1ZTEA 4LP8A 2AZ0A 3AG2C 4O4JB 4YIOA 1XHZA 1QVFU 2LJ2A 4IIJA 1EZJA 5L3CA 1H2GA 4JI5O 4WFFA 1WPBA 4MVSA 4PV1B 1MABG 4DV7O 1K7DA 3AG1C 5KA5A 2OIGA 1A32A 5LHGA 2K9PA 4TSFG 2FTKA 5KLVH 3T1YO 1X4TA 2EBOA 4CS4A 2X7RB 4UUJC 4F6RA 2P90A 3K79A 1AP5A 4EB6A 3UT5B 2D3OW 3ASOC 2RDCA 4JTDB 4B3SB 4LC1A 4LFBB 5IYCO 1AR1B 5E1AC 4JAUA 3H1JH 4QJFB 3N2GA 3CD6V 4WFEA 3CP1A 3LNMB 4B3MB 1MSWD 5F2VO 3CCJV 4YHHB 4I55A 3K5MA 3RVYA 3ZJZA 4OPAA 4ZBMA 4UVBA 2WLKA 5J2TA 4DR2O 4UV8A 3HPLC 3ZCCA 3TXQA 1FXKB 1URFA 5DM6V 5JH7B 1QHTA 4HZ3A 1BMFG 1KP2A 3S3WA 1OCCC 1P49A 1XOUA 4EFBA 4LFAO 3BA9A 1E1RG 2OIEA 4U7OA 2AHYA 1OCZC 1F4NA 3F7YC 3ZMZA 4I50B 5LOVA 5EBWC 1SESA 1Q3EA 2CK3G 4I9QA 1PL0A 4YJ3B 1QQCA 2Q5ZA 5B3SB 1AB3A 1N32B 4DUZB 3W7XA 5H6QA 5EC1C 4B7KA 1D5AA 1JA8A 2XAFA 3IC7A 3O9OA 4XDJA 1BGYH 5J9PC 5JVDB 2EIJC 2WA3A 4WCEV 4MTFA 1NTMH 5EYPB 4UXNA 4QIWF 5IYZA 1NTZH 3QG5A 4ICGA 3E8BA 4W4LA 3CEIA 4B7EA 1RSOA 2ZXWC 2HKOA 5A9GA 2NN4A 1AJQA 3KCYA 1S5LZ 4PD4F 1EFRG 4DRXB 3ABUA 2BSKB 2QM4A 5GTIZ 3ASNB 4TOIA 3D36A 1S76D 2YIBD 2K1EA 3KCXA 4K35A 3AG2B 1DF5A 1KQSU 4ZIBA 4ZI7B 3H9VA 4TUYA 4X88A 2P06A 4UCUA 1VQNV 1SQFA 5EK0A 1SZXA 3JAWB 3K9AA 3JARA 4OPHA 5K1PA 4B3RB 2B1GA 4JI5B 2ODMA 1SA0A 3AG1B 2AZ2A 1FFXB 1DTOA 1QU7A 4PDLA 3U0ZA 2Q68A 4F4LA 4LBEC 3J81N 1MZEA 5FLXN 4DV7B 1GM8A 1GN4A 1PNKA 3D3IA 4DV1O 2QTOA 4KUMA 1N34O 3ASOB 3T1YB 1GO3F 1Q90D 1VQ8V 4GX1A 5CA0B 5KX5B 3K5LA 5LYJB 4RAIA 3W7UA 1IZ3A 1MOFA 5LXTA 2VQFB 5FPRA 2DW4A 2CTQA 3JALB 3VQYA 3QO8A 4R7CA 2PZSA 4DR4O 3OFNG 5IJ0A 1G4YB 1D5NA 4LF6O 3E2EA 4B3TO 2RJZA 1GH6A 2OCHA 3ZRWB 3KKYA 1YTFB 3ZMVA 2QKCA 4J10A 3RVZA 5KMGA 1GN3A 2WLJA 2AXTZ 5D5PA 3SPGA 3RBZA 3OGIB 1OCCB 4DR2B 1YF2A 1V55C 3DC5A 5HFLA 1VF6C 3NR7A 5EIBC 1H2NA 1R6NA 1NS1A 4J41A 1V54B 1OCZB 1SQBH 3HKEB 2CGOA 1IBLO 2JGDB 4JF3A 1K3EA 5K1XA 3JCZA 3FB5C 4U3FH 3ETGA 1SF9A 4LFAB 4FZ1A 3GWOA 1G8MA 2B1IA 5DN6G 1YHQV 3G71V 1J95A 1VQ5V 5EZYB 5ITZB 2PYLA 4IHJB 2E75B 2YSUB 5BR8O 2EZOA 4AI8A 1ZLZA 2EX3A 1WA8A 3ZBHA 1T5EA 3TXSA 5LMNO 1I94O 1Z5WA 3A8TA 3H1IH 1IX9A 2ADQB 1QCEA 4CS2A 2ZXWB 4I4TB 5FNVB 2HHHO 3C3TA 2FB5A 1YDXA 1M5IA 1VQOV 4UCVA 2ZIOA 2KQXA 4H0LB 3K5OA 3HKBB 4LNUB 5CA1B 1H2SB 2IH3C 4BAYA 2F66C 2VRZA 2CE4A 5H9CA 2W0XA 1R3KC 2YIDA 3IFXA 5LHIA 3CMEV 1FJGO 3VOUA 4NR1A 2BTQA 4MS2A 3RYFA 1TAEA 4J7JA 3JD4A 1YIJV 1L8DA 2KB1A 3M8AA 2GUZB 4OGQB 4GKJO 2VS0A 4WFBV 2HP8A 2QWNB 3FKSG 5IJ9B 1K4DC 1XNRO 3E22B 1QLNA 3K03A 3U11A 2JEUA 1RPRA 5LMUO 4IYHA 4QPKA 4GX2A 2IM9A 1VQPV 1N34B 3HB3B 1I08A 2BOCC 4G2KA 4JASA 3BRCA 4LH7A 4EEQA 4FM0A 1L0LH 4O4JA 5B1AC 3BEHA 3A0BZ 4RQEA 3N27A 3T1HB 1P4RA 4DR4B 1N0JA 2IW5A 4PDVA 3SPJA 3FAVB 3ABLC 4B3TB 3FFQA 4FK5C 4X62O 2O57A 1YEWA 4JI2B 1J5EO 1XHXA 4FFBB 2XTAA 4CH6A 3DSQA 5KHJA 3WG7C 2YICA 4JI8O 1VQ6V 2ZDIC 4U3JA 1VQ7V 2YIBA 4LF8O 1KBHA 4CH4A 3SDLA 3LSQA 5BMVB 2L6LA 2HEPA 1R3IC 3ZX6A 4YIPA 4FLZA 4O4LB 1SS3A 1IBLB 3RYHB 3PN1A 1D2DA 1Q6UA 2XAHA 2JJ1G 2IJHA 4OXSA 4WF9V 4A5UB 3JAKA 5A2QN 4O4HB 1NR1A 1ZL8A 5BR8B 2GDSA 4JTCB 3K0GA 3UCSC 1WJZA 3WB2A 1I94B 5LMNB 1RP3B 1TVKB 4X1IB 1IXMA 3AG7A 1FXKA 1XL4A 3ETQA 1RM1C 3FX7A 4IGGA 1BZKA 2HHHB 3SYOA 5IDJA 3ABTA 3X2QC 4BWAA 5JJJB 2JJ2G 3G6BA 1YXBA 3AG4C 2KSDA 4YJ2A 1LR1A 4GCZA 1S72V 1Z5VA 2KG7A 4U7NA 4Z1VA 3HKDB 1FD9A 2WAMA 4UB6Z 1AR4A 1SKVA 3BFRA 4B08A 4LCUC 1PV0A 1SQVH 4YJ3A 4N23A 4FJCC 4UB8Z 1NH2D 1RPOA 2WPDG 2UU9O 5CBHA 4WFHA 1FAFA 1KUQA 1H2LA 4JI7O 2ZT9B 1ENVA 5L3BA 4O4IA 3L72H 1SQPH 4X20B 1EBOA 5EYPA 1SQGA 1YCIA 5DEDA 2FL4A 4GKJB 1CP9A 3B2EE 1GMGA 2BSKA 4BIUA 1YITV 1GAXA 4MTGA 5B1AB 4GT1A 5EBMC 1S77D 2N04A 2P22C 4ZI7A 2JS3A 4NKGB 4LF4O 2JIZG 1R6KA 1KB9F 1OCOB 3CRAA 2QM7A 1O9GA 4D6TH 5D5QA 3ABLB 2V7QG 2CGNA 5EBLC 1NT2B 2P5OA 1R3JC 3TGUH 3BVOA 4O2AB 1GN2A 3L75H 1NI8A 3TCUA 3KZIZ 5J2UB 2CDYA 2QDOA 4LF7O 3WG7B 3D3QA 2EIMB 3L9DA 2PI5A 4X62B 3E35A 3SYPA 1Y76B 4FLVA 1J5EB 1UFIA 2Z5UA 1MMMA 3ZHRA 1OCRC 1DLBA 4K0KO 3TETA 1TUBB 4D7TA 3QTCA 3KG2A 3B77A 2EZPA 4LF8B 1UPGA 3JALA 4JAAA 4H13B 1Y66A 3P32A 2UUCO 2M7WA 1W0JG 3JD1A 1ROPA 1FFTB 4NYKA 3OR6C 1SQQH 2DYRC 2Q0OC 5CBFA 3OR7C 2ETNA 2Q7HA 1ZSPA 2LW7A 3F5WC 5LP6C 1AROP 3SYCA 2R70A 1M9NA 2EIKC 4MVRA 2G38A 1RM1B 1HR0O 3JD0A 1Z2GA 4DK0A 3M7MX 1M1KW 1OHHG 4PA6A 1V9PA 2PF4E 4X1KB 3MHSC 1YZBA 3LDCA 2ILMA 1W59A 1BCCH 1BHAA 4JZGA 3GB7C 2ZE7A 2F93B 5LL6Y 2UXDO 3ETDA 3ZMSA 4JYCA 5LHHA 4WFAV 5KA6A 2CTRA 5JCOA 3I56V 3M99B 1KECA 1IVSA 4UCSA 5EZYA 5ITZA 4IHJA 1PPJH 5H5NA 4NVPA 1VQMV 2R9AA 2HVKC 4UCTA 4MTXA 2ZE8A 2LW1A 3OW2U 1US6A 2ZNJA 2EILC 4DV5O 4NXNB 2LP7A 3ZRSA 2CTPA 2XUMA 2JGUA 5CMUA 3OUFA 3BABA 3K57A 4JI7B 4I4TA 1NZ6A 3E8HA 3E8FA 2CTWA 4HYOA 3CCMV 5IWAO 1QR8A 1XBLA 2NLJC 4PA9A 1PP9H 5KHHA 2A3QA 4GZRB 2LQTA 1FPOA 2BTOA 4LNUA 5CA1A 1M56B 2QR4A 2YXLA 3GWKC 1JCHA 2GBOA 2GV9A 2PUSA 1WN7A 4H37A 4J9YB 1JJ2U 1BS3A 1Y6XA 4L8JA 4LF4B 3J7AU 1L1FA 4TV8B 4DR3O 4X1YA 1EZVH 2WLLB 4NXMO 1CPYA 1M90W 1MNGA 3BCCH 4O2BB 3LNNA 3LSUA 2YS8A 4DR5O 4DV2O 1VARA 1JR9A 1QBZA 2UXCO 4HAMA 1OCRB 3OAAG 5BZBA 2FKXA 2Q8VA 4LF7B 3RYCA 4UFZA 2WLIB 3JASB 2DQ3A 1R3LC 2JVDA 2IJJA 1XNQO 1KYOF 1ZX3A 1VQKV 4K0KB 3HKCB 1Q6IA 3L70H 3JATB 4KFMA 3BHPA 1AI5A 1G1XB 4FLWA 4PJ0Z 2ZNIA 1VQ4V 2IU3A 2OTLV 1JJOA 2DYRB 3ZHUA 1JFFA 1QNMA 2UUCB 1Y74B 2LFRA 3CCRV 5IYDO 2Y69C 3R65A 5GONB 3RYIB 5IYBO 3ZHVA 3SJCC 3E8GA 3CB2A 2ARHA 2XNDG 2W0FC 4JYBA 1FXVA 3D36C 1QR9A 2PY5A 1KU9A 1PKXA 4WBNA 3T2MA 4JI6O 2DE0X 1HNXO 3AEIA 4IIJB 4AILC 3K5NA 4R8CA 3WB1A 4K3AA 5CB4A 3FYEB 1UJWB 2R9IA 2EJ7A 2P6JA 3IC9A 4GYCB 3SJBC 4OX9O 2RNBA 2JS5A 2QGNA 4I5SA 1NQTA 1HNWO 3ZEDA 3SGIA 2UUAO 2DYSC 4X65O 4TQDA 3WFVA 2UXDB 1GTOA 5FPOA 2EILB 4MVMA 2IJIA 4O4HA 4F6RB 4NTYA 3OMNB 5B1NA 1NJIW 4EB6B 2XAGA 1N36O 2MK3A 3WB0A 4ZHQB 3OEHG 4BW5A 5L3FA 4DV5B 3RN4A 4X1IA 2Y48A 4LF5O 4LFCO 3N2GB 4QE9A 2JDIG 2AHZA 4HNAA 3K59A 4JI0O 2MW2B 4D7SA 5IWAB 3W7WA 4FLUA 3OTFA 2ZE5A 2E76B 3CCLV 1Q82W 2EIJB 4I55B 4DR1O 4P2ZA 1NKDA 1WB7A 2LFSA 3VQWA 1Q6HA 5LA6A 3JSNA 4JV5O 2X6AA 4JYAO 1VMGA 5C8YA 1G6UA 3E89A 2ZE6A 2P7TC 4E2LA 1YSCA 1VEWA 3AK2A 2XASA 1PM9A 3CE2A 4Z1MG 5JQGB 1HWYA 1JVMA 3ZIAG 4DR5B 4TV9A 3H1HH 1CXZB 3I55V 2PI4A 2LGQA 4UCRA 4DW1A 1DF4A 1PL4A 2FYUH 5LOVB 1FKAO 3RWRD 3B09A 1OJHA 3K04A 5JJNB 3MDSA 1W2BU 4HBNA 1SETA 3FYIB 1YTFD 1XNQB 5L3EA 4DV4O 5IYZB 4CC5A 3ZHQA 2PTMA 4LWSA 3JSLA 4DV3O 1GN6A 2Y69B 2B5UA 4MVZA 1RSOB 2M6YA 1KKDA 4JYYA 1DGSA 1CEZA 4FM1A 1B04A 4O2AA 4DV1B 4KL1A 4DR7O 2C2AA 4I0XA 2QA4V 1U96A 2BCCH 1S5HC 5KHGA 2CH7A 3G67A 1MSDA 1N0NA 1VQLV 2PGGA 1M93A 3FB8C 2HLDG 2LGWA 5TISZ 1Y76A 4TUYB 3LSSA 1H2MA 2Q73A 1F7YA 5KHKA 3W7SA 1K4CC 2JRIA 4GX5A 3K9SA 4JI6B 1HNXB 3JARB 3JD3A 4LF6B 2JK5C 3L74H 1SA0B 3S3XA 2DYSB 1Q7YW 2EINC 3VBBA 1VP7A 1Q8IA 4OX9B 2NR5A 5JWPA 2QM8A 5CN0A 3C3SA 1MA1A 4PI2A 1HNWB 2WA4A 1V55B 2ZM6O 3K08A 2UUAB 1KD1W 4X65B 5B66Z 3ZRXA 3T4ZA 3UKMA 3UT5A 4J80A 1YI2V 3H01A 4RWUA 4LR3A 1YJ9V 5LXTB 1N36B 2XOKG 2P4VA 1NVPB 2XAQA 3CCSV 3BPZA 5IJ0B 2UUBO 1EN6A 2QJ1A 4QGPA 2Y0IA 3CRQA 4LFCB 3CMAV 1TUEB 1XI1A 3RFRA 5KAFZ 1I5YA 2A9HA 1NR7A 3UQ8A 4JI0B 4X89A 3DC6A 3B40A 4XDLA 1AR5A 1B6QA 1JMKC 1PNMA 1WNSA 4DR1B 5KMGB 3ICXA 3IAYA 1F23A 1PNLA 2YI8A 2NNUA 4X66O 2ZCEA 3H1LH 2DOSA 5JH7A 3O65A 1DK1A 4K8XA 2GTSA 2UXBO 3JD2A 3CJHB 3H1KH 4JV5B 4DW0A 2ZD9A 4JYAB 1I7FA 1MG1A 4DR6O 3EXAA 4BR6A 4FM2A 2F4VO 3ZHTA 3QF7A 4LH6A 5L3GA 1FYJA 4I50A 2OTJV 1K34A 2R72A 4AQYO 2Y4UA 1O9HA 1ZWIC 3ZMTA 1P7BA 2XT9A 1WA8B 1FJGB 3HR0A 2LO1A 5JVDA 3CC4V 1K5QA 3ETEA 4FVMA 2W6IG 4TV8A 4DV4B 1JOYA 1EM1A 2WLNA 4DV3B 5EIBD 3VQVA 4DRXA 3N2KB 1FXKC 1IXBA 1N33O 1XNRB 4Q6GA 1E79G 3PJSK 3Q4HB 2ZKOA 1IBKO 5LMUB 1F51A 2QWPB 3CRRA 4DR7B 1KMIZ 2A7WA 3OEEG 4FMTA 4UVAA 3CCEV 3JAWA 4GUNA 4DUZO 1X59A 2DMXA 4FLYA 2OWOA 1N4CA 2EINB 2X6CA 4PHZA 4GKKO 3G4SV 1FFXA 3CRCA 3B4SA 3OMAB 1EN4A 4FLXA 3SR2C 3SJAC 2VWJA 1VQ9V 4BW9A 1Y74A 1FXHA 4FIPC 1K92A 1GM9A 4EKWA 4MTOA 2ZM6B 1AVMA 3MHHC 5CA0A 5KX5A 5LYJA 5AG2A 4JI8B 4FLTA 1WP8A 2ZINA 1IBMO 3ASNC 3UO3A 4J11A 3RT3C 1R73A 4PA3A 4JGSA 1BSMA 3ZRVA 5IT9N 1I0HA 1KKCA 4B3RO 3CC2V 3K58A 1SERA 3CXHF 2F43G 1BE3H 2DQ0A 1I5XA 2UUBB 3ZRWA 2PYJA 3D8CA 3CRMA 2ZR3A 2GTAA 1COWG 4PI0A 4EFEA 4J7ZA 3E83A 2AW9A 3RGBA 1XREA 4DV6O 1VF7A 4CH5A 4CC6A 4GLXA 1U97A 3X2QB 4PDRA 1L0NH 1XMOO 4MW3A 1IURA 3ZN0A 2Q6AA 3AG4B 5B1BC 5JJEB 4F6EA 4KP4A 5B1OA 1NTKH 4U3JB 3DXRB 4X66B 4KHPO 2VQFO 4P9OA 3MD0A 2E5LO 5LGNA 1N8RW 3HKEA 2JGDA 4ZHQA 2UXBB 1NU1H 3K3WA 1GRJA 2QKAA 3OGCC 3DTUB 4DR6B 2Q7EA 2Z3YA 4ZOLB 2QSAA 2F4VB 3STZC 4TQFA 4JI1O 4QNHB 3APQA 3APOA 1SC5B 3EVKA 3JAKB 4ZKIA 4AQYB 1THZA 1Q86W 1H2KA 5IY5C 5KUKA 1JQ0A 2N05A 1ZL8B 2YXHA 1VIBA 2HVJC 2UU9B 2HR3A 2L35A 3ML0A 1GKFA 5FNVA 3G80A 3AG3C 2W6JG 3BY6A 2P4KA 4N21A 3SPCA 4H33A 4L87A 2ZIMA 3FD9A 4G27B 5JQGA 1YVWA 4YJ2B 3HKBA 3LUTB 1HNZO 1N33B 2D2CB 1V54C 2KG7B 3SPHA 4DUYO 1IBKB 1SQXH 2X0LA 2XHBA 2UXXA 2YEVB 1BHBA 2EULA 2H94A 5JCOC 4H44B 3I5DA 1QVGU 2YDEA 4YY3O 2ZR2A 2GUZA 3ABKC 4O4IB 4GKKB 4UV9A 4YXWG 1P7GA 1Y4MA 3OMIB 2HFEC 5IJ9A 4MW8A 3E22A 3C90A 3CS5A 5C93A 3SPIA 2QEXV 4AHCA 1WPXA 1K33A 2F1MA 5H6RA 3K06A 1S0VA 2RCVA 2IU0A 1Q5OA 2AGAA 1IBMB 1M4UA 1K9MW 3LDEA 5DECA 1JX9A 3QVNA 1H8EG 2ADPA 3UM7A 2H8PC 3FAVA 5LP6B 1AI7A 3FB7C 2EIKB 3SYQA 2RN9A 3CWBH 1HP8A 2P67A 4XBFA 1SRYA 2DWDC 4FFBA 4LF9O 3T4DA 5B1BB 2A06H 1VF6A 4DV6B 5L3DA 2Q7GA 4X8AA 1HR0B 3OT7A 4KXRA 3GVMA 1B06A 1R6TA 4P9PA 1XMOB 5BMVA 4JZ2A 4PA7A 3A0HZ 2F23A 2GHYA 1AP6A 4P30A 1VF5B 3AK3A 5CBGA 4KHPB 1HDJA 4O4LA 1K5SA 3T1HO 2E5LB 5BXZA 1HW7A 4ABMA 4JPRA 2WWWA 3DGEA 4X9QA 3RYHA 2Q0AA 2OCCC 4MSWC 3QNEA 5FL7G 1WAZA 5IY5B 1YJNV 4MVUA 4CS3A 3K0DA 3NXSA 4CH3A 4Z2WA 5LGTA 1W0KG 2QKSA 3B8MA 4JI1B 4JI2O 2QE7G 3MAQA 3ABMC 2ITDC 3AG3B 2BE3A 1WLEA 2YXYA 2V4DA 4JI4O 1ZUQA 1TVKA 2Q4PA 1AJPA 4CBCA 2ZQMA 2YI9A 3CJHA 3CXCU 4QPJA 3THOA 3BA8A 2DWEC 1TA8A 3A0RA 1AI4A 5KUMA 1S3JA 3TK1A 4PELA 3OD4A 4UCOA 3HKDA 1XILA 3B8NA 4FZ0A 1HNZB 3BAAA 5J2TB 5CA3A 5KHIA 4DUYB 2OYQA 2DJVA 4FPPA 2HJDA 1IDSA 4W4KA 3ABKB 4DR3B 2BOBC 4QE7A 3UO2A 4RO2A 1GK9A 4NXMB 2EJRA 5LBQA 1S5JA 3OE7G 4X20A 1Y67A 4RUEA 4DV2B 2V1DA 4YY3B 1XL6A 1XQ8A 3EFFK 3JCUZ 1Q43A 2UXCB 3N2KA 4IL6Z 5HFMA 2E74B 3Q4HA 3ZMUA 3STLC 3EHBB 1K8AW 2HJFC 2A79B 3CX5F 3OTOO 2GSMB 2Y4TA 2RQ6A 2CUGA 4CZZA 4DXWA 1R1BA 3ZN1A 1BL8A 1M57C 5KAIZ 3F5TA 2UXNA 2FMLA 4JTAB 4X1YB 2VQEO 3CHXA 3L71H 2CAZC 1XDCA 5H2FZ 3OUSA 1OV9A 5J2UA 4JI3O 3CCQV 2IH1C 1AI6A 1AJNA 2ZDIA 2QWRB 4NB5A 3VQXA 3WU2Z 3OM3B 4LF9B 3RYCB 1XMQO 3F7VC 3G6EV 4MVOA 4XDKA 2KKWA 1XUQA 1TUBA 2WLHA 4G28B 2OCCB 5GW7A 1XEQA 3RW0A 3CYOA 4I7ZB 4X64O 4FFKA 2OT5A 4DV0O 1KC8W 5IE9A 1YJWV 2B9ZA 4ASUG 4JAVA 3U10A 2Z0AA 1JFFB 2DN9A 4BIOA 1OCOC 2IBZH 3SJQC 2VWKA 1NH2B 3AK1A 1WB8A 3ABMB 3JYCA 3CCVV 4TT3G 2Q9LA 3QO7A 2R9RB 1TGOA 1FS0G 1RFYA 1QLEC 3P30A 1F4MA 4R6ZA 3A2FA 3SYAA 1K97A 4WBNB 1GM7A 4JI4B 2EIMC 3JAMN 1K73W 4X1KA 5CB4B 1Q81W 4LF5B 3DXRA 3R66A 3CPWU 1ZAUA 2YIAA 3CC7V 3L73H 4BIZA 4I9WA 4MT8A 4ZOLA 1BQZA 2F95B 5GTHZ 3IJ4A 1E1QG 2IJKA 3CSXA 1AILA 3CCUV 4R50A 4MVQA 2XAJA 1LUWA 4DYLA 3J80N 2QTSA 3ZS8C 4B3SO 2Y0PA 4LFBO 2Q69A 4PA4A 4J7KA
chains in the Genus database with same CATH topology
1SQXH 3H1HH 1P84F 1NTMH 1NTZH 1KB9F 2A06H 3H1JH 2FYUH 5KLVH 1L0NH 4D6TH 1PPJH 1PP9H 1SQVH 2IBZH 3CXHF 3H1LH 1EZVH 1SQQH 1BE3H 3L71H 4PD4F 1NTKH 3BCCH 3TGUH 3L73H 3H1KH 3L74H 1KYOF 3L75H 2BCCH 1BCCH 1SQBH 3CX5F 3CWBH 3H1IH 1NU1H 1BGYH 3L72H 3L70H 1SQPH 1L0LH 4U3FH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQX H;  3H1H H;  1P84 F;  1NTM H;  1NTZ H;  1KB9 F;  2A06 H;  3H1J H;  2FYU H;  5KLV H;  1L0N H;  4D6T H;  1PPJ H;  1PP9 H;  1SQV H;  2IBZ H;  3CXH F;  3H1L H;  1EZV H;  1SQQ H;  1BE3 H;  3L71 H;  4PD4 F;  1NTK H;  3BCC H;  3TGU H;  3L73 H;  3H1K H;  3L74 H;  1KYO F;  3L75 H;  2BCC H;  1BCC H;  1SQB H;  3CX5 F;  3CWB H;  3H1I H;  1NU1 H;  1BGY H;  3L72 H;  3L70 H;  1SQP H;  1L0L H;  4U3F H; 
#chains in the Genus database with same CATH topology
 2QWO B;  1LUV A;  1JPX A;  4B3M O;  2ITC C;  4RUF A;  4YHH O;  2HG5 C;  1SZT A;  4HNA B;  2A0L A;  3ZHS A;  3P3N A;  1KP3 A;  2JEX A;  3LDD A;  1M57 B;  4RQF A;  3P3P A;  4K8Z A;  2YEV A;  3OTO B;  1OZ0 A;  5BY1 A;  5LA6 B;  2QWQ B;  5B5E Z;  2YC0 A;  3T1C A;  4DO2 A;  2Q67 A;  2WLL A;  4NXN O;  2ATK C;  4WFG A;  4O2B A;  5C8Y B;  3IGA C;  5LGU A;  2VQE B;  1NBM G;  4NTX A;  4UVC A;  4TV9 B;  3TJT A;  4C7U A;  2WSS G;  3E86 A;  3FB6 C;  4JI3 B;  1NVP D;  4GX0 A;  1B3Q A;  1MZF A;  1N32 O;  2H3O A;  2WLI A;  3JAS A;  4NTW A;  1XMQ B;  2BTQ B;  1PD3 A;  5EC2 C;  4J9Z B;  3RYF B;  2E3C A;  1WP7 A;  1H8H G;  3HKC A;  4PDM A;  5B3S C;  3JAT A;  4Q20 A;  4IYI A;  1M56 C;  2RMK B;  4DK1 A;  1EN5 A;  2N74 A;  1BQ0 A;  2X6B A;  4LWS B;  4X64 B;  4DV0 B;  5LP6 A;  2YUA A;  5E79 Z;  3W7T A;  3QO5 A;  5GON A;  3RYI A;  1LNQ A;  1QLE B;  4E4E A;  4J42 A;  4I0X B;  2CH7 B;  2WLM A;  4IT5 A;  1BT8 A;  4TWK A;  1ORQ C;  1P84 F;  1H38 A;  1ZTE A;  4LP8 A;  2AZ0 A;  3AG2 C;  4O4J B;  4YIO A;  1XHZ A;  1QVF U;  2LJ2 A;  4IIJ A;  1EZJ A;  5L3C A;  1H2G A;  4JI5 O;  4WFF A;  1WPB A;  4MVS A;  4PV1 B;  1MAB G;  4DV7 O;  1K7D A;  3AG1 C;  5KA5 A;  2OIG A;  1A32 A;  5LHG A;  2K9P A;  4TSF G;  2FTK A;  5KLV H;  3T1Y O;  1X4T A;  2EBO A;  4CS4 A;  2X7R B;  4UUJ C;  4F6R A;  2P90 A;  3K79 A;  1AP5 A;  4EB6 A;  3UT5 B;  2D3O W;  3ASO C;  2RDC A;  4JTD B;  4B3S B;  4LC1 A;  4LFB B;  5IYC O;  1AR1 B;  5E1A C;  4JAU A;  3H1J H;  4QJF B;  3N2G A;  3CD6 V;  4WFE A;  3CP1 A;  3LNM B;  4B3M B;  1MSW D;  5F2V O;  3CCJ V;  4YHH B;  4I55 A;  3K5M A;  3RVY A;  3ZJZ A;  4OPA A;  4ZBM A;  4UVB A;  2WLK A;  5J2T A;  4DR2 O;  4UV8 A;  3HPL C;  3ZCC A;  3TXQ A;  1FXK B;  1URF A;  5DM6 V;  5JH7 B;  1QHT A;  4HZ3 A;  1BMF G;  1KP2 A;  3S3W A;  1OCC C;  1P49 A;  1XOU A;  4EFB A;  4LFA O;  3BA9 A;  1E1R G;  2OIE A;  4U7O A;  2AHY A;  1OCZ C;  1F4N A;  3F7Y C;  3ZMZ A;  4I50 B;  5LOV A;  5EBW C;  1SES A;  1Q3E A;  2CK3 G;  4I9Q A;  1PL0 A;  4YJ3 B;  1QQC A;  2Q5Z A;  5B3S B;  1AB3 A;  1N32 B;  4DUZ B;  3W7X A;  5H6Q A;  5EC1 C;  4B7K A;  1D5A A;  1JA8 A;  2XAF A;  3IC7 A;  3O9O A;  4XDJ A;  1BGY H;  5J9P C;  5JVD B;  2EIJ C;  2WA3 A;  4WCE V;  4MTF A;  1NTM H;  5EYP B;  4UXN A;  4QIW F;  5IYZ A;  1NTZ H;  3QG5 A;  4ICG A;  3E8B A;  4W4L A;  3CEI A;  4B7E A;  1RSO A;  2ZXW C;  2HKO A;  5A9G A;  2NN4 A;  1AJQ A;  3KCY A;  1S5L Z;  4PD4 F;  1EFR G;  4DRX B;  3ABU A;  2BSK B;  2QM4 A;  5GTI Z;  3ASN B;  4TOI A;  3D36 A;  1S76 D;  2YIB D;  2K1E A;  3KCX A;  4K35 A;  3AG2 B;  1DF5 A;  1KQS U;  4ZIB A;  4ZI7 B;  3H9V A;  4TUY A;  4X88 A;  2P06 A;  4UCU A;  1VQN V;  1SQF A;  5EK0 A;  1SZX A;  3JAW B;  3K9A A;  3JAR A;  4OPH A;  5K1P A;  4B3R B;  2B1G A;  4JI5 B;  2ODM A;  1SA0 A;  3AG1 B;  2AZ2 A;  1FFX B;  1DTO A;  1QU7 A;  4PDL A;  3U0Z A;  2Q68 A;  4F4L A;  4LBE C;  3J81 N;  1MZE A;  5FLX N;  4DV7 B;  1GM8 A;  1GN4 A;  1PNK A;  3D3I A;  4DV1 O;  2QTO A;  4KUM A;  1N34 O;  3ASO B;  3T1Y B;  1GO3 F;  1Q90 D;  1VQ8 V;  4GX1 A;  5CA0 B;  5KX5 B;  3K5L A;  5LYJ B;  4RAI A;  3W7U A;  1IZ3 A;  1MOF A;  5LXT A;  2VQF B;  5FPR A;  2DW4 A;  2CTQ A;  3JAL B;  3VQY A;  3QO8 A;  4R7C A;  2PZS A;  4DR4 O;  3OFN G;  5IJ0 A;  1G4Y B;  1D5N A;  4LF6 O;  3E2E A;  4B3T O;  2RJZ A;  1GH6 A;  2OCH A;  3ZRW B;  3KKY A;  1YTF B;  3ZMV A;  2QKC A;  4J10 A;  3RVZ A;  5KMG A;  1GN3 A;  2WLJ A;  2AXT Z;  5D5P A;  3SPG A;  3RBZ A;  3OGI B;  1OCC B;  4DR2 B;  1YF2 A;  1V55 C;  3DC5 A;  5HFL A;  1VF6 C;  3NR7 A;  5EIB C;  1H2N A;  1R6N A;  1NS1 A;  4J41 A;  1V54 B;  1OCZ B;  1SQB H;  3HKE B;  2CGO A;  1IBL O;  2JGD B;  4JF3 A;  1K3E A;  5K1X A;  3JCZ A;  3FB5 C;  4U3F H;  3ETG A;  1SF9 A;  4LFA B;  4FZ1 A;  3GWO A;  1G8M A;  2B1I A;  5DN6 G;  1YHQ V;  3G71 V;  1J95 A;  1VQ5 V;  5EZY B;  5ITZ B;  2PYL A;  4IHJ B;  2E75 B;  2YSU B;  5BR8 O;  2EZO A;  4AI8 A;  1ZLZ A;  2EX3 A;  1WA8 A;  3ZBH A;  1T5E A;  3TXS A;  5LMN O;  1I94 O;  1Z5W A;  3A8T A;  3H1I H;  1IX9 A;  2ADQ B;  1QCE A;  4CS2 A;  2ZXW B;  4I4T B;  5FNV B;  2HHH O;  3C3T A;  2FB5 A;  1YDX A;  1M5I A;  1VQO V;  4UCV A;  2ZIO A;  2KQX A;  4H0L B;  3K5O A;  3HKB B;  4LNU B;  5CA1 B;  1H2S B;  2IH3 C;  4BAY A;  2F66 C;  2VRZ A;  2CE4 A;  5H9C A;  2W0X A;  1R3K C;  2YID A;  3IFX A;  5LHI A;  3CME V;  1FJG O;  3VOU A;  4NR1 A;  2BTQ A;  4MS2 A;  3RYF A;  1TAE A;  4J7J A;  3JD4 A;  1YIJ V;  1L8D A;  2KB1 A;  3M8A A;  2GUZ B;  4OGQ B;  4GKJ O;  2VS0 A;  4WFB V;  2HP8 A;  2QWN B;  3FKS G;  5IJ9 B;  1K4D C;  1XNR O;  3E22 B;  1QLN A;  3K03 A;  3U11 A;  2JEU A;  1RPR A;  5LMU O;  4IYH A;  4QPK A;  4GX2 A;  2IM9 A;  1VQP V;  1N34 B;  3HB3 B;  1I08 A;  2BOC C;  4G2K A;  4JAS A;  3BRC A;  4LH7 A;  4EEQ A;  4FM0 A;  1L0L H;  4O4J A;  5B1A C;  3BEH A;  3A0B Z;  4RQE A;  3N27 A;  3T1H B;  1P4R A;  4DR4 B;  1N0J A;  2IW5 A;  4PDV A;  3SPJ A;  3FAV B;  3ABL C;  4B3T B;  3FFQ A;  4FK5 C;  4X62 O;  2O57 A;  1YEW A;  4JI2 B;  1J5E O;  1XHX A;  4FFB B;  2XTA A;  4CH6 A;  3DSQ A;  5KHJ A;  3WG7 C;  2YIC A;  4JI8 O;  1VQ6 V;  2ZDI C;  4U3J A;  1VQ7 V;  2YIB A;  4LF8 O;  1KBH A;  4CH4 A;  3SDL A;  3LSQ A;  5BMV B;  2L6L A;  2HEP A;  1R3I C;  3ZX6 A;  4YIP A;  4FLZ A;  4O4L B;  1SS3 A;  1IBL B;  3RYH B;  3PN1 A;  1D2D A;  1Q6U A;  2XAH A;  2JJ1 G;  2IJH A;  4OXS A;  4WF9 V;  4A5U B;  3JAK A;  5A2Q N;  4O4H B;  1NR1 A;  1ZL8 A;  5BR8 B;  2GDS A;  4JTC B;  3K0G A;  3UCS C;  1WJZ A;  3WB2 A;  1I94 B;  5LMN B;  1RP3 B;  1TVK B;  4X1I B;  1IXM A;  3AG7 A;  1FXK A;  1XL4 A;  3ETQ A;  1RM1 C;  3FX7 A;  4IGG A;  1BZK A;  2HHH B;  3SYO A;  5IDJ A;  3ABT A;  3X2Q C;  4BWA A;  5JJJ B;  2JJ2 G;  3G6B A;  1YXB A;  3AG4 C;  2KSD A;  4YJ2 A;  1LR1 A;  4GCZ A;  1S72 V;  1Z5V A;  2KG7 A;  4U7N A;  4Z1V A;  3HKD B;  1FD9 A;  2WAM A;  4UB6 Z;  1AR4 A;  1SKV A;  3BFR A;  4B08 A;  4LCU C;  1PV0 A;  1SQV H;  4YJ3 A;  4N23 A;  4FJC C;  4UB8 Z;  1NH2 D;  1RPO A;  2WPD G;  2UU9 O;  5CBH A;  4WFH A;  1FAF A;  1KUQ A;  1H2L A;  4JI7 O;  2ZT9 B;  1ENV A;  5L3B A;  4O4I A;  3L72 H;  1SQP H;  4X20 B;  1EBO A;  5EYP A;  1SQG A;  1YCI A;  5DED A;  2FL4 A;  4GKJ B;  1CP9 A;  3B2E E;  1GMG A;  2BSK A;  4BIU A;  1YIT V;  1GAX A;  4MTG A;  5B1A B;  4GT1 A;  5EBM C;  1S77 D;  2N04 A;  2P22 C;  4ZI7 A;  2JS3 A;  4NKG B;  4LF4 O;  2JIZ G;  1R6K A;  1KB9 F;  1OCO B;  3CRA A;  2QM7 A;  1O9G A;  4D6T H;  5D5Q A;  3ABL B;  2V7Q G;  2CGN A;  5EBL C;  1NT2 B;  2P5O A;  1R3J C;  3TGU H;  3BVO A;  4O2A B;  1GN2 A;  3L75 H;  1NI8 A;  3TCU A;  3KZI Z;  5J2U B;  2CDY A;  2QDO A;  4LF7 O;  3WG7 B;  3D3Q A;  2EIM B;  3L9D A;  2PI5 A;  4X62 B;  3E35 A;  3SYP A;  1Y76 B;  4FLV A;  1J5E B;  1UFI A;  2Z5U A;  1MMM A;  3ZHR A;  1OCR C;  1DLB A;  4K0K O;  3TET A;  1TUB B;  4D7T A;  3QTC A;  3KG2 A;  3B77 A;  2EZP A;  4LF8 B;  1UPG A;  3JAL A;  4JAA A;  4H13 B;  1Y66 A;  3P32 A;  2UUC O;  2M7W A;  1W0J G;  3JD1 A;  1ROP A;  1FFT B;  4NYK A;  3OR6 C;  1SQQ H;  2DYR C;  2Q0O C;  5CBF A;  3OR7 C;  2ETN A;  2Q7H A;  1ZSP A;  2LW7 A;  3F5W C;  5LP6 C;  1ARO P;  3SYC A;  2R70 A;  1M9N A;  2EIK C;  4MVR A;  2G38 A;  1RM1 B;  1HR0 O;  3JD0 A;  1Z2G A;  4DK0 A;  3M7M X;  1M1K W;  1OHH G;  4PA6 A;  1V9P A;  2PF4 E;  4X1K B;  3MHS C;  1YZB A;  3LDC A;  2ILM A;  1W59 A;  1BCC H;  1BHA A;  4JZG A;  3GB7 C;  2ZE7 A;  2F93 B;  5LL6 Y;  2UXD O;  3ETD A;  3ZMS A;  4JYC A;  5LHH A;  4WFA V;  5KA6 A;  2CTR A;  5JCO A;  3I56 V;  3M99 B;  1KEC A;  1IVS A;  4UCS A;  5EZY A;  5ITZ A;  4IHJ A;  1PPJ H;  5H5N A;  4NVP A;  1VQM V;  2R9A A;  2HVK C;  4UCT A;  4MTX A;  2ZE8 A;  2LW1 A;  3OW2 U;  1US6 A;  2ZNJ A;  2EIL C;  4DV5 O;  4NXN B;  2LP7 A;  3ZRS A;  2CTP A;  2XUM A;  2JGU A;  5CMU A;  3OUF A;  3BAB A;  3K57 A;  4JI7 B;  4I4T A;  1NZ6 A;  3E8H A;  3E8F A;  2CTW A;  4HYO A;  3CCM V;  5IWA O;  1QR8 A;  1XBL A;  2NLJ C;  4PA9 A;  1PP9 H;  5KHH A;  2A3Q A;  4GZR B;  2LQT A;  1FPO A;  2BTO A;  4LNU A;  5CA1 A;  1M56 B;  2QR4 A;  2YXL A;  3GWK C;  1JCH A;  2GBO A;  2GV9 A;  2PUS A;  1WN7 A;  4H37 A;  4J9Y B;  1JJ2 U;  1BS3 A;  1Y6X A;  4L8J A;  4LF4 B;  3J7A U;  1L1F A;  4TV8 B;  4DR3 O;  4X1Y A;  1EZV H;  2WLL B;  4NXM O;  1CPY A;  1M90 W;  1MNG A;  3BCC H;  4O2B B;  3LNN A;  3LSU A;  2YS8 A;  4DR5 O;  4DV2 O;  1VAR A;  1JR9 A;  1QBZ A;  2UXC O;  4HAM A;  1OCR B;  3OAA G;  5BZB A;  2FKX A;  2Q8V A;  4LF7 B;  3RYC A;  4UFZ A;  2WLI B;  3JAS B;  2DQ3 A;  1R3L C;  2JVD A;  2IJJ A;  1XNQ O;  1KYO F;  1ZX3 A;  1VQK V;  4K0K B;  3HKC B;  1Q6I A;  3L70 H;  3JAT B;  4KFM A;  3BHP A;  1AI5 A;  1G1X B;  4FLW A;  4PJ0 Z;  2ZNI A;  1VQ4 V;  2IU3 A;  2OTL V;  1JJO A;  2DYR B;  3ZHU A;  1JFF A;  1QNM A;  2UUC B;  1Y74 B;  2LFR A;  3CCR V;  5IYD O;  2Y69 C;  3R65 A;  5GON B;  3RYI B;  5IYB O;  3ZHV A;  3SJC C;  3E8G A;  3CB2 A;  2ARH A;  2XND G;  2W0F C;  4JYB A;  1FXV A;  3D36 C;  1QR9 A;  2PY5 A;  1KU9 A;  1PKX A;  4WBN A;  3T2M A;  4JI6 O;  2DE0 X;  1HNX O;  3AEI A;  4IIJ B;  4AIL C;  3K5N A;  4R8C A;  3WB1 A;  4K3A A;  5CB4 A;  3FYE B;  1UJW B;  2R9I A;  2EJ7 A;  2P6J A;  3IC9 A;  4GYC B;  3SJB C;  4OX9 O;  2RNB A;  2JS5 A;  2QGN A;  4I5S A;  1NQT A;  1HNW O;  3ZED A;  3SGI A;  2UUA O;  2DYS C;  4X65 O;  4TQD A;  3WFV A;  2UXD B;  1GTO A;  5FPO A;  2EIL B;  4MVM A;  2IJI A;  4O4H A;  4F6R B;  4NTY A;  3OMN B;  5B1N A;  1NJI W;  4EB6 B;  2XAG A;  1N36 O;  2MK3 A;  3WB0 A;  4ZHQ B;  3OEH G;  4BW5 A;  5L3F A;  4DV5 B;  3RN4 A;  4X1I A;  2Y48 A;  4LF5 O;  4LFC O;  3N2G B;  4QE9 A;  2JDI G;  2AHZ A;  4HNA A;  3K59 A;  4JI0 O;  2MW2 B;  4D7S A;  5IWA B;  3W7W A;  4FLU A;  3OTF A;  2ZE5 A;  2E76 B;  3CCL V;  1Q82 W;  2EIJ B;  4I55 B;  4DR1 O;  4P2Z A;  1NKD A;  1WB7 A;  2LFS A;  3VQW A;  1Q6H A;  5LA6 A;  3JSN A;  4JV5 O;  2X6A A;  4JYA O;  1VMG A;  5C8Y A;  1G6U A;  3E89 A;  2ZE6 A;  2P7T C;  4E2L A;  1YSC A;  1VEW A;  3AK2 A;  2XAS A;  1PM9 A;  3CE2 A;  4Z1M G;  5JQG B;  1HWY A;  1JVM A;  3ZIA G;  4DR5 B;  4TV9 A;  3H1H H;  1CXZ B;  3I55 V;  2PI4 A;  2LGQ A;  4UCR A;  4DW1 A;  1DF4 A;  1PL4 A;  2FYU H;  5LOV B;  1FKA O;  3RWR D;  3B09 A;  1OJH A;  3K04 A;  5JJN B;  3MDS A;  1W2B U;  4HBN A;  1SET A;  3FYI B;  1YTF D;  1XNQ B;  5L3E A;  4DV4 O;  5IYZ B;  4CC5 A;  3ZHQ A;  2PTM A;  4LWS A;  3JSL A;  4DV3 O;  1GN6 A;  2Y69 B;  2B5U A;  4MVZ A;  1RSO B;  2M6Y A;  1KKD A;  4JYY A;  1DGS A;  1CEZ A;  4FM1 A;  1B04 A;  4O2A A;  4DV1 B;  4KL1 A;  4DR7 O;  2C2A A;  4I0X A;  2QA4 V;  1U96 A;  2BCC H;  1S5H C;  5KHG A;  2CH7 A;  3G67 A;  1MSD A;  1N0N A;  1VQL V;  2PGG A;  1M93 A;  3FB8 C;  2HLD G;  2LGW A;  5TIS Z;  1Y76 A;  4TUY B;  3LSS A;  1H2M A;  2Q73 A;  1F7Y A;  5KHK A;  3W7S A;  1K4C C;  2JRI A;  4GX5 A;  3K9S A;  4JI6 B;  1HNX B;  3JAR B;  3JD3 A;  4LF6 B;  2JK5 C;  3L74 H;  1SA0 B;  3S3X A;  2DYS B;  1Q7Y W;  2EIN C;  3VBB A;  1VP7 A;  1Q8I A;  4OX9 B;  2NR5 A;  5JWP A;  2QM8 A;  5CN0 A;  3C3S A;  1MA1 A;  4PI2 A;  1HNW B;  2WA4 A;  1V55 B;  2ZM6 O;  3K08 A;  2UUA B;  1KD1 W;  4X65 B;  5B66 Z;  3ZRX A;  3T4Z A;  3UKM A;  3UT5 A;  4J80 A;  1YI2 V;  3H01 A;  4RWU A;  4LR3 A;  1YJ9 V;  5LXT B;  1N36 B;  2XOK G;  2P4V A;  1NVP B;  2XAQ A;  3CCS V;  3BPZ A;  5IJ0 B;  2UUB O;  1EN6 A;  2QJ1 A;  4QGP A;  2Y0I A;  3CRQ A;  4LFC B;  3CMA V;  1TUE B;  1XI1 A;  3RFR A;  5KAF Z;  1I5Y A;  2A9H A;  1NR7 A;  3UQ8 A;  4JI0 B;  4X89 A;  3DC6 A;  3B40 A;  4XDL A;  1AR5 A;  1B6Q A;  1JMK C;  1PNM A;  1WNS A;  4DR1 B;  5KMG B;  3ICX A;  3IAY A;  1F23 A;  1PNL A;  2YI8 A;  2NNU A;  4X66 O;  2ZCE A;  3H1L H;  2DOS A;  5JH7 A;  3O65 A;  1DK1 A;  4K8X A;  2GTS A;  2UXB O;  3JD2 A;  3CJH B;  3H1K H;  4JV5 B;  4DW0 A;  2ZD9 A;  4JYA B;  1I7F A;  1MG1 A;  4DR6 O;  3EXA A;  4BR6 A;  4FM2 A;  2F4V O;  3ZHT A;  3QF7 A;  4LH6 A;  5L3G A;  1FYJ A;  4I50 A;  2OTJ V;  1K34 A;  2R72 A;  4AQY O;  2Y4U A;  1O9H A;  1ZWI C;  3ZMT A;  1P7B A;  2XT9 A;  1WA8 B;  1FJG B;  3HR0 A;  2LO1 A;  5JVD A;  3CC4 V;  1K5Q A;  3ETE A;  4FVM A;  2W6I G;  4TV8 A;  4DV4 B;  1JOY A;  1EM1 A;  2WLN A;  4DV3 B;  5EIB D;  3VQV A;  4DRX A;  3N2K B;  1FXK C;  1IXB A;  1N33 O;  1XNR B;  4Q6G A;  1E79 G;  3PJS K;  3Q4H B;  2ZKO A;  1IBK O;  5LMU B;  1F51 A;  2QWP B;  3CRR A;  4DR7 B;  1KMI Z;  2A7W A;  3OEE G;  4FMT A;  4UVA A;  3CCE V;  3JAW A;  4GUN A;  4DUZ O;  1X59 A;  2DMX A;  4FLY A;  2OWO A;  1N4C A;  2EIN B;  2X6C A;  4PHZ A;  4GKK O;  3G4S V;  1FFX A;  3CRC A;  3B4S A;  3OMA B;  1EN4 A;  4FLX A;  3SR2 C;  3SJA C;  2VWJ A;  1VQ9 V;  4BW9 A;  1Y74 A;  1FXH A;  4FIP C;  1K92 A;  1GM9 A;  4EKW A;  4MTO A;  2ZM6 B;  1AVM A;  3MHH C;  5CA0 A;  5KX5 A;  5LYJ A;  5AG2 A;  4JI8 B;  4FLT A;  1WP8 A;  2ZIN A;  1IBM O;  3ASN C;  3UO3 A;  4J11 A;  3RT3 C;  1R73 A;  4PA3 A;  4JGS A;  1BSM A;  3ZRV A;  5IT9 N;  1I0H A;  1KKC A;  4B3R O;  3CC2 V;  3K58 A;  1SER A;  3CXH F;  2F43 G;  1BE3 H;  2DQ0 A;  1I5X A;  2UUB B;  3ZRW A;  2PYJ A;  3D8C A;  3CRM A;  2ZR3 A;  2GTA A;  1COW G;  4PI0 A;  4EFE A;  4J7Z A;  3E83 A;  2AW9 A;  3RGB A;  1XRE A;  4DV6 O;  1VF7 A;  4CH5 A;  4CC6 A;  4GLX A;  1U97 A;  3X2Q B;  4PDR A;  1L0N H;  1XMO O;  4MW3 A;  1IUR A;  3ZN0 A;  2Q6A A;  3AG4 B;  5B1B C;  5JJE B;  4F6E A;  4KP4 A;  5B1O A;  1NTK H;  4U3J B;  3DXR B;  4X66 B;  4KHP O;  2VQF O;  4P9O A;  3MD0 A;  2E5L O;  5LGN A;  1N8R W;  3HKE A;  2JGD A;  4ZHQ A;  2UXB B;  1NU1 H;  3K3W A;  1GRJ A;  2QKA A;  3OGC C;  3DTU B;  4DR6 B;  2Q7E A;  2Z3Y A;  4ZOL B;  2QSA A;  2F4V B;  3STZ C;  4TQF A;  4JI1 O;  4QNH B;  3APQ A;  3APO A;  1SC5 B;  3EVK A;  3JAK B;  4ZKI A;  4AQY B;  1THZ A;  1Q86 W;  1H2K A;  5IY5 C;  5KUK A;  1JQ0 A;  2N05 A;  1ZL8 B;  2YXH A;  1VIB A;  2HVJ C;  2UU9 B;  2HR3 A;  2L35 A;  3ML0 A;  1GKF A;  5FNV A;  3G80 A;  3AG3 C;  2W6J G;  3BY6 A;  2P4K A;  4N21 A;  3SPC A;  4H33 A;  4L87 A;  2ZIM A;  3FD9 A;  4G27 B;  5JQG A;  1YVW A;  4YJ2 B;  3HKB A;  3LUT B;  1HNZ O;  1N33 B;  2D2C B;  1V54 C;  2KG7 B;  3SPH A;  4DUY O;  1IBK B;  1SQX H;  2X0L A;  2XHB A;  2UXX A;  2YEV B;  1BHB A;  2EUL A;  2H94 A;  5JCO C;  4H44 B;  3I5D A;  1QVG U;  2YDE A;  4YY3 O;  2ZR2 A;  2GUZ A;  3ABK C;  4O4I B;  4GKK B;  4UV9 A;  4YXW G;  1P7G A;  1Y4M A;  3OMI B;  2HFE C;  5IJ9 A;  4MW8 A;  3E22 A;  3C90 A;  3CS5 A;  5C93 A;  3SPI A;  2QEX V;  4AHC A;  1WPX A;  1K33 A;  2F1M A;  5H6R A;  3K06 A;  1S0V A;  2RCV A;  2IU0 A;  1Q5O A;  2AGA A;  1IBM B;  1M4U A;  1K9M W;  3LDE A;  5DEC A;  1JX9 A;  3QVN A;  1H8E G;  2ADP A;  3UM7 A;  2H8P C;  3FAV A;  5LP6 B;  1AI7 A;  3FB7 C;  2EIK B;  3SYQ A;  2RN9 A;  3CWB H;  1HP8 A;  2P67 A;  4XBF A;  1SRY A;  2DWD C;  4FFB A;  4LF9 O;  3T4D A;  5B1B B;  2A06 H;  1VF6 A;  4DV6 B;  5L3D A;  2Q7G A;  4X8A A;  1HR0 B;  3OT7 A;  4KXR A;  3GVM A;  1B06 A;  1R6T A;  4P9P A;  1XMO B;  5BMV A;  4JZ2 A;  4PA7 A;  3A0H Z;  2F23 A;  2GHY A;  1AP6 A;  4P30 A;  1VF5 B;  3AK3 A;  5CBG A;  4KHP B;  1HDJ A;  4O4L A;  1K5S A;  3T1H O;  2E5L B;  5BXZ A;  1HW7 A;  4ABM A;  4JPR A;  2WWW A;  3DGE A;  4X9Q A;  3RYH A;  2Q0A A;  2OCC C;  4MSW C;  3QNE A;  5FL7 G;  1WAZ A;  5IY5 B;  1YJN V;  4MVU A;  4CS3 A;  3K0D A;  3NXS A;  4CH3 A;  4Z2W A;  5LGT A;  1W0K G;  2QKS A;  3B8M A;  4JI1 B;  4JI2 O;  2QE7 G;  3MAQ A;  3ABM C;  2ITD C;  3AG3 B;  2BE3 A;  1WLE A;  2YXY A;  2V4D A;  4JI4 O;  1ZUQ A;  1TVK A;  2Q4P A;  1AJP A;  4CBC A;  2ZQM A;  2YI9 A;  3CJH A;  3CXC U;  4QPJ A;  3THO A;  3BA8 A;  2DWE C;  1TA8 A;  3A0R A;  1AI4 A;  5KUM A;  1S3J A;  3TK1 A;  4PEL A;  3OD4 A;  4UCO A;  3HKD A;  1XIL A;  3B8N A;  4FZ0 A;  1HNZ B;  3BAA A;  5J2T B;  5CA3 A;  5KHI A;  4DUY B;  2OYQ A;  2DJV A;  4FPP A;  2HJD A;  1IDS A;  4W4K A;  3ABK B;  4DR3 B;  2BOB C;  4QE7 A;  3UO2 A;  4RO2 A;  1GK9 A;  4NXM B;  2EJR A;  5LBQ A;  1S5J A;  3OE7 G;  4X20 A;  1Y67 A;  4RUE A;  4DV2 B;  2V1D A;  4YY3 B;  1XL6 A;  1XQ8 A;  3EFF K;  3JCU Z;  1Q43 A;  2UXC B;  3N2K A;  4IL6 Z;  5HFM A;  2E74 B;  3Q4H A;  3ZMU A;  3STL C;  3EHB B;  1K8A W;  2HJF C;  2A79 B;  3CX5 F;  3OTO O;  2GSM B;  2Y4T A;  2RQ6 A;  2CUG A;  4CZZ A;  4DXW A;  1R1B A;  3ZN1 A;  1BL8 A;  1M57 C;  5KAI Z;  3F5T A;  2UXN A;  2FML A;  4JTA B;  4X1Y B;  2VQE O;  3CHX A;  3L71 H;  2CAZ C;  1XDC A;  5H2F Z;  3OUS A;  1OV9 A;  5J2U A;  4JI3 O;  3CCQ V;  2IH1 C;  1AI6 A;  1AJN A;  2ZDI A;  2QWR B;  4NB5 A;  3VQX A;  3WU2 Z;  3OM3 B;  4LF9 B;  3RYC B;  1XMQ O;  3F7V C;  3G6E V;  4MVO A;  4XDK A;  2KKW A;  1XUQ A;  1TUB A;  2WLH A;  4G28 B;  2OCC B;  5GW7 A;  1XEQ A;  3RW0 A;  3CYO A;  4I7Z B;  4X64 O;  4FFK A;  2OT5 A;  4DV0 O;  1KC8 W;  5IE9 A;  1YJW V;  2B9Z A;  4ASU G;  4JAV A;  3U10 A;  2Z0A A;  1JFF B;  2DN9 A;  4BIO A;  1OCO C;  2IBZ H;  3SJQ C;  2VWK A;  1NH2 B;  3AK1 A;  1WB8 A;  3ABM B;  3JYC A;  3CCV V;  4TT3 G;  2Q9L A;  3QO7 A;  2R9R B;  1TGO A;  1FS0 G;  1RFY A;  1QLE C;  3P30 A;  1F4M A;  4R6Z A;  3A2F A;  3SYA A;  1K97 A;  4WBN B;  1GM7 A;  4JI4 B;  2EIM C;  3JAM N;  1K73 W;  4X1K A;  5CB4 B;  1Q81 W;  4LF5 B;  3DXR A;  3R66 A;  3CPW U;  1ZAU A;  2YIA A;  3CC7 V;  3L73 H;  4BIZ A;  4I9W A;  4MT8 A;  4ZOL A;  1BQZ A;  2F95 B;  5GTH Z;  3IJ4 A;  1E1Q G;  2IJK A;  3CSX A;  1AIL A;  3CCU V;  4R50 A;  4MVQ A;  2XAJ A;  1LUW A;  4DYL A;  3J80 N;  2QTS A;  3ZS8 C;  4B3S O;  2Y0P A;  4LFB O;  2Q69 A;  4PA4 A;  4J7K A; 
#chains in the Genus database with same CATH homology
 1SQX H;  3H1H H;  1P84 F;  1NTM H;  1NTZ H;  1KB9 F;  2A06 H;  3H1J H;  2FYU H;  5KLV H;  1L0N H;  4D6T H;  1PPJ H;  1PP9 H;  1SQV H;  2IBZ H;  3CXH F;  3H1L H;  1EZV H;  1SQQ H;  1BE3 H;  3L71 H;  4PD4 F;  1NTK H;  3BCC H;  3TGU H;  3L73 H;  3H1K H;  3L74 H;  1KYO F;  3L75 H;  2BCC H;  1BCC H;  1SQB H;  3CX5 F;  3CWB H;  3H1I H;  1NU1 H;  1BGY H;  3L72 H;  3L70 H;  1SQP H;  1L0L H;  4U3F H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...