3CX5F

Structure of complex iii with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
74
structure length
74
Chain Sequence
b'VTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHKEDCVEEFFHLQHYLDTATAPRLFDKLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 30
structure length 74
sequence length 74
chains with identical sequence Q
ec nomenclature
pdb deposition date 2008-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3cx5F00
1SQVH 4D6TH 1L0LH 1KB9F 4PD4F 3L70H 1NTZH 3H1JH 1P84F 1BGYH 3H1IH 2FYUH 3BCCH 2IBZH 2BCCH 3CX5F 1NTKH 3L72H 1KYOF 1EZVH 1PPJH 2A06H 3L74H 4U3FH 5KLVH 3CXHF 3H1KH 3L71H 1BE3H 1NTMH 1SQXH 3L73H 1NU1H 3CWBH 1SQBH 3H1LH 3TGUH 1BCCH 1SQQH 1L0NH 1SQPH 3L75H 3H1HH 1PP9H
chains in the Genus database with same CATH superfamily
4DV3O 4IIJA 3J7AU 4EEQA 1MNGA 2ZE8A 4X64B 2HKOA 2CH7B 2Z5UA 2UXBB 4DV4O 1EFRG 4GKKO 4ICGA 5BZBA 4CS3A 2QDOA 3B4SA 3DTUB 2RNBA 4X65B 4OX9O 5BY1A 4YHHO 3AG4B 4DR6B 2A79B 1R6NA 1PV0A 4WBNB 2Q0AA 3RW0A 1K92A 2PY5A 4ZHQB 4B3MO 1N0NA 3LDCA 4TT3G 2FB5A 5LMNB 4WF9V 2BCCH 4BIZA 1NS1A 3SJBC 1HNZO 3B40A 2IH3C 2YS8A 5DN6G 5L3CA 1M93A 1XMQB 1VF6A 2OCCB 3SYPA 4B3TO 1XMOO 2Q0OC 2YIBA 2ITDC 2PF4E 4GX1A 4AILC 3SYOA 2H3OA 3E22A 1SC5B 1Q6HA 2EIKB 1MSWD 2EX3A 2OT5A 3CYOA 4C7UA 2ODMA 1FFXB 2CTPA 4MTFA 4J10A 1NR1A 1NU1H 1M57C 1SQBH 1RP3B 2OIEA 3OEEG 1V54B 1NTZH 3O9OA 4JYAB 5CMUA 2EJ7A 5JJJB 3AK1A 1BSMA 3UM7A 2YEVA 5L3DA 3F7YC 1F51A 4WFAV 3HPLC 4O4LA 3J80N 4XDKA 2YIAA 4EFBA 3G4SV 4ZBMA 5JVDA 1SA0A 1NQTA 5BR8O 3CRAA 4JI5O 4CH3A 2ILMA 2DYRB 4RO2A 3O65A 3UKMA 2Q73A 2QGNA 3E8HA 5LBQA 1L8DA 1SQGA 2LGWA 1NVPB 1FS0G 3SDLA 3BVOA 4NTWA 1FAFA 1QCEA 3CRQA 4LH7A 1XNRB 4ASUG 1O9GA 3MHSC 4NYKA 1NTMH 4O4IB 3AG2C 4UB6Z 1CP9A 1YTFB 2XAJA 5KA5A 5KA6A 3RYIB 1BZKA 1URFA 2DYSB 3LUTB 1R6KA 4DW1A 1J5EB 2NLJC 1H8EG 2W6IG 1XL6A 5KHHA 3RBZA 3LNNA 4L87A 1AI4A 4NXMB 2QJ1A 2GTSA 3ABKC 3T1YO 3BA8A 3UO3A 2UXDO 3ETQA 3L71H 5E79Z 1UJWB 3AG3B 4JTCB 3VQYA 5GONB 3JYCA 3MAQA 4PA9A 4FZ1A 4JI6B 3T4DA 4LF6O 1JX9A 4TV8B 4UFZA 5IJ9A 3WFVA 1Q6IA 5J9PC 2M7WA 4GX0A 4MVRA 1DK1A 4G2KA 4FLWA 4D6TH 4JYYA 3TK1A 5LXTB 5CB4B 2UUCB 3ZMSA 1VQMV 2P67A 3ZHSA 2BTQA 2X7RB 5LOVB 5C8YA 4X20A 3C90A 1AI7A 3EVKA 2JGDA 5B1AB 4DV2O 5CBFA 2E74B 4DUYB 3LDEA 1RPOA 4CH6A 4FK5C 2VQEO 4J42A 1OV9A 4KUMA 3RVZA 1RSOA 2JRIA 4B3SB 3ZCCA 1XEQA 4LF8O 3WB0A 4AQYB 1AR5A 1VQOV 1JOYA 2JGUA 2M6YA 4NR1A 5KMGB 3D3QA 3WB2A 3QNEA 2JEUA 2E76B 2LFRA 2RMKB 3JCUZ 5EBMC 1ROPA 1N36B 2N74A 5EIBC 1MABG 1OCRC 4DR7O 2UUBO 1XQ8A 1BGYH 1G4YB 2FYUH 3T1HB 2DWEC 1Q6UA 2IW5A 3QO8A 4DO2A 3HKEB 3APOA 5LL6Y 1ZL8B 1NH2B 3CXCU 1Q86W 1F4NA 1YI2V 5J2TA 2GUZA 3E2EA 1WAZA 5JQGB 4X66B 4CC6A 4J7KA 3RYFB 1EN4A 1H2NA 4F4LA 2EILC 2WLIB 4FLUA 3RT3C 1KKDA 4PDLA 4ZOLA 5LHGA 2XAGA 2IM9A 1KMIZ 4RAIA 2ADQB 2P4VA 3K58A 3RYHA 2YDEA 2YXLA 3N2GA 1Y4MA 1RM1B 3OM3B 2VWJA 2Q6AA 4O4HB 2UXCB 3K0DA 1V55C 2GHYA 1VQ4V 4DV1O 1YHQV 4UXNA 1K4CC 3ABMC 3CCVV 1Y6XA 1GAXA 3OEHG 4LH6A 1UPGA 2UUAO 4ZI7B 4DRXA 5EC1C 2IH1C 3JARB 3N2KB 5B3SB 5BMVB 1K3EA 2YI9A 2UU9B 2K9PA 2QTSA 1IBLB 3IFXA 2P06A 4LNUB 1B04A 1OJHA 2GBOA 4JGSA 4JI7O 3DXRA 3G80A 4JAVA 1PL0A 3M7MX 2X6CA 3N27A 1M90W 4NVPA 3IGAC 4X1IB 4TV9B 1N0JA 5B5EZ 1I0HA 5TISZ 4UUJC 3F7VC 4BIOA 1TVKA 1PNLA 4I0XB 1GM7A 4FJCC 4GKJO 1I5YA 2HR3A 4NXNB 2XUMA 1TUBB 4MTGA 4RUFA 4IGGA 2WA4A 3A0HZ 1S5HC 3HKBB 4CS2A 4W4KA 3D36C 3JAWB 5H2FZ 4O2AA 1OCCB 1JJ2U 3OTFA 1JCHA 4QNHB 3QO5A 3OW2U 3D36A 4X1KB 2XTAA 3L72H 3PJSK 3IJ4A 3W7UA 4I55B 1Q43A 4RQFA 3R65A 2ZR3A 1YJ9V 4DV5B 2P5OA 3W7SA 4QIWF 4Z1VA 2ZM6B 3OTOB 5EZYB 2A9HA 1OHHG 4O2BB 1KU9A 4A5UB 2VWKA 3ZMVA 2NR5A 4LFAO 5LMUO 1EN6A 2DWDC 2F4VB 1GM8A 4MTOA 3CPWU 1DF4A 2C2AA 5FNVB 3X2QB 2ETNA 3G71V 4J9YB 2EZOA 4JI3B 3L73H 1G6UA 4LR3A 2H94A 4IIJB 1M5IA 1JJOA 4J41A 5LYJA 4I4TA 4DR1B 4TQDA 1NKDA 1F7YA 4QJFB 4MVSA 1X4TA 4U7NA 3TGUH 2X6BA 1NH2D 1TA8A 2MW2B 3WG7C 1XILA 5B1NA 1RFYA 1QHTA 2N04A 3B2EE 4PA3A 1YZBA 2QWOB 1B3QA 1YJWV 3ZHTA 4NB5A 4QGPA 1SQXH 1WN7A 4P2ZA 4MW3A 5JJEB 5GTIZ 1H8HG 3L70H 1YIJV 3H1JH 3CD6V 4JI2O 3E22B 3D3IA 2CTRA 1SERA 1KP2A 4LFCO 2ZR2A 1BQ0A 1K9MW 1R6TA 3WB1A 4B7KA 5IYZB 4LF7B 1CEZA 5KAIZ 4JAUA 4E2LA 1H2LA 1R1BA 3SPGA 5AG2A 2MK3A 1S3JA 1R3IC 1SZTA 2DQ0A 5L3BA 4B3RB 3E89A 1WA8A 4K3AA 2YEVB 2UXNA 2Q7EA 1Q90D 3ETGA 2Z3YA 4O4LB 1XBLA 1N8RW 2HVJC 1R73A 5EK0A 1FXKC 2AGAA 2Q7HA 4YJ3A 4YXWG 3BRCA 3CCRV 4DXWA 1N34B 4YJ2B 1Z2GA 2GSMB 3SGIA 1FXKA 3TXSA 2QM4A 2ZE7A 2AHZA 2XAFA 3MHHC 1D5NA 2VRZA 1E79G 4G27B 3RN4A 1Z5WA 4DUZB 5K1XA 2JK5C 2PYLA 1GN6A 4MVOA 4MS2A 2VQFB 4IYIA 4TOIA 2OIGA 4GYCB 2QWNB 1PKXA 5LP6C 1QU7A 4X8AA 3AG2B 4OPHA 3JASB 2WLKA 3ZMZA 2EBOA 3L9DA 4LCUC 2KKWA 3B09A 3CC2V 3RYCA 5J2UA 1M56B 2ZINA 1GK9A 2F66C 4H44B 1THZA 4LWSA 1IXBA 1QQCA 4GX2A 4IT5A 4KHPO 2XHBA 2DQ3A 4KXRA 4JYCA 3ZRVA 2CE4A 5IJ9B 1ZSPA 2HFEC 2QR4A 5IY5B 1QR9A 1MMMA 1Y66A 5K1PA 2ZCEA 4OGQB 4TQFA 1MA1A 1IBKB 2P22C 1EM1A 1GO3F 3GWKC 5LA6A 2OWOA 3CCMV 3TCUA 2IJKA 4IHJB 4FFBB 2BTQB 4X1YA 1OCZC 1BS3A 4PJ0Z 2DW4A 5C8YB 1EBOA 1LUVA 3QTCA 3K5NA 3OR7C 3K04A 2HHHO 2JGDB 5JCOC 3L74H 4Z2WA 2XASA 4JI8B 3STLC 2A3QA 3FYIB 2B1IA 3THOA 5EC2C 5JCOA 3M8AA 4RWUA 3H1HH 1RSOB 2PUSA 4JPRA 5LHIA 2BTOA 4WCEV 2K1EA 1QVFU 2A7WA 2P90A 3DGEA 1I7FA 3APQA 2KSDA 1Y67A 4DR5O 4G28B 1HNWB 1NI8A 1FXVA 4DV0O 1SESA 2GDSA 1KB9F 2YIBD 1QVGU 4UCSA 1QLEC 5HFLA 1OCRB 4P9OA 3WU2Z 3PN1A 1E1QG 3ASOC 3K5OA 1KC8W 3FD9A 3KZIZ 3A0RA 1L1FA 2ITCC 2Q67A 1NJIW 3OMAB 3SPHA 5J2TB 2LO1A 1M4UA 1SZXA 2GUZB 4B7EA 1E1RG 3HB3B 2PI5A 2JEXA 2Y4TA 4PDVA 1KBHA 3SR2C 4ZOLB 1NBMG 4LFBB 3DC6A 4YY3B 4KP4A 1S5LZ 5IYCO 4D7SA 3ZHQA 4DV7O 1PNMA 3KCYA 2JVDA 1VQ7V 3RYHB 1LNQA 3N2GB 4X89A 2OTJV 1VP7A 2Z0AA 1QNMA 2JS3A 2ZT9B 1G8MA 3S3WA 4PHZA 1J95A 4XDLA 3HKCA 1K5QA 2QKAA 3ABUA 2EINB 2GV9A 4LF4O 1KKCA 1MG1A 3CRRA 4DRXB 4GLXA 1BCCH 1VQ6V 4K0KB 4I50A 4WFBV 4WBNA 3CEIA 5IWAO 5D5PA 4JI1O 3SYQA 4ZHQA 1HNXO 4DR4O 2F93B 1I94B 1JVMA 4LF9B 4HAMA 3DXRB 2PTMA 3G6BA 1N32B 3CC7V 5A2QN 1IBMO 5F2VO 2OCCC 4DR3B 3ZRSA 3SJAC 2R9AA 5IE9A 5H6QA 4DV6O 2ZXWC 2EIKC 4UV8A 1P84F 3OMNB 4JI0B 1TVKB 1HDJA 4YIOA 2B1GA 4LF5O 2HJFC 3ZIAG 1ZUQA 1M9NA 2WSSG 1HR0B 2X6AA 1QLNA 4MW8A 4ZIBA 1XI1A 1FFXA 4AI8A 1KUQA 3ZMUA 2WPDG 5E1AC 4JI4B 1N33B 4F6EA 1VF5B 1H2KA 4O2AB 4X62B 3HKDA 2LGQA 5EYPA 2EJRA 1SETA 2ZD9A 2GTAA 3U0ZA 2P4KA 2EULA 1NTKH 1KD1W 1CPYA 4DV3B 4UCRA 2ZE6A 4U3JB 1ENVA 1VMGA 3FAVA 3BABA 1IXMA 2HLDG 4DV4B 3RWRD 3TETA 1BT8A 4GKKB 3CRCA 2QE7G 2E5LO 1TUEB 3ZMTA 1QR8A 3ETEA 2N05A 4OX9B 1AR1B 4YHHB 4L8JA 3ZHVA 2WLLA 1NT2B 4B3MB 1BHBA 1FJGO 3JATB 2EIMB 2DYSC 2AW9A 4OPAA 4MTXA 1WP7A 5KX5B 3G6EV 1XNQO 4FIPC 3FX7A 4I4TB 4B3TB 1GN2A 2LFSA 3FB8C 1XMOB 1NVPD 3JCZA 4P9PA 5FPOA 3UQ8A 4JV5O 1WNSA 3EFFK 2FKXA 3AG3C 2CK3G 4Q6GA 1XUQA 1YTFD 2BOCC 2YI8A 1SS3A 3NXSA 2R72A 4NTYA 4LP8A 1WPXA 3CJHA 4TV8A 2CGNA 4I7ZB 1BMFG 3AG1C 4PV1B 4FMTA 2QTOA 1SRYA 3H1KH 3KKYA 1SQPH 4X64O 2UXBO 3W7WA 2VS0A 3JD2A 1Y74B 1GRJA 1HW7A 5CA1B 2QM8A 2ZIOA 5IYDO 5BR8B 4JI5B 3FB5C 2FL4A 5LOVA 4X65O 4DK0A 4DR2B 2P7TC 4DR6O 1R3JC 5DEDA 4N21A 4J7JA 2WLJA 1H2MA 1R3LC 4DW0A 3OGCC 2P6JA 4YIPA 2ZE5A 1SQQH 5LMNO 2Q4PA 3E86A 1ORQC 1MSDA 1YVWA 2A0LA 2X0LA 3ZN0A 5CBHA 1GN3A 1YDXA 3OD4A 2LQTA 2PYJA 2ZKOA 1GMGA 1P49A 1XL4A 3ZS8C 1XMQO 2IU3A 2CUGA 4PDRA 1XHXA 1PNKA 1AJNA 3ML0A 2PI4A 2XNDG 3T1YB 4ABMA 2AZ2A 2UXDB 2JDIG 1NR7A 4CH5A 1HP8A 1S5JA 3JAKB 2DMXA 2YUAA 2AHYA 2F43G 3OGIB 2R9IA 5JH7A 1VQKV 1Y76A 1PPJH 4LF6B 5KHGA 3RGBA 3ZRWA 4F6RA 1F4MA 4JYAO 3QVNA 3CWBH 2QSAA 3KG2A 1ZL8A 1OCOB 2DJVA 1UFIA 3ZRXA 3RYFA 3JALA 2CDYA 2Y0PA 3OR6C 4MT8A 2Y4UA 2WLIA 5J2UB 4IL6Z 4BR6A 1XDCA 3BPZA 1RM1C 1SF9A 1VQPV 4HNAA 4R50A 2Q8VA 3SYCA 1U96A 3C3TA 4DV2B 2QM7A 3FFQA 3K08A 4WFEA 4J7ZA 2VQEB 1XNRO 3UO2A 1DGSA 3P32A 1WB8A 4LF8B 1KP3A 1J5EO 5EBWC 4K35A 4DYLA 5LA6B 5B3SC 1WPBA 5KHKA 1TGOA 3BHPA 2BOBC 3ICXA 3N2KA 5BMVA 4NXMO 4FPPA 5DM6V 2YIDA 1K4DC 5IT9N 1IX9A 1KQSU 1ZX3A 3J81N 1HWYA 2HP8A 2WLHA 3BAAA 2WAMA 4CZZA 4CBCA 1US6A 1W59A 4DR7B 2UUBB 2DE0X 2RQ6A 3K3WA 3CCJV 4JI6O 2L6LA 4B08A 2HJDA 3JD1A 1M57B 1IDSA 3W7TA 2B9ZA 3ZN1A 3SYAA 1JPXA 1XHZA 3SJQC 4JAAA 2CTWA 5KUKA 5H5NA 3E83A 4MSWC 4JTAB 3MD0A 4BW9A 1B06A 3LDDA 1TUBA 2JJ1G 4UB8Z 5JVDB 1SA0B 2QKSA 2UUCO 3CRMA 3R66A 1FYJA 2NN4A 5IJ0A 5LGUA 5C93A 3GVMA 1IURA 3K57A 2EIJC 4DUYO 2IJIA 1Q3EA 2OCHA 4BWAA 1AR4A 5L3EA 4DV1B 3CXHF 3FKSG 4B3SO 2BSKA 2AZ0A 4AQYO 1K73W 2RCVA 2Q68A 3A8TA 4FFKA 5EZYA 5B66Z 3JSLA 2ZQMA 1K8AW 2UUAB 5LP6A 2ARHA 4TUYA 4ZKIA 5H9CA 3CS5A 4JZ2A 4HBNA 4GUNA 1N36O 4H13B 4KL1A 5B1BC 3AEIA 3ABKB 4JI7B 1YF2A 2O57A 3T1HO 3UCSC 3HKCB 5KAFZ 1R3KC 3H1IH 3E8GA 4I9QA 3K03A 1GTOA 1A32A 1SQFA 3CCQV 2XT9A 1ZAUA 4P30A 3OT7A 1JFFA 1JQ0A 1VQ9V 2WWWA 4X66O 4R8CA 4I50B 3L75H 3QG5A 3MDSA 3OFNG 4GKJB 2CTQA 3CHXA 2HEPA 4XBFA 1JMKC 1PM9A 4QPKA 1D2DA 2IBZH 5IYBO 1WB7A 4X20B 1VF6C 4EKWA 2UXCO 1B6QA 5FL7G 3A2FA 4UVAA 4FM2A 1N4CA 3ABTA 1BQZA 5CA0A 2Y69C 1WJZA 3K06A 2ZXWB 2KG7A 5BXZA 4LFAB 2IJJA 5LMUB 5IYZA 1FD9A 4X88A 2UU9O 1BE3H 2RJZA 1IBLO 3HKDB 2Y48A 5EYPB 4NTXA 4EB6A 4BIUA 1V9PA 4FLTA 1T5EA 1IVSA 3A0BZ 5L3FA 3E8BA 3SPCA 3ASNC 2DOSA 3ABLC 4O4JA 1VQNV 3FAVB 1MZFA 5EBLC 4PA6A 3UT5A 3EXAA 5LGNA 2CGOA 4H0LB 1Q8IA 3T2MA 5LHHA 4CS4A 3JAMN 4YJ2A 4DR2O 2ATKC 5HFMA 3K9SA 4NXNO 2WLLB 3ZX6A 1EZJA 1LUWA 5CN0A 1KYOF 3Q4HA 5ITZA 2EILB 4I9WA 1DLBA 2D2CB 2LW1A 3QF7A 5LGTA 1JR9A 3LNMB 4QE9A 1BHAA 3STZC 4LBEC 2ADPA 4JTDB 1K33A 3OUSA 4K8ZA 4PA4A 4PD4F 3JASA 1VQLV 1YCIA 3I5DA 3U11A 1YXBA 1K5SA 5B1OA 1M56C 1AP5A 1V55B 2CH7A 4DV5O 3VOUA 3CCEV 4JI2B 3VBBA 2ZM6O 3OTOO 4FLXA 2NNUA 2PGGA 3ABMB 3AG4C 4HYOA 4LFCB 2HVKC 1PL4A 2E75B 3OUFA 2YC0A 3FYEB 2F4VO 3DC5A 1GN4A 4UCVA 1YSCA 5JJNB 4TSFG 4UVBA 3CJHB 4AHCA 3CSXA 2YXYA 5IY5C 4W4LA 4JI3O 3K79A 1M1KW 3LSSA 4PELA 1S0VA 2XOKG 3VQVA 4WFHA 4EFEA 4J9ZB 3AG1B 1YJNV 3H1LH 4FZ0A 1PP9H 4DR1O 3IC7A 4IHJA 4JASA 2DN9A 4FFBA 1CXZB 3CCLV 3NR7A 2D3OW 3M99B 4N23A 2WLNA 2KB1A 3SJCC 3I56V 4MVZA 2XAQA 1YITV 4GX5A 3CMAV 3TJTA 1V54C 1FPOA 2QKCA 2V7QG 1H2GA 3K5LA 2FMLA 3BA9A 2UXXA 3BY6A 4MVMA 2RDCA 2QA4V 1G1XB 2DYRC 2IU0A 4JF3A 2XAHA 2LJ2A 3BEHA 3P30A 3VQWA 3ZBHA 4LF7O 5JH7B 1MOFA 3BFRA 1Y76B 4KHPB 1MZEA 3SPIA 1X59A 3JD3A 3ZRWB 1AP6A 3EHBB 5KUMA 4D7TA 4F6RB 3K59A 3W7XA 5IDJA 4PI0A 4B3RO 2V4DA 2QWPB 4O4IA 2Q9LA 4MVQA 5CBGA 1HNZB 4H37A 3JD0A 3RYIA 2JIZG 4FLYA 3JALB 5LYJB 1DTOA 3IC9A 3CCSV 4FVMA 3RFRA 2LW7A 5EIBD 3GWOA 1AI6A 1K7DA 2R70A 1WLEA 3AK3A 4R6ZA 4J80A 1N34O 4HNAB 1ZTEA 4UVCA 3FB6C 1PD3A 2Q5ZA 3JSNA 2HHHB 5KHIA 4H33A 5GONA 4DUZO 1I5XA 2EINC 3WG7B 2VQFO 3QO7A 3HR0A 4JYBA 3H01A 4K8XA 1Q81W 3U10A 1XOUA 4GZRB 3GB7C 2BE3A 2OTLV 1L0LH 2ZIMA 4X9QA 4FM1A 4DR5B 5LXTA 3ZHRA 3I55V 3B77A 5CB4A 1P4RA 4LC1A 4DV0B 1F23A 1AJPA 3CX5F 5B1AC 1NZ6A 1VF7A 1K34A 4OXSA 4CH4A 1Z5VA 3CCUV 4HZ3A 3CB2A 3H9VA 3CMEV 2CAZC 2Y0IA 4PDMA 1Q5OA 4J11A 1VARA 1W0JG 3OAAG 4XDJA 2KQXA 3DSQA 3E8FA 1WA8B 4IYHA 2HG5C 3CP1A 1IBKO 1U97A 1XREA 5KMGA 3ETDA 3C3SA 1AROP 2QWRB 5KLVH 1COWG 2WA3A 4PI2A 4FLZA 4UCUA 1OZ0A 4YJ3B 1L0NH 1ZLZA 4DV7B 5IJ0B 2LP7A 1FXKB 4TWKA 3P3PA 1ZWIC 1O9HA 2FTKA 1VIBA 4JI8O 2AXTZ 3E35A 2EIJB 4U3JA 3D8CA 1AVMA 2BSKB 5GW7A 1KECA 2B5UA 3HKEA 1S76D 4PA7A 4LF4B 5FLXN 5LP6B 4TUYB 5JQGA 5D5QA 1VEWA 1TAEA 2YXHA 1AJQA 2WLMA 1FXHA 5IWAB 4GT1A 2EIMC 3RYCB 4JI1B 1HNXB 1HNWO 4DR4B 4CC5A 2F95B 4WFGA 3JATA 1H2SB 4E4EA 4LWSB 1GH6A 4UV9A 2W6JG 1SKVA 3T4ZA 2IJHA 5B1BB 4Z1MG 4QPJA 4FLVA 5KX5A 4RUEA 1SQVH 1IBMB 5CA3A 2F1MA 4O4HA 3T1CA 2L35A 2ZDIC 2G38A 4JZGA 4DV6B 1S72V 1RPRA 3K5MA 1JFFB 2JJ2G 2ZDIA 3AK2A 1QBZA 5L3GA 2E3CA 4UCOA 2RN9A 3F5WC 3JD4A 4LF5B 4ZI7A 4WFFA 1YEWA 1EN5A 2ZNIA 4LFBO 3JARA 4YY3O 4X1YB 1AILA 3BCCH 4DK1A 3KCXA 1VQ8V 3ZJZA 4LNUA 1AB3A 1OCZB 4I5SA 3TXQA 1P7GA 3S3XA 1EZVH 4RQEA 4BW5A 4U3FH 3B8NA 3OE7G 4BAYA 2F23A 1DF5A 3AG7A 3K0GA 4X1IA 1GM9A 4NKGB 4QE7A 4TV9A 3ZEDA 5CA0B 1FFTB 1Y74A 3LSUA 5CA1A 2KG7B 5H6RA 2R9RB 1GKFA 1H38A 2Y69B 2YSUB 4UCTA 2EZPA 2E5LB 3F5TA 4MVUA 1S77D 4K0KO 4I0XA 1WP8A 2ZNJA 3CE2A 5FPRA 3IAYA 1I94O 4GCZA 4LF9O 3CC4V 4EB6B 1FJGB 3RVYA 1OCCC 5JWPA 3VQXA 3HKBA 1N32O 1P7BA 5GTHZ 3JAWA 2Q69A 2H8PC 2QWQB 1QLEB 4O4JB 4DR3O 1Q7YW 1K97A 2QEXV 1W0KG 1XNQB 1LR1A 3FB7C 3ASNB 4X1KA 3UT5B 2A06H 4U7OA 3ABLB 4I55A 2Q7GA 3ASOB 2PZSA 1Q82W 3G67A 4JI0O 3B8MA 5KHJA 4JV5B 1FKAO 5A9GA 4KFMA 3K9AA 1JA8A 2V1DA 4O2BA 5DECA 1IZ3A 1HR0O 2OYQA 3JAKA 3LSQA 3Q4HB 3X2QC 4FM0A 2YICA 1D5AA 5ITZB 1W2BU 1AI5A 3SPJA 3P3NA 2W0XA 1BL8A 4JI4O 1N33O 2W0FC 5FNVA 3OMIB 1I08A 4X62O 1OCOC 3ZHUA 1VQ5V 4R7CA 4Q20A 2JS5A
chains in the Genus database with same CATH topology
1SQVH 4D6TH 1L0LH 1KB9F 4PD4F 3L70H 1NTZH 3H1JH 1P84F 1BGYH 3H1IH 2FYUH 3BCCH 2IBZH 2BCCH 3CX5F 1NTKH 3L72H 1KYOF 1EZVH 1PPJH 2A06H 3L74H 4U3FH 5KLVH 3CXHF 3H1KH 3L71H 1BE3H 1NTMH 1SQXH 3L73H 1NU1H 3CWBH 1SQBH 3H1LH 3TGUH 1BCCH 1SQQH 1L0NH 1SQPH 3L75H 3H1HH 1PP9H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQV H;  4D6T H;  1L0L H;  1KB9 F;  4PD4 F;  3L70 H;  1NTZ H;  3H1J H;  1P84 F;  1BGY H;  3H1I H;  2FYU H;  3BCC H;  2IBZ H;  2BCC H;  3CX5 F;  1NTK H;  3L72 H;  1KYO F;  1EZV H;  1PPJ H;  2A06 H;  3L74 H;  4U3F H;  5KLV H;  3CXH F;  3H1K H;  3L71 H;  1BE3 H;  1NTM H;  1SQX H;  3L73 H;  1NU1 H;  3CWB H;  1SQB H;  3H1L H;  3TGU H;  1BCC H;  1SQQ H;  1L0N H;  1SQP H;  3L75 H;  3H1H H;  1PP9 H; 
#chains in the Genus database with same CATH topology
 4DV3 O;  4IIJ A;  3J7A U;  4EEQ A;  1MNG A;  2ZE8 A;  4X64 B;  2HKO A;  2CH7 B;  2Z5U A;  2UXB B;  4DV4 O;  1EFR G;  4GKK O;  4ICG A;  5BZB A;  4CS3 A;  2QDO A;  3B4S A;  3DTU B;  2RNB A;  4X65 B;  4OX9 O;  5BY1 A;  4YHH O;  3AG4 B;  4DR6 B;  2A79 B;  1R6N A;  1PV0 A;  4WBN B;  2Q0A A;  3RW0 A;  1K92 A;  2PY5 A;  4ZHQ B;  4B3M O;  1N0N A;  3LDC A;  4TT3 G;  2FB5 A;  5LMN B;  4WF9 V;  2BCC H;  4BIZ A;  1NS1 A;  3SJB C;  1HNZ O;  3B40 A;  2IH3 C;  2YS8 A;  5DN6 G;  5L3C A;  1M93 A;  1XMQ B;  1VF6 A;  2OCC B;  3SYP A;  4B3T O;  1XMO O;  2Q0O C;  2YIB A;  2ITD C;  2PF4 E;  4GX1 A;  4AIL C;  3SYO A;  2H3O A;  3E22 A;  1SC5 B;  1Q6H A;  2EIK B;  1MSW D;  2EX3 A;  2OT5 A;  3CYO A;  4C7U A;  2ODM A;  1FFX B;  2CTP A;  4MTF A;  4J10 A;  1NR1 A;  1NU1 H;  1M57 C;  1SQB H;  1RP3 B;  2OIE A;  3OEE G;  1V54 B;  1NTZ H;  3O9O A;  4JYA B;  5CMU A;  2EJ7 A;  5JJJ B;  3AK1 A;  1BSM A;  3UM7 A;  2YEV A;  5L3D A;  3F7Y C;  1F51 A;  4WFA V;  3HPL C;  4O4L A;  3J80 N;  4XDK A;  2YIA A;  4EFB A;  3G4S V;  4ZBM A;  5JVD A;  1SA0 A;  1NQT A;  5BR8 O;  3CRA A;  4JI5 O;  4CH3 A;  2ILM A;  2DYR B;  4RO2 A;  3O65 A;  3UKM A;  2Q73 A;  2QGN A;  3E8H A;  5LBQ A;  1L8D A;  1SQG A;  2LGW A;  1NVP B;  1FS0 G;  3SDL A;  3BVO A;  4NTW A;  1FAF A;  1QCE A;  3CRQ A;  4LH7 A;  1XNR B;  4ASU G;  1O9G A;  3MHS C;  4NYK A;  1NTM H;  4O4I B;  3AG2 C;  4UB6 Z;  1CP9 A;  1YTF B;  2XAJ A;  5KA5 A;  5KA6 A;  3RYI B;  1BZK A;  1URF A;  2DYS B;  3LUT B;  1R6K A;  4DW1 A;  1J5E B;  2NLJ C;  1H8E G;  2W6I G;  1XL6 A;  5KHH A;  3RBZ A;  3LNN A;  4L87 A;  1AI4 A;  4NXM B;  2QJ1 A;  2GTS A;  3ABK C;  3T1Y O;  3BA8 A;  3UO3 A;  2UXD O;  3ETQ A;  3L71 H;  5E79 Z;  1UJW B;  3AG3 B;  4JTC B;  3VQY A;  5GON B;  3JYC A;  3MAQ A;  4PA9 A;  4FZ1 A;  4JI6 B;  3T4D A;  4LF6 O;  1JX9 A;  4TV8 B;  4UFZ A;  5IJ9 A;  3WFV A;  1Q6I A;  5J9P C;  2M7W A;  4GX0 A;  4MVR A;  1DK1 A;  4G2K A;  4FLW A;  4D6T H;  4JYY A;  3TK1 A;  5LXT B;  5CB4 B;  2UUC B;  3ZMS A;  1VQM V;  2P67 A;  3ZHS A;  2BTQ A;  2X7R B;  5LOV B;  5C8Y A;  4X20 A;  3C90 A;  1AI7 A;  3EVK A;  2JGD A;  5B1A B;  4DV2 O;  5CBF A;  2E74 B;  4DUY B;  3LDE A;  1RPO A;  4CH6 A;  4FK5 C;  2VQE O;  4J42 A;  1OV9 A;  4KUM A;  3RVZ A;  1RSO A;  2JRI A;  4B3S B;  3ZCC A;  1XEQ A;  4LF8 O;  3WB0 A;  4AQY B;  1AR5 A;  1VQO V;  1JOY A;  2JGU A;  2M6Y A;  4NR1 A;  5KMG B;  3D3Q A;  3WB2 A;  3QNE A;  2JEU A;  2E76 B;  2LFR A;  2RMK B;  3JCU Z;  5EBM C;  1ROP A;  1N36 B;  2N74 A;  5EIB C;  1MAB G;  1OCR C;  4DR7 O;  2UUB O;  1XQ8 A;  1BGY H;  1G4Y B;  2FYU H;  3T1H B;  2DWE C;  1Q6U A;  2IW5 A;  3QO8 A;  4DO2 A;  3HKE B;  3APO A;  5LL6 Y;  1ZL8 B;  1NH2 B;  3CXC U;  1Q86 W;  1F4N A;  1YI2 V;  5J2T A;  2GUZ A;  3E2E A;  1WAZ A;  5JQG B;  4X66 B;  4CC6 A;  4J7K A;  3RYF B;  1EN4 A;  1H2N A;  4F4L A;  2EIL C;  2WLI B;  4FLU A;  3RT3 C;  1KKD A;  4PDL A;  4ZOL A;  5LHG A;  2XAG A;  2IM9 A;  1KMI Z;  4RAI A;  2ADQ B;  2P4V A;  3K58 A;  3RYH A;  2YDE A;  2YXL A;  3N2G A;  1Y4M A;  1RM1 B;  3OM3 B;  2VWJ A;  2Q6A A;  4O4H B;  2UXC B;  3K0D A;  1V55 C;  2GHY A;  1VQ4 V;  4DV1 O;  1YHQ V;  4UXN A;  1K4C C;  3ABM C;  3CCV V;  1Y6X A;  1GAX A;  3OEH G;  4LH6 A;  1UPG A;  2UUA O;  4ZI7 B;  4DRX A;  5EC1 C;  2IH1 C;  3JAR B;  3N2K B;  5B3S B;  5BMV B;  1K3E A;  2YI9 A;  2UU9 B;  2K9P A;  2QTS A;  1IBL B;  3IFX A;  2P06 A;  4LNU B;  1B04 A;  1OJH A;  2GBO A;  4JGS A;  4JI7 O;  3DXR A;  3G80 A;  4JAV A;  1PL0 A;  3M7M X;  2X6C A;  3N27 A;  1M90 W;  4NVP A;  3IGA C;  4X1I B;  4TV9 B;  1N0J A;  5B5E Z;  1I0H A;  5TIS Z;  4UUJ C;  3F7V C;  4BIO A;  1TVK A;  1PNL A;  4I0X B;  1GM7 A;  4FJC C;  4GKJ O;  1I5Y A;  2HR3 A;  4NXN B;  2XUM A;  1TUB B;  4MTG A;  4RUF A;  4IGG A;  2WA4 A;  3A0H Z;  1S5H C;  3HKB B;  4CS2 A;  4W4K A;  3D36 C;  3JAW B;  5H2F Z;  4O2A A;  1OCC B;  1JJ2 U;  3OTF A;  1JCH A;  4QNH B;  3QO5 A;  3OW2 U;  3D36 A;  4X1K B;  2XTA A;  3L72 H;  3PJS K;  3IJ4 A;  3W7U A;  4I55 B;  1Q43 A;  4RQF A;  3R65 A;  2ZR3 A;  1YJ9 V;  4DV5 B;  2P5O A;  3W7S A;  4QIW F;  4Z1V A;  2ZM6 B;  3OTO B;  5EZY B;  2A9H A;  1OHH G;  4O2B B;  1KU9 A;  4A5U B;  2VWK A;  3ZMV A;  2NR5 A;  4LFA O;  5LMU O;  1EN6 A;  2DWD C;  2F4V B;  1GM8 A;  4MTO A;  3CPW U;  1DF4 A;  2C2A A;  5FNV B;  3X2Q B;  2ETN A;  3G71 V;  4J9Y B;  2EZO A;  4JI3 B;  3L73 H;  1G6U A;  4LR3 A;  2H94 A;  4IIJ B;  1M5I A;  1JJO A;  4J41 A;  5LYJ A;  4I4T A;  4DR1 B;  4TQD A;  1NKD A;  1F7Y A;  4QJF B;  4MVS A;  1X4T A;  4U7N A;  3TGU H;  2X6B A;  1NH2 D;  1TA8 A;  2MW2 B;  3WG7 C;  1XIL A;  5B1N A;  1RFY A;  1QHT A;  2N04 A;  3B2E E;  4PA3 A;  1YZB A;  2QWO B;  1B3Q A;  1YJW V;  3ZHT A;  4NB5 A;  4QGP A;  1SQX H;  1WN7 A;  4P2Z A;  4MW3 A;  5JJE B;  5GTI Z;  1H8H G;  3L70 H;  1YIJ V;  3H1J H;  3CD6 V;  4JI2 O;  3E22 B;  3D3I A;  2CTR A;  1SER A;  1KP2 A;  4LFC O;  2ZR2 A;  1BQ0 A;  1K9M W;  1R6T A;  3WB1 A;  4B7K A;  5IYZ B;  4LF7 B;  1CEZ A;  5KAI Z;  4JAU A;  4E2L A;  1H2L A;  1R1B A;  3SPG A;  5AG2 A;  2MK3 A;  1S3J A;  1R3I C;  1SZT A;  2DQ0 A;  5L3B A;  4B3R B;  3E89 A;  1WA8 A;  4K3A A;  2YEV B;  2UXN A;  2Q7E A;  1Q90 D;  3ETG A;  2Z3Y A;  4O4L B;  1XBL A;  1N8R W;  2HVJ C;  1R73 A;  5EK0 A;  1FXK C;  2AGA A;  2Q7H A;  4YJ3 A;  4YXW G;  3BRC A;  3CCR V;  4DXW A;  1N34 B;  4YJ2 B;  1Z2G A;  2GSM B;  3SGI A;  1FXK A;  3TXS A;  2QM4 A;  2ZE7 A;  2AHZ A;  2XAF A;  3MHH C;  1D5N A;  2VRZ A;  1E79 G;  4G27 B;  3RN4 A;  1Z5W A;  4DUZ B;  5K1X A;  2JK5 C;  2PYL A;  1GN6 A;  4MVO A;  4MS2 A;  2VQF B;  4IYI A;  4TOI A;  2OIG A;  4GYC B;  2QWN B;  1PKX A;  5LP6 C;  1QU7 A;  4X8A A;  3AG2 B;  4OPH A;  3JAS B;  2WLK A;  3ZMZ A;  2EBO A;  3L9D A;  4LCU C;  2KKW A;  3B09 A;  3CC2 V;  3RYC A;  5J2U A;  1M56 B;  2ZIN A;  1GK9 A;  2F66 C;  4H44 B;  1THZ A;  4LWS A;  1IXB A;  1QQC A;  4GX2 A;  4IT5 A;  4KHP O;  2XHB A;  2DQ3 A;  4KXR A;  4JYC A;  3ZRV A;  2CE4 A;  5IJ9 B;  1ZSP A;  2HFE C;  2QR4 A;  5IY5 B;  1QR9 A;  1MMM A;  1Y66 A;  5K1P A;  2ZCE A;  4OGQ B;  4TQF A;  1MA1 A;  1IBK B;  2P22 C;  1EM1 A;  1GO3 F;  3GWK C;  5LA6 A;  2OWO A;  3CCM V;  3TCU A;  2IJK A;  4IHJ B;  4FFB B;  2BTQ B;  4X1Y A;  1OCZ C;  1BS3 A;  4PJ0 Z;  2DW4 A;  5C8Y B;  1EBO A;  1LUV A;  3QTC A;  3K5N A;  3OR7 C;  3K04 A;  2HHH O;  2JGD B;  5JCO C;  3L74 H;  4Z2W A;  2XAS A;  4JI8 B;  3STL C;  2A3Q A;  3FYI B;  2B1I A;  3THO A;  5EC2 C;  5JCO A;  3M8A A;  4RWU A;  3H1H H;  1RSO B;  2PUS A;  4JPR A;  5LHI A;  2BTO A;  4WCE V;  2K1E A;  1QVF U;  2A7W A;  2P90 A;  3DGE A;  1I7F A;  3APQ A;  2KSD A;  1Y67 A;  4DR5 O;  4G28 B;  1HNW B;  1NI8 A;  1FXV A;  4DV0 O;  1SES A;  2GDS A;  1KB9 F;  2YIB D;  1QVG U;  4UCS A;  1QLE C;  5HFL A;  1OCR B;  4P9O A;  3WU2 Z;  3PN1 A;  1E1Q G;  3ASO C;  3K5O A;  1KC8 W;  3FD9 A;  3KZI Z;  3A0R A;  1L1F A;  2ITC C;  2Q67 A;  1NJI W;  3OMA B;  3SPH A;  5J2T B;  2LO1 A;  1M4U A;  1SZX A;  2GUZ B;  4B7E A;  1E1R G;  3HB3 B;  2PI5 A;  2JEX A;  2Y4T A;  4PDV A;  1KBH A;  3SR2 C;  4ZOL B;  1NBM G;  4LFB B;  3DC6 A;  4YY3 B;  4KP4 A;  1S5L Z;  5IYC O;  4D7S A;  3ZHQ A;  4DV7 O;  1PNM A;  3KCY A;  2JVD A;  1VQ7 V;  3RYH B;  1LNQ A;  3N2G B;  4X89 A;  2OTJ V;  1VP7 A;  2Z0A A;  1QNM A;  2JS3 A;  2ZT9 B;  1G8M A;  3S3W A;  4PHZ A;  1J95 A;  4XDL A;  3HKC A;  1K5Q A;  2QKA A;  3ABU A;  2EIN B;  2GV9 A;  4LF4 O;  1KKC A;  1MG1 A;  3CRR A;  4DRX B;  4GLX A;  1BCC H;  1VQ6 V;  4K0K B;  4I50 A;  4WFB V;  4WBN A;  3CEI A;  5IWA O;  5D5P A;  4JI1 O;  3SYQ A;  4ZHQ A;  1HNX O;  4DR4 O;  2F93 B;  1I94 B;  1JVM A;  4LF9 B;  4HAM A;  3DXR B;  2PTM A;  3G6B A;  1N32 B;  3CC7 V;  5A2Q N;  1IBM O;  5F2V O;  2OCC C;  4DR3 B;  3ZRS A;  3SJA C;  2R9A A;  5IE9 A;  5H6Q A;  4DV6 O;  2ZXW C;  2EIK C;  4UV8 A;  1P84 F;  3OMN B;  4JI0 B;  1TVK B;  1HDJ A;  4YIO A;  2B1G A;  4LF5 O;  2HJF C;  3ZIA G;  1ZUQ A;  1M9N A;  2WSS G;  1HR0 B;  2X6A A;  1QLN A;  4MW8 A;  4ZIB A;  1XI1 A;  1FFX A;  4AI8 A;  1KUQ A;  3ZMU A;  2WPD G;  5E1A C;  4JI4 B;  1N33 B;  4F6E A;  1VF5 B;  1H2K A;  4O2A B;  4X62 B;  3HKD A;  2LGQ A;  5EYP A;  2EJR A;  1SET A;  2ZD9 A;  2GTA A;  3U0Z A;  2P4K A;  2EUL A;  1NTK H;  1KD1 W;  1CPY A;  4DV3 B;  4UCR A;  2ZE6 A;  4U3J B;  1ENV A;  1VMG A;  3FAV A;  3BAB A;  1IXM A;  2HLD G;  4DV4 B;  3RWR D;  3TET A;  1BT8 A;  4GKK B;  3CRC A;  2QE7 G;  2E5L O;  1TUE B;  3ZMT A;  1QR8 A;  3ETE A;  2N05 A;  4OX9 B;  1AR1 B;  4YHH B;  4L8J A;  3ZHV A;  2WLL A;  1NT2 B;  4B3M B;  1BHB A;  1FJG O;  3JAT B;  2EIM B;  2DYS C;  2AW9 A;  4OPA A;  4MTX A;  1WP7 A;  5KX5 B;  3G6E V;  1XNQ O;  4FIP C;  3FX7 A;  4I4T B;  4B3T B;  1GN2 A;  2LFS A;  3FB8 C;  1XMO B;  1NVP D;  3JCZ A;  4P9P A;  5FPO A;  3UQ8 A;  4JV5 O;  1WNS A;  3EFF K;  2FKX A;  3AG3 C;  2CK3 G;  4Q6G A;  1XUQ A;  1YTF D;  2BOC C;  2YI8 A;  1SS3 A;  3NXS A;  2R72 A;  4NTY A;  4LP8 A;  1WPX A;  3CJH A;  4TV8 A;  2CGN A;  4I7Z B;  1BMF G;  3AG1 C;  4PV1 B;  4FMT A;  2QTO A;  1SRY A;  3H1K H;  3KKY A;  1SQP H;  4X64 O;  2UXB O;  3W7W A;  2VS0 A;  3JD2 A;  1Y74 B;  1GRJ A;  1HW7 A;  5CA1 B;  2QM8 A;  2ZIO A;  5IYD O;  5BR8 B;  4JI5 B;  3FB5 C;  2FL4 A;  5LOV A;  4X65 O;  4DK0 A;  4DR2 B;  2P7T C;  4DR6 O;  1R3J C;  5DED A;  4N21 A;  4J7J A;  2WLJ A;  1H2M A;  1R3L C;  4DW0 A;  3OGC C;  2P6J A;  4YIP A;  2ZE5 A;  1SQQ H;  5LMN O;  2Q4P A;  3E86 A;  1ORQ C;  1MSD A;  1YVW A;  2A0L A;  2X0L A;  3ZN0 A;  5CBH A;  1GN3 A;  1YDX A;  3OD4 A;  2LQT A;  2PYJ A;  2ZKO A;  1GMG A;  1P49 A;  1XL4 A;  3ZS8 C;  1XMQ O;  2IU3 A;  2CUG A;  4PDR A;  1XHX A;  1PNK A;  1AJN A;  3ML0 A;  2PI4 A;  2XND G;  3T1Y B;  4ABM A;  2AZ2 A;  2UXD B;  2JDI G;  1NR7 A;  4CH5 A;  1HP8 A;  1S5J A;  3JAK B;  2DMX A;  2YUA A;  2AHY A;  2F43 G;  3OGI B;  2R9I A;  5JH7 A;  1VQK V;  1Y76 A;  1PPJ H;  4LF6 B;  5KHG A;  3RGB A;  3ZRW A;  4F6R A;  1F4M A;  4JYA O;  3QVN A;  3CWB H;  2QSA A;  3KG2 A;  1ZL8 A;  1OCO B;  2DJV A;  1UFI A;  3ZRX A;  3RYF A;  3JAL A;  2CDY A;  2Y0P A;  3OR6 C;  4MT8 A;  2Y4U A;  2WLI A;  5J2U B;  4IL6 Z;  4BR6 A;  1XDC A;  3BPZ A;  1RM1 C;  1SF9 A;  1VQP V;  4HNA A;  4R50 A;  2Q8V A;  3SYC A;  1U96 A;  3C3T A;  4DV2 B;  2QM7 A;  3FFQ A;  3K08 A;  4WFE A;  4J7Z A;  2VQE B;  1XNR O;  3UO2 A;  1DGS A;  3P32 A;  1WB8 A;  4LF8 B;  1KP3 A;  1J5E O;  5EBW C;  4K35 A;  4DYL A;  5LA6 B;  5B3S C;  1WPB A;  5KHK A;  1TGO A;  3BHP A;  2BOB C;  3ICX A;  3N2K A;  5BMV A;  4NXM O;  4FPP A;  5DM6 V;  2YID A;  1K4D C;  5IT9 N;  1IX9 A;  1KQS U;  1ZX3 A;  3J81 N;  1HWY A;  2HP8 A;  2WLH A;  3BAA A;  2WAM A;  4CZZ A;  4CBC A;  1US6 A;  1W59 A;  4DR7 B;  2UUB B;  2DE0 X;  2RQ6 A;  3K3W A;  3CCJ V;  4JI6 O;  2L6L A;  4B08 A;  2HJD A;  3JD1 A;  1M57 B;  1IDS A;  3W7T A;  2B9Z A;  3ZN1 A;  3SYA A;  1JPX A;  1XHZ A;  3SJQ C;  4JAA A;  2CTW A;  5KUK A;  5H5N A;  3E83 A;  4MSW C;  4JTA B;  3MD0 A;  4BW9 A;  1B06 A;  3LDD A;  1TUB A;  2JJ1 G;  4UB8 Z;  5JVD B;  1SA0 B;  2QKS A;  2UUC O;  3CRM A;  3R66 A;  1FYJ A;  2NN4 A;  5IJ0 A;  5LGU A;  5C93 A;  3GVM A;  1IUR A;  3K57 A;  2EIJ C;  4DUY O;  2IJI A;  1Q3E A;  2OCH A;  4BWA A;  1AR4 A;  5L3E A;  4DV1 B;  3CXH F;  3FKS G;  4B3S O;  2BSK A;  2AZ0 A;  4AQY O;  1K73 W;  2RCV A;  2Q68 A;  3A8T A;  4FFK A;  5EZY A;  5B66 Z;  3JSL A;  2ZQM A;  1K8A W;  2UUA B;  5LP6 A;  2ARH A;  4TUY A;  4ZKI A;  5H9C A;  3CS5 A;  4JZ2 A;  4HBN A;  4GUN A;  1N36 O;  4H13 B;  4KL1 A;  5B1B C;  3AEI A;  3ABK B;  4JI7 B;  1YF2 A;  2O57 A;  3T1H O;  3UCS C;  3HKC B;  5KAF Z;  1R3K C;  3H1I H;  3E8G A;  4I9Q A;  3K03 A;  1GTO A;  1A32 A;  1SQF A;  3CCQ V;  2XT9 A;  1ZAU A;  4P30 A;  3OT7 A;  1JFF A;  1JQ0 A;  1VQ9 V;  2WWW A;  4X66 O;  4R8C A;  4I50 B;  3L75 H;  3QG5 A;  3MDS A;  3OFN G;  4GKJ B;  2CTQ A;  3CHX A;  2HEP A;  4XBF A;  1JMK C;  1PM9 A;  4QPK A;  1D2D A;  2IBZ H;  5IYB O;  1WB7 A;  4X20 B;  1VF6 C;  4EKW A;  2UXC O;  1B6Q A;  5FL7 G;  3A2F A;  4UVA A;  4FM2 A;  1N4C A;  3ABT A;  1BQZ A;  5CA0 A;  2Y69 C;  1WJZ A;  3K06 A;  2ZXW B;  2KG7 A;  5BXZ A;  4LFA B;  2IJJ A;  5LMU B;  5IYZ A;  1FD9 A;  4X88 A;  2UU9 O;  1BE3 H;  2RJZ A;  1IBL O;  3HKD B;  2Y48 A;  5EYP B;  4NTX A;  4EB6 A;  4BIU A;  1V9P A;  4FLT A;  1T5E A;  1IVS A;  3A0B Z;  5L3F A;  3E8B A;  3SPC A;  3ASN C;  2DOS A;  3ABL C;  4O4J A;  1VQN V;  3FAV B;  1MZF A;  5EBL C;  4PA6 A;  3UT5 A;  3EXA A;  5LGN A;  2CGO A;  4H0L B;  1Q8I A;  3T2M A;  5LHH A;  4CS4 A;  3JAM N;  4YJ2 A;  4DR2 O;  2ATK C;  5HFM A;  3K9S A;  4NXN O;  2WLL B;  3ZX6 A;  1EZJ A;  1LUW A;  5CN0 A;  1KYO F;  3Q4H A;  5ITZ A;  2EIL B;  4I9W A;  1DLB A;  2D2C B;  2LW1 A;  3QF7 A;  5LGT A;  1JR9 A;  3LNM B;  4QE9 A;  1BHA A;  3STZ C;  4LBE C;  2ADP A;  4JTD B;  1K33 A;  3OUS A;  4K8Z A;  4PA4 A;  4PD4 F;  3JAS A;  1VQL V;  1YCI A;  3I5D A;  3U11 A;  1YXB A;  1K5S A;  5B1O A;  1M56 C;  1AP5 A;  1V55 B;  2CH7 A;  4DV5 O;  3VOU A;  3CCE V;  4JI2 B;  3VBB A;  2ZM6 O;  3OTO O;  4FLX A;  2NNU A;  2PGG A;  3ABM B;  3AG4 C;  4HYO A;  4LFC B;  2HVK C;  1PL4 A;  2E75 B;  3OUF A;  2YC0 A;  3FYE B;  2F4V O;  3DC5 A;  1GN4 A;  4UCV A;  1YSC A;  5JJN B;  4TSF G;  4UVB A;  3CJH B;  4AHC A;  3CSX A;  2YXY A;  5IY5 C;  4W4L A;  4JI3 O;  3K79 A;  1M1K W;  3LSS A;  4PEL A;  1S0V A;  2XOK G;  3VQV A;  4WFH A;  4EFE A;  4J9Z B;  3AG1 B;  1YJN V;  3H1L H;  4FZ0 A;  1PP9 H;  4DR1 O;  3IC7 A;  4IHJ A;  4JAS A;  2DN9 A;  4FFB A;  1CXZ B;  3CCL V;  3NR7 A;  2D3O W;  3M99 B;  4N23 A;  2WLN A;  2KB1 A;  3SJC C;  3I56 V;  4MVZ A;  2XAQ A;  1YIT V;  4GX5 A;  3CMA V;  3TJT A;  1V54 C;  1FPO A;  2QKC A;  2V7Q G;  1H2G A;  3K5L A;  2FML A;  3BA9 A;  2UXX A;  3BY6 A;  4MVM A;  2RDC A;  2QA4 V;  1G1X B;  2DYR C;  2IU0 A;  4JF3 A;  2XAH A;  2LJ2 A;  3BEH A;  3P30 A;  3VQW A;  3ZBH A;  4LF7 O;  5JH7 B;  1MOF A;  3BFR A;  1Y76 B;  4KHP B;  1MZE A;  3SPI A;  1X59 A;  3JD3 A;  3ZRW B;  1AP6 A;  3EHB B;  5KUM A;  4D7T A;  4F6R B;  3K59 A;  3W7X A;  5IDJ A;  4PI0 A;  4B3R O;  2V4D A;  2QWP B;  4O4I A;  2Q9L A;  4MVQ A;  5CBG A;  1HNZ B;  4H37 A;  3JD0 A;  3RYI A;  2JIZ G;  4FLY A;  3JAL B;  5LYJ B;  1DTO A;  3IC9 A;  3CCS V;  4FVM A;  3RFR A;  2LW7 A;  5EIB D;  3GWO A;  1AI6 A;  1K7D A;  2R70 A;  1WLE A;  3AK3 A;  4R6Z A;  4J80 A;  1N34 O;  4HNA B;  1ZTE A;  4UVC A;  3FB6 C;  1PD3 A;  2Q5Z A;  3JSN A;  2HHH B;  5KHI A;  4H33 A;  5GON A;  4DUZ O;  1I5X A;  2EIN C;  3WG7 B;  2VQF O;  3QO7 A;  3HR0 A;  4JYB A;  3H01 A;  4K8X A;  1Q81 W;  3U10 A;  1XOU A;  4GZR B;  3GB7 C;  2BE3 A;  2OTL V;  1L0L H;  2ZIM A;  4X9Q A;  4FM1 A;  4DR5 B;  5LXT A;  3ZHR A;  3I55 V;  3B77 A;  5CB4 A;  1P4R A;  4LC1 A;  4DV0 B;  1F23 A;  1AJP A;  3CX5 F;  5B1A C;  1NZ6 A;  1VF7 A;  1K34 A;  4OXS A;  4CH4 A;  1Z5V A;  3CCU V;  4HZ3 A;  3CB2 A;  3H9V A;  3CME V;  2CAZ C;  2Y0I A;  4PDM A;  1Q5O A;  4J11 A;  1VAR A;  1W0J G;  3OAA G;  4XDJ A;  2KQX A;  3DSQ A;  3E8F A;  1WA8 B;  4IYH A;  2HG5 C;  3CP1 A;  1IBK O;  1U97 A;  1XRE A;  5KMG A;  3ETD A;  3C3S A;  1ARO P;  2QWR B;  5KLV H;  1COW G;  2WA3 A;  4PI2 A;  4FLZ A;  4UCU A;  1OZ0 A;  4YJ3 B;  1L0N H;  1ZLZ A;  4DV7 B;  5IJ0 B;  2LP7 A;  1FXK B;  4TWK A;  3P3P A;  1ZWI C;  1O9H A;  2FTK A;  1VIB A;  4JI8 O;  2AXT Z;  3E35 A;  2EIJ B;  4U3J A;  3D8C A;  1AVM A;  2BSK B;  5GW7 A;  1KEC A;  2B5U A;  3HKE A;  1S76 D;  4PA7 A;  4LF4 B;  5FLX N;  5LP6 B;  4TUY B;  5JQG A;  5D5Q A;  1VEW A;  1TAE A;  2YXH A;  1AJQ A;  2WLM A;  1FXH A;  5IWA B;  4GT1 A;  2EIM C;  3RYC B;  4JI1 B;  1HNX B;  1HNW O;  4DR4 B;  4CC5 A;  2F95 B;  4WFG A;  3JAT A;  1H2S B;  4E4E A;  4LWS B;  1GH6 A;  4UV9 A;  2W6J G;  1SKV A;  3T4Z A;  2IJH A;  5B1B B;  4Z1M G;  4QPJ A;  4FLV A;  5KX5 A;  4RUE A;  1SQV H;  1IBM B;  5CA3 A;  2F1M A;  4O4H A;  3T1C A;  2L35 A;  2ZDI C;  2G38 A;  4JZG A;  4DV6 B;  1S72 V;  1RPR A;  3K5M A;  1JFF B;  2JJ2 G;  2ZDI A;  3AK2 A;  1QBZ A;  5L3G A;  2E3C A;  4UCO A;  2RN9 A;  3F5W C;  3JD4 A;  4LF5 B;  4ZI7 A;  4WFF A;  1YEW A;  1EN5 A;  2ZNI A;  4LFB O;  3JAR A;  4YY3 O;  4X1Y B;  1AIL A;  3BCC H;  4DK1 A;  3KCX A;  1VQ8 V;  3ZJZ A;  4LNU A;  1AB3 A;  1OCZ B;  4I5S A;  3TXQ A;  1P7G A;  3S3X A;  1EZV H;  4RQE A;  4BW5 A;  4U3F H;  3B8N A;  3OE7 G;  4BAY A;  2F23 A;  1DF5 A;  3AG7 A;  3K0G A;  4X1I A;  1GM9 A;  4NKG B;  4QE7 A;  4TV9 A;  3ZED A;  5CA0 B;  1FFT B;  1Y74 A;  3LSU A;  5CA1 A;  2KG7 B;  5H6R A;  2R9R B;  1GKF A;  1H38 A;  2Y69 B;  2YSU B;  4UCT A;  2EZP A;  2E5L B;  3F5T A;  4MVU A;  1S77 D;  4K0K O;  4I0X A;  1WP8 A;  2ZNJ A;  3CE2 A;  5FPR A;  3IAY A;  1I94 O;  4GCZ A;  4LF9 O;  3CC4 V;  4EB6 B;  1FJG B;  3RVY A;  1OCC C;  5JWP A;  3VQX A;  3HKB A;  1N32 O;  1P7B A;  5GTH Z;  3JAW A;  2Q69 A;  2H8P C;  2QWQ B;  1QLE B;  4O4J B;  4DR3 O;  1Q7Y W;  1K97 A;  2QEX V;  1W0K G;  1XNQ B;  1LR1 A;  3FB7 C;  3ASN B;  4X1K A;  3UT5 B;  2A06 H;  4U7O A;  3ABL B;  4I55 A;  2Q7G A;  3ASO B;  2PZS A;  1Q82 W;  3G67 A;  4JI0 O;  3B8M A;  5KHJ A;  4JV5 B;  1FKA O;  5A9G A;  4KFM A;  3K9A A;  1JA8 A;  2V1D A;  4O2B A;  5DEC A;  1IZ3 A;  1HR0 O;  2OYQ A;  3JAK A;  3LSQ A;  3Q4H B;  3X2Q C;  4FM0 A;  2YIC A;  1D5A A;  5ITZ B;  1W2B U;  1AI5 A;  3SPJ A;  3P3N A;  2W0X A;  1BL8 A;  4JI4 O;  1N33 O;  2W0F C;  5FNV A;  3OMI B;  1I08 A;  4X62 O;  1OCO C;  3ZHU A;  1VQ5 V;  4R7C A;  4Q20 A;  2JS5 A; 
#chains in the Genus database with same CATH homology
 1SQV H;  4D6T H;  1L0L H;  1KB9 F;  4PD4 F;  3L70 H;  1NTZ H;  3H1J H;  1P84 F;  1BGY H;  3H1I H;  2FYU H;  3BCC H;  2IBZ H;  2BCC H;  3CX5 F;  1NTK H;  3L72 H;  1KYO F;  1EZV H;  1PPJ H;  2A06 H;  3L74 H;  4U3F H;  5KLV H;  3CXH F;  3H1K H;  3L71 H;  1BE3 H;  1NTM H;  1SQX H;  3L73 H;  1NU1 H;  3CWB H;  1SQB H;  3H1L H;  3TGU H;  1BCC H;  1SQQ H;  1L0N H;  1SQP H;  3L75 H;  3H1H H;  1PP9 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...