3CX5H

Structure of complex iii with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
93
structure length
93
Chain Sequence
GPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
total genus 18
structure length 93
sequence length 93
chains with identical sequence S
ec nomenclature
pdb deposition date 2008-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3cx5H00
1NTMG 1SQVG 2FYUG 2A06G 3CWBG 1SQBG 4PD4H 1BGYG 1L0NG 4U3FG 3L72G 3H1IG 1NU1G 3TGUG 1KB9H 3L74G 1SQPG 3H1HG 1NTKG 3H1JG 4D6TG 1PPJG 3CX5H 2BCCG 1SQQG 3H1LG 1KYOH 1P84H 1BE3G 1NTZG 3BCCG 3CXHH 3L70G 3L75G 1EZVG 1PP9G 1BCCG 3L71G 3H1KG 2IBZG 3L73G 5KLVG 1SQXG 1L0LG
chains in the Genus database with same CATH superfamily
1NTMG 1FS0E 1PIXA 2FYUK 1ZRTE 1NTKD 2OTKE 5AW5B 3RBZA 3V2RA 1N2DC 1FZAA 1NKZB 1NTMD 1PGQA 1CI6B 3H1LE 4OWFA 3H1LD 4JPZB 4EYYQ 5TISE 5KLVJ 2XNDH 1KQSO 3L72D 2ZYGA 2Z4EA 2MKVA 2PGDA 3HTKA 1NU1K 4WWIA 3MZWB 2E74D 2L91A 1KB9I 1EZVE 1NU1D 3IAOA 3L74G 3MIWA 2J5UA 3CWBD 1SQVJ 4HB1A 3M9BA 2QM8A 3H1IE 4WY4D 3H1ID 1J1EC 3L36A 3CCUP 3ZDMA 4R4LA 2I1JA 3AEEC 3CL3D 2E76B 2DW3A 2GA1A 1PL5A 4DT0A 1HH0A 1FAVA 1UIIA 2R32A 3H1KD 3JSVC 4I2LC 4L75A 3H1KE 3O6QA 3QWOC 3H1KG 1A02F 1K73Q 2QJYC 2WVRA 3JC22 4YXWH 1X79B 2G3AA 3L37A 1KTMA 1RF0A 2WMMA 4H44C 4UB6H 3OW2O 1H88A 1PGOA 2A06G 4NPFX 2R3CA 1GL2B 3F5HA 4N3YB 3V5BA 5GTIH 2M8RA 2E76D 4WBAA 2H89C 5CJ0A 1R5LA 4JYCA 3TNUB 2H7HA 4K3AA 1N7SC 4JQ0D 3TGUG 3AE9C 2LXBA 4KHXA 3V4WA 3TDKA 3HD7A 2PP6A 2BCCG 3D6YA 1SQQG 3O6QB 3LW5H 2B88A 1EDKA 3RK3C 4I1LA 2FYZA 1QVGO 2XDJA 2IX7C 5APUA 3L75D 1R5SA 3HD7B 1M7LA 2O01J 5KAFH 1L0NJ 2RN0A 3SWFA 1NU1J 1OIPA 1BCCD 2Q3EA 2UWJE 2XKMA 3CWBJ 3GHGB 4H44D 4ASWA 3SFEC 3L75J 2FYUJ 5AW3B 3PRJA 1BCCG 1W5CE 5APWA 2YO2A 3H1IJ 5AVZB 1N7SA 4ZKUA 2POHA 3FGAD 1X22A 2OQQA 2QG4A 3CPWO 5AVUB 1FC2C 1SQBE 4C7RA 2XZRA 3IR9A 4M3LA 1SQBG 2BCCD 5CCGD 1H89A 3NTNA 3CXHD 1CI6A 1NTZK 4H13C 1EXIA 2YNYA 4JF7A 3CCVP 1N7LA 2R3SA 3FXEA 1KV4A 2IBZE 4EIJA 1SQQJ 5KAIE 5APSA 2WSCJ 1QL1A 1SQPG 3KHUA 5AVSB 4D6TJ 2N1TC 1NTKG 3BATA 1KC8Q 3WU2E 4N78E 5B5EH 5CJ4A 1GDTA 3L4FA 1NWQA 1BE3D 3H1LG 4D6TD 3L74J 3CCJP 2WSEJ 3SSUA 4D6TE 4XA4A 1A02J 1GL2D 2FFDC 1FDMA 1BE3J 2NRGA 1XTGB 1RE4A 2B87A 3L74D 5CBNA 3LIEA 2YIUC 2AXCA 3GF3A 1EZVG 2QJYB 3HTKB 1USDA 4Y99B 2AXTH 3L71G 3Q5SA 1K9MQ 2QE7H 2ZXXA 4IL6E 5KJ7D 1VQOP 3A2AA 1SS1A 2Q9IA 1OXZA 3GMAA 1T8ZA 2PAJA 2E76C 1IFIA 3L73D 3GW6A 2N1TA 3HE5B 4PV1B 1S9KE 1S9KD 1AVYA 1LP1A 4TLFA 2K3RA 1OW7A 1RE3C 2K9YA 1KYOI 4L76A 1T3UA 2J58A 4BRYB 1URQC 1VF5C 2CK3H 2V7QJ 2ZT9B 3H1JE 1MZ9A 1RE4C 2CPBA 3PLNA 5KLVK 2K9JA 3MGNA 5E79H 2HODB 1YIJP 1E79H 3AE7C 2IFMA 1NU1E 1UIXA 2E42A 2A06E 1GK6A 3SFDC 3KDPB 3A7OA 3AEDC 4I7ZB 4QMAA 2OYIC 4HJGH 3ABVC 3MUDC 1FZGA 4WY4C 2YMKA 1HTLC 4H0LC 1PFIA 2W6JH 4LC1A 1RQUA 2HPCA 3P7KA 1RE3A 1HGZA 3H6PA 5CHXA 1FZCC 1IFNA 2J59M 2N9BA 5L8RJ 3B5NC 1NTKJ 3VP9A 1YJNP 2R5DA 1VQNP 2E5TA 2XNXA 2MJZA 2YMYA 1LT1A 2E75C 2WSEH 1P84E 2W27A 3M0DC 3CI9A 4IOIH 5KLVD 5KLIC 3A5TA 4EDFA 1NTMK 3EFFK 2JKVA 2YKQA 1NH4A 1VPCA 2FYUD 5K5GB 5KJ7A 1JUNA 5BVZA 1S5LH 3M0AA 1VQPP 4K35A 3EFGA 4WY4A 2KXPB 1OVUA 2HG5D 2WQYC 1N7SD 1IJDB 1AVOA 1PPJE 4HH2A 1FZCA 2OYHA 1PPJG 2PFXA 2ZYDA 1E5WA 2JP3A 4TT3H 3OA7A 3M0DA 1KYOH 1AQTA 4RO0A 1SQVK 1SQQD 1S2EA 2O1KA 2ZYAA 3HE4B 3JCUE 5KAFE 4C46A 1S5LE 5AW0B 1SQVE 1ZOYC 3P8MC 3RL0D 5KJ7C 3BVHA 1FU1A 1KILA 1LTJC 1SQPE 2O3JA 2QJPB 1FJKA 1JEKA 1L4AB 2YO3A 1Y9BA 3AEGC 1IK9A 1RH5B 4IFMA 2QJPC 4EI2A 5B66H 1SQXG 3CCEP 2P67A 3MP7B 3S9OA 3P32A 3WUTA 3RK2D 2C9LY 1L0LJ 2Y0CA 3CXHI 1ZRTD 2NPSC 1M1JB 3PJSK 3RL0g 2KLUA 2Y9YA 1USEA 1WRGA 2OYHC 2OTJP 2WZ7A 1IFMA 1NGMB 1EXJA 1DD3A 3EQ2A 2ZJSE 1HVVA 4ZKPA 1BSNA 1NO4A 2KNCB 5AVRB 3RGUA 5AW1B 2WSFJ 3H1HG 3AE8C 1AV1A 2BASA 3D70A 1MFTA 1L0ND 2WPQA 2JO1A 4U7JA 4H0LD 1BCCJ 1KILB 3G71P 1FE6A 1LT9C 2YKOA 1ZR4A 4WVZA 2D2CB 3RK2C 3E7KA 3G3ZA 4OGQC 2C0WA 3CXHH 3H32A 3RL0B 1FOSE 1JCCA 2E75D 2H8PD 3F89A 1HJ0A 2OARA 3A0BE 3B5NB 3B5ND 1Q82Q 2BCCJ 1IZNB 3MHVA 3TF5A 3SWYA 1FZCB 1Q7YQ 5APQA 1JY2N 2LXCB 3CMAP 3CWBG 1GW4A 1LT9B 2M0BA 4NPEA 3CC7P 1FZEA 1L0NG 2OYIB 1G1IA 2QIWA 1OMIA 2PRRA 1PZQA 1NKNA 3BCCJ 4N6JA 2YXRB 2GM4A 1LTGC 2OGUA 1S72P 2HLOA 3A0HE 2WPVB 1NYHA 3HE4A 5APVA 1KYOE 1WMKA 1JY3O 1SFCA 2XU6A 2I8DA 1ZN5A 5CCHC 1G1JA 1IO4A 1QX8A 3L70D 1KORA 1M1JC 1K8AQ 2B89A 3FX0A 1BCCE 2Y9ZA 2OYHB 3TSIA 2O1JA 1KQLA 3L70G 4MN4C 1DIPA 3L70J 2KUBA 2Y0DA 3Q1MA 4W80A 1RY3A 1LTJB 1JB0J 1LWUC 2K9JB 2Q1KA 2YIUB 3AE4C 1VQ8P 1OX3A 3H25A 3CX5D 3PP5A 4ZMDA 1JMMA 1DD4A 3CX5E 4PD4H 2KP8A 1MKMA 2SPZA 2FYUE 3MTUE 5BU5A 5CCHA 4O9BA 1CZQA 1WT6A 1L0LE 3D6ZA 1AQ5A 1L0LD 2KI7B 3HE5A 3KZIE 1SQXE 1Q90D 1N73B 2P1JA 4LLHA 2CPSA 1KQGB 2M3EA 1VQ4P 1GU4A 1SQPJ 1VF5D 4D6TG 2AEFA 2LKMA 2M3BA 1RQVA 3N4XA 4OGQD 4RJTA 2O01H 1LWUA 2JWDA 1ZLLA 3RBXA 3RK3E 2IFNA 1HGVA 5E79E 3L74E 1YJWP 1YTZI 3L71E 3B8EB 3BCCG 2GUVA 1NOHA 1QLED 3HUSB 1NHLA 2ZVOB 2P2UA 1GW3A 4OH8B 2Q7CA 4UB6E 3WUVA 3WU2H 5APXA 1OFCX 1RHZB 3GHGC 1LP1B 4AUWA 1NTKK 4H0LB 5BU8B 1OVRA 5APYA 3HD7C 1YTZT 3AE5C 3C9IA 2AEJA 4LGDE 3NXSA 3SWKA 2IZ1A 5C39A 2QEXP 1R8EA 2C9NY 1L2PA 2WSCH 3KYQA 3S1KA 5CMZA 2WT7A 1NU1G 2Z5HA 1DX7A 2GUSA 5AW6B 1S3JA 3PTZA 2B87B 3VMAA 1N7SB 2P58A 1VL2A 4JYBA 1N86A 1EZVD 1VF5B 2FYNB 2QJKC 2ZT9C 3CWBE 1KILD 1L0NE 3E1IA 1H8AA 1KILE 3GHGA 4RKUJ 1CSBA 2AEMA 1IC2A 2Q3IA 1L0NK 1KFMA 3B4SA 3TGUJ 1JCDA 1FBMA 2A45I 4H44B 3AECC 1S1CX 5AVYB 5KAIH 3VYIA 1LJ2A 1M8OB 1J1DB 3VP8A 4Y99C 2LR2A 2VRSA 5KLVG 1P84D 3CCLP 2W83C 5KLVE 1G2CB 2W6BA 4A7PA 2A45H 3VMYA 3IF4A 3TNUA 2FFDB 3N7NA 1J1EB 1JY3N 3GG2A 3H1IG 3USSA 1LNQA 1KMIZ 2FYNC 1M90Q 4GKGA 2FFDA 3AE3C 3Q5PA 5KKZB 4R4MA 1VQKP 1FZBA 1OVVA 1PPJD 2E5YA 1PP9E 3WMM0 3CX5H 1PP9D 5CCGA 1ZMEC 1NTZD 4H13B 3CCRP 1NJIQ 5DJUB 4ZNCA 2KZJA 1ZR2A 2RMZA 1VDFA 4IL6H 5CCHD 2D2CD 3VMXA 1NTZJ 2ZAEB 5EFWB 2Z5IA 3CD6P 3C8VA 1X8YA 1BDCA 1SQPD 1VQ7P 3L75G 5AW7B 4GOFA 2ITAA 1FOSF 1CW5A 1EQ7A 3G9RA 1ZW0A 2E43A 1GL2A 4BWNA 1SQBD 3II6A 2HR3A 3AEFC 2WT7B 3BCCD 1G2CA 5CCGC 3O8ZA 3A0HH 3BCCE 3RK3B 3S4RA 3LW5J 3CCSP 1SQBJ 4PJ0H 1JNMA 3CX5I 3CC4P 1HBWA 2IBZD 2ZT9D 3H1HE 3IFMA 1Y47A 2IYOA 3L35A 3R2PA 1RF0C 5KKZC 3K5BA 3V4QA 1SQPK 5APTA 3GF7A 1N73C 1SQXK 2QM7A 3PH0A 1YHQP 3V6IA 1QL2A 4N78D 1SVFA 2WITA 4PV1D 2KK7A 4XFJA 4NPDA 4AQRD 1GL2C 5H2FE 3VTPC 4GDOA 2NPSD 3RK3D 1SQBK 4PD4D 3L71D 1LWUB 1JMBA 1MUUA 2M5AB 4IL6X 1J1DC 1OWAA 5AW9B 1K04A 3NMDA 1JY2P 2K88A 1GK4A 3FXDA 3IN6A 5AW4B 1N73A 1NAYA 2HFED 4L73A 1LTTC 2FBWC 2BEZF 3M9HA 1IFJA 2WPSA 1NTKE 3KPEA 1SP4A 3CCQP 1DEBA 1NTME 1KZUB 2BEQD 2IYPA 2KYVA 2QVAA 1T2KD 1KFNA 2IZ0A 2QJKB 1LTIC 3FWNA 3PHLA 2WSFH 3M9QA 4CPGA 3HUSA 3D71A 1BDDA 3H1JD 5AW2B 3BASA 1KB9H 1FDIA 1LTJA 4B86A 2A06D 4C7NB 1URQD 1IK7A 2KZIA 1HJBA 1JO5A 4YTPC 4Z1MH 4HYTB 1VQLP 1PGJA 1JTHB 2R44A 3L70E 1M57D 2W8ZA 1YITP 1EDLA 1HF9A 3WUUA 2YKPA 1PP9J 1FDOA 1GMJA 2P10A 1L4AD 1PP9G 1SFCB 2KOGA 3G6EP 2H43A 2K1AA 2E74B 2KB7P 3JCUH 4KJMA 4YPCA 4WB4A 1RF1B 3HUSC 3H1HJ 4OGQB 3M06A 2FYUG 1SQVG 4YXDC 1YJ9P 1H0TA 4EOTA 1JY2O 3V2NA 3CCMP 2IPPA 3Q5RA 1EDJA 2YXQB 1X9VA 4PJ0E 2Y0EA 4Y28J 2AXTE 1KN7A 3I5CA 4JBZA 1LT9A 3ITKA 1VQ9P 3U1AA 2B9BA 2W6AA 3W68A 4ASVA 2O01N 1OW8A 2FXPA 5M1BA 4GODA 3CLQA 1RF1C 2ZFCA 3TGUD 3TGUE 1SQQK 2KLVA 4H13D 1NTZE 1U7MA 4DJGA 1P84H 1LTSC 3H32B 1XTCC 1MV8A 1NTZG 2ZVNB 1URQA 1W2BO 2HYNA 1SQQE 1SQVD 2NPSB 1AJYA 1BGYE 1JOCA 2C0XA 2P7JA 3HRNA 3TYYA 4DZOA 3M91A 1L0LK 3AE1C 3LIDA 1PV3A 5GTHE 1VQMP 1X0TA 2OYIA 3MUDA 2RH0A 1Z56A 2R5BA 4RESB 2QSIA 1T2KC 1ZP0C 2IBZI 3VMZA 1VQ5P 4DCKA 5AVWB 2KS1B 3L72G 1LTAC 3BRVB 3L72E 2JEEA 2WPRA 3B5NA 1EZVI 1M1JA 3H1HD 5AVXB 5AVVB 2FKWB 2RKLA 3A3YB 3T97B 2V7QH 5GTHH 1OW6A 1AFOA 3V2PA 1KD1Q 3U59A 4KT0J 1QGKB 1J2JB 1EDIA 1BE3E 3KZIH 3V2QA 4UB8H 1BE3G 4HKZH 4W7ZA 5AW8B 3CC2P 3HD7D 2JDIH 5KLIB 2KNCA 1M56D 3NFQA 1OZHA 3T97A 4PD4E 1K05A 1SLQA 1U7JA 3AE6C 2IDBA 3Q2YA 1NTMJ 3FWLA 4GIFA 1GD2E 1SFCD 2OTLP 5GTIE 1KQFB 2JR8A 3TK1A 2KS1A 3KXDA 3L72J 4I6MC 3RK2B 3RL0C 4U3FD 2D2CC 1D7MA 2V4HA 3BRTB 4U3FE 1P84I 1QEXA 4WY4B 5B5EE 3W67A 4U3FG 4BXLA 2WTYA 1GTWA 1KILC 3C1LA 4GT1A 4I7ZC 4U3FJ 1NVOA 4GOEA 3P8CD 5H2FH 3U1CA 1L4AA 2L5GB 3G4SP 3MD0A 3AEBC 3P8CE 1VQ6P 1H0TB 3E1RA 1GZLA 1U57A 1DEEG 2QRXA 2W90A 4IFFA 5DJTB 3OJAB 2NPSA 1Q81Q 1BGYJ 1URQB 3H1JG 1T6AA 3R4YA 4XE5B 2KSEA 1N8RQ 1Y8AA 1YYCA 1QVFO 1KYOD 3L71J 1BSHA 4OVNF 4L74A 3B71A 3UIAA 3L75E 2OYOA 2HPCB 1T3JA 4IFDK 2KIKA 4PV1C 2H88C 1JM0A 1JTHA 1S5LX 2QA4P 5KTBA 4DOJA 2FY8A 5TISH 3H1LJ 5TJHA 1L4AC 1PGPA 1HUCA 1YI2P 2HODA 3VN0A 1EC5A 3KQGA 4UB8E 1KB9E 5AVTB 1M1KQ 1ZXGA 3A0BH 1KB9D 2N9YB 2BCCE 1SQXJ 1LGHB 2FXOA 1BGYG 2Q6QA 3CXHE 3H1JJ 1RF1A 3OAKA 1W2EA 3AEAC 3I56P 2Q5UA 3L73J 2K37A 2WWWA 1SQXD 2JWAA 2N1TB 3AE2C 3VOPA 2N1TD 1Q86Q 3CMEP 2ZXEB 1GU5A 1FJPA 1YQ4C 1YBKA 2XV5A 3H1KJ 1HWTC 2G8YA 1IFDA 3GLMA 3I55P 2JJLA 1LTBC 1AA0A 2M5AA 5AVQB 4PD4I 1TU3F 5CBOA 2I1KA 1JY3P 3EWKA 4C7NA 4AYCA 1YQ3C 1ZV8A 1IFPA 2FXMA 3Q3DA 2NZ2A 2A45G 2E75B 1BGYD 2WSSH 1NAFA 1Q2NA 1MFZA 2E74C 2KSJA 4W7YA 1FZFA 4BRYA 1S4XA 1DH3A 1SFCC 2IBZG 3L73G 1L0LG 3QH9A 3L73E 5B66E
chains in the Genus database with same CATH topology
1NTMG 1SQVG 2FYUG 2A06G 3CWBG 1SQBG 4PD4H 1BGYG 1L0NG 4U3FG 3L72G 3H1IG 1NU1G 3TGUG 1KB9H 3L74G 1SQPG 3H1HG 1NTKG 3H1JG 4D6TG 1PPJG 3CX5H 2BCCG 1SQQG 3H1LG 1KYOH 1P84H 1BE3G 1NTZG 3BCCG 3CXHH 3L70G 3L75G 1EZVG 1PP9G 1BCCG 3L71G 3H1KG 2IBZG 3L73G 5KLVG 1SQXG 1L0LG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTM G;  1SQV G;  2FYU G;  2A06 G;  3CWB G;  1SQB G;  4PD4 H;  1BGY G;  1L0N G;  4U3F G;  3L72 G;  3H1I G;  1NU1 G;  3TGU G;  1KB9 H;  3L74 G;  1SQP G;  3H1H G;  1NTK G;  3H1J G;  4D6T G;  1PPJ G;  3CX5 H;  2BCC G;  1SQQ G;  3H1L G;  1KYO H;  1P84 H;  1BE3 G;  1NTZ G;  3BCC G;  3CXH H;  3L70 G;  3L75 G;  1EZV G;  1PP9 G;  1BCC G;  3L71 G;  3H1K G;  2IBZ G;  3L73 G;  5KLV G;  1SQX G;  1L0L G; 
#chains in the Genus database with same CATH topology
 1NTM G;  1FS0 E;  1PIX A;  2FYU K;  1ZRT E;  1NTK D;  2OTK E;  5AW5 B;  3RBZ A;  3V2R A;  1N2D C;  1FZA A;  1NKZ B;  1NTM D;  1PGQ A;  1CI6 B;  3H1L E;  4OWF A;  3H1L D;  4JPZ B;  4EYY Q;  5TIS E;  5KLV J;  2XND H;  1KQS O;  3L72 D;  2ZYG A;  2Z4E A;  2MKV A;  2PGD A;  3HTK A;  1NU1 K;  4WWI A;  3MZW B;  2E74 D;  2L91 A;  1KB9 I;  1EZV E;  1NU1 D;  3IAO A;  3L74 G;  3MIW A;  2J5U A;  3CWB D;  1SQV J;  4HB1 A;  3M9B A;  2QM8 A;  3H1I E;  4WY4 D;  3H1I D;  1J1E C;  3L36 A;  3CCU P;  3ZDM A;  4R4L A;  2I1J A;  3AEE C;  3CL3 D;  2E76 B;  2DW3 A;  2GA1 A;  1PL5 A;  4DT0 A;  1HH0 A;  1FAV A;  1UII A;  2R32 A;  3H1K D;  3JSV C;  4I2L C;  4L75 A;  3H1K E;  3O6Q A;  3QWO C;  3H1K G;  1A02 F;  1K73 Q;  2QJY C;  2WVR A;  3JC2 2;  4YXW H;  1X79 B;  2G3A A;  3L37 A;  1KTM A;  1RF0 A;  2WMM A;  4H44 C;  4UB6 H;  3OW2 O;  1H88 A;  1PGO A;  2A06 G;  4NPF X;  2R3C A;  1GL2 B;  3F5H A;  4N3Y B;  3V5B A;  5GTI H;  2M8R A;  2E76 D;  4WBA A;  2H89 C;  5CJ0 A;  1R5L A;  4JYC A;  3TNU B;  2H7H A;  4K3A A;  1N7S C;  4JQ0 D;  3TGU G;  3AE9 C;  2LXB A;  4KHX A;  3V4W A;  3TDK A;  3HD7 A;  2PP6 A;  2BCC G;  3D6Y A;  1SQQ G;  3O6Q B;  3LW5 H;  2B88 A;  1EDK A;  3RK3 C;  4I1L A;  2FYZ A;  1QVG O;  2XDJ A;  2IX7 C;  5APU A;  3L75 D;  1R5S A;  3HD7 B;  1M7L A;  2O01 J;  5KAF H;  1L0N J;  2RN0 A;  3SWF A;  1NU1 J;  1OIP A;  1BCC D;  2Q3E A;  2UWJ E;  2XKM A;  3CWB J;  3GHG B;  4H44 D;  4ASW A;  3SFE C;  3L75 J;  2FYU J;  5AW3 B;  3PRJ A;  1BCC G;  1W5C E;  5APW A;  2YO2 A;  3H1I J;  5AVZ B;  1N7S A;  4ZKU A;  2POH A;  3FGA D;  1X22 A;  2OQQ A;  2QG4 A;  3CPW O;  5AVU B;  1FC2 C;  1SQB E;  4C7R A;  2XZR A;  3IR9 A;  4M3L A;  1SQB G;  2BCC D;  5CCG D;  1H89 A;  3NTN A;  3CXH D;  1CI6 A;  1NTZ K;  4H13 C;  1EXI A;  2YNY A;  4JF7 A;  3CCV P;  1N7L A;  2R3S A;  3FXE A;  1KV4 A;  2IBZ E;  4EIJ A;  1SQQ J;  5KAI E;  5APS A;  2WSC J;  1QL1 A;  1SQP G;  3KHU A;  5AVS B;  4D6T J;  2N1T C;  1NTK G;  3BAT A;  1KC8 Q;  3WU2 E;  4N78 E;  5B5E H;  5CJ4 A;  1GDT A;  3L4F A;  1NWQ A;  1BE3 D;  3H1L G;  4D6T D;  3L74 J;  3CCJ P;  2WSE J;  3SSU A;  4D6T E;  4XA4 A;  1A02 J;  1GL2 D;  2FFD C;  1FDM A;  1BE3 J;  2NRG A;  1XTG B;  1RE4 A;  2B87 A;  3L74 D;  5CBN A;  3LIE A;  2YIU C;  2AXC A;  3GF3 A;  1EZV G;  2QJY B;  3HTK B;  1USD A;  4Y99 B;  2AXT H;  3L71 G;  3Q5S A;  1K9M Q;  2QE7 H;  2ZXX A;  4IL6 E;  5KJ7 D;  1VQO P;  3A2A A;  1SS1 A;  2Q9I A;  1OXZ A;  3GMA A;  1T8Z A;  2PAJ A;  2E76 C;  1IFI A;  3L73 D;  3GW6 A;  2N1T A;  3HE5 B;  4PV1 B;  1S9K E;  1S9K D;  1AVY A;  1LP1 A;  4TLF A;  2K3R A;  1OW7 A;  1RE3 C;  2K9Y A;  1KYO I;  4L76 A;  1T3U A;  2J58 A;  4BRY B;  1URQ C;  1VF5 C;  2CK3 H;  2V7Q J;  2ZT9 B;  3H1J E;  1MZ9 A;  1RE4 C;  2CPB A;  3PLN A;  5KLV K;  2K9J A;  3MGN A;  5E79 H;  2HOD B;  1YIJ P;  1E79 H;  3AE7 C;  2IFM A;  1NU1 E;  1UIX A;  2E42 A;  2A06 E;  1GK6 A;  3SFD C;  3KDP B;  3A7O A;  3AED C;  4I7Z B;  4QMA A;  2OYI C;  4HJG H;  3ABV C;  3MUD C;  1FZG A;  4WY4 C;  2YMK A;  1HTL C;  4H0L C;  1PFI A;  2W6J H;  4LC1 A;  1RQU A;  2HPC A;  3P7K A;  1RE3 A;  1HGZ A;  3H6P A;  5CHX A;  1FZC C;  1IFN A;  2J59 M;  2N9B A;  5L8R J;  3B5N C;  1NTK J;  3VP9 A;  1YJN P;  2R5D A;  1VQN P;  2E5T A;  2XNX A;  2MJZ A;  2YMY A;  1LT1 A;  2E75 C;  2WSE H;  1P84 E;  2W27 A;  3M0D C;  3CI9 A;  4IOI H;  5KLV D;  5KLI C;  3A5T A;  4EDF A;  1NTM K;  3EFF K;  2JKV A;  2YKQ A;  1NH4 A;  1VPC A;  2FYU D;  5K5G B;  5KJ7 A;  1JUN A;  5BVZ A;  1S5L H;  3M0A A;  1VQP P;  4K35 A;  3EFG A;  4WY4 A;  2KXP B;  1OVU A;  2HG5 D;  2WQY C;  1N7S D;  1IJD B;  1AVO A;  1PPJ E;  4HH2 A;  1FZC A;  2OYH A;  1PPJ G;  2PFX A;  2ZYD A;  1E5W A;  2JP3 A;  4TT3 H;  3OA7 A;  3M0D A;  1KYO H;  1AQT A;  4RO0 A;  1SQV K;  1SQQ D;  1S2E A;  2O1K A;  2ZYA A;  3HE4 B;  3JCU E;  5KAF E;  4C46 A;  1S5L E;  5AW0 B;  1SQV E;  1ZOY C;  3P8M C;  3RL0 D;  5KJ7 C;  3BVH A;  1FU1 A;  1KIL A;  1LTJ C;  1SQP E;  2O3J A;  2QJP B;  1FJK A;  1JEK A;  1L4A B;  2YO3 A;  1Y9B A;  3AEG C;  1IK9 A;  1RH5 B;  4IFM A;  2QJP C;  4EI2 A;  5B66 H;  1SQX G;  3CCE P;  2P67 A;  3MP7 B;  3S9O A;  3P32 A;  3WUT A;  3RK2 D;  2C9L Y;  1L0L J;  2Y0C A;  3CXH I;  1ZRT D;  2NPS C;  1M1J B;  3PJS K;  3RL0 g;  2KLU A;  2Y9Y A;  1USE A;  1WRG A;  2OYH C;  2OTJ P;  2WZ7 A;  1IFM A;  1NGM B;  1EXJ A;  1DD3 A;  3EQ2 A;  2ZJS E;  1HVV A;  4ZKP A;  1BSN A;  1NO4 A;  2KNC B;  5AVR B;  3RGU A;  5AW1 B;  2WSF J;  3H1H G;  3AE8 C;  1AV1 A;  2BAS A;  3D70 A;  1MFT A;  1L0N D;  2WPQ A;  2JO1 A;  4U7J A;  4H0L D;  1BCC J;  1KIL B;  3G71 P;  1FE6 A;  1LT9 C;  2YKO A;  1ZR4 A;  4WVZ A;  2D2C B;  3RK2 C;  3E7K A;  3G3Z A;  4OGQ C;  2C0W A;  3CXH H;  3H32 A;  3RL0 B;  1FOS E;  1JCC A;  2E75 D;  2H8P D;  3F89 A;  1HJ0 A;  2OAR A;  3A0B E;  3B5N B;  3B5N D;  1Q82 Q;  2BCC J;  1IZN B;  3MHV A;  3TF5 A;  3SWY A;  1FZC B;  1Q7Y Q;  5APQ A;  1JY2 N;  2LXC B;  3CMA P;  3CWB G;  1GW4 A;  1LT9 B;  2M0B A;  4NPE A;  3CC7 P;  1FZE A;  1L0N G;  2OYI B;  1G1I A;  2QIW A;  1OMI A;  2PRR A;  1PZQ A;  1NKN A;  3BCC J;  4N6J A;  2YXR B;  2GM4 A;  1LTG C;  2OGU A;  1S72 P;  2HLO A;  3A0H E;  2WPV B;  1NYH A;  3HE4 A;  5APV A;  1KYO E;  1WMK A;  1JY3 O;  1SFC A;  2XU6 A;  2I8D A;  1ZN5 A;  5CCH C;  1G1J A;  1IO4 A;  1QX8 A;  3L70 D;  1KOR A;  1M1J C;  1K8A Q;  2B89 A;  3FX0 A;  1BCC E;  2Y9Z A;  2OYH B;  3TSI A;  2O1J A;  1KQL A;  3L70 G;  4MN4 C;  1DIP A;  3L70 J;  2KUB A;  2Y0D A;  3Q1M A;  4W80 A;  1RY3 A;  1LTJ B;  1JB0 J;  1LWU C;  2K9J B;  2Q1K A;  2YIU B;  3AE4 C;  1VQ8 P;  1OX3 A;  3H25 A;  3CX5 D;  3PP5 A;  4ZMD A;  1JMM A;  1DD4 A;  3CX5 E;  4PD4 H;  2KP8 A;  1MKM A;  2SPZ A;  2FYU E;  3MTU E;  5BU5 A;  5CCH A;  4O9B A;  1CZQ A;  1WT6 A;  1L0L E;  3D6Z A;  1AQ5 A;  1L0L D;  2KI7 B;  3HE5 A;  3KZI E;  1SQX E;  1Q90 D;  1N73 B;  2P1J A;  4LLH A;  2CPS A;  1KQG B;  2M3E A;  1VQ4 P;  1GU4 A;  1SQP J;  1VF5 D;  4D6T G;  2AEF A;  2LKM A;  2M3B A;  1RQV A;  3N4X A;  4OGQ D;  4RJT A;  2O01 H;  1LWU A;  2JWD A;  1ZLL A;  3RBX A;  3RK3 E;  2IFN A;  1HGV A;  5E79 E;  3L74 E;  1YJW P;  1YTZ I;  3L71 E;  3B8E B;  3BCC G;  2GUV A;  1NOH A;  1QLE D;  3HUS B;  1NHL A;  2ZVO B;  2P2U A;  1GW3 A;  4OH8 B;  2Q7C A;  4UB6 E;  3WUV A;  3WU2 H;  5APX A;  1OFC X;  1RHZ B;  3GHG C;  1LP1 B;  4AUW A;  1NTK K;  4H0L B;  5BU8 B;  1OVR A;  5APY A;  3HD7 C;  1YTZ T;  3AE5 C;  3C9I A;  2AEJ A;  4LGD E;  3NXS A;  3SWK A;  2IZ1 A;  5C39 A;  2QEX P;  1R8E A;  2C9N Y;  1L2P A;  2WSC H;  3KYQ A;  3S1K A;  5CMZ A;  2WT7 A;  1NU1 G;  2Z5H A;  1DX7 A;  2GUS A;  5AW6 B;  1S3J A;  3PTZ A;  2B87 B;  3VMA A;  1N7S B;  2P58 A;  1VL2 A;  4JYB A;  1N86 A;  1EZV D;  1VF5 B;  2FYN B;  2QJK C;  2ZT9 C;  3CWB E;  1KIL D;  1L0N E;  3E1I A;  1H8A A;  1KIL E;  3GHG A;  4RKU J;  1CSB A;  2AEM A;  1IC2 A;  2Q3I A;  1L0N K;  1KFM A;  3B4S A;  3TGU J;  1JCD A;  1FBM A;  2A45 I;  4H44 B;  3AEC C;  1S1C X;  5AVY B;  5KAI H;  3VYI A;  1LJ2 A;  1M8O B;  1J1D B;  3VP8 A;  4Y99 C;  2LR2 A;  2VRS A;  5KLV G;  1P84 D;  3CCL P;  2W83 C;  5KLV E;  1G2C B;  2W6B A;  4A7P A;  2A45 H;  3VMY A;  3IF4 A;  3TNU A;  2FFD B;  3N7N A;  1J1E B;  1JY3 N;  3GG2 A;  3H1I G;  3USS A;  1LNQ A;  1KMI Z;  2FYN C;  1M90 Q;  4GKG A;  2FFD A;  3AE3 C;  3Q5P A;  5KKZ B;  4R4M A;  1VQK P;  1FZB A;  1OVV A;  1PPJ D;  2E5Y A;  1PP9 E;  3WMM 0;  3CX5 H;  1PP9 D;  5CCG A;  1ZME C;  1NTZ D;  4H13 B;  3CCR P;  1NJI Q;  5DJU B;  4ZNC A;  2KZJ A;  1ZR2 A;  2RMZ A;  1VDF A;  4IL6 H;  5CCH D;  2D2C D;  3VMX A;  1NTZ J;  2ZAE B;  5EFW B;  2Z5I A;  3CD6 P;  3C8V A;  1X8Y A;  1BDC A;  1SQP D;  1VQ7 P;  3L75 G;  5AW7 B;  4GOF A;  2ITA A;  1FOS F;  1CW5 A;  1EQ7 A;  3G9R A;  1ZW0 A;  2E43 A;  1GL2 A;  4BWN A;  1SQB D;  3II6 A;  2HR3 A;  3AEF C;  2WT7 B;  3BCC D;  1G2C A;  5CCG C;  3O8Z A;  3A0H H;  3BCC E;  3RK3 B;  3S4R A;  3LW5 J;  3CCS P;  1SQB J;  4PJ0 H;  1JNM A;  3CX5 I;  3CC4 P;  1HBW A;  2IBZ D;  2ZT9 D;  3H1H E;  3IFM A;  1Y47 A;  2IYO A;  3L35 A;  3R2P A;  1RF0 C;  5KKZ C;  3K5B A;  3V4Q A;  1SQP K;  5APT A;  3GF7 A;  1N73 C;  1SQX K;  2QM7 A;  3PH0 A;  1YHQ P;  3V6I A;  1QL2 A;  4N78 D;  1SVF A;  2WIT A;  4PV1 D;  2KK7 A;  4XFJ A;  4NPD A;  4AQR D;  1GL2 C;  5H2F E;  3VTP C;  4GDO A;  2NPS D;  3RK3 D;  1SQB K;  4PD4 D;  3L71 D;  1LWU B;  1JMB A;  1MUU A;  2M5A B;  4IL6 X;  1J1D C;  1OWA A;  5AW9 B;  1K04 A;  3NMD A;  1JY2 P;  2K88 A;  1GK4 A;  3FXD A;  3IN6 A;  5AW4 B;  1N73 A;  1NAY A;  2HFE D;  4L73 A;  1LTT C;  2FBW C;  2BEZ F;  3M9H A;  1IFJ A;  2WPS A;  1NTK E;  3KPE A;  1SP4 A;  3CCQ P;  1DEB A;  1NTM E;  1KZU B;  2BEQ D;  2IYP A;  2KYV A;  2QVA A;  1T2K D;  1KFN A;  2IZ0 A;  2QJK B;  1LTI C;  3FWN A;  3PHL A;  2WSF H;  3M9Q A;  4CPG A;  3HUS A;  3D71 A;  1BDD A;  3H1J D;  5AW2 B;  3BAS A;  1KB9 H;  1FDI A;  1LTJ A;  4B86 A;  2A06 D;  4C7N B;  1URQ D;  1IK7 A;  2KZI A;  1HJB A;  1JO5 A;  4YTP C;  4Z1M H;  4HYT B;  1VQL P;  1PGJ A;  1JTH B;  2R44 A;  3L70 E;  1M57 D;  2W8Z A;  1YIT P;  1EDL A;  1HF9 A;  3WUU A;  2YKP A;  1PP9 J;  1FDO A;  1GMJ A;  2P10 A;  1L4A D;  1PP9 G;  1SFC B;  2KOG A;  3G6E P;  2H43 A;  2K1A A;  2E74 B;  2KB7 P;  3JCU H;  4KJM A;  4YPC A;  4WB4 A;  1RF1 B;  3HUS C;  3H1H J;  4OGQ B;  3M06 A;  2FYU G;  1SQV G;  4YXD C;  1YJ9 P;  1H0T A;  4EOT A;  1JY2 O;  3V2N A;  3CCM P;  2IPP A;  3Q5R A;  1EDJ A;  2YXQ B;  1X9V A;  4PJ0 E;  2Y0E A;  4Y28 J;  2AXT E;  1KN7 A;  3I5C A;  4JBZ A;  1LT9 A;  3ITK A;  1VQ9 P;  3U1A A;  2B9B A;  2W6A A;  3W68 A;  4ASV A;  2O01 N;  1OW8 A;  2FXP A;  5M1B A;  4GOD A;  3CLQ A;  1RF1 C;  2ZFC A;  3TGU D;  3TGU E;  1SQQ K;  2KLV A;  4H13 D;  1NTZ E;  1U7M A;  4DJG A;  1P84 H;  1LTS C;  3H32 B;  1XTC C;  1MV8 A;  1NTZ G;  2ZVN B;  1URQ A;  1W2B O;  2HYN A;  1SQQ E;  1SQV D;  2NPS B;  1AJY A;  1BGY E;  1JOC A;  2C0X A;  2P7J A;  3HRN A;  3TYY A;  4DZO A;  3M91 A;  1L0L K;  3AE1 C;  3LID A;  1PV3 A;  5GTH E;  1VQM P;  1X0T A;  2OYI A;  3MUD A;  2RH0 A;  1Z56 A;  2R5B A;  4RES B;  2QSI A;  1T2K C;  1ZP0 C;  2IBZ I;  3VMZ A;  1VQ5 P;  4DCK A;  5AVW B;  2KS1 B;  3L72 G;  1LTA C;  3BRV B;  3L72 E;  2JEE A;  2WPR A;  3B5N A;  1EZV I;  1M1J A;  3H1H D;  5AVX B;  5AVV B;  2FKW B;  2RKL A;  3A3Y B;  3T97 B;  2V7Q H;  5GTH H;  1OW6 A;  1AFO A;  3V2P A;  1KD1 Q;  3U59 A;  4KT0 J;  1QGK B;  1J2J B;  1EDI A;  1BE3 E;  3KZI H;  3V2Q A;  4UB8 H;  1BE3 G;  4HKZ H;  4W7Z A;  5AW8 B;  3CC2 P;  3HD7 D;  2JDI H;  5KLI B;  2KNC A;  1M56 D;  3NFQ A;  1OZH A;  3T97 A;  4PD4 E;  1K05 A;  1SLQ A;  1U7J A;  3AE6 C;  2IDB A;  3Q2Y A;  1NTM J;  3FWL A;  4GIF A;  1GD2 E;  1SFC D;  2OTL P;  5GTI E;  1KQF B;  2JR8 A;  3TK1 A;  2KS1 A;  3KXD A;  3L72 J;  4I6M C;  3RK2 B;  3RL0 C;  4U3F D;  2D2C C;  1D7M A;  2V4H A;  3BRT B;  4U3F E;  1P84 I;  1QEX A;  4WY4 B;  5B5E E;  3W67 A;  4U3F G;  4BXL A;  2WTY A;  1GTW A;  1KIL C;  3C1L A;  4GT1 A;  4I7Z C;  4U3F J;  1NVO A;  4GOE A;  3P8C D;  5H2F H;  3U1C A;  1L4A A;  2L5G B;  3G4S P;  3MD0 A;  3AEB C;  3P8C E;  1VQ6 P;  1H0T B;  3E1R A;  1GZL A;  1U57 A;  1DEE G;  2QRX A;  2W90 A;  4IFF A;  5DJT B;  3OJA B;  2NPS A;  1Q81 Q;  1BGY J;  1URQ B;  3H1J G;  1T6A A;  3R4Y A;  4XE5 B;  2KSE A;  1N8R Q;  1Y8A A;  1YYC A;  1QVF O;  1KYO D;  3L71 J;  1BSH A;  4OVN F;  4L74 A;  3B71 A;  3UIA A;  3L75 E;  2OYO A;  2HPC B;  1T3J A;  4IFD K;  2KIK A;  4PV1 C;  2H88 C;  1JM0 A;  1JTH A;  1S5L X;  2QA4 P;  5KTB A;  4DOJ A;  2FY8 A;  5TIS H;  3H1L J;  5TJH A;  1L4A C;  1PGP A;  1HUC A;  1YI2 P;  2HOD A;  3VN0 A;  1EC5 A;  3KQG A;  4UB8 E;  1KB9 E;  5AVT B;  1M1K Q;  1ZXG A;  3A0B H;  1KB9 D;  2N9Y B;  2BCC E;  1SQX J;  1LGH B;  2FXO A;  1BGY G;  2Q6Q A;  3CXH E;  3H1J J;  1RF1 A;  3OAK A;  1W2E A;  3AEA C;  3I56 P;  2Q5U A;  3L73 J;  2K37 A;  2WWW A;  1SQX D;  2JWA A;  2N1T B;  3AE2 C;  3VOP A;  2N1T D;  1Q86 Q;  3CME P;  2ZXE B;  1GU5 A;  1FJP A;  1YQ4 C;  1YBK A;  2XV5 A;  3H1K J;  1HWT C;  2G8Y A;  1IFD A;  3GLM A;  3I55 P;  2JJL A;  1LTB C;  1AA0 A;  2M5A A;  5AVQ B;  4PD4 I;  1TU3 F;  5CBO A;  2I1K A;  1JY3 P;  3EWK A;  4C7N A;  4AYC A;  1YQ3 C;  1ZV8 A;  1IFP A;  2FXM A;  3Q3D A;  2NZ2 A;  2A45 G;  2E75 B;  1BGY D;  2WSS H;  1NAF A;  1Q2N A;  1MFZ A;  2E74 C;  2KSJ A;  4W7Y A;  1FZF A;  4BRY A;  1S4X A;  1DH3 A;  1SFC C;  2IBZ G;  3L73 G;  1L0L G;  3QH9 A;  3L73 E;  5B66 E; 
#chains in the Genus database with same CATH homology
 1NTM G;  1SQV G;  2FYU G;  2A06 G;  3CWB G;  1SQB G;  4PD4 H;  1BGY G;  1L0N G;  4U3F G;  3L72 G;  3H1I G;  1NU1 G;  3TGU G;  1KB9 H;  3L74 G;  1SQP G;  3H1H G;  1NTK G;  3H1J G;  4D6T G;  1PPJ G;  3CX5 H;  2BCC G;  1SQQ G;  3H1L G;  1KYO H;  1P84 H;  1BE3 G;  1NTZ G;  3BCC G;  3CXH H;  3L70 G;  3L75 G;  1EZV G;  1PP9 G;  1BCC G;  3L71 G;  3H1K G;  2IBZ G;  3L73 G;  5KLV G;  1SQX G;  1L0L G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...