3CX5I

Structure of complex iii with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
57
structure length
57
Chain Sequence
b'SFSSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 18
structure length 57
sequence length 57
chains with identical sequence T
ec nomenclature
pdb deposition date 2008-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 3cx5I00
1SQBJ 1NTMJ 3H1HJ 3H1KJ 2IBZI 1NU1J 3L74J 3L72J 1KB9I 1BCCJ 1EZVI 3CWBJ 3CX5I 1SQVJ 3L75J 1SQPJ 1L0LJ 2FYUJ 1SQQJ 1SQXJ 3L70J 3L71J 1NTKJ 1BGYJ 2BCCJ 3H1LJ 1KYOI 4U3FJ 3L73J 4D6TJ 3CXHI 4PD4I 3BCCJ 5KLVJ 1L0NJ 3H1JJ 3TGUJ 1NTZJ 3H1IJ 1P84I 1PP9J 1BE3J
chains in the Genus database with same CATH superfamily
3VYIA 1AQTA 5KAIE 1LP1A 1WMKA 5KLVD 1YJNP 1NHLA 3JCUH 3FX0A 2A45G 2ZVOB 1DD3A 2KB7P 3Q5RA 3AEDC 3CX5H 3H1LJ 5AVSB 2Q9IA 1PP9E 2E75D 2NZ2A 3A0BE 2OYHA 1FZCA 4ASVA 1AQ5A 3TNUA 3A7OA 1ZRTD 1KN7A 3M9BA 2K9YA 2GUVA 1GL2B 3L70D 2OYIB 3SFEC 4PV1D 5TISH 2QJKC 2QM7A 2KSEA 5H2FE 1S5LX 3CXHD 4PJ0E 4C7NA 1SLQA 2K9JB 3TGUJ 4C7RA 3OW2O 3HD7B 4H0LD 2OTJP 1FS0E 4EIJA 1NAFA 2VRSA 1GTWA 1FOSF 1BDCA 2N9BA 3B5NC 3P7KA 1Z56A 3GW6A 5CMZA 3RK3C 1S9KD 5E79E 3CMEP 2AXTE 1SQXE 3L71E 1JY2O 1WRGA 2YKOA 2FY8A 1BE3E 1HWTC 5APXA 1BGYJ 1EZVE 3CC7P 3V2PA 1J1DB 2ZT9D 2RN0A 1KTMA 1CI6A 4TT3H 3LW5H 2I1JA 1RF0C 4U3FG 1S1CX 3D6YA 1JY2P 1PP9G 2QG4A 2ZAEB 3IN6A 2KP8A 1NTKK 1OZHA 3BRVB 3TGUD 2CK3H 5K5GB 1W2BO 1ZOYC 3AEBC 1OVUA 1P84H 4Y99B 4LC1A 2XKMA 5KJ7C 3A5TA 2JO1A 2H88C 3CCUP 1AFOA 3AE2C 1SQVG 3HUSA 1S72P 1FC2C 3U1CA 1IZNB 2E76D 1LJ2A 2QVAA 1KILA 1IFJA 2P58A 5APWA 3CCMP 3D70A 1IFNA 3PP5A 2BCCJ 2AEFA 1FBMA 1T3UA 3A2AA 1OMIA 3L73E 1GU5A 5CCGA 5AVWB 1SQPG 3HD7C 1M8OB 1BGYD 4BRYB 1NTMJ 2QSIA 1SQXG 1LT9B 1HJ0A 1IO4A 3H25A 1KQLA 2XDJA 4IFMA 2FKWB 1GD2E 4ZMDA 1BE3G 5CCHC 2WPQA 2NPSD 5B66E 5M1BA 2R3SA 1RE3A 2HR3A 1EZVG 4OGQC 2O1JA 2N1TD 2WPVB 1BCCE 2K88A 2K37A 1MFZA 5AW7B 5AW0B 1SFCB 3CXHI 1JTHB 1X22A 1T2KC 1NTZJ 1OWAA 2KLVA 4I1LA 2UWJE 3H1KJ 1S5LH 1NU1J 2WITA 2FXOA 1L0LJ 2FYUJ 2E5TA 2KS1B 1VQ8P 1JY3N 1KFMA 3KDPB 3UIAA 1IK9A 1YJWP 3H1IJ 1M1JB 1N73A 4IFFA 1VQ6P 2FFDC 3FGAD 4B86A 1U7MA 1N7SA 3OAKA 3U1AA 1N86A 3G4SP 1SQBK 2J59M 1NTMD 3RBXA 2B89A 2H8PD 3AEEC 1M1KQ 1ZR2A 2R44A 1KB9D 1GDTA 1VQ7P 1FE6A 2MJZA 1LTTC 3MUDC 3TYYA 4HKZH 5KLIB 2J58A 1YHQP 3BCCJ 4JYCA 1L0NJ 1PPJD 1LTIC 4GDOA 3M9QA 4D6TE 1Q82Q 2PP6A 3KYQA 2QJYB 1NTZD 1VQOP 2W8ZA 1LTJA 5AVUB 3H1LG 2M3BA 1DEBA 3H1KD 4UB6H 1NU1D 4H44C 3IFMA 3RK2B 3NTNA 3H1JE 1L0LD 2FYUD 2ZYDA 1G1IA 1YBKA 1T3JA 4GKGA 3JSVC 4WY4C 1SQBE 4N78D 1KYOD 2A06E 3H1ID 1FAVA 1Q81Q 5DJUB 4Z1MH 1H0TA 5KKZC 2KNCA 4ASWA 2Y9YA 1AV1A 2QM8A 2L91A 4NPEA 1ZLLA 2L5GB 2QA4P 3TGUG 3CWBJ 1JMMA 2WZ7A 1AVYA 4WVZA 1R8EA 4JF7A 2Y0DA 1ZR4A 3S9OA 3AECC 2Q7CA 3T97B 2M0BA 1W5CE 4IL6E 2HODA 2JJLA 3Q5SA 3USSA 1URQD 1UIXA 1L0ND 2Z4EA 2G3AA 3VP8A 4PD4D 1KC8Q 2IFMA 2B87B 2W6AA 3KZIE 2K3RA 1FJKA 3TK1A 4N3YB 1QEXA 1CI6B 2P1JA 4I2LC 2C0XA 4D6TG 3O6QB 3B4SA 3L75J 2E74D 1Q2NA 2HLOA 4W80A 1DD4A 3P8CE 1OVRA 2QJKB 2YMYA 2BASA 1OFCX 1FU1A 4QMAA 1LGHB 1W2EA 2CPBA 1MKMA 5KAIH 2P2UA 5AVYB 4YPCA 3TSIA 3JC22 1JB0J 5APVA 1G2CA 2OYHC 3CWBD 1FZCC 2A06G 2H43A 4EOTA 2JKVA 3RL0C 2Z5IA 3SFDC 1MFTA 3AE3C 3V4QA 2RMZA 1KB9I 3B5NB 5TJHA 2LXCB 3RK3B 3D6ZA 3HE4A 3A0BH 3G9RA 5AW9B 2CPSA 4WB4A 5KJ7D 2BCCG 1NKZB 2KZIA 1VF5C 5H2FH 1M90Q 1KD1Q 1GL2D 1S2EA 1EDIA 1EDJA 2GUSA 1NTMG 1KILE 4PJ0H 4R4MA 4ZKPA 1SQVK 3L75D 3R2PA 2NPSA 5AW5B 1L4AD 3CX5D 3AE8C 1JY2N 1FOSE 3AE5C 1H8AA 2IZ1A 4EYYQ 3LW5J 5APQA 1KYOI 2N1TA 2R5DA 5E79H 2AXTH 4U3FE 3HTKB 1SQPK 2PRRA 2POHA 1SQXK 3AEFC 4L76A 1NTZG 1SQQJ 2HPCA 1NTKJ 5AW1B 1N2DC 4JYBA 3BRTB 5AW8B 4K3AA 2AXCA 1KV4A 3M06A 1OX3A 2YO3A 2WPSA 3CCRP 1Y9BA 1YQ3C 1SQVE 2JP3A 4GIFA 4PD4I 3V4WA 1MV8A 5APUA 3CCQP 1HVVA 1ZP0C 2B88A 4IOIH 1HBWA 4RESB 1VQLP 1PGOA 5BU8B 3L74J 2FXMA 3HUSC 1TU3F 3VOPA 3C9IA 1KILC 4DT0A 1SQPE 5AVZB 1OW6A 2P10A 2WSCH 3L73D 4OGQB 1BSHA 5EFWB 3BCCG 3QWOC 1L0NG 5CBOA 5CCGC 2R3CA 3FXEA 3MZWB 1SP4A 2Q3IA 2LKMA 1LTJB 2PFXA 2WSEH 3GMAA 2J5UA 3Q1MA 2O01H 5KLVE 1E5WA 1SQQD 3CL3D 1NTKD 4H13C 2C9NY 1H88A 3MD0A 5L8RJ 2JEEA 1RE3C 2QRXA 2ZYAA 1ZV8A 1P84D 1CSBA 4JPZB 5B66H 4TLFA 1PZQA 3MIWA 2FFDB 1G1JA 4GODA 1FDOA 1ZRTE 1RF1A 4R4LA 4NPDA 3KXDA 1RQUA 1X0TA 3L74D 3L70E 2D2CC 1D7MA 2M5AA 1QL1A 3CXHE 3V2QA 1SFCD 1LWUA 3B71A 3CX5I 1N73C 3EFGA 1URQA 1Y8AA 5DJTB 3V2RA 1N7SC 1LNQA 1IFMA 2KK7A 1FZEA 4OVNF 5KAFH 5AVTB 5AVVB 1LTSC 1QVGO 1KQGB 3CI9A 3GLMA 1S9KE 4XE5B 2AEMA 4H44B 2E42A 5AW2B 4O9BA 2OARA 3H32A 2FXPA 3BVHA 3L75G 1EDKA 2YNYA 4GOFA 4WY4B 2PGDA 3H1LE 3VMXA 1K05A 4HB1A 3HE5B 3N7NA 5KLVG 2V7QH 3WMM0 5KKZB 1VQNP 5GTHE 2E75C 1NOHA 1LTJC 5CJ4A 3EQ2A 1ZW0A 4I7ZC 3L72J 3CCJP 1USDA 2BEQD 3CC2P 2Q5UA 2IYOA 3V2NA 3GHGA 3HE4B 5KAFE 4PV1C 4YXDC 4DCKA 2V4HA 3MGNA 3TGUE 1RHZB 4KHXA 2H89C 3L70G 3RK2D 1PFIA 2GM4A 1M7LA 4H0LC 2AEJA 2WWWA 4BWNA 3AE6C 1GL2A 1OVVA 1BSNA 2OYIA 2IBZD 2ZXEB 1VDFA 2WT7B 3Q3DA 2W83C 1IFDA 3LIEA 1L4AA 5CHXA 2KZJA 4KJMA 2P67A 1LP1B 2OTKE 1NWQA 1RH5B 2K9JA 3RGUA 1ZN5A 3G3ZA 1M56D 2Z5HA 1BGYE 4AQRD 1PIXA 4IFDK 1P84I 3PH0A 4IL6H 2IDBA 3H1HJ 1PV3A 2IYPA 5C39A 2ZT9C 1VL2A 2P7JA 2O01N 2KSJA 1NTMK 2O1KA 1VQMP 2OYHB 1GK6A 1GU4A 1FZCB 3L72D 2YO2A 1J1EB 3TNUB 3KZIH 3GF7A 3RL0B 1VQPP 1SQQG 3S4RA 4JQ0D 1K9MQ 1JEKA 5APTA 2A45H 2K1AA 2XNDH 3SWYA 3N4XA 1QVFO 1KMIZ 2Y9ZA 4GOEA 2Q6QA 2YIUC 4C7NB 2QIWA 1KFNA 1PP9J 5BVZA 1VF5B 4UB8E 3V6IA 3WU2E 4C46A 1NTZK 1RE4A 2KYVA 5GTIE 1SVFA 2E76C 2BCCE 2YKPA 3L37A 4EI2A 1FZBA 4YTPC 1NTME 2NRGA 2M8RA 3OA7A 4ZKUA 4I6MC 2KUBA 3H1HD 4HJGH 1KB9E 1NAYA 3B5ND 3WUTA 3R4YA 1X79B 3RK3D 2DW3A 1BGYG 2WSFH 2C9LY 2NPSC 1PPJE 3M0DA 1SQXJ 3L71J 3AEAC 5CCGD 4CPGA 1KQSO 3A0HE 3AE4C 4BRYA 1LT9A 2IPPA 1BE3J 2N1TC 1VQ4P 1NTZE 2FYNC 1L0NK 3H1KE 3NXSA 1NU1E 1AA0A 1PP9D 2ITAA 1JNMA 1L0LE 2FYUE 1JM0A 2IFNA 1J1EC 4N78E 4Y28J 1KYOE 2JR8A 1J2JB 2W6BA 4GT1A 2IBZI 3HUSB 2M3EA 1GZLA 4BXLA 4RJTA 1K04A 1GW4A 1IK7A 2LR2A 1KILB 1SFCA 1JTHA 1EXIA 2QJPC 3EFFK 1SQVD 2RKLA 2SPZA 3HRNA 4HYTB 2JWAA 3CMAP 2KS1A 3BATA 2C0WA 2WTYA 1KZUB 2N9YB 3FWNA 2WSCJ 1M1JA 4EDFA 1RQVA 3BCCE 2IBZG 1L0NE 1YQ4C 4H13B 1GW3A 1LTAC 1SQXD 3H32B 3L71D 4PD4E 1X8YA 5APYA 1FZFA 1FDIA 5AVRB 4U7JA 1PL5A 1NGMB 1EQ7A 2IX7C 3W68A 3HD7D 4YXWH 3L4FA 1BE3D 2WSEJ 2ZJSE 4WWIA 2O01J 1OW7A 3L73J 1RY3A 2QE7H 3GG2A 1PPJG 4RO0A 2KI7B 1R5SA 1EZVD 1WT6A 5CCHD 4MN4C 3ABVC 2ZVNB 3WUUA 1T6AA 4NPFX 2W6JH 2E5YA 3MHVA 1LTGC 2KIKA 4KT0J 3M91A 2KXPB 2D2CB 3GHGB 4OGQD 2LXBA 3H1KG 3L72G 3BASA 1NU1G 3G6EP 1L0LG 2FYUG 5CJ0A 1EC5A 2KOGA 2KLUA 5B5EE 1N73B 5KLVK 1T2KD 1BCCJ 3KPEA 1N7SB 2HG5D 3CWBE 1FZGA 3H1IG 4DOJA 2HFED 1RF1C 1SS1A 3G71P 3ZDMA 1AJYA 1L4AB 1A02J 1CZQA 1LWUC 3TF5A 1VPCA 1URQC 3CC4P 1HJBA 4OWFA 3PHLA 4DJGA 3VMYA 1OXZA 3V5BA 3PLNA 3CXHH 3JCUE 3F89A 1KORA 2YXRB 1AVOA 4N6JA 3L75E 1YTZT 2ZYGA 3ITKA 3T97A 3H1HG 3C8VA 2E75B 3CX5E 1K73Q 2E74C 2V7QJ 4I7ZB 1YYCA 3Q2YA 1CW5A 4IL6X 1EXJA 3IR9A 2B87A 3H1LD 1BDDA 4K35A 4PV1B 1PGQA 5AW6B 4D6TJ 1H0TB 1BCCD 2KNCB 5TISE 4XA4A 1S4XA 4H44D 3O6QA 2OQQA 1LT1A 2JDIH 4H0LB 1XTCC 1QLED 3NMDA 4WY4D 2PAJA 1Q86Q 1GMJA 3RL0g 3H1JJ 5GTHH 3GHGC 3CWBG 1SQQK 2ZXXA 1SQBJ 2I8DA 3AE7C 3K5BA 3CCLP 2HODB 1YTZI 3WUVA 1YIJP 3AE9C 1JO5A 4L75A 2JWDA 2FYZA 3B8EB 3EWKA 4JBZA 1OIPA 3AE1C 1N8RQ 1HGVA 4W7YA 3VMAA 1YITP 2R32A 3B5NA 1GL2C 2OYIC 3SSUA 1QGKB 2ZT9B 1VQ5P 1EZVI 2RH0A 2YKQA 1L2PA 2WSSH 1NO4A 1L4AC 2W90A 1HUCA 1U57A 3IAOA 1HH0A 1NH4A 1PGPA 4D6TD 3L71G 1JCCA 1K8AQ 1IC2A 2OTLP 1JUNA 3IF4A 5APSA 3SWFA 1RF0A 5AW3B 1SQQE 2YIUB 1NTKE 1Q90D 3I55P 1G2CB 3II6A 4XFJA 1MZ9A 3H1JD 3CCEP 1P84E 3CPWO 3CD6P 3PRJA 1JCDA 1SQBD 1U7JA 3SWKA 3L36A 2E76B 3HTKA 2Y0CA 2A06D 3CCVP 2H7HA 2YMKA 1J1DC 1YJ9P 5BU5A 5KJ7A 3L74E 2ZFCA 3PJSK 1DIPA 3RL0D 1E79H 3I5CA 1RE4C 2Y0EA 3S1KA 1M57D 4LGDE 2YXQB 2BCCD 1XTGB 5CBNA 1HF9A 2NPSB 2FBWC 1YI2P 1NYHA 2HYNA 3P8MC 4UB8H 3WU2H 2BEZF 5AVXB 3HD7A 1VF5D 4Y99C 1ZXGA 1HTLC 5GTIH 2N1TB 1VQ9P 2WSFJ 3FXDA 2FYNB 3CLQA 1DH3A 3L73G 3KHUA 1UIIA 5CCHA 4ZNCA 2Q3EA 3CCSP 5AW4B 1KB9H 2HPCB 3M0DC 2G8YA 2O3JA 4AYCA 1S5LE 3P8CD 2WMMA 1NTKG 2I1KA 1LT9C 4L74A 1QX8A 2QJPB 3MP7B 4HH2A 1MUUA 3FWLA 4U3FJ 1HGZA 1A02F 4DZOA 3PTZA 1ZMEC 2R5BA 1BCCG 1IJDB 3C1LA 3A0HH 2B9BA 3VTPC 2OYOA 1JY3O 3M0AA 2WQYC 3L35A 4M3LA 1NU1K 2FFDA 1DX7A 1LTBC 3RBZA 1SFCC 3L74G 2QEXP 1FDMA 1L0LK 2FYUK 3W67A 5AVQB 1JMBA 1NVOA 3I56P 1KYOH 3TDKA 1SQVJ 4LLHA 3OJAB 2IBZE 2XU6A 3QH9A 1FZAA 2XNXA 2W27A 1KILD 3LIDA 3MUDA 1VQKP 3BCCD 1M1JC 3AEGC 1JY3P 1X9VA 2GA1A 3GF3A 4UB6E 1DEEG 1SQPJ 3E1IA 3Q5PA 4A7PA 1PGJA 3F5HA 2WPRA 1Y47A 4U3FD 4PD4H 1NJIQ 2XZRA 4AUWA 1H89A 3D71A 3L72E 3A3YB 4H13D 1QL2A 1FJPA 1RF1B 1T8ZA 5KTBA 4L73A 5KLIC 1S3JA 5KLVJ 4WY4A 2Q1KA 3VN0A 3VMZA 3O8ZA 3HE5A 2M5AB 4OH8B 3H1IE 2WVRA 3H1JG 1N7LA 3H6PA 1LWUB 4RKUJ 2QJYC 1IFIA 3P32A 1SQBG 1URQB 2E43A 4W7ZA 3RK2C 3NFQA 2D2CD 5B5EH 2XV5A 3L70J 1USEA 3E1RA 3KQGA 4WBAA 1IFPA 2A45I 1R5LA 1GK4A 2E74B 1SQPD 1N7SD 2IZ0A 3VP9A 1Q7YQ 3E7KA 3M9HA 3H1HE 1NKNA 1EDLA 1KQFB 3MTUE 3RK3E 1OW8A 2WT7A 2OGUA 3U59A 1JOCA 2MKVA
chains in the Genus database with same CATH topology
1SQBJ 1NTMJ 3H1HJ 3H1KJ 2IBZI 1NU1J 3L74J 3L72J 1KB9I 1BCCJ 1EZVI 3CWBJ 3CX5I 1SQVJ 3L75J 1SQPJ 1L0LJ 2FYUJ 1SQQJ 1SQXJ 3L70J 3L71J 1NTKJ 1BGYJ 2BCCJ 3H1LJ 1KYOI 4U3FJ 3L73J 4D6TJ 3CXHI 4PD4I 3BCCJ 5KLVJ 1L0NJ 3H1JJ 3TGUJ 1NTZJ 3H1IJ 1P84I 1PP9J 1BE3J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQB J;  1NTM J;  3H1H J;  3H1K J;  2IBZ I;  1NU1 J;  3L74 J;  3L72 J;  1KB9 I;  1BCC J;  1EZV I;  3CWB J;  3CX5 I;  1SQV J;  3L75 J;  1SQP J;  1L0L J;  2FYU J;  1SQQ J;  1SQX J;  3L70 J;  3L71 J;  1NTK J;  1BGY J;  2BCC J;  3H1L J;  1KYO I;  4U3F J;  3L73 J;  4D6T J;  3CXH I;  4PD4 I;  3BCC J;  5KLV J;  1L0N J;  3H1J J;  3TGU J;  1NTZ J;  3H1I J;  1P84 I;  1PP9 J;  1BE3 J; 
#chains in the Genus database with same CATH topology
 3VYI A;  1AQT A;  5KAI E;  1LP1 A;  1WMK A;  5KLV D;  1YJN P;  1NHL A;  3JCU H;  3FX0 A;  2A45 G;  2ZVO B;  1DD3 A;  2KB7 P;  3Q5R A;  3AED C;  3CX5 H;  3H1L J;  5AVS B;  2Q9I A;  1PP9 E;  2E75 D;  2NZ2 A;  3A0B E;  2OYH A;  1FZC A;  4ASV A;  1AQ5 A;  3TNU A;  3A7O A;  1ZRT D;  1KN7 A;  3M9B A;  2K9Y A;  2GUV A;  1GL2 B;  3L70 D;  2OYI B;  3SFE C;  4PV1 D;  5TIS H;  2QJK C;  2QM7 A;  2KSE A;  5H2F E;  1S5L X;  3CXH D;  4PJ0 E;  4C7N A;  1SLQ A;  2K9J B;  3TGU J;  4C7R A;  3OW2 O;  3HD7 B;  4H0L D;  2OTJ P;  1FS0 E;  4EIJ A;  1NAF A;  2VRS A;  1GTW A;  1FOS F;  1BDC A;  2N9B A;  3B5N C;  3P7K A;  1Z56 A;  3GW6 A;  5CMZ A;  3RK3 C;  1S9K D;  5E79 E;  3CME P;  2AXT E;  1SQX E;  3L71 E;  1JY2 O;  1WRG A;  2YKO A;  2FY8 A;  1BE3 E;  1HWT C;  5APX A;  1BGY J;  1EZV E;  3CC7 P;  3V2P A;  1J1D B;  2ZT9 D;  2RN0 A;  1KTM A;  1CI6 A;  4TT3 H;  3LW5 H;  2I1J A;  1RF0 C;  4U3F G;  1S1C X;  3D6Y A;  1JY2 P;  1PP9 G;  2QG4 A;  2ZAE B;  3IN6 A;  2KP8 A;  1NTK K;  1OZH A;  3BRV B;  3TGU D;  2CK3 H;  5K5G B;  1W2B O;  1ZOY C;  3AEB C;  1OVU A;  1P84 H;  4Y99 B;  4LC1 A;  2XKM A;  5KJ7 C;  3A5T A;  2JO1 A;  2H88 C;  3CCU P;  1AFO A;  3AE2 C;  1SQV G;  3HUS A;  1S72 P;  1FC2 C;  3U1C A;  1IZN B;  2E76 D;  1LJ2 A;  2QVA A;  1KIL A;  1IFJ A;  2P58 A;  5APW A;  3CCM P;  3D70 A;  1IFN A;  3PP5 A;  2BCC J;  2AEF A;  1FBM A;  1T3U A;  3A2A A;  1OMI A;  3L73 E;  1GU5 A;  5CCG A;  5AVW B;  1SQP G;  3HD7 C;  1M8O B;  1BGY D;  4BRY B;  1NTM J;  2QSI A;  1SQX G;  1LT9 B;  1HJ0 A;  1IO4 A;  3H25 A;  1KQL A;  2XDJ A;  4IFM A;  2FKW B;  1GD2 E;  4ZMD A;  1BE3 G;  5CCH C;  2WPQ A;  2NPS D;  5B66 E;  5M1B A;  2R3S A;  1RE3 A;  2HR3 A;  1EZV G;  4OGQ C;  2O1J A;  2N1T D;  2WPV B;  1BCC E;  2K88 A;  2K37 A;  1MFZ A;  5AW7 B;  5AW0 B;  1SFC B;  3CXH I;  1JTH B;  1X22 A;  1T2K C;  1NTZ J;  1OWA A;  2KLV A;  4I1L A;  2UWJ E;  3H1K J;  1S5L H;  1NU1 J;  2WIT A;  2FXO A;  1L0L J;  2FYU J;  2E5T A;  2KS1 B;  1VQ8 P;  1JY3 N;  1KFM A;  3KDP B;  3UIA A;  1IK9 A;  1YJW P;  3H1I J;  1M1J B;  1N73 A;  4IFF A;  1VQ6 P;  2FFD C;  3FGA D;  4B86 A;  1U7M A;  1N7S A;  3OAK A;  3U1A A;  1N86 A;  3G4S P;  1SQB K;  2J59 M;  1NTM D;  3RBX A;  2B89 A;  2H8P D;  3AEE C;  1M1K Q;  1ZR2 A;  2R44 A;  1KB9 D;  1GDT A;  1VQ7 P;  1FE6 A;  2MJZ A;  1LTT C;  3MUD C;  3TYY A;  4HKZ H;  5KLI B;  2J58 A;  1YHQ P;  3BCC J;  4JYC A;  1L0N J;  1PPJ D;  1LTI C;  4GDO A;  3M9Q A;  4D6T E;  1Q82 Q;  2PP6 A;  3KYQ A;  2QJY B;  1NTZ D;  1VQO P;  2W8Z A;  1LTJ A;  5AVU B;  3H1L G;  2M3B A;  1DEB A;  3H1K D;  4UB6 H;  1NU1 D;  4H44 C;  3IFM A;  3RK2 B;  3NTN A;  3H1J E;  1L0L D;  2FYU D;  2ZYD A;  1G1I A;  1YBK A;  1T3J A;  4GKG A;  3JSV C;  4WY4 C;  1SQB E;  4N78 D;  1KYO D;  2A06 E;  3H1I D;  1FAV A;  1Q81 Q;  5DJU B;  4Z1M H;  1H0T A;  5KKZ C;  2KNC A;  4ASW A;  2Y9Y A;  1AV1 A;  2QM8 A;  2L91 A;  4NPE A;  1ZLL A;  2L5G B;  2QA4 P;  3TGU G;  3CWB J;  1JMM A;  2WZ7 A;  1AVY A;  4WVZ A;  1R8E A;  4JF7 A;  2Y0D A;  1ZR4 A;  3S9O A;  3AEC C;  2Q7C A;  3T97 B;  2M0B A;  1W5C E;  4IL6 E;  2HOD A;  2JJL A;  3Q5S A;  3USS A;  1URQ D;  1UIX A;  1L0N D;  2Z4E A;  2G3A A;  3VP8 A;  4PD4 D;  1KC8 Q;  2IFM A;  2B87 B;  2W6A A;  3KZI E;  2K3R A;  1FJK A;  3TK1 A;  4N3Y B;  1QEX A;  1CI6 B;  2P1J A;  4I2L C;  2C0X A;  4D6T G;  3O6Q B;  3B4S A;  3L75 J;  2E74 D;  1Q2N A;  2HLO A;  4W80 A;  1DD4 A;  3P8C E;  1OVR A;  2QJK B;  2YMY A;  2BAS A;  1OFC X;  1FU1 A;  4QMA A;  1LGH B;  1W2E A;  2CPB A;  1MKM A;  5KAI H;  2P2U A;  5AVY B;  4YPC A;  3TSI A;  3JC2 2;  1JB0 J;  5APV A;  1G2C A;  2OYH C;  3CWB D;  1FZC C;  2A06 G;  2H43 A;  4EOT A;  2JKV A;  3RL0 C;  2Z5I A;  3SFD C;  1MFT A;  3AE3 C;  3V4Q A;  2RMZ A;  1KB9 I;  3B5N B;  5TJH A;  2LXC B;  3RK3 B;  3D6Z A;  3HE4 A;  3A0B H;  3G9R A;  5AW9 B;  2CPS A;  4WB4 A;  5KJ7 D;  2BCC G;  1NKZ B;  2KZI A;  1VF5 C;  5H2F H;  1M90 Q;  1KD1 Q;  1GL2 D;  1S2E A;  1EDI A;  1EDJ A;  2GUS A;  1NTM G;  1KIL E;  4PJ0 H;  4R4M A;  4ZKP A;  1SQV K;  3L75 D;  3R2P A;  2NPS A;  5AW5 B;  1L4A D;  3CX5 D;  3AE8 C;  1JY2 N;  1FOS E;  3AE5 C;  1H8A A;  2IZ1 A;  4EYY Q;  3LW5 J;  5APQ A;  1KYO I;  2N1T A;  2R5D A;  5E79 H;  2AXT H;  4U3F E;  3HTK B;  1SQP K;  2PRR A;  2POH A;  1SQX K;  3AEF C;  4L76 A;  1NTZ G;  1SQQ J;  2HPC A;  1NTK J;  5AW1 B;  1N2D C;  4JYB A;  3BRT B;  5AW8 B;  4K3A A;  2AXC A;  1KV4 A;  3M06 A;  1OX3 A;  2YO3 A;  2WPS A;  3CCR P;  1Y9B A;  1YQ3 C;  1SQV E;  2JP3 A;  4GIF A;  4PD4 I;  3V4W A;  1MV8 A;  5APU A;  3CCQ P;  1HVV A;  1ZP0 C;  2B88 A;  4IOI H;  1HBW A;  4RES B;  1VQL P;  1PGO A;  5BU8 B;  3L74 J;  2FXM A;  3HUS C;  1TU3 F;  3VOP A;  3C9I A;  1KIL C;  4DT0 A;  1SQP E;  5AVZ B;  1OW6 A;  2P10 A;  2WSC H;  3L73 D;  4OGQ B;  1BSH A;  5EFW B;  3BCC G;  3QWO C;  1L0N G;  5CBO A;  5CCG C;  2R3C A;  3FXE A;  3MZW B;  1SP4 A;  2Q3I A;  2LKM A;  1LTJ B;  2PFX A;  2WSE H;  3GMA A;  2J5U A;  3Q1M A;  2O01 H;  5KLV E;  1E5W A;  1SQQ D;  3CL3 D;  1NTK D;  4H13 C;  2C9N Y;  1H88 A;  3MD0 A;  5L8R J;  2JEE A;  1RE3 C;  2QRX A;  2ZYA A;  1ZV8 A;  1P84 D;  1CSB A;  4JPZ B;  5B66 H;  4TLF A;  1PZQ A;  3MIW A;  2FFD B;  1G1J A;  4GOD A;  1FDO A;  1ZRT E;  1RF1 A;  4R4L A;  4NPD A;  3KXD A;  1RQU A;  1X0T A;  3L74 D;  3L70 E;  2D2C C;  1D7M A;  2M5A A;  1QL1 A;  3CXH E;  3V2Q A;  1SFC D;  1LWU A;  3B71 A;  3CX5 I;  1N73 C;  3EFG A;  1URQ A;  1Y8A A;  5DJT B;  3V2R A;  1N7S C;  1LNQ A;  1IFM A;  2KK7 A;  1FZE A;  4OVN F;  5KAF H;  5AVT B;  5AVV B;  1LTS C;  1QVG O;  1KQG B;  3CI9 A;  3GLM A;  1S9K E;  4XE5 B;  2AEM A;  4H44 B;  2E42 A;  5AW2 B;  4O9B A;  2OAR A;  3H32 A;  2FXP A;  3BVH A;  3L75 G;  1EDK A;  2YNY A;  4GOF A;  4WY4 B;  2PGD A;  3H1L E;  3VMX A;  1K05 A;  4HB1 A;  3HE5 B;  3N7N A;  5KLV G;  2V7Q H;  3WMM 0;  5KKZ B;  1VQN P;  5GTH E;  2E75 C;  1NOH A;  1LTJ C;  5CJ4 A;  3EQ2 A;  1ZW0 A;  4I7Z C;  3L72 J;  3CCJ P;  1USD A;  2BEQ D;  3CC2 P;  2Q5U A;  2IYO A;  3V2N A;  3GHG A;  3HE4 B;  5KAF E;  4PV1 C;  4YXD C;  4DCK A;  2V4H A;  3MGN A;  3TGU E;  1RHZ B;  4KHX A;  2H89 C;  3L70 G;  3RK2 D;  1PFI A;  2GM4 A;  1M7L A;  4H0L C;  2AEJ A;  2WWW A;  4BWN A;  3AE6 C;  1GL2 A;  1OVV A;  1BSN A;  2OYI A;  2IBZ D;  2ZXE B;  1VDF A;  2WT7 B;  3Q3D A;  2W83 C;  1IFD A;  3LIE A;  1L4A A;  5CHX A;  2KZJ A;  4KJM A;  2P67 A;  1LP1 B;  2OTK E;  1NWQ A;  1RH5 B;  2K9J A;  3RGU A;  1ZN5 A;  3G3Z A;  1M56 D;  2Z5H A;  1BGY E;  4AQR D;  1PIX A;  4IFD K;  1P84 I;  3PH0 A;  4IL6 H;  2IDB A;  3H1H J;  1PV3 A;  2IYP A;  5C39 A;  2ZT9 C;  1VL2 A;  2P7J A;  2O01 N;  2KSJ A;  1NTM K;  2O1K A;  1VQM P;  2OYH B;  1GK6 A;  1GU4 A;  1FZC B;  3L72 D;  2YO2 A;  1J1E B;  3TNU B;  3KZI H;  3GF7 A;  3RL0 B;  1VQP P;  1SQQ G;  3S4R A;  4JQ0 D;  1K9M Q;  1JEK A;  5APT A;  2A45 H;  2K1A A;  2XND H;  3SWY A;  3N4X A;  1QVF O;  1KMI Z;  2Y9Z A;  4GOE A;  2Q6Q A;  2YIU C;  4C7N B;  2QIW A;  1KFN A;  1PP9 J;  5BVZ A;  1VF5 B;  4UB8 E;  3V6I A;  3WU2 E;  4C46 A;  1NTZ K;  1RE4 A;  2KYV A;  5GTI E;  1SVF A;  2E76 C;  2BCC E;  2YKP A;  3L37 A;  4EI2 A;  1FZB A;  4YTP C;  1NTM E;  2NRG A;  2M8R A;  3OA7 A;  4ZKU A;  4I6M C;  2KUB A;  3H1H D;  4HJG H;  1KB9 E;  1NAY A;  3B5N D;  3WUT A;  3R4Y A;  1X79 B;  3RK3 D;  2DW3 A;  1BGY G;  2WSF H;  2C9L Y;  2NPS C;  1PPJ E;  3M0D A;  1SQX J;  3L71 J;  3AEA C;  5CCG D;  4CPG A;  1KQS O;  3A0H E;  3AE4 C;  4BRY A;  1LT9 A;  2IPP A;  1BE3 J;  2N1T C;  1VQ4 P;  1NTZ E;  2FYN C;  1L0N K;  3H1K E;  3NXS A;  1NU1 E;  1AA0 A;  1PP9 D;  2ITA A;  1JNM A;  1L0L E;  2FYU E;  1JM0 A;  2IFN A;  1J1E C;  4N78 E;  4Y28 J;  1KYO E;  2JR8 A;  1J2J B;  2W6B A;  4GT1 A;  2IBZ I;  3HUS B;  2M3E A;  1GZL A;  4BXL A;  4RJT A;  1K04 A;  1GW4 A;  1IK7 A;  2LR2 A;  1KIL B;  1SFC A;  1JTH A;  1EXI A;  2QJP C;  3EFF K;  1SQV D;  2RKL A;  2SPZ A;  3HRN A;  4HYT B;  2JWA A;  3CMA P;  2KS1 A;  3BAT A;  2C0W A;  2WTY A;  1KZU B;  2N9Y B;  3FWN A;  2WSC J;  1M1J A;  4EDF A;  1RQV A;  3BCC E;  2IBZ G;  1L0N E;  1YQ4 C;  4H13 B;  1GW3 A;  1LTA C;  1SQX D;  3H32 B;  3L71 D;  4PD4 E;  1X8Y A;  5APY A;  1FZF A;  1FDI A;  5AVR B;  4U7J A;  1PL5 A;  1NGM B;  1EQ7 A;  2IX7 C;  3W68 A;  3HD7 D;  4YXW H;  3L4F A;  1BE3 D;  2WSE J;  2ZJS E;  4WWI A;  2O01 J;  1OW7 A;  3L73 J;  1RY3 A;  2QE7 H;  3GG2 A;  1PPJ G;  4RO0 A;  2KI7 B;  1R5S A;  1EZV D;  1WT6 A;  5CCH D;  4MN4 C;  3ABV C;  2ZVN B;  3WUU A;  1T6A A;  4NPF X;  2W6J H;  2E5Y A;  3MHV A;  1LTG C;  2KIK A;  4KT0 J;  3M91 A;  2KXP B;  2D2C B;  3GHG B;  4OGQ D;  2LXB A;  3H1K G;  3L72 G;  3BAS A;  1NU1 G;  3G6E P;  1L0L G;  2FYU G;  5CJ0 A;  1EC5 A;  2KOG A;  2KLU A;  5B5E E;  1N73 B;  5KLV K;  1T2K D;  1BCC J;  3KPE A;  1N7S B;  2HG5 D;  3CWB E;  1FZG A;  3H1I G;  4DOJ A;  2HFE D;  1RF1 C;  1SS1 A;  3G71 P;  3ZDM A;  1AJY A;  1L4A B;  1A02 J;  1CZQ A;  1LWU C;  3TF5 A;  1VPC A;  1URQ C;  3CC4 P;  1HJB A;  4OWF A;  3PHL A;  4DJG A;  3VMY A;  1OXZ A;  3V5B A;  3PLN A;  3CXH H;  3JCU E;  3F89 A;  1KOR A;  2YXR B;  1AVO A;  4N6J A;  3L75 E;  1YTZ T;  2ZYG A;  3ITK A;  3T97 A;  3H1H G;  3C8V A;  2E75 B;  3CX5 E;  1K73 Q;  2E74 C;  2V7Q J;  4I7Z B;  1YYC A;  3Q2Y A;  1CW5 A;  4IL6 X;  1EXJ A;  3IR9 A;  2B87 A;  3H1L D;  1BDD A;  4K35 A;  4PV1 B;  1PGQ A;  5AW6 B;  4D6T J;  1H0T B;  1BCC D;  2KNC B;  5TIS E;  4XA4 A;  1S4X A;  4H44 D;  3O6Q A;  2OQQ A;  1LT1 A;  2JDI H;  4H0L B;  1XTC C;  1QLE D;  3NMD A;  4WY4 D;  2PAJ A;  1Q86 Q;  1GMJ A;  3RL0 g;  3H1J J;  5GTH H;  3GHG C;  3CWB G;  1SQQ K;  2ZXX A;  1SQB J;  2I8D A;  3AE7 C;  3K5B A;  3CCL P;  2HOD B;  1YTZ I;  3WUV A;  1YIJ P;  3AE9 C;  1JO5 A;  4L75 A;  2JWD A;  2FYZ A;  3B8E B;  3EWK A;  4JBZ A;  1OIP A;  3AE1 C;  1N8R Q;  1HGV A;  4W7Y A;  3VMA A;  1YIT P;  2R32 A;  3B5N A;  1GL2 C;  2OYI C;  3SSU A;  1QGK B;  2ZT9 B;  1VQ5 P;  1EZV I;  2RH0 A;  2YKQ A;  1L2P A;  2WSS H;  1NO4 A;  1L4A C;  2W90 A;  1HUC A;  1U57 A;  3IAO A;  1HH0 A;  1NH4 A;  1PGP A;  4D6T D;  3L71 G;  1JCC A;  1K8A Q;  1IC2 A;  2OTL P;  1JUN A;  3IF4 A;  5APS A;  3SWF A;  1RF0 A;  5AW3 B;  1SQQ E;  2YIU B;  1NTK E;  1Q90 D;  3I55 P;  1G2C B;  3II6 A;  4XFJ A;  1MZ9 A;  3H1J D;  3CCE P;  1P84 E;  3CPW O;  3CD6 P;  3PRJ A;  1JCD A;  1SQB D;  1U7J A;  3SWK A;  3L36 A;  2E76 B;  3HTK A;  2Y0C A;  2A06 D;  3CCV P;  2H7H A;  2YMK A;  1J1D C;  1YJ9 P;  5BU5 A;  5KJ7 A;  3L74 E;  2ZFC A;  3PJS K;  1DIP A;  3RL0 D;  1E79 H;  3I5C A;  1RE4 C;  2Y0E A;  3S1K A;  1M57 D;  4LGD E;  2YXQ B;  2BCC D;  1XTG B;  5CBN A;  1HF9 A;  2NPS B;  2FBW C;  1YI2 P;  1NYH A;  2HYN A;  3P8M C;  4UB8 H;  3WU2 H;  2BEZ F;  5AVX B;  3HD7 A;  1VF5 D;  4Y99 C;  1ZXG A;  1HTL C;  5GTI H;  2N1T B;  1VQ9 P;  2WSF J;  3FXD A;  2FYN B;  3CLQ A;  1DH3 A;  3L73 G;  3KHU A;  1UII A;  5CCH A;  4ZNC A;  2Q3E A;  3CCS P;  5AW4 B;  1KB9 H;  2HPC B;  3M0D C;  2G8Y A;  2O3J A;  4AYC A;  1S5L E;  3P8C D;  2WMM A;  1NTK G;  2I1K A;  1LT9 C;  4L74 A;  1QX8 A;  2QJP B;  3MP7 B;  4HH2 A;  1MUU A;  3FWL A;  4U3F J;  1HGZ A;  1A02 F;  4DZO A;  3PTZ A;  1ZME C;  2R5B A;  1BCC G;  1IJD B;  3C1L A;  3A0H H;  2B9B A;  3VTP C;  2OYO A;  1JY3 O;  3M0A A;  2WQY C;  3L35 A;  4M3L A;  1NU1 K;  2FFD A;  1DX7 A;  1LTB C;  3RBZ A;  1SFC C;  3L74 G;  2QEX P;  1FDM A;  1L0L K;  2FYU K;  3W67 A;  5AVQ B;  1JMB A;  1NVO A;  3I56 P;  1KYO H;  3TDK A;  1SQV J;  4LLH A;  3OJA B;  2IBZ E;  2XU6 A;  3QH9 A;  1FZA A;  2XNX A;  2W27 A;  1KIL D;  3LID A;  3MUD A;  1VQK P;  3BCC D;  1M1J C;  3AEG C;  1JY3 P;  1X9V A;  2GA1 A;  3GF3 A;  4UB6 E;  1DEE G;  1SQP J;  3E1I A;  3Q5P A;  4A7P A;  1PGJ A;  3F5H A;  2WPR A;  1Y47 A;  4U3F D;  4PD4 H;  1NJI Q;  2XZR A;  4AUW A;  1H89 A;  3D71 A;  3L72 E;  3A3Y B;  4H13 D;  1QL2 A;  1FJP A;  1RF1 B;  1T8Z A;  5KTB A;  4L73 A;  5KLI C;  1S3J A;  5KLV J;  4WY4 A;  2Q1K A;  3VN0 A;  3VMZ A;  3O8Z A;  3HE5 A;  2M5A B;  4OH8 B;  3H1I E;  2WVR A;  3H1J G;  1N7L A;  3H6P A;  1LWU B;  4RKU J;  2QJY C;  1IFI A;  3P32 A;  1SQB G;  1URQ B;  2E43 A;  4W7Z A;  3RK2 C;  3NFQ A;  2D2C D;  5B5E H;  2XV5 A;  3L70 J;  1USE A;  3E1R A;  3KQG A;  4WBA A;  1IFP A;  2A45 I;  1R5L A;  1GK4 A;  2E74 B;  1SQP D;  1N7S D;  2IZ0 A;  3VP9 A;  1Q7Y Q;  3E7K A;  3M9H A;  3H1H E;  1NKN A;  1EDL A;  1KQF B;  3MTU E;  3RK3 E;  1OW8 A;  2WT7 A;  2OGU A;  3U59 A;  1JOC A;  2MKV A; 
#chains in the Genus database with same CATH homology
 1SQB J;  1NTM J;  3H1H J;  3H1K J;  2IBZ I;  1NU1 J;  3L74 J;  3L72 J;  1KB9 I;  1BCC J;  1EZV I;  3CWB J;  3CX5 I;  1SQV J;  3L75 J;  1SQP J;  1L0L J;  2FYU J;  1SQQ J;  1SQX J;  3L70 J;  3L71 J;  1NTK J;  1BGY J;  2BCC J;  3H1L J;  1KYO I;  4U3F J;  3L73 J;  4D6T J;  3CXH I;  4PD4 I;  3BCC J;  5KLV J;  1L0N J;  3H1J J;  3TGU J;  1NTZ J;  3H1I J;  1P84 I;  1PP9 J;  1BE3 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...