3CX5I

Structure of complex iii with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
57
structure length
57
Chain Sequence
SFSSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 18
structure length 57
sequence length 57
chains with identical sequence T
ec nomenclature
pdb deposition date 2008-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 3cx5I00
1L0NJ 1KYOI 4U3FJ 1SQPJ 3L70J 4PD4I 1SQBJ 1NU1J 3H1LJ 3L75J 1SQXJ 3H1IJ 3L74J 1KB9I 2IBZI 4D6TJ 1P84I 1NTKJ 1BE3J 1SQVJ 1L0LJ 1SQQJ 1PP9J 1BCCJ 1BGYJ 1NTMJ 3H1JJ 3L72J 3L71J 3H1KJ 2FYUJ 3L73J 3TGUJ 5KLVJ 3H1HJ 1NTZJ 3CXHI 1EZVI 3CX5I 3CWBJ 2BCCJ 3BCCJ
chains in the Genus database with same CATH superfamily
1YTZI 1ZRTD 4RKUJ 5CMZA 3CC7P 1BGYD 3BCCG 1QX8A 3HE4A 4UB8E 1ZOYC 3A0HE 4LLHA 5APWA 1QVFO 1JCDA 4BRYA 1RF1C 5AW7B 1JY3O 1KMIZ 2WPSA 1Y9BA 3L71G 3EWKA 2E74C 1D7MA 2ZXEB 4OWFA 3MTUE 2QSIA 4WVZA 2HLOA 3MIWA 3OA7A 3JSVC 1JTHA 4A7PA 2GA1A 4DOJA 1EDJA 2N1TB 4HB1A 1PIXA 1Y47A 3A7OA 1QGKB 3PH0A 3VMYA 5CBOA 2JO1A 4LGDE 1NTMJ 4NPDA 4OGQD 3V5BA 2FKWB 3AEBC 1AQTA 3WU2E 1MV8A 2YIUB 1YBKA 1IJDB 2JEEA 1IFDA 1KQGB 1PGJA 1S9KD 3PLNA 5B5EH 4GOEA 1GD2E 3H32A 1N73A 3L74J 2PFXA 4PD4D 5AVXB 1BCCJ 5KAFH 1KQFB 1VQ5P 3VN0A 1Q7YQ 2QE7H 2ZYGA 4H44B 1SQPD 4WWIA 3D6ZA 2BEZF 1EZVD 3VMAA 1LTSC 5CBNA 1OWAA 1FZBA 3GMAA 1AFOA 2YKQA 3HRNA 2G8YA 2DW3A 3H6PA 2NPSC 1T3JA 2KI7B 1SFCB 1VQ8P 3II6A 3H1KD 1NU1E 1AVYA 1HTLC 2OARA 3GHGB 1BCCG 2YXRB 1AQ5A 3VTPC 1BSNA 3L73G 3CWBE 2OTLP 3K5BA 3CX5E 3AE7C 1WRGA 2FYUJ 1SLQA 5CHXA 1M1JC 1GZLA 1FC2C 2M3EA 1JCCA 4U3FJ 1BSHA 3H1HG 1L0LD 3KYQA 4I7ZB 1R5SA 1OZHA 2KS1A 2OYHA 1RQUA 2IBZI 1IFMA 3PP5A 3TYYA 2I8DA 3U1AA 1SQQE 3A2AA 3HE4B 3V2NA 3RL0D 1DX7A 3U1CA 1URQC 3RL0g 4BRYB 3OW2O 1VDFA 5AVQB 1DD4A 3HE5A 3I55P 2KZJA 1SQXE 1S5LX 4Y99C 1E5WA 1VQ6P 2XDJA 1SQVE 3CXHH 4IFFA 1USEA 5KKZC 2OQQA 1J1EB 4R4MA 3P7KA 2FYUG 1GL2B 2Q3EA 3CCQP 1JTHB 4ZNCA 1A02J 2WSSH 2NPSA 2QJKC 1NKZB 3TDKA 1LP1A 2P10A 2MJZA 3G71P 1A02F 1L0NG 2ZVNB 1LGHB 3NTNA 2IFMA 2JP3A 2XNDH 2R3CA 3IFMA 1S72P 2QG4A 5KLVE 1KYOI 2N1TD 2IX7C 2JWDA 3I56P 1T2KC 4KT0J 3WMM0 2V7QH 2PP6A 2O01N 5H2FE 2B9BA 3H32B 1N73B 4WY4C 3GLMA 4HH2A 3SWYA 3HUSA 1H8AA 3LW5J 1S3JA 4AYCA 1M1JA 4PJ0H 3KHUA 2BCCE 5TJHA 1KTMA 1FDOA 1VF5D 3TGUD 3L75E 1SQPG 2KXPB 4L76A 4D6TE 2WMMA 1HJ0A 2HG5D 3B71A 3FWNA 4H44D 1KN7A 1RE4A 3NXSA 4JQ0D 1NU1K 3UIAA 1GTWA 1RF1B 2OTKE 4CPGA 3H1JD 1JY3P 5CCGC 3CC4P 2GUSA 4NPFX 3FX0A 2E74B 2WPRA 1BGYE 1NJIQ 1PP9E 3PJSK 2R44A 2A06E 2WITA 2Y0CA 3H1KG 3L70J 2Y9ZA 2M0BA 1PGQA 1USDA 3O8ZA 5KJ7C 3IAOA 1SFCD 3P8MC 2JR8A 3BCCD 1HGVA 2D2CC 4PV1C 2ZAEB 4U7JA 1LT1A 3P8CD 1NOHA 4PJ0E 3L72G 4XA4A 1SP4A 1JY3N 2M3BA 3RK3E 1X9VA 1M90Q 1SQQK 3L71D 2K9JA 2KIKA 3W68A 1CI6B 1ZP0C 5APTA 3H1IG 2WVRA 1NO4A 3KPEA 1SQXK 5CCHD 1SQVK 3L70G 3AECC 2Z5HA 1S9KE 3H1LG 5DJTB 1DH3A 1AV1A 2VRSA 1EXJA 2Q9IA 1HWTC 1OIPA 3MHVA 3MP7B 1IFIA 1KYOD 5APSA 1EZVE 2NPSB 1MFTA 1DEEG 5BU5A 3FXEA 1LP1B 2H89C 3WUUA 5KLVK 1NH4A 1YJWP 4DCKA 1UIXA 3A5TA 2P1JA 1KB9E 2WQYC 1GL2D 1MFZA 1KORA 2E75C 1OW7A 1YTZT 3AE1C 1FE6A 1KV4A 1PZQA 1AVOA 4BXLA 3AE6C 1JY2O 1M56D 1M1KQ 1NTMD 3HUSB 5AVYB 1M1JB 2K88A 4XE5B 2AEFA 2R3SA 1GW4A 1EDIA 3E7KA 2W6JH 4K3AA 5M1BA 3E1RA 1SFCA 3L37A 1KFNA 3M9BA 3TGUG 3Q3DA 1CZQA 4M3LA 2NRGA 1BCCD 4YXWH 2L5GB 1URQB 3SFEC 2RH0A 4GODA 2Q1KA 2Z4EA 3V2QA 1L0LE 2W8ZA 1YIJP 1NTZJ 2CPBA 4GT1A 1RF0C 2QEXP 3L35A 1YITP 1LWUC 2Z5IA 2AEMA 2OYOA 1NU1J 2WSFH 2WZ7A 1FAVA 3RBXA 3AE2C 1P84I 1S1CX 3H1HD 2HR3A 1LTJC 2E74D 2QJKB 3CWBJ 3CCVP 5CCHA 2QIWA 2IBZG 2HODA 1NTKJ 3IN6A 2A45G 1SQBE 3F89A 3CCJP 2WSCJ 1N2DC 4ASWA 1EQ7A 4EDFA 2OYIC 2K9JB 4GDOA 2WT7B 2HFED 2YO3A 1VQKP 1U7MA 1NTZG 3P32A 1KILE 2KLVA 2E5TA 1WMKA 1IK9A 5E79H 1H0TA 2WWWA 2FYUD 1SQQJ 4DJGA 2FFDA 1LNQA 2WTYA 1GL2A 2QM7A 5AW4B 1L0ND 1K9MQ 4IFDK 1SQXJ 2IPPA 1SQVJ 2B88A 1VQPP 3PRJA 4N78D 1U57A 3H25A 2XKMA 3G3ZA 5AW9B 1ZLLA 1NTKG 2W90A 1LTAC 4N6JA 4W7ZA 1KC8Q 1K73Q 1VF5B 1LWUA 1VQMP 3OAKA 3MZWB 3CMAP 3AEAC 1RH5B 2NPSD 4UB6H 2H8PD 2M8RA 1K05A 2WSEH 5KLVJ 1N7SC 2O01H 1AJYA 4R4LA 1NHLA 4H13C 3FXDA 3RK3C 1HH0A 1ZW0A 2FXMA 3CD6P 2QJYC 4L73A 2I1KA 5GTIH 1X8YA 3RGUA 3PHLA 4WB4A 2BCCJ 1NTMG 2FYNC 1RF1A 2YKOA 1KYOH 3CCUP 2C0WA 3L75J 5AVRB 2IYOA 2YKPA 2P58A 2ZYDA 1MUUA 2J59M 3P8CE 4TLFA 4D6TJ 3V4WA 1L0LK 2H88C 1AA0A 1P84D 3M0DC 3L74G 1JB0J 1Q2NA 4GOFA 4QMAA 3S9OA 3L71E 1ZV8A 5B5EE 3VMZA 1L2PA 2LKMA 5KLVG 2IZ1A 3LIDA 3Q5PA 3IF4A 1FDIA 3HD7C 3L72D 5KAFE 1LTBC 1PP9J 1VL2A 2Y0DA 1URQD 3U59A 5C39A 1R8EA 1J1DC 4IOIH 3E1IA 4HJGH 4H0LC 3H1ID 5GTIE 1ZMEC 1SQBK 2BCCG 1CI6A 1T6AA 4L74A 3V4QA 3MD0A 5APXA 2A45I 2HODB 4D6TG 3RBZA 3AEFC 2E75B 3L70D 3OJAB 1FJKA 1N7SA 5AVWB 3H1LD 3AE4C 5CJ0A 4JBZA 2B87A 1YJNP 2WPVB 1FS0E 1SS1A 4ZKPA 1PPJE 1JY2P 4C7NB 5BVZA 1H0TB 4LC1A 4AUWA 3EFGA 2FFDB 1T2KD 2A06G 3T97B 1HF9A 1H89A 2W6AA 1BDCA 1LT9C 4U3FG 1RY3A 2W83C 1IC2A 4HKZH 1JNMA 2HYNA 3CX5I 1QL2A 2ZT9C 1VQ4P 3N7NA 3USSA 1DD3A 3CCRP 1JY2N 2KK7A 1LTIC 1BE3J 2Y9YA 3D71A 4HYTB 1LWUB 5AVZB 3D70A 1Y8AA 5CJ4A 2I1JA 1IFPA 3L73E 5CCGD 1OX3A 2YMYA 2L91A 4EOTA 2YXQB 3JCUH 4RJTA 1K04A 2AXTH 2PAJA 1PL5A 2K37A 3BASA 3CXHE 2ZXXA 3AEGC 5AW0B 1DIPA 3NMDA 1M8OB 5KJ7D 1KILC 3H1HE 2KOGA 1URQA 3VP9A 2AEJA 2OYIB 4PV1D 2YMKA 1OMIA 3LIEA 2OGUA 1ZRTE 1M7LA 1BE3G 1NGMB 4WBAA 1OXZA 1G1IA 1ZN5A 3V2RA 4PD4H 1YQ3C 2CPSA 1Q82Q 2XU6A 3TSIA 1L0LJ 1VQNP 2E76C 2IBZD 1GU5A 1YJ9P 1LT9A 4TT3H 4RESB 1CSBA 3JCUE 1KFMA 1L0NE 1KZUB 1NTZD 3RK2C 5AW3B 4IL6H 2WT7A 2GM4A 2IZ0A 3TF5A 2KZIA 4YPCA 2WPQA 4WY4A 4C46A 1NU1D 4N78E 3V2PA 1SQBJ 1S2EA 1P84H 1N7SB 1NWQA 1W5CE 2KP8A 1FJPA 4H13B 2B87B 3EFFK 2QJYB 3C8VA 4PD4E 2E75D 2ITAA 2IDBA 3CX5D 1VQ9P 1NTKD 2PGDA 3GHGC 2J5UA 2QJPC 1SQPE 2BASA 3B5NC 4EYYQ 3ITKA 1OFCX 5CCGA 4JF7A 1OVUA 4OVNF 2OTJP 1ZXGA 2RKLA 1L4AC 2C0XA 1X0TA 5AW5B 1LJ2A 2KSJA 4IFMA 1FZCC 4IL6E 3SFDC 2IFNA 5KJ7A 3CLQA 2XV5A 2LXBA 3H1KE 1SQXD 5KAIH 1SQVD 3I5CA 2FXPA 1Q90D 1HVVA 3G6EP 3A0BH 4I2LC 2JJLA 1KQLA 2QVAA 1FDMA 1JO5A 3N4XA 1E79H 3F5HA 5B66H 5L8RJ 3D6YA 3C9IA 3L72E 4BWNA 1G2CB 2W27A 3L74D 4I6MC 3ABVC 4GIFA 1FBMA 1NAFA 5AVUB 5KLVD 4AQRD 2ZYAA 3H1IE 2LR2A 2K9YA 4UB8H 1LTGC 3CCLP 1ZR2A 1EZVI 1QL1A 1EDKA 4ASVA 4Y99B 2KB7P 2R5BA 1KB9I 5KKZB 3H1LE 1OVVA 2KLUA 5K5GB 2BCCD 2FYUK 2KNCA 3L71J 1FU1A 2FXOA 5KAIE 3AE8C 3C1LA 5AVSB 2O1KA 2GUVA 1L0NK 1LT9B 1N73C 3EQ2A 3A0BE 3FGAD 3AE3C 4D6TD 1L4AA 1LTTC 1EC5A 3CMEP 1QVGO 1EDLA 2ZT9B 1MKMA 2V4HA 1NKNA 1NYHA 2SPZA 3M9HA 1JUNA 1Q81Q 2XZRA 3IR9A 1OW8A 2NZ2A 1IO4A 1PP9D 4WY4B 4C7NA 3Q2YA 4DT0A 1VQOP 1IK7A 2A06D 3MGNA 1YQ4C 4L75A 2KSEA 1NU1G 3GW6A 4RO0A 1G1JA 2R5DA 4U3FD 3T97A 3S1KA 2E5YA 1SQPK 3WUTA 3O6QB 3CWBG 5GTHH 5APUA 1N7SD 1DEBA 2C9NY 1KILB 2A45H 4H13D 3RK3D 3BRTB 1H88A 1N7LA 5TISH 2FY8A 3TGUE 5DJUB 1RF0A 5AW8B 3CI9A 1VPCA 1X79B 1EXIA 1NVOA 2AXCA 4I1LA 2K3RA 1UIIA 2BEQD 2ZJSE 3SSUA 2JWAA 1K8AQ 1VQ7P 3HTKA 1LTJA 1SQQG 3H1JE 3WUVA 2OYHC 2E76B 5E79E 1HGZA 2HPCB 2D2CB 3QWOC 4PV1B 1JM0A 1FZAA 2XNXA 1PPJG 1SQXG 5KLIC 3L73J 3CX5H 1J2JB 1SQVG 2P67A 4JPZB 4OGQC 2WSCH 1FOSE 3HD7D 3RK2B 5GTHE 2IBZE 2OYIA 1BE3D 3BCCE 1MZ9A 1X22A 1KB9D 1NAYA 4H0LD 2E42A 5TISE 3H1HJ 1NTZE 3CL3D 2R32A 1YHQP 1W2BO 4MN4C 4UB6E 1BGYJ 2MKVA 1M57D 4IL6X 2QJPB 1TU3F 3B5NB 2P2UA 2KNCB 1W2EA 2V7QJ 5AW2B 1OW6A 1JOCA 1GDTA 2QM8A 3TNUB 1L4AB 3M9QA 2Q3IA 4YXDC 1KQSO 1NTKE 3L75G 3HUSC 1VQLP 4ZMDA 4C7RA 1KYOE 1FZCB 2Q7CA 2POHA 1L0NJ 5KTBA 4W7YA 2H43A 4EIJA 2J58A 3B8EB 4N3YB 1XTGB 2ZT9D 5H2FH 3TK1A 1GU4A 1RE4C 1BGYG 1PP9G 1HUCA 3BRVB 2M5AA 3VP8A 2Q6QA 1GK4A 4WY4D 4JYBA 2QRXA 4W80A 2C9LY 3AE5C 1KD1Q 3M0DA 1NTME 3VMXA 4GKGA 2Y0EA 1SQBD 2IYPA 5AW6B 1SQPJ 1HJBA 3RL0C 1IFJA 3L74E 1KILD 3HD7A 5EFWB 1IFNA 3FWLA 1BCCE 3KZIH 3R4YA 2PRRA 3GG2A 4Y28J 3CCMP 3HTKB 1LTJB 2RN0A 2CK3H 2QA4P 3AE9C 4YTPC 1G2CA 2N9YB 1QLED 3H1KJ 3QH9A 4OH8B 4XFJA 1RE3C 1ZR4A 2E76D 1Z56A 2D2CD 3KDPB 2N1TC 1U7JA 3L72J 1T3UA 1EZVG 1NTZK 3SWKA 1IZNB 3PTZA 1JMBA 3RK2D 2YIUC 3H1IJ 3V6IA 1HBWA 3KZIE 1VF5C 2YNYA 3CCEP 2H7HA 2FYUE 3CC2P 4KHXA 1Q86Q 1FZEA 3H1LJ 2AXTE 1NTKK 4H44C 4U3FE 2B89A 3M06A 2UWJE 4DZOA 2O3JA 5APYA 2RMZA 1JMMA 3CXHI 1N86A 3VYIA 3B5ND 4O9BA 3GF7A 1KB9H 4EI2A 5APVA 1GW3A 4JYCA 3LW5H 2OYHB 2KS1B 1L4AD 3RK3B 3CWBD 1JEKA 1SFCC 1L0LG 5AVTB 3O6QA 2W6BA 5APQA 4K35A 3KQGA 1RE3A 2KUBA 1KILA 5KLIB 3Q1MA 1RHZB 2M5AB 3KXDA 4OGQB 2G3AA 2FYNB 1NTMK 3M91A 5AVVB 3HE5B 3G9RA 2N1TA 3BVHA 1PV3A 3L36A 3L4FA 2WSFJ 5BU8B 1FZFA 1PGPA 1GK6A 4NPEA 2O1JA 3B4SA 1SQQD 2Q5UA 3MUDC 5AW1B 1T8ZA 2FYZA 1YYCA 1S5LH 1S4XA 2ZVOB 1QEXA 4B86A 3M0AA 1BE3E 1SQBG 1CW5A 4I7ZC 3TGUJ 5CCHC 1PPJD 3HD7B 2HPCA 1P84E 3GF3A 3AEDC 1R5LA 3A3YB 2N9BA 1J1DB 2P7JA 4H0LB 3H1JJ 3W67A 3JC22 2KYVA 1OVRA 3R2PA 4PD4I 2K1AA 2LXCB 3G4SP 2FFDC 1J1EC 1GMJA 1GL2C 2JDIH 1N8RQ 3BATA 3CCSP 3A0HH 3S4RA 1PGOA 1FZGA 3BCCJ 1FOSF 2JKVA 1S5LE 3Q5SA 2E43A 3CPWO 3ZDMA 4Z1MH 3GHGA 3L70E 3L73D 1BDDA 3VOPA 3B5NA 2FBWC 3AEEC 1RQVA 4ZKUA 3H1JG 1YI2P 3L75D 3CXHD 1XTCC 3TNUA 3SWFA 2WSEJ 2O01J 1PFIA 3MUDA 3NFQA 1WT6A 4KJMA 1SVFA 1FZCA 5B66E 2YO2A 3RL0B 2ZFCA 3WU2H 3Q5RA
chains in the Genus database with same CATH topology
1L0NJ 1KYOI 4U3FJ 1SQPJ 3L70J 4PD4I 1SQBJ 1NU1J 3H1LJ 3L75J 1SQXJ 3H1IJ 3L74J 1KB9I 2IBZI 4D6TJ 1P84I 1NTKJ 1BE3J 1SQVJ 1L0LJ 1SQQJ 1PP9J 1BCCJ 1BGYJ 1NTMJ 3H1JJ 3L72J 3L71J 3H1KJ 2FYUJ 3L73J 3TGUJ 5KLVJ 3H1HJ 1NTZJ 3CXHI 1EZVI 3CX5I 3CWBJ 2BCCJ 3BCCJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0N J;  1KYO I;  4U3F J;  1SQP J;  3L70 J;  4PD4 I;  1SQB J;  1NU1 J;  3H1L J;  3L75 J;  1SQX J;  3H1I J;  3L74 J;  1KB9 I;  2IBZ I;  4D6T J;  1P84 I;  1NTK J;  1BE3 J;  1SQV J;  1L0L J;  1SQQ J;  1PP9 J;  1BCC J;  1BGY J;  1NTM J;  3H1J J;  3L72 J;  3L71 J;  3H1K J;  2FYU J;  3L73 J;  3TGU J;  5KLV J;  3H1H J;  1NTZ J;  3CXH I;  1EZV I;  3CX5 I;  3CWB J;  2BCC J;  3BCC J; 
#chains in the Genus database with same CATH topology
 1YTZ I;  1ZRT D;  4RKU J;  5CMZ A;  3CC7 P;  1BGY D;  3BCC G;  1QX8 A;  3HE4 A;  4UB8 E;  1ZOY C;  3A0H E;  4LLH A;  5APW A;  1QVF O;  1JCD A;  4BRY A;  1RF1 C;  5AW7 B;  1JY3 O;  1KMI Z;  2WPS A;  1Y9B A;  3L71 G;  3EWK A;  2E74 C;  1D7M A;  2ZXE B;  4OWF A;  3MTU E;  2QSI A;  4WVZ A;  2HLO A;  3MIW A;  3OA7 A;  3JSV C;  1JTH A;  4A7P A;  2GA1 A;  4DOJ A;  1EDJ A;  2N1T B;  4HB1 A;  1PIX A;  1Y47 A;  3A7O A;  1QGK B;  3PH0 A;  3VMY A;  5CBO A;  2JO1 A;  4LGD E;  1NTM J;  4NPD A;  4OGQ D;  3V5B A;  2FKW B;  3AEB C;  1AQT A;  3WU2 E;  1MV8 A;  2YIU B;  1YBK A;  1IJD B;  2JEE A;  1IFD A;  1KQG B;  1PGJ A;  1S9K D;  3PLN A;  5B5E H;  4GOE A;  1GD2 E;  3H32 A;  1N73 A;  3L74 J;  2PFX A;  4PD4 D;  5AVX B;  1BCC J;  5KAF H;  1KQF B;  1VQ5 P;  3VN0 A;  1Q7Y Q;  2QE7 H;  2ZYG A;  4H44 B;  1SQP D;  4WWI A;  3D6Z A;  2BEZ F;  1EZV D;  3VMA A;  1LTS C;  5CBN A;  1OWA A;  1FZB A;  3GMA A;  1AFO A;  2YKQ A;  3HRN A;  2G8Y A;  2DW3 A;  3H6P A;  2NPS C;  1T3J A;  2KI7 B;  1SFC B;  1VQ8 P;  3II6 A;  3H1K D;  1NU1 E;  1AVY A;  1HTL C;  2OAR A;  3GHG B;  1BCC G;  2YXR B;  1AQ5 A;  3VTP C;  1BSN A;  3L73 G;  3CWB E;  2OTL P;  3K5B A;  3CX5 E;  3AE7 C;  1WRG A;  2FYU J;  1SLQ A;  5CHX A;  1M1J C;  1GZL A;  1FC2 C;  2M3E A;  1JCC A;  4U3F J;  1BSH A;  3H1H G;  1L0L D;  3KYQ A;  4I7Z B;  1R5S A;  1OZH A;  2KS1 A;  2OYH A;  1RQU A;  2IBZ I;  1IFM A;  3PP5 A;  3TYY A;  2I8D A;  3U1A A;  1SQQ E;  3A2A A;  3HE4 B;  3V2N A;  3RL0 D;  1DX7 A;  3U1C A;  1URQ C;  3RL0 g;  4BRY B;  3OW2 O;  1VDF A;  5AVQ B;  1DD4 A;  3HE5 A;  3I55 P;  2KZJ A;  1SQX E;  1S5L X;  4Y99 C;  1E5W A;  1VQ6 P;  2XDJ A;  1SQV E;  3CXH H;  4IFF A;  1USE A;  5KKZ C;  2OQQ A;  1J1E B;  4R4M A;  3P7K A;  2FYU G;  1GL2 B;  2Q3E A;  3CCQ P;  1JTH B;  4ZNC A;  1A02 J;  2WSS H;  2NPS A;  2QJK C;  1NKZ B;  3TDK A;  1LP1 A;  2P10 A;  2MJZ A;  3G71 P;  1A02 F;  1L0N G;  2ZVN B;  1LGH B;  3NTN A;  2IFM A;  2JP3 A;  2XND H;  2R3C A;  3IFM A;  1S72 P;  2QG4 A;  5KLV E;  1KYO I;  2N1T D;  2IX7 C;  2JWD A;  3I56 P;  1T2K C;  4KT0 J;  3WMM 0;  2V7Q H;  2PP6 A;  2O01 N;  5H2F E;  2B9B A;  3H32 B;  1N73 B;  4WY4 C;  3GLM A;  4HH2 A;  3SWY A;  3HUS A;  1H8A A;  3LW5 J;  1S3J A;  4AYC A;  1M1J A;  4PJ0 H;  3KHU A;  2BCC E;  5TJH A;  1KTM A;  1FDO A;  1VF5 D;  3TGU D;  3L75 E;  1SQP G;  2KXP B;  4L76 A;  4D6T E;  2WMM A;  1HJ0 A;  2HG5 D;  3B71 A;  3FWN A;  4H44 D;  1KN7 A;  1RE4 A;  3NXS A;  4JQ0 D;  1NU1 K;  3UIA A;  1GTW A;  1RF1 B;  2OTK E;  4CPG A;  3H1J D;  1JY3 P;  5CCG C;  3CC4 P;  2GUS A;  4NPF X;  3FX0 A;  2E74 B;  2WPR A;  1BGY E;  1NJI Q;  1PP9 E;  3PJS K;  2R44 A;  2A06 E;  2WIT A;  2Y0C A;  3H1K G;  3L70 J;  2Y9Z A;  2M0B A;  1PGQ A;  1USD A;  3O8Z A;  5KJ7 C;  3IAO A;  1SFC D;  3P8M C;  2JR8 A;  3BCC D;  1HGV A;  2D2C C;  4PV1 C;  2ZAE B;  4U7J A;  1LT1 A;  3P8C D;  1NOH A;  4PJ0 E;  3L72 G;  4XA4 A;  1SP4 A;  1JY3 N;  2M3B A;  3RK3 E;  1X9V A;  1M90 Q;  1SQQ K;  3L71 D;  2K9J A;  2KIK A;  3W68 A;  1CI6 B;  1ZP0 C;  5APT A;  3H1I G;  2WVR A;  1NO4 A;  3KPE A;  1SQX K;  5CCH D;  1SQV K;  3L70 G;  3AEC C;  2Z5H A;  1S9K E;  3H1L G;  5DJT B;  1DH3 A;  1AV1 A;  2VRS A;  1EXJ A;  2Q9I A;  1HWT C;  1OIP A;  3MHV A;  3MP7 B;  1IFI A;  1KYO D;  5APS A;  1EZV E;  2NPS B;  1MFT A;  1DEE G;  5BU5 A;  3FXE A;  1LP1 B;  2H89 C;  3WUU A;  5KLV K;  1NH4 A;  1YJW P;  4DCK A;  1UIX A;  3A5T A;  2P1J A;  1KB9 E;  2WQY C;  1GL2 D;  1MFZ A;  1KOR A;  2E75 C;  1OW7 A;  1YTZ T;  3AE1 C;  1FE6 A;  1KV4 A;  1PZQ A;  1AVO A;  4BXL A;  3AE6 C;  1JY2 O;  1M56 D;  1M1K Q;  1NTM D;  3HUS B;  5AVY B;  1M1J B;  2K88 A;  4XE5 B;  2AEF A;  2R3S A;  1GW4 A;  1EDI A;  3E7K A;  2W6J H;  4K3A A;  5M1B A;  3E1R A;  1SFC A;  3L37 A;  1KFN A;  3M9B A;  3TGU G;  3Q3D A;  1CZQ A;  4M3L A;  2NRG A;  1BCC D;  4YXW H;  2L5G B;  1URQ B;  3SFE C;  2RH0 A;  4GOD A;  2Q1K A;  2Z4E A;  3V2Q A;  1L0L E;  2W8Z A;  1YIJ P;  1NTZ J;  2CPB A;  4GT1 A;  1RF0 C;  2QEX P;  3L35 A;  1YIT P;  1LWU C;  2Z5I A;  2AEM A;  2OYO A;  1NU1 J;  2WSF H;  2WZ7 A;  1FAV A;  3RBX A;  3AE2 C;  1P84 I;  1S1C X;  3H1H D;  2HR3 A;  1LTJ C;  2E74 D;  2QJK B;  3CWB J;  3CCV P;  5CCH A;  2QIW A;  2IBZ G;  2HOD A;  1NTK J;  3IN6 A;  2A45 G;  1SQB E;  3F89 A;  3CCJ P;  2WSC J;  1N2D C;  4ASW A;  1EQ7 A;  4EDF A;  2OYI C;  2K9J B;  4GDO A;  2WT7 B;  2HFE D;  2YO3 A;  1VQK P;  1U7M A;  1NTZ G;  3P32 A;  1KIL E;  2KLV A;  2E5T A;  1WMK A;  1IK9 A;  5E79 H;  1H0T A;  2WWW A;  2FYU D;  1SQQ J;  4DJG A;  2FFD A;  1LNQ A;  2WTY A;  1GL2 A;  2QM7 A;  5AW4 B;  1L0N D;  1K9M Q;  4IFD K;  1SQX J;  2IPP A;  1SQV J;  2B88 A;  1VQP P;  3PRJ A;  4N78 D;  1U57 A;  3H25 A;  2XKM A;  3G3Z A;  5AW9 B;  1ZLL A;  1NTK G;  2W90 A;  1LTA C;  4N6J A;  4W7Z A;  1KC8 Q;  1K73 Q;  1VF5 B;  1LWU A;  1VQM P;  3OAK A;  3MZW B;  3CMA P;  3AEA C;  1RH5 B;  2NPS D;  4UB6 H;  2H8P D;  2M8R A;  1K05 A;  2WSE H;  5KLV J;  1N7S C;  2O01 H;  1AJY A;  4R4L A;  1NHL A;  4H13 C;  3FXD A;  3RK3 C;  1HH0 A;  1ZW0 A;  2FXM A;  3CD6 P;  2QJY C;  4L73 A;  2I1K A;  5GTI H;  1X8Y A;  3RGU A;  3PHL A;  4WB4 A;  2BCC J;  1NTM G;  2FYN C;  1RF1 A;  2YKO A;  1KYO H;  3CCU P;  2C0W A;  3L75 J;  5AVR B;  2IYO A;  2YKP A;  2P58 A;  2ZYD A;  1MUU A;  2J59 M;  3P8C E;  4TLF A;  4D6T J;  3V4W A;  1L0L K;  2H88 C;  1AA0 A;  1P84 D;  3M0D C;  3L74 G;  1JB0 J;  1Q2N A;  4GOF A;  4QMA A;  3S9O A;  3L71 E;  1ZV8 A;  5B5E E;  3VMZ A;  1L2P A;  2LKM A;  5KLV G;  2IZ1 A;  3LID A;  3Q5P A;  3IF4 A;  1FDI A;  3HD7 C;  3L72 D;  5KAF E;  1LTB C;  1PP9 J;  1VL2 A;  2Y0D A;  1URQ D;  3U59 A;  5C39 A;  1R8E A;  1J1D C;  4IOI H;  3E1I A;  4HJG H;  4H0L C;  3H1I D;  5GTI E;  1ZME C;  1SQB K;  2BCC G;  1CI6 A;  1T6A A;  4L74 A;  3V4Q A;  3MD0 A;  5APX A;  2A45 I;  2HOD B;  4D6T G;  3RBZ A;  3AEF C;  2E75 B;  3L70 D;  3OJA B;  1FJK A;  1N7S A;  5AVW B;  3H1L D;  3AE4 C;  5CJ0 A;  4JBZ A;  2B87 A;  1YJN P;  2WPV B;  1FS0 E;  1SS1 A;  4ZKP A;  1PPJ E;  1JY2 P;  4C7N B;  5BVZ A;  1H0T B;  4LC1 A;  4AUW A;  3EFG A;  2FFD B;  1T2K D;  2A06 G;  3T97 B;  1HF9 A;  1H89 A;  2W6A A;  1BDC A;  1LT9 C;  4U3F G;  1RY3 A;  2W83 C;  1IC2 A;  4HKZ H;  1JNM A;  2HYN A;  3CX5 I;  1QL2 A;  2ZT9 C;  1VQ4 P;  3N7N A;  3USS A;  1DD3 A;  3CCR P;  1JY2 N;  2KK7 A;  1LTI C;  1BE3 J;  2Y9Y A;  3D71 A;  4HYT B;  1LWU B;  5AVZ B;  3D70 A;  1Y8A A;  5CJ4 A;  2I1J A;  1IFP A;  3L73 E;  5CCG D;  1OX3 A;  2YMY A;  2L91 A;  4EOT A;  2YXQ B;  3JCU H;  4RJT A;  1K04 A;  2AXT H;  2PAJ A;  1PL5 A;  2K37 A;  3BAS A;  3CXH E;  2ZXX A;  3AEG C;  5AW0 B;  1DIP A;  3NMD A;  1M8O B;  5KJ7 D;  1KIL C;  3H1H E;  2KOG A;  1URQ A;  3VP9 A;  2AEJ A;  2OYI B;  4PV1 D;  2YMK A;  1OMI A;  3LIE A;  2OGU A;  1ZRT E;  1M7L A;  1BE3 G;  1NGM B;  4WBA A;  1OXZ A;  1G1I A;  1ZN5 A;  3V2R A;  4PD4 H;  1YQ3 C;  2CPS A;  1Q82 Q;  2XU6 A;  3TSI A;  1L0L J;  1VQN P;  2E76 C;  2IBZ D;  1GU5 A;  1YJ9 P;  1LT9 A;  4TT3 H;  4RES B;  1CSB A;  3JCU E;  1KFM A;  1L0N E;  1KZU B;  1NTZ D;  3RK2 C;  5AW3 B;  4IL6 H;  2WT7 A;  2GM4 A;  2IZ0 A;  3TF5 A;  2KZI A;  4YPC A;  2WPQ A;  4WY4 A;  4C46 A;  1NU1 D;  4N78 E;  3V2P A;  1SQB J;  1S2E A;  1P84 H;  1N7S B;  1NWQ A;  1W5C E;  2KP8 A;  1FJP A;  4H13 B;  2B87 B;  3EFF K;  2QJY B;  3C8V A;  4PD4 E;  2E75 D;  2ITA A;  2IDB A;  3CX5 D;  1VQ9 P;  1NTK D;  2PGD A;  3GHG C;  2J5U A;  2QJP C;  1SQP E;  2BAS A;  3B5N C;  4EYY Q;  3ITK A;  1OFC X;  5CCG A;  4JF7 A;  1OVU A;  4OVN F;  2OTJ P;  1ZXG A;  2RKL A;  1L4A C;  2C0X A;  1X0T A;  5AW5 B;  1LJ2 A;  2KSJ A;  4IFM A;  1FZC C;  4IL6 E;  3SFD C;  2IFN A;  5KJ7 A;  3CLQ A;  2XV5 A;  2LXB A;  3H1K E;  1SQX D;  5KAI H;  1SQV D;  3I5C A;  2FXP A;  1Q90 D;  1HVV A;  3G6E P;  3A0B H;  4I2L C;  2JJL A;  1KQL A;  2QVA A;  1FDM A;  1JO5 A;  3N4X A;  1E79 H;  3F5H A;  5B66 H;  5L8R J;  3D6Y A;  3C9I A;  3L72 E;  4BWN A;  1G2C B;  2W27 A;  3L74 D;  4I6M C;  3ABV C;  4GIF A;  1FBM A;  1NAF A;  5AVU B;  5KLV D;  4AQR D;  2ZYA A;  3H1I E;  2LR2 A;  2K9Y A;  4UB8 H;  1LTG C;  3CCL P;  1ZR2 A;  1EZV I;  1QL1 A;  1EDK A;  4ASV A;  4Y99 B;  2KB7 P;  2R5B A;  1KB9 I;  5KKZ B;  3H1L E;  1OVV A;  2KLU A;  5K5G B;  2BCC D;  2FYU K;  2KNC A;  3L71 J;  1FU1 A;  2FXO A;  5KAI E;  3AE8 C;  3C1L A;  5AVS B;  2O1K A;  2GUV A;  1L0N K;  1LT9 B;  1N73 C;  3EQ2 A;  3A0B E;  3FGA D;  3AE3 C;  4D6T D;  1L4A A;  1LTT C;  1EC5 A;  3CME P;  1QVG O;  1EDL A;  2ZT9 B;  1MKM A;  2V4H A;  1NKN A;  1NYH A;  2SPZ A;  3M9H A;  1JUN A;  1Q81 Q;  2XZR A;  3IR9 A;  1OW8 A;  2NZ2 A;  1IO4 A;  1PP9 D;  4WY4 B;  4C7N A;  3Q2Y A;  4DT0 A;  1VQO P;  1IK7 A;  2A06 D;  3MGN A;  1YQ4 C;  4L75 A;  2KSE A;  1NU1 G;  3GW6 A;  4RO0 A;  1G1J A;  2R5D A;  4U3F D;  3T97 A;  3S1K A;  2E5Y A;  1SQP K;  3WUT A;  3O6Q B;  3CWB G;  5GTH H;  5APU A;  1N7S D;  1DEB A;  2C9N Y;  1KIL B;  2A45 H;  4H13 D;  3RK3 D;  3BRT B;  1H88 A;  1N7L A;  5TIS H;  2FY8 A;  3TGU E;  5DJU B;  1RF0 A;  5AW8 B;  3CI9 A;  1VPC A;  1X79 B;  1EXI A;  1NVO A;  2AXC A;  4I1L A;  2K3R A;  1UII A;  2BEQ D;  2ZJS E;  3SSU A;  2JWA A;  1K8A Q;  1VQ7 P;  3HTK A;  1LTJ A;  1SQQ G;  3H1J E;  3WUV A;  2OYH C;  2E76 B;  5E79 E;  1HGZ A;  2HPC B;  2D2C B;  3QWO C;  4PV1 B;  1JM0 A;  1FZA A;  2XNX A;  1PPJ G;  1SQX G;  5KLI C;  3L73 J;  3CX5 H;  1J2J B;  1SQV G;  2P67 A;  4JPZ B;  4OGQ C;  2WSC H;  1FOS E;  3HD7 D;  3RK2 B;  5GTH E;  2IBZ E;  2OYI A;  1BE3 D;  3BCC E;  1MZ9 A;  1X22 A;  1KB9 D;  1NAY A;  4H0L D;  2E42 A;  5TIS E;  3H1H J;  1NTZ E;  3CL3 D;  2R32 A;  1YHQ P;  1W2B O;  4MN4 C;  4UB6 E;  1BGY J;  2MKV A;  1M57 D;  4IL6 X;  2QJP B;  1TU3 F;  3B5N B;  2P2U A;  2KNC B;  1W2E A;  2V7Q J;  5AW2 B;  1OW6 A;  1JOC A;  1GDT A;  2QM8 A;  3TNU B;  1L4A B;  3M9Q A;  2Q3I A;  4YXD C;  1KQS O;  1NTK E;  3L75 G;  3HUS C;  1VQL P;  4ZMD A;  4C7R A;  1KYO E;  1FZC B;  2Q7C A;  2POH A;  1L0N J;  5KTB A;  4W7Y A;  2H43 A;  4EIJ A;  2J58 A;  3B8E B;  4N3Y B;  1XTG B;  2ZT9 D;  5H2F H;  3TK1 A;  1GU4 A;  1RE4 C;  1BGY G;  1PP9 G;  1HUC A;  3BRV B;  2M5A A;  3VP8 A;  2Q6Q A;  1GK4 A;  4WY4 D;  4JYB A;  2QRX A;  4W80 A;  2C9L Y;  3AE5 C;  1KD1 Q;  3M0D A;  1NTM E;  3VMX A;  4GKG A;  2Y0E A;  1SQB D;  2IYP A;  5AW6 B;  1SQP J;  1HJB A;  3RL0 C;  1IFJ A;  3L74 E;  1KIL D;  3HD7 A;  5EFW B;  1IFN A;  3FWL A;  1BCC E;  3KZI H;  3R4Y A;  2PRR A;  3GG2 A;  4Y28 J;  3CCM P;  3HTK B;  1LTJ B;  2RN0 A;  2CK3 H;  2QA4 P;  3AE9 C;  4YTP C;  1G2C A;  2N9Y B;  1QLE D;  3H1K J;  3QH9 A;  4OH8 B;  4XFJ A;  1RE3 C;  1ZR4 A;  2E76 D;  1Z56 A;  2D2C D;  3KDP B;  2N1T C;  1U7J A;  3L72 J;  1T3U A;  1EZV G;  1NTZ K;  3SWK A;  1IZN B;  3PTZ A;  1JMB A;  3RK2 D;  2YIU C;  3H1I J;  3V6I A;  1HBW A;  3KZI E;  1VF5 C;  2YNY A;  3CCE P;  2H7H A;  2FYU E;  3CC2 P;  4KHX A;  1Q86 Q;  1FZE A;  3H1L J;  2AXT E;  1NTK K;  4H44 C;  4U3F E;  2B89 A;  3M06 A;  2UWJ E;  4DZO A;  2O3J A;  5APY A;  2RMZ A;  1JMM A;  3CXH I;  1N86 A;  3VYI A;  3B5N D;  4O9B A;  3GF7 A;  1KB9 H;  4EI2 A;  5APV A;  1GW3 A;  4JYC A;  3LW5 H;  2OYH B;  2KS1 B;  1L4A D;  3RK3 B;  3CWB D;  1JEK A;  1SFC C;  1L0L G;  5AVT B;  3O6Q A;  2W6B A;  5APQ A;  4K35 A;  3KQG A;  1RE3 A;  2KUB A;  1KIL A;  5KLI B;  3Q1M A;  1RHZ B;  2M5A B;  3KXD A;  4OGQ B;  2G3A A;  2FYN B;  1NTM K;  3M91 A;  5AVV B;  3HE5 B;  3G9R A;  2N1T A;  3BVH A;  1PV3 A;  3L36 A;  3L4F A;  2WSF J;  5BU8 B;  1FZF A;  1PGP A;  1GK6 A;  4NPE A;  2O1J A;  3B4S A;  1SQQ D;  2Q5U A;  3MUD C;  5AW1 B;  1T8Z A;  2FYZ A;  1YYC A;  1S5L H;  1S4X A;  2ZVO B;  1QEX A;  4B86 A;  3M0A A;  1BE3 E;  1SQB G;  1CW5 A;  4I7Z C;  3TGU J;  5CCH C;  1PPJ D;  3HD7 B;  2HPC A;  1P84 E;  3GF3 A;  3AED C;  1R5L A;  3A3Y B;  2N9B A;  1J1D B;  2P7J A;  4H0L B;  3H1J J;  3W67 A;  3JC2 2;  2KYV A;  1OVR A;  3R2P A;  4PD4 I;  2K1A A;  2LXC B;  3G4S P;  2FFD C;  1J1E C;  1GMJ A;  1GL2 C;  2JDI H;  1N8R Q;  3BAT A;  3CCS P;  3A0H H;  3S4R A;  1PGO A;  1FZG A;  3BCC J;  1FOS F;  2JKV A;  1S5L E;  3Q5S A;  2E43 A;  3CPW O;  3ZDM A;  4Z1M H;  3GHG A;  3L70 E;  3L73 D;  1BDD A;  3VOP A;  3B5N A;  2FBW C;  3AEE C;  1RQV A;  4ZKU A;  3H1J G;  1YI2 P;  3L75 D;  3CXH D;  1XTC C;  3TNU A;  3SWF A;  2WSE J;  2O01 J;  1PFI A;  3MUD A;  3NFQ A;  1WT6 A;  4KJM A;  1SVF A;  1FZC A;  5B66 E;  2YO2 A;  3RL0 B;  2ZFC A;  3WU2 H;  3Q5R A; 
#chains in the Genus database with same CATH homology
 1L0N J;  1KYO I;  4U3F J;  1SQP J;  3L70 J;  4PD4 I;  1SQB J;  1NU1 J;  3H1L J;  3L75 J;  1SQX J;  3H1I J;  3L74 J;  1KB9 I;  2IBZ I;  4D6T J;  1P84 I;  1NTK J;  1BE3 J;  1SQV J;  1L0L J;  1SQQ J;  1PP9 J;  1BCC J;  1BGY J;  1NTM J;  3H1J J;  3L72 J;  3L71 J;  3H1K J;  2FYU J;  3L73 J;  3TGU J;  5KLV J;  3H1H J;  1NTZ J;  3CXH I;  1EZV I;  3CX5 I;  3CWB J;  2BCC J;  3BCC J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...