3CX5I

Structure of complex iii with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
57
structure length
57
Chain Sequence
SFSSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
pubmed doi rcsb
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
source organism Mus musculus
molecule tags Oxidoreductase
total genus 18
structure length 57
sequence length 57
chains with identical sequence T
ec nomenclature
pdb deposition date 2008-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 3cx5I00
3CX5I 1NTKJ 1EZVI 3L72J 2BCCJ 1BE3J 1NTZJ 1KB9I 4PD4I 3L73J 2FYUJ 1SQBJ 3TGUJ 3H1IJ 1NTMJ 1SQXJ 1L0LJ 3CWBJ 1NU1J 3L70J 3H1JJ 4U3FJ 1BCCJ 3H1LJ 4D6TJ 3H1KJ 1L0NJ 3BCCJ 3L74J 1SQVJ 3H1HJ 5KLVJ 1SQQJ 2IBZI 1KYOI 3L75J 1PP9J 3CXHI 1BGYJ 1SQPJ 3L71J 1P84I
chains in the Genus database with same CATH superfamily
2H89C 3NXSA 1PP9D 1SVFA 2B88A 1RQVA 3CD6P 3BATA 5DJTB 1LTTC 4N3YB 3RL0B 2JDIH 4H44B 1G1IA 3GW6A 3CCQP 1DD3A 3CXHH 3CC2P 3A3YB 4D6TE 2E76D 2PFXA 3RK3B 1SLQA 4LGDE 1NHLA 2YIUB 3G4SP 2FYUJ 1EDKA 2YMYA 1T2KD 1E5WA 1YIJP 2RKLA 1K05A 3CPWO 3MGNA 3WUUA 3KQGA 2JWAA 1Y9BA 3B4SA 1CI6B 1ZRTD 1SQQD 1ZV8A 2WWWA 1FU1A 3M0DA 2O01N 3VMZA 1UIXA 3L72G 4W7YA 4H44C 4RO0A 1BGYJ 3L71J 1EQ7A 1CI6A 2O1JA 3RK3C 4PV1B 3H1LG 1GTWA 2YIUC 3M0DC 2K37A 2FFDB 2AEFA 2D2CB 3H1HE 3CWBG 2G8YA 1HWTC 2KZIA 5CHXA 1BE3E 2XNDH 1NTZD 3TGUE 1KQLA 2KP8A 3D70A 1YITP 2M0BA 2CK3H 2FFDA 1VL2A 1RY3A 3BCCG 1NOHA 4OVNF 4PV1C 3H1IE 2FYNB 3PTZA 3AE1C 4GODA 5KLVJ 3JCUE 2K3RA 3H1LD 3HRNA 1KILD 2ZJSE 3FWLA 1USDA 2FFDC 2D2CC 2XNXA 1LT1A 1YJWP 1IFDA 5E79H 2C0XA 5CJ4A 1VPCA 1YI2P 3N7NA 3USSA 5H2FE 5AVRB 4ZKUA 2AXTH 2YKOA 3TK1A 1U7JA 1H8AA 3M0AA 3WMM0 3VMAA 3H6PA 4Y28J 4EOTA 1L0LE 3H1JD 2FYNC 1JMBA 4H13B 2B9BA 2POHA 4BXLA 5GTIE 5AVSB 3PH0A 1IJDB 2W90A 3S9OA 3E7KA 2O01H 3H32B 1JTHB 2M5AB 5TISH 4H0LB 5K5GB 1M90Q 2BCCG 2YO2A 2QRXA 3A7OA 4IL6H 1R8EA 2E75D 2KLUA 2OTJP 1PFIA 4C7RA 2ZFCA 4OWFA 3PP5A 1FOSF 5APQA 3H32A 3KZIH 1JTHA 4U3FJ 1S4XA 3E1RA 1VF5B 3HTKB 2M5AA 3TF5A 1PP9J 1BCCD 1P84H 1Z56A 1U57A 1P84I 3GMAA 4GKGA 4H13C 1ZP0C 3E1IA 2C0WA 5AW0B 4PD4E 1M1JB 3P8CD 1G2CB 3PHLA 3HTKA 4C7NB 2OTLP 3D6YA 1LTBC 5AVXB 3N4XA 3L70E 4D6TD 4H0LC 4ASVA 1L0NE 3LIEA 3BRVB 1BDCA 4A7PA 2ZYAA 4HH2A 1HJBA 3PJSK 3H1HG 3F89A 1M1JA 1QL1A 1G2CA 1KYOH 2R5BA 4IL6X 4C7NA 1SQQJ 1KYOI 3JSVC 1BE3G 1NU1E 2OYHC 2N1TD 3TGUG 1KFMA 3O8ZA 2Z5HA 2SPZA 2NPSB 5CCGC 4DOJA 2R3CA 1GL2B 1BSNA 1M1JC 2YKPA 1J1EB 3P32A 3GHGB 5KJ7A 2E74D 3W67A 3MUDA 2FKWB 4WWIA 1J2JB 1J1DB 3HD7B 3L75E 2XU6A 2NPSA 1KB9E 2KIKA 3MZWB 2A45I 3SFDC 5KAIE 2IDBA 3LIDA 1LTSC 1OW7A 1E79H 1OVUA 1GL2A 1HGZA 2ZT9B 1IZNB 3GHGA 1AFOA 1L0NK 2GUVA 2J5UA 1S5LH 1IFMA 1H89A 3H1HD 3SWFA 5KJ7C 3U1CA 3MUDC 1NTZJ 3HD7A 3L71D 3IF4A 1LGHB 1M56D 2NPSC 1FZFA 2WPQA 1SQBD 2WPRA 3VMYA 4BRYB 1R5SA 2OQQA 1IO4A 1GL2C 1J1EC 1N73B 5B5EH 1FZAA 1J1DC 3HD7C 1NTKE 2KS1B 2R3SA 3H1LJ 2KB7P 3JC22 3H1ID 1NTME 1FDOA 4BRYA 2WSFJ 4TT3H 2Q3EA 5AVTB 2ZYDA 2K1AA 1N73A 3AEFC 2ITAA 1EZVE 4N78D 2KS1A 2KXPB 1AVOA 1SQQK 1URQD 3NTNA 1HBWA 4UB8H 5BU8B 3F5HA 1N73C 1KMIZ 4GDOA 5APVA 3P8MC 5AW8B 1LT9B 2OYOA 3H1JJ 3L73E 4PJ0H 1SFCB 3II6A 4UB6E 1JCDA 1L0LD 2WSFH 1R5LA 3H1KD 1YTZI 3L70G 1SQPE 2P10A 1L0NG 2XKMA 1LT9A 4ZKPA 1NTMK 1RE4A 4L76A 3G71P 5AW3B 4I1LA 1SFCA 4WB4A 2YKQA 1JNMA 5CMZA 2WITA 3BCCE 1LWUC 3RGUA 1P84D 3R2PA 3AEGC 1BCCJ 2R44A 1RE4C 3A5TA 1QVFO 1PPJD 1SFCC 3CMEP 1OVVA 4IFMA 1L4AB 2ZVNB 3ITKA 1SQVE 3I56P 3RL0D 1BSHA 4H44D 5AW9B 3L74G 4PD4D 3FX0A 2NRGA 3L75G 3RK3D 4D6TJ 3T97B 3U59A 3L70D 2BEZF 1L4AA 1PGJA 2C9LY 2IBZE 1KYOD 2A06D 2ZYGA 1SQPK 4RJTA 2W6AA 3VMXA 1OIPA 3IR9A 3CX5E 1VQ4P 3D71A 1NKZB 2JEEA 3QWOC 5L8RJ 1NH4A 3WUVA 1ZOYC 1NU1D 3T97A 4RKUJ 4XE5B 1L4AC 2QSIA 2DW3A 3GG2A 3CXHE 2J59M 2PP6A 2BCCE 1OZHA 2C9NY 3OAKA 1NTKG 4PV1D 1KQFB 1JOCA 3I5CA 5M1BA 2Y0CA 1SQVK 2Q5UA 1X22A 1NTMG 2QJYB 3L75D 2HFED 1DX7A 2P2UA 3KDPB 1NAYA 1ZLLA 1UIIA 5GTHH 2RN0A 3AE2C 4JPZB 3CC4P 5C39A 3SSUA 2D2CD 3O6QB 1EZVG 2KNCB 3WU2E 3H1HJ 2P1JA 1IK9A 3B71A 1HH0A 3G3ZA 1S9KE 2P7JA 3C8VA 1SQBJ 1PGQA 5BVZA 4R4MA 2FYUE 4CPGA 3O6QA 2LKMA 2H8PD 2KNCA 3L73G 1T6AA 1GK4A 1K8AQ 2CPBA 2WT7B 2QJYC 3H1IJ 2Q7CA 2YXRB 5AW1B 2RMZA 5KKZC 3CCRP 3KXDA 1SQXK 1SQPG 2B89A 2JO1A 3CCVP 1NYHA 3WUTA 3KYQA 5AW4B 1ZW0A 2QJKB 2WT7A 2JKVA 1EZVD 1RH5B 1S2EA 3L72D 2QM8A 1WT6A 4HYTB 1LJ2A 2HPCB 3Q1MA 4B86A 5KAFE 1VQ9P 1PL5A 2Y0DA 4JQ0D 3B5NB 2GA1A 3RBXA 1SQVG 3JCUH 1L0LJ 2FYUK 2O01J 1W2EA 4H13D 1Q81Q 2J58A 3H1KJ 1VQOP 1N86A 5E79E 3CWBD 2HPCA 2HG5D 3P7KA 4ZMDA 1YQ3C 2BASA 2E5YA 4H0LD 2H43A 2QJKC 2IBZG 3B5NA 1X9VA 1GD2E 3V2RA 3AE5C 4XFJA 3M06A 3K5BA 1TU3F 4XA4A 3IN6A 3BCCD 2AEJA 1T3JA 1VF5D 1X8YA 1M7LA 1HTLC 2HR3A 2N9YB 3M9BA 4RESB 1DIPA 1SQBK 2KUBA 2ZXEB 3B5NC 2PAJA 1GW3A 3OJAB 5GTIH 5CCGD 1A02F 3AE9C 3CL3D 1AQ5A 1YHQP 1IK7A 5EFWB 1FBMA 5TJHA 1HGVA 2Y9YA 1M57D 4JBZA 5APTA 4IL6E 4AUWA 1YQ4C 3TNUB 1NAFA 3L70J 2P67A 4NPEA 2K9JB 1Y47A 3KHUA 1JCCA 2OYHB 1H0TB 1OWAA 4Y99B 3VP8A 1PGOA 4GT1A 1NU1J 5KJ7D 1HUCA 3TNUA 1FC2C 3VTPC 4OGQB 2QVAA 2K9JA 1ZR4A 4BWNA 1OW6A 2OYHA 3RL0g 1H0TA 5KLVK 2FYUG 2NPSD 3OW2O 2NZ2A 4PD4H 1DEEG 4PD4I 1GL2D 5CCGA 4C46A 5CCHA 2BCCD 1USEA 4WY4B 4YPCA 1M1KQ 2K88A 1KQSO 3HD7D 1NVOA 2PRRA 3L75J 3BVHA 4U3FE 3RBZA 3VOPA 3U1AA 3A0BE 1N2DC 3V2PA 3OA7A 1PP9E 3V2QA 4Y99C 2ZT9D 1FAVA 5CCHC 3AE3C 4WY4A 3AECC 2WSCH 5AVZB 3M9HA 1LTAC 4OGQC 5BU5A 3GF7A 2QM7A 1W5CE 2JR8A 3L74E 5B66H 3Q3DA 1KORA 2O3JA 1K04A 3TSIA 4DCKA 1N7SB 4HB1A 1LNQA 2A45H 1RQUA 1QX8A 3C9IA 4I2LC 2KLVA 2GM4A 4WY4C 2QG4A 2I1JA 3CCJP 3SFEC 1ZRTE 1SQQE 1FZBA 1KB9H 2I1KA 5AVVB 1KB9I 1N7SA 1Q82Q 4O9BA 5KLIB 1BE3D 3UIAA 3TGUD 1A02J 5AW7B 3CC7P 1G1JA 2WMMA 2Z5IA 1QGKB 2MJZA 1VQPP 4OH8B 2P58A 1SP4A 3L72J 5APSA 5B5EE 5KLVG 4EDFA 1N7SC 3A0HE 4IFFA 4Z1MH 4KT0J 1YYCA 4L75A 5AVQB 2LR2A 3L4FA 1CSBA 2W27A 1OXZA 4YXWH 1XTGB 5AVWB 1MKMA 2FXPA 1JY2N 1SFCD 4AYCA 1OW8A 3C1LA 4DZOA 3CWBJ 3L36A 5KLIC 1S5LX 3S4RA 5APYA 1DH3A 3CLQA 1LWUB 1FE6A 3CCSP 1EZVI 2FXOA 1CW5A 4K35A 1PV3A 2N9BA 3AEEC 1FOSE 3BCCJ 2VRSA 1JM0A 1Y8AA 1LWUA 4JYBA 5CBNA 1ZXGA 4UB6H 1JY3N 2R5DA 1L4AD 3H25A 2W6JH 2WPSA 2WSEJ 1SS1A 2IZ0A 3V6IA 1EXIA 1Q7YQ 1CZQA 3RK2B 3CCMP 2M8RA 4U7JA 4U3FG 1NTZK 2V4HA 1GW4A 4EI2A 1PP9G 4KJMA 2AXCA 3AEAC 1EC5A 3VN0A 2WQYC 4YXDC 3EFGA 1MV8A 2AEMA 1KFNA 1KC8Q 5CBOA 4GOEA 5AW6B 2WSEH 2W8ZA 1K73Q 1L0ND 1QLED 2WPVB 2BCCJ 3RK2C 1S1CX 1SQQG 3BRTB 3SWYA 1H88A 1GU4A 2O1KA 1ZMEC 1AJYA 1PZQA 1FZGA 4LC1A 2IBZI 1YBKA 1BCCE 2JJLA 3CX5H 2IYOA 1X79B 3CX5I 1T3UA 1AV1A 4EIJA 4I7ZB 5AW5B 1VQLP 4ZNCA 1VDFA 4YTPC 2B87B 2W6BA 2FY8A 3P8CE 4NPDA 1KV4A 1NGMB 1L2PA 1ZR2A 1SQXE 2GUSA 2KI7B 2KSJA 2H88C 3CXHI 4M3LA 2XV5A 3L74D 2BEQD 2M3BA 5KKZB 2W83C 4HKZH 2QEXP 1NO4A 1KB9D 2QJPB 1FS0E 2B87A 1FDMA 1KN7A 5GTHE 4JF7A 1NTZG 3FWNA 1EXJA 2FBWC 2YNYA 4W7ZA 2Q9IA 1BE3J 2XDJA 3TGUJ 3PLNA 3Q2YA 3WU2H 4I7ZC 2YO3A 2E76B 3AE4C 4TLFA 3RL0C 3GLMA 3EWKA 1NJIQ 1NTKD 5APXA 3A2AA 3QH9A 4N6JA 3D6ZA 2IZ1A 2QJPC 1NTMD 1N8RQ 3B5ND 5APUA 3EFFK 2CPSA 4AQRD 1BGYE 3L71E 2FXMA 3IAOA 1SQBE 2E76C 4L73A 1X0TA 1FJPA 2YMKA 2LXBA 1T2KC 1JY2P 3CI9A 2KYVA 3H1JG 3G6EP 1OVRA 1QL2A 3L73D 3M9QA 3SWKA 5KAFH 2E5TA 2WZ7A 2ZAEB 1D7MA 1JMMA 3GF3A 1PIXA 2FYZA 3CCUP 2ZVOB 4ASWA 1AQTA 2AXTE 1SQPD 2M3EA 5H2FH 4N78E 3TDKA 1LTIC 3HE5B 3ZDMA 1NKNA 4GIFA 3W68A 1IC2A 4MN4C 3HUSB 5KLVE 1GMJA 1JY3P 3BASA 1BCCG 1KQGB 2R32A 1KILB 4K3AA 1YJ9P 1RF1B 1M8OB 1QVGO 1LTJB 3HE5A 3MD0A 2IFNA 5CCHD 1KTMA 3H1KE 1IFIA 5TISE 1SQVD 3MHVA 1SQXG 3HUSA 1XTCC 4OGQD 4D6TG 1MZ9A 1KILA 2Q1KA 1RF1A 2L5GB 3ABVC 1L0NJ 2G3AA 1VQ8P 3S1KA 1AA0A 1LTJA 4GOFA 3KZIE 2E42A 2KK7A 2IBZD 2OYIB 1WMKA 4WY4D 2HODB 1P84E 3HUSC 3CX5D 4WVZA 1IFPA 2KSEA 4DT0A 2JWDA 1KILC 2WSCJ 2ZXXA 3PRJA 1RF1C 3KPEA 2IX7C 3FXEA 2WTYA 1PPJE 3VYIA 5CJ0A 1LTJC 4R4LA 2OYIA 5AW2B 3CXHD 2HODA 3CCEP 2LXCB 1HVVA 1FDIA 1JY2O 3AE8C 2E75B 3RK3E 1DEBA 2K9YA 1L0LK 3L74J 1SQXD 4NPFX 1N7SD 1N7LA 1KYOE 2A06E 3NFQA 3M91A 3CMAP 1RHZB 3MTUE 2OYIC 2YXQB 2Y9ZA 1RF0A 1K9MQ 1BGYG 5APWA 3A0BH 3L71G 1VF5C 2OGUA 1SQBG 4HJGH 3AEDC 1OMIA 1S9KD 1GZLA 1HF9A 1KZUB 1FJKA 2WVRA 5B66E 1JY3O 4LLHA 2FYUD 1VQ6P 1RF0C 2E75C 1VQ7P 2OTKE 3H1IG 3AEBC 4JYCA 1NTKJ 4L74A 3Q5RA 1S5LE 5KAIH 3HE4B 1Q90D 2N1TB 1NTMJ 4I6MC 1GU5A 3FGAD 3IFMA 4EYYQ 1NWQA 3R4YA 3MP7B 1RE3A 1BDDA 1MFZA 1JUNA 2IYPA 3Q5SA 2I8DA 1BGYD 1EDJA 1IFNA 3HE4A 1VQ5P 2N1TA 3L37A 1VQNP 2E74B 1NU1K 5AVYB 4DJGA 1YJNP 3GHGC 1YTZT 1T8ZA 2V7QJ 4IOIH 3V4QA 1L0LG 3A0HH 1RE3C 1JEKA 3L73J 3AE6C 3CCLP 3H1KG 2N1TC 2QIWA 1W2BO 1NTZE 3LW5J 1WRGA 2JP3A 2Y0EA 2ZT9C 1OX3A 1SQPJ 2MKVA 3V5BA 1FZCB 1KD1Q 2XZRA 3TYYA 4IFDK 4UB8E 1Q86Q 2Z4EA 3L72E 3RK2D 1HJ0A 2Q6QA 2E74C 2E43A 2PGDA 3AE7C 3I55P 4PJ0E 3H1LE 5KTBA 1KILE 5KLVD 2V7QH 5DJUB 1PPJG 1FZCA 3B8EB 5AVUB 1DD4A 2KZJA 2QA4P 1MUUA 3V2NA 3LW5H 1QEXA 1PGPA 3G9RA 1SQVJ 2IPPA 3CWBE 3EQ2A 1JO5A 3L35A 4KHXA 1NTKK 3Q5PA 1FZCC 1URQB 2A06G 1FZEA 4WBAA 4QMAA 3FXDA 3V4WA 3NMDA 3MIWA 1OFCX 1EDIA 2RH0A 1GK6A 1LP1B 3H1JE 1S3JA 2OARA 1JB0J 1NU1G 2HYNA 1MFTA 1URQA 1LT9C 2H7HA 2Q3IA 2KOGA 2QE7H 1LP1A 1IFJA 3VP9A 2A45G 2HLOA 1VQMP 1GDTA 2L91A 1VQKP 1AVYA 1SQXJ 2IFMA 1URQC 2UWJE 1Q2NA 1LTGC 1S72P 4W80A 1EDLA 4U3FD 1U7MA 1ZN5A 2WSSH
chains in the Genus database with same CATH topology
3CX5I 1NTKJ 1EZVI 3L72J 2BCCJ 1BE3J 1NTZJ 1KB9I 4PD4I 3L73J 2FYUJ 1SQBJ 3TGUJ 3H1IJ 1NTMJ 1SQXJ 1L0LJ 3CWBJ 1NU1J 3L70J 3H1JJ 4U3FJ 1BCCJ 3H1LJ 4D6TJ 3H1KJ 1L0NJ 3BCCJ 3L74J 1SQVJ 3H1HJ 5KLVJ 1SQQJ 2IBZI 1KYOI 3L75J 1PP9J 3CXHI 1BGYJ 1SQPJ 3L71J 1P84I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CX5 I;  1NTK J;  1EZV I;  3L72 J;  2BCC J;  1BE3 J;  1NTZ J;  1KB9 I;  4PD4 I;  3L73 J;  2FYU J;  1SQB J;  3TGU J;  3H1I J;  1NTM J;  1SQX J;  1L0L J;  3CWB J;  1NU1 J;  3L70 J;  3H1J J;  4U3F J;  1BCC J;  3H1L J;  4D6T J;  3H1K J;  1L0N J;  3BCC J;  3L74 J;  1SQV J;  3H1H J;  5KLV J;  1SQQ J;  2IBZ I;  1KYO I;  3L75 J;  1PP9 J;  3CXH I;  1BGY J;  1SQP J;  3L71 J;  1P84 I; 
#chains in the Genus database with same CATH topology
 2H89 C;  3NXS A;  1PP9 D;  1SVF A;  2B88 A;  1RQV A;  3CD6 P;  3BAT A;  5DJT B;  1LTT C;  4N3Y B;  3RL0 B;  2JDI H;  4H44 B;  1G1I A;  3GW6 A;  3CCQ P;  1DD3 A;  3CXH H;  3CC2 P;  3A3Y B;  4D6T E;  2E76 D;  2PFX A;  3RK3 B;  1SLQ A;  4LGD E;  1NHL A;  2YIU B;  3G4S P;  2FYU J;  1EDK A;  2YMY A;  1T2K D;  1E5W A;  1YIJ P;  2RKL A;  1K05 A;  3CPW O;  3MGN A;  3WUU A;  3KQG A;  2JWA A;  1Y9B A;  3B4S A;  1CI6 B;  1ZRT D;  1SQQ D;  1ZV8 A;  2WWW A;  1FU1 A;  3M0D A;  2O01 N;  3VMZ A;  1UIX A;  3L72 G;  4W7Y A;  4H44 C;  4RO0 A;  1BGY J;  3L71 J;  1EQ7 A;  1CI6 A;  2O1J A;  3RK3 C;  4PV1 B;  3H1L G;  1GTW A;  2YIU C;  3M0D C;  2K37 A;  2FFD B;  2AEF A;  2D2C B;  3H1H E;  3CWB G;  2G8Y A;  1HWT C;  2KZI A;  5CHX A;  1BE3 E;  2XND H;  1NTZ D;  3TGU E;  1KQL A;  2KP8 A;  3D70 A;  1YIT P;  2M0B A;  2CK3 H;  2FFD A;  1VL2 A;  1RY3 A;  3BCC G;  1NOH A;  4OVN F;  4PV1 C;  3H1I E;  2FYN B;  3PTZ A;  3AE1 C;  4GOD A;  5KLV J;  3JCU E;  2K3R A;  3H1L D;  3HRN A;  1KIL D;  2ZJS E;  3FWL A;  1USD A;  2FFD C;  2D2C C;  2XNX A;  1LT1 A;  1YJW P;  1IFD A;  5E79 H;  2C0X A;  5CJ4 A;  1VPC A;  1YI2 P;  3N7N A;  3USS A;  5H2F E;  5AVR B;  4ZKU A;  2AXT H;  2YKO A;  3TK1 A;  1U7J A;  1H8A A;  3M0A A;  3WMM 0;  3VMA A;  3H6P A;  4Y28 J;  4EOT A;  1L0L E;  3H1J D;  2FYN C;  1JMB A;  4H13 B;  2B9B A;  2POH A;  4BXL A;  5GTI E;  5AVS B;  3PH0 A;  1IJD B;  2W90 A;  3S9O A;  3E7K A;  2O01 H;  3H32 B;  1JTH B;  2M5A B;  5TIS H;  4H0L B;  5K5G B;  1M90 Q;  2BCC G;  2YO2 A;  2QRX A;  3A7O A;  4IL6 H;  1R8E A;  2E75 D;  2KLU A;  2OTJ P;  1PFI A;  4C7R A;  2ZFC A;  4OWF A;  3PP5 A;  1FOS F;  5APQ A;  3H32 A;  3KZI H;  1JTH A;  4U3F J;  1S4X A;  3E1R A;  1VF5 B;  3HTK B;  2M5A A;  3TF5 A;  1PP9 J;  1BCC D;  1P84 H;  1Z56 A;  1U57 A;  1P84 I;  3GMA A;  4GKG A;  4H13 C;  1ZP0 C;  3E1I A;  2C0W A;  5AW0 B;  4PD4 E;  1M1J B;  3P8C D;  1G2C B;  3PHL A;  3HTK A;  4C7N B;  2OTL P;  3D6Y A;  1LTB C;  5AVX B;  3N4X A;  3L70 E;  4D6T D;  4H0L C;  4ASV A;  1L0N E;  3LIE A;  3BRV B;  1BDC A;  4A7P A;  2ZYA A;  4HH2 A;  1HJB A;  3PJS K;  3H1H G;  3F89 A;  1M1J A;  1QL1 A;  1G2C A;  1KYO H;  2R5B A;  4IL6 X;  4C7N A;  1SQQ J;  1KYO I;  3JSV C;  1BE3 G;  1NU1 E;  2OYH C;  2N1T D;  3TGU G;  1KFM A;  3O8Z A;  2Z5H A;  2SPZ A;  2NPS B;  5CCG C;  4DOJ A;  2R3C A;  1GL2 B;  1BSN A;  1M1J C;  2YKP A;  1J1E B;  3P32 A;  3GHG B;  5KJ7 A;  2E74 D;  3W67 A;  3MUD A;  2FKW B;  4WWI A;  1J2J B;  1J1D B;  3HD7 B;  3L75 E;  2XU6 A;  2NPS A;  1KB9 E;  2KIK A;  3MZW B;  2A45 I;  3SFD C;  5KAI E;  2IDB A;  3LID A;  1LTS C;  1OW7 A;  1E79 H;  1OVU A;  1GL2 A;  1HGZ A;  2ZT9 B;  1IZN B;  3GHG A;  1AFO A;  1L0N K;  2GUV A;  2J5U A;  1S5L H;  1IFM A;  1H89 A;  3H1H D;  3SWF A;  5KJ7 C;  3U1C A;  3MUD C;  1NTZ J;  3HD7 A;  3L71 D;  3IF4 A;  1LGH B;  1M56 D;  2NPS C;  1FZF A;  2WPQ A;  1SQB D;  2WPR A;  3VMY A;  4BRY B;  1R5S A;  2OQQ A;  1IO4 A;  1GL2 C;  1J1E C;  1N73 B;  5B5E H;  1FZA A;  1J1D C;  3HD7 C;  1NTK E;  2KS1 B;  2R3S A;  3H1L J;  2KB7 P;  3JC2 2;  3H1I D;  1NTM E;  1FDO A;  4BRY A;  2WSF J;  4TT3 H;  2Q3E A;  5AVT B;  2ZYD A;  2K1A A;  1N73 A;  3AEF C;  2ITA A;  1EZV E;  4N78 D;  2KS1 A;  2KXP B;  1AVO A;  1SQQ K;  1URQ D;  3NTN A;  1HBW A;  4UB8 H;  5BU8 B;  3F5H A;  1N73 C;  1KMI Z;  4GDO A;  5APV A;  3P8M C;  5AW8 B;  1LT9 B;  2OYO A;  3H1J J;  3L73 E;  4PJ0 H;  1SFC B;  3II6 A;  4UB6 E;  1JCD A;  1L0L D;  2WSF H;  1R5L A;  3H1K D;  1YTZ I;  3L70 G;  1SQP E;  2P10 A;  1L0N G;  2XKM A;  1LT9 A;  4ZKP A;  1NTM K;  1RE4 A;  4L76 A;  3G71 P;  5AW3 B;  4I1L A;  1SFC A;  4WB4 A;  2YKQ A;  1JNM A;  5CMZ A;  2WIT A;  3BCC E;  1LWU C;  3RGU A;  1P84 D;  3R2P A;  3AEG C;  1BCC J;  2R44 A;  1RE4 C;  3A5T A;  1QVF O;  1PPJ D;  1SFC C;  3CME P;  1OVV A;  4IFM A;  1L4A B;  2ZVN B;  3ITK A;  1SQV E;  3I56 P;  3RL0 D;  1BSH A;  4H44 D;  5AW9 B;  3L74 G;  4PD4 D;  3FX0 A;  2NRG A;  3L75 G;  3RK3 D;  4D6T J;  3T97 B;  3U59 A;  3L70 D;  2BEZ F;  1L4A A;  1PGJ A;  2C9L Y;  2IBZ E;  1KYO D;  2A06 D;  2ZYG A;  1SQP K;  4RJT A;  2W6A A;  3VMX A;  1OIP A;  3IR9 A;  3CX5 E;  1VQ4 P;  3D71 A;  1NKZ B;  2JEE A;  3QWO C;  5L8R J;  1NH4 A;  3WUV A;  1ZOY C;  1NU1 D;  3T97 A;  4RKU J;  4XE5 B;  1L4A C;  2QSI A;  2DW3 A;  3GG2 A;  3CXH E;  2J59 M;  2PP6 A;  2BCC E;  1OZH A;  2C9N Y;  3OAK A;  1NTK G;  4PV1 D;  1KQF B;  1JOC A;  3I5C A;  5M1B A;  2Y0C A;  1SQV K;  2Q5U A;  1X22 A;  1NTM G;  2QJY B;  3L75 D;  2HFE D;  1DX7 A;  2P2U A;  3KDP B;  1NAY A;  1ZLL A;  1UII A;  5GTH H;  2RN0 A;  3AE2 C;  4JPZ B;  3CC4 P;  5C39 A;  3SSU A;  2D2C D;  3O6Q B;  1EZV G;  2KNC B;  3WU2 E;  3H1H J;  2P1J A;  1IK9 A;  3B71 A;  1HH0 A;  3G3Z A;  1S9K E;  2P7J A;  3C8V A;  1SQB J;  1PGQ A;  5BVZ A;  4R4M A;  2FYU E;  4CPG A;  3O6Q A;  2LKM A;  2H8P D;  2KNC A;  3L73 G;  1T6A A;  1GK4 A;  1K8A Q;  2CPB A;  2WT7 B;  2QJY C;  3H1I J;  2Q7C A;  2YXR B;  5AW1 B;  2RMZ A;  5KKZ C;  3CCR P;  3KXD A;  1SQX K;  1SQP G;  2B89 A;  2JO1 A;  3CCV P;  1NYH A;  3WUT A;  3KYQ A;  5AW4 B;  1ZW0 A;  2QJK B;  2WT7 A;  2JKV A;  1EZV D;  1RH5 B;  1S2E A;  3L72 D;  2QM8 A;  1WT6 A;  4HYT B;  1LJ2 A;  2HPC B;  3Q1M A;  4B86 A;  5KAF E;  1VQ9 P;  1PL5 A;  2Y0D A;  4JQ0 D;  3B5N B;  2GA1 A;  3RBX A;  1SQV G;  3JCU H;  1L0L J;  2FYU K;  2O01 J;  1W2E A;  4H13 D;  1Q81 Q;  2J58 A;  3H1K J;  1VQO P;  1N86 A;  5E79 E;  3CWB D;  2HPC A;  2HG5 D;  3P7K A;  4ZMD A;  1YQ3 C;  2BAS A;  2E5Y A;  4H0L D;  2H43 A;  2QJK C;  2IBZ G;  3B5N A;  1X9V A;  1GD2 E;  3V2R A;  3AE5 C;  4XFJ A;  3M06 A;  3K5B A;  1TU3 F;  4XA4 A;  3IN6 A;  3BCC D;  2AEJ A;  1T3J A;  1VF5 D;  1X8Y A;  1M7L A;  1HTL C;  2HR3 A;  2N9Y B;  3M9B A;  4RES B;  1DIP A;  1SQB K;  2KUB A;  2ZXE B;  3B5N C;  2PAJ A;  1GW3 A;  3OJA B;  5GTI H;  5CCG D;  1A02 F;  3AE9 C;  3CL3 D;  1AQ5 A;  1YHQ P;  1IK7 A;  5EFW B;  1FBM A;  5TJH A;  1HGV A;  2Y9Y A;  1M57 D;  4JBZ A;  5APT A;  4IL6 E;  4AUW A;  1YQ4 C;  3TNU B;  1NAF A;  3L70 J;  2P67 A;  4NPE A;  2K9J B;  1Y47 A;  3KHU A;  1JCC A;  2OYH B;  1H0T B;  1OWA A;  4Y99 B;  3VP8 A;  1PGO A;  4GT1 A;  1NU1 J;  5KJ7 D;  1HUC A;  3TNU A;  1FC2 C;  3VTP C;  4OGQ B;  2QVA A;  2K9J A;  1ZR4 A;  4BWN A;  1OW6 A;  2OYH A;  3RL0 g;  1H0T A;  5KLV K;  2FYU G;  2NPS D;  3OW2 O;  2NZ2 A;  4PD4 H;  1DEE G;  4PD4 I;  1GL2 D;  5CCG A;  4C46 A;  5CCH A;  2BCC D;  1USE A;  4WY4 B;  4YPC A;  1M1K Q;  2K88 A;  1KQS O;  3HD7 D;  1NVO A;  2PRR A;  3L75 J;  3BVH A;  4U3F E;  3RBZ A;  3VOP A;  3U1A A;  3A0B E;  1N2D C;  3V2P A;  3OA7 A;  1PP9 E;  3V2Q A;  4Y99 C;  2ZT9 D;  1FAV A;  5CCH C;  3AE3 C;  4WY4 A;  3AEC C;  2WSC H;  5AVZ B;  3M9H A;  1LTA C;  4OGQ C;  5BU5 A;  3GF7 A;  2QM7 A;  1W5C E;  2JR8 A;  3L74 E;  5B66 H;  3Q3D A;  1KOR A;  2O3J A;  1K04 A;  3TSI A;  4DCK A;  1N7S B;  4HB1 A;  1LNQ A;  2A45 H;  1RQU A;  1QX8 A;  3C9I A;  4I2L C;  2KLV A;  2GM4 A;  4WY4 C;  2QG4 A;  2I1J A;  3CCJ P;  3SFE C;  1ZRT E;  1SQQ E;  1FZB A;  1KB9 H;  2I1K A;  5AVV B;  1KB9 I;  1N7S A;  1Q82 Q;  4O9B A;  5KLI B;  1BE3 D;  3UIA A;  3TGU D;  1A02 J;  5AW7 B;  3CC7 P;  1G1J A;  2WMM A;  2Z5I A;  1QGK B;  2MJZ A;  1VQP P;  4OH8 B;  2P58 A;  1SP4 A;  3L72 J;  5APS A;  5B5E E;  5KLV G;  4EDF A;  1N7S C;  3A0H E;  4IFF A;  4Z1M H;  4KT0 J;  1YYC A;  4L75 A;  5AVQ B;  2LR2 A;  3L4F A;  1CSB A;  2W27 A;  1OXZ A;  4YXW H;  1XTG B;  5AVW B;  1MKM A;  2FXP A;  1JY2 N;  1SFC D;  4AYC A;  1OW8 A;  3C1L A;  4DZO A;  3CWB J;  3L36 A;  5KLI C;  1S5L X;  3S4R A;  5APY A;  1DH3 A;  3CLQ A;  1LWU B;  1FE6 A;  3CCS P;  1EZV I;  2FXO A;  1CW5 A;  4K35 A;  1PV3 A;  2N9B A;  3AEE C;  1FOS E;  3BCC J;  2VRS A;  1JM0 A;  1Y8A A;  1LWU A;  4JYB A;  5CBN A;  1ZXG A;  4UB6 H;  1JY3 N;  2R5D A;  1L4A D;  3H25 A;  2W6J H;  2WPS A;  2WSE J;  1SS1 A;  2IZ0 A;  3V6I A;  1EXI A;  1Q7Y Q;  1CZQ A;  3RK2 B;  3CCM P;  2M8R A;  4U7J A;  4U3F G;  1NTZ K;  2V4H A;  1GW4 A;  4EI2 A;  1PP9 G;  4KJM A;  2AXC A;  3AEA C;  1EC5 A;  3VN0 A;  2WQY C;  4YXD C;  3EFG A;  1MV8 A;  2AEM A;  1KFN A;  1KC8 Q;  5CBO A;  4GOE A;  5AW6 B;  2WSE H;  2W8Z A;  1K73 Q;  1L0N D;  1QLE D;  2WPV B;  2BCC J;  3RK2 C;  1S1C X;  1SQQ G;  3BRT B;  3SWY A;  1H88 A;  1GU4 A;  2O1K A;  1ZME C;  1AJY A;  1PZQ A;  1FZG A;  4LC1 A;  2IBZ I;  1YBK A;  1BCC E;  2JJL A;  3CX5 H;  2IYO A;  1X79 B;  3CX5 I;  1T3U A;  1AV1 A;  4EIJ A;  4I7Z B;  5AW5 B;  1VQL P;  4ZNC A;  1VDF A;  4YTP C;  2B87 B;  2W6B A;  2FY8 A;  3P8C E;  4NPD A;  1KV4 A;  1NGM B;  1L2P A;  1ZR2 A;  1SQX E;  2GUS A;  2KI7 B;  2KSJ A;  2H88 C;  3CXH I;  4M3L A;  2XV5 A;  3L74 D;  2BEQ D;  2M3B A;  5KKZ B;  2W83 C;  4HKZ H;  2QEX P;  1NO4 A;  1KB9 D;  2QJP B;  1FS0 E;  2B87 A;  1FDM A;  1KN7 A;  5GTH E;  4JF7 A;  1NTZ G;  3FWN A;  1EXJ A;  2FBW C;  2YNY A;  4W7Z A;  2Q9I A;  1BE3 J;  2XDJ A;  3TGU J;  3PLN A;  3Q2Y A;  3WU2 H;  4I7Z C;  2YO3 A;  2E76 B;  3AE4 C;  4TLF A;  3RL0 C;  3GLM A;  3EWK A;  1NJI Q;  1NTK D;  5APX A;  3A2A A;  3QH9 A;  4N6J A;  3D6Z A;  2IZ1 A;  2QJP C;  1NTM D;  1N8R Q;  3B5N D;  5APU A;  3EFF K;  2CPS A;  4AQR D;  1BGY E;  3L71 E;  2FXM A;  3IAO A;  1SQB E;  2E76 C;  4L73 A;  1X0T A;  1FJP A;  2YMK A;  2LXB A;  1T2K C;  1JY2 P;  3CI9 A;  2KYV A;  3H1J G;  3G6E P;  1OVR A;  1QL2 A;  3L73 D;  3M9Q A;  3SWK A;  5KAF H;  2E5T A;  2WZ7 A;  2ZAE B;  1D7M A;  1JMM A;  3GF3 A;  1PIX A;  2FYZ A;  3CCU P;  2ZVO B;  4ASW A;  1AQT A;  2AXT E;  1SQP D;  2M3E A;  5H2F H;  4N78 E;  3TDK A;  1LTI C;  3HE5 B;  3ZDM A;  1NKN A;  4GIF A;  3W68 A;  1IC2 A;  4MN4 C;  3HUS B;  5KLV E;  1GMJ A;  1JY3 P;  3BAS A;  1BCC G;  1KQG B;  2R32 A;  1KIL B;  4K3A A;  1YJ9 P;  1RF1 B;  1M8O B;  1QVG O;  1LTJ B;  3HE5 A;  3MD0 A;  2IFN A;  5CCH D;  1KTM A;  3H1K E;  1IFI A;  5TIS E;  1SQV D;  3MHV A;  1SQX G;  3HUS A;  1XTC C;  4OGQ D;  4D6T G;  1MZ9 A;  1KIL A;  2Q1K A;  1RF1 A;  2L5G B;  3ABV C;  1L0N J;  2G3A A;  1VQ8 P;  3S1K A;  1AA0 A;  1LTJ A;  4GOF A;  3KZI E;  2E42 A;  2KK7 A;  2IBZ D;  2OYI B;  1WMK A;  4WY4 D;  2HOD B;  1P84 E;  3HUS C;  3CX5 D;  4WVZ A;  1IFP A;  2KSE A;  4DT0 A;  2JWD A;  1KIL C;  2WSC J;  2ZXX A;  3PRJ A;  1RF1 C;  3KPE A;  2IX7 C;  3FXE A;  2WTY A;  1PPJ E;  3VYI A;  5CJ0 A;  1LTJ C;  4R4L A;  2OYI A;  5AW2 B;  3CXH D;  2HOD A;  3CCE P;  2LXC B;  1HVV A;  1FDI A;  1JY2 O;  3AE8 C;  2E75 B;  3RK3 E;  1DEB A;  2K9Y A;  1L0L K;  3L74 J;  1SQX D;  4NPF X;  1N7S D;  1N7L A;  1KYO E;  2A06 E;  3NFQ A;  3M91 A;  3CMA P;  1RHZ B;  3MTU E;  2OYI C;  2YXQ B;  2Y9Z A;  1RF0 A;  1K9M Q;  1BGY G;  5APW A;  3A0B H;  3L71 G;  1VF5 C;  2OGU A;  1SQB G;  4HJG H;  3AED C;  1OMI A;  1S9K D;  1GZL A;  1HF9 A;  1KZU B;  1FJK A;  2WVR A;  5B66 E;  1JY3 O;  4LLH A;  2FYU D;  1VQ6 P;  1RF0 C;  2E75 C;  1VQ7 P;  2OTK E;  3H1I G;  3AEB C;  4JYC A;  1NTK J;  4L74 A;  3Q5R A;  1S5L E;  5KAI H;  3HE4 B;  1Q90 D;  2N1T B;  1NTM J;  4I6M C;  1GU5 A;  3FGA D;  3IFM A;  4EYY Q;  1NWQ A;  3R4Y A;  3MP7 B;  1RE3 A;  1BDD A;  1MFZ A;  1JUN A;  2IYP A;  3Q5S A;  2I8D A;  1BGY D;  1EDJ A;  1IFN A;  3HE4 A;  1VQ5 P;  2N1T A;  3L37 A;  1VQN P;  2E74 B;  1NU1 K;  5AVY B;  4DJG A;  1YJN P;  3GHG C;  1YTZ T;  1T8Z A;  2V7Q J;  4IOI H;  3V4Q A;  1L0L G;  3A0H H;  1RE3 C;  1JEK A;  3L73 J;  3AE6 C;  3CCL P;  3H1K G;  2N1T C;  2QIW A;  1W2B O;  1NTZ E;  3LW5 J;  1WRG A;  2JP3 A;  2Y0E A;  2ZT9 C;  1OX3 A;  1SQP J;  2MKV A;  3V5B A;  1FZC B;  1KD1 Q;  2XZR A;  3TYY A;  4IFD K;  4UB8 E;  1Q86 Q;  2Z4E A;  3L72 E;  3RK2 D;  1HJ0 A;  2Q6Q A;  2E74 C;  2E43 A;  2PGD A;  3AE7 C;  3I55 P;  4PJ0 E;  3H1L E;  5KTB A;  1KIL E;  5KLV D;  2V7Q H;  5DJU B;  1PPJ G;  1FZC A;  3B8E B;  5AVU B;  1DD4 A;  2KZJ A;  2QA4 P;  1MUU A;  3V2N A;  3LW5 H;  1QEX A;  1PGP A;  3G9R A;  1SQV J;  2IPP A;  3CWB E;  3EQ2 A;  1JO5 A;  3L35 A;  4KHX A;  1NTK K;  3Q5P A;  1FZC C;  1URQ B;  2A06 G;  1FZE A;  4WBA A;  4QMA A;  3FXD A;  3V4W A;  3NMD A;  3MIW A;  1OFC X;  1EDI A;  2RH0 A;  1GK6 A;  1LP1 B;  3H1J E;  1S3J A;  2OAR A;  1JB0 J;  1NU1 G;  2HYN A;  1MFT A;  1URQ A;  1LT9 C;  2H7H A;  2Q3I A;  2KOG A;  2QE7 H;  1LP1 A;  1IFJ A;  3VP9 A;  2A45 G;  2HLO A;  1VQM P;  1GDT A;  2L91 A;  1VQK P;  1AVY A;  1SQX J;  2IFM A;  1URQ C;  2UWJ E;  1Q2N A;  1LTG C;  1S72 P;  4W80 A;  1EDL A;  4U3F D;  1U7M A;  1ZN5 A;  2WSS H; 
#chains in the Genus database with same CATH homology
 3CX5 I;  1NTK J;  1EZV I;  3L72 J;  2BCC J;  1BE3 J;  1NTZ J;  1KB9 I;  4PD4 I;  3L73 J;  2FYU J;  1SQB J;  3TGU J;  3H1I J;  1NTM J;  1SQX J;  1L0L J;  3CWB J;  1NU1 J;  3L70 J;  3H1J J;  4U3F J;  1BCC J;  3H1L J;  4D6T J;  3H1K J;  1L0N J;  3BCC J;  3L74 J;  1SQV J;  3H1H J;  5KLV J;  1SQQ J;  2IBZ I;  1KYO I;  3L75 J;  1PP9 J;  3CXH I;  1BGY J;  1SQP J;  3L71 J;  1P84 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...