3CXC2

The structure of an enhanced oxazolidinone inhibitor bound to the 50s ribosomal subunit of h. marismortui
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design at the atomic level: design of biaryloxazolidinones as potent orally active antibiotics.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RIBOSOMAL RNA
total genus 17
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3cxc200
1NJI4 1W2B2 1VQN3 3CC73 3CPW2 1YHQ3 3CD63 1YJN3 3CCE3 1VQ63 1K734 2QEX3 3CME3 3OW22 1K8A4 1VQM3 1KD14 2QA43 3CCR3 1M904 3CC23 2OTJ3 1M1K4 2OTL3 1YIJ3 1KQS2 1Q7Y4 1Q864 3G4S3 1K9M4 3CCL3 1VQ73 1S723 3CXC2 1QVF2 1VQO3 3I563 3G6E3 3CCS3 1KC84 1JJ22 1VQP3 1N8R4 3CCU3 3CCJ3 1VQK3 3CMA3 3CCM3 3CC43 3CCQ3 1Q824 3G713 1YJW3 1VQ43 1VQ53 1QVG2 1VQL3 1YIT3 1VQ93 3I553 1VQ83 3CCV3 1YJ93 1Q814 1YI23
chains in the Genus database with same CATH superfamily
2ML5A 1QALA 3O8YA 3AGOA 3JUOA 3GWRA 1BRGA 2OWPA 2KF3A 1ZX2A 2KRTA 3G0KA 5STDA 3VF1A 3CCE3 2JDIH 1DETA 1LOXA 1TRPA 3F7SA 5HOHA 3PCRA 1I2GA 4RNTA 2IMJA 4HM4B 1RN1A 3UL6A 3LTBA 5BU4A 2RBIA 1K9M4 2BO9B 3IJEB 1UCKA 1X1WA 5BVBA 5D82A 4WHAA 5IG3A 1QVF2 4JRFA 3I563 1Q40B 3KE7A 1NWWA 1O7HB 3PZWA 5I97A 1ASKA 1FGTA 1WQLB 3X3ZA 4STDA 3CCQ3 1B2SA 3WODG 1BNFA 2ZHXB 1OGXA 5AYSC 4AKZA 1N5HA 4XBYA 1GY6A 4XM4A 1LRAA 2F56A 5EEOA 4J9AA 4BIRA 1W7CA 1HYFA 1DMQA 1FGQA 3BNCA 3EHCA 1I2FA 1Q9EA 3FKAA 3RGRA 4AKYA 4EC6A 1RMSA 1BSEA 3X41A 1A2KA 2UUGC 1TJDA 2GU3A 1OF5B 4KVHA 3OWYA 3EC9A 1W6GA 5JPUA 1BNIA 4LEHA 3MSOA 2W9PA 3BIRA 1OF5A 1BANA 3D3LA 3KFQC 4R9KA 3FF0A 1UCLA 4LGQA 2INXA 3ECFA 4HM0B 3D4AA 2OOVA 1VQK3 3F8HA 1CQSA 1O7PB 3FCSB 1IVWA 2QIYA 3CNMA 4HM1B 3MYTA 5LC7A 5G1LA 3MG3A 3CU3A 3EQQB 1YVSA 4MMYB 4KZ1A 3KZTA 1R4CA 1DVCA 1O7GB 3HOHA 2R41A 3GZBA 2J8XB 2CWTA 1VZZA 2W6JH 3OXAA 3EBYA 5ELJA 3MG1A 1CYVA 4O02B 5EVHA 1M904 2JQ5A 1LVNA 2Z6BA 3K0ZA 1G0TA 1W4NA 4BL3A 5G2GA 1AR0A 4HJLB 3BNEA 3DGNA 1VQ73 1S723 2F98A 2B24B 1ISKA 1RGAA 1UUGB 5TGNA 3WDGB 1RTUA 1PYLA 1VQP3 4WP5A 4N6TA 3LTAA 5M1AA 2GBXB 3PCSA 1VQL3 1YJ93 2CFDA 3LT8A 4HM2B 4I4KA 5AIIA 1E3RA 3K5TA 2LYXA 1T5YA 3HK4A 3JUPA 4NPBA 2D42A 4MMZB 4FCZA 1YJN3 1DVDA 3KSPA 1B20A 3CNXA 4FMAA 1G02A 1ZGXA 3NV0A 5CLKA 1KD14 2B1XB 4RBNA 1RGFA 3UNLA 2STDA 4GHOA 1WMOA 1IV9A 1NNVA 2GEYA 2H0HA 1K41A 2O3OA 3N9HA 5AIGA 2MF7A 2F99A 4HOHA 1CH0A 3K63A 1VQO3 4GSPA 3G6E3 1FGOA 2KAAA 2P0XA 3VGNA 1JBRA 3BB9A 2SARA 1ROVA 1QMAA 4N6UA 3MG2A 2YX9A 2D1WA 1E3VA 2Z76A 1OHSA 1YIT3 2BMOB 1WMPA 1I8VA 2RFRA 2CH9A 3JUQA 1IVUA 2C4BA 2XF3A 4HYZA 3SX1A 1O7WB 3DGYA 2RNTA 4BU4A 4EYCA 2CX1A 1RGGA 1Z1SA 5AEWB 2Q07A 1PFPA 2P09A 5IENA 1W2ZA 1LNIA 1OH0A 3SYUA 3Q1CA 5D81A 3EN8A 2OQEC 1Q7Y4 1TTOA 4CJNA 1RGLA 1JRQA 1WMNA 1GMQA 3BNDA 4OVMA 3DXOA 4X2HA 3EB8A 1I3IA 2QGUA 3JUNA 1RGCA 4WFOA 3QK9A 2IUJA 2F4YA 3FF2A 3JUMA 3N54B 1SQWA 1HU9A 2ZA4A 1UCJA 2HMMB 3HIGA 3FG4A 1MWSA 3SLUA 4AEQA 3X40A 3S28A 2Y73A 3GRDA 3ROBA 3CC73 2CK3H 3URPA 4J8TA 4HZ9B 1LXEA 2UX0A 1BSDA 1O7NB 3SOAA 2XFSA 3KIIA 1PU4A 5AYRB 1MNLA 4WYKA 1HKXA 4XDWA 3U1WA 1BNRA 5HGRA 1GD4A 7STDA 1ULIB 1ZO2A 2OCTA 2WGOA 1WTHA 2FGTA 2P0MA 2BMRB 3KSED 3LTDA 3F8XA 5CF2A 4XDVA 2L4VA 3NQYA 4R80A 2WGQA 4NHFA 2H0IA 1EKMA 1N9EA 3NBBA 1YNVX 5LC6A 1IV7A 1DYUA 3KCHA 5A0OB 2WO0A 4J5KA 1EA2A 1BNEA 3FSDA 5RNTA 1BVIA 1V57A 3X3YA 2CW9A 5IG0A 2R4IA 4XB5A 3UL5A 3DGLA 3MKIA 2GEXA 4OUQA 1TU5A 3OWUA 2IA7A 2KXGA 4R4KA 4HM7B 1IT8A 1UUWB 1GD3A 4WWUC 1VQM3 3FG1A 4QWTA 1X1UA 1R4YA 1EQKA 3STDA 3WMDA 1JKGB 2CFLA 1IT7A 1IDPA 2BIRA 1K28A 1LOVA 1Q864 1W02A 3FZWA 4HM5B 1DMNA 1W6CA 2CC3A 5IF6A 3CXC2 1CEWI 1YGWA 1D6YA 4J5GA 1F8NA 4BTYA 2W04A 1BNSA 3AMOB 2LQVA 1RGKA 1FZUA 1A2VA 3OX9A 3F40A 1I2EA 3EBTA 3X42A 4Q53A 5IG5A 3A76A 1Q814 1BSBA 1RRLA 4XBXA 3V98A 3LZAA 1GOUA 1X1XA 5AI1A 1C54A 4FMCA 2M7OA 3CME3 1CYUA 3OW22 1K8A4 1BRIA 4L8OA 4ILFA 3EE1A 5FGOA 1Y4KA 5GSPA 1DE3A 3LTCA 3T8NA 2IYJA 3FLJA 5DRVA 4CPKA 5IG4A 5JPPA 4WYKB 1RDSA 1KQS2 1FA3A 3MWZA 2YFIB 3WR2A 3CCL3 3UJMA 2FXTA 3WOEB 1EG9B 1FGMA 2HMNB 2IUKA 1I0XA 2CIUA 3ZG0A 1N8R4 1W00A 1GSPA 1BNGA 1SJWA 1UI7A 1RRHA 1TFKA 2MC8A 1SIIA 4LMIA 3U97A 1ROAA 3TDGA 3Q3FA 4K61A 3V92A 3DZLA 1E97A 1W2B2 3LMLA 1RN4A 1YHQ3 1AVKA 1Q40A 2BNGA 2FNQA 1J2BA 3DGOA 1L5GB 1MGRA 1TFOA 4EV2A 4N6NB 2XSOB 3NBJA 4FR9A 1STDA 2PZVA 1JN5A 4U13A 1HZ1A 1BUQA 3SEDA 5IEOA 8RNTA 3S29A 4MEIA 1IQXA 1KWIA 2CFKA 1G96A 3NQZA 3QRDA 4K1VA 3NX0A 1FGRA 1O7MB 4N6V0 1WNHA 3EN1B 1TIJA 1UUVB 3OWSA 4HBRA 2K0MA 4TX4A 1NU3A 2HMKB 1EUIC 1GMRA 4O2HA 4GB5A 4O8SA 1VQ83 1BNJA 5AIHA 2W56B 1NJI4 1LOWA 4MJDA 1IVVA 2CKFB 2HMJB 5FW5A 1C7HA 2GSPA 4H3UA 4EW5A 2QEX3 1RHLA 1FW7A 3DUKA 3JVCA 3AGNA 2CFGA 2ZDJA 4HVNA 2AADA 1D6ZA 1RCKA 1B2MA 2PNCA 1VQQA 1M1K4 1GOYA 2XRXB 1SIHA 3NBRA 3PGBA 1TUHA 1A67A 2I9WA 7RNTA 3CCS3 4N6MA 3G8ZA 4R9LA 1JV2B 3KKGA 4FCMA 2ZL8A 1BSAA 5AIFA 1LNHA 4O3VA 4CCVA 1Q42A 2E2TA 2E2VA 3Q90A 1TRQA 1NB5I 3GAXA 5IEPA 4NREA 1YI23 3A5EA 2GBWB 2ML6A 2W9QA 2OOVC 2KCDA 3SXXA 2WOHA 4ORLA 1K734 2Z7AA 4HKVB 3T8UA 1BAOA 1JN5B 1UI8A 1IU7A 5G1KA 1T2IA 1UW1A 2CG1A 2RSXA 1A90A 3CCR3 3GSPA 1IYYA 1UGIA 1UGHI 5EQLA 3RDEA 5CK6A 3S27A 4MMXB 4ZM8A 2CWVA 3WA2X 1RSNA 1U8CB 5AEUB 1RNTA 5KP4A 5KP1A 1JB4A 3RGAA 3CCU3 1MWRA 3CCM3 3CC43 1YJW3 5CXOA 5BIRA 1NB3I 3PYJA 1QAKA 2Y74A 3D79A 3DH2A 4BL2A 4H61A 1BIRA 2AAEA 3NHXA 5ELUA 2XGNA 2WOFA 4KFEA 1LQMB 1STFI 2E2UA 1N9JA 1BU4A 2HMLB 4GL6A 4LSOA 1B3SA 7GSPA 2F5WA 2QA43 2V1LA 2H0GA 3NM2A 3CC23 1GS3A 2BT3A 1YVBI 4FMDA 1BRJA 1ZS7A 1OGZA 1OHPA 3D5GA 4N3VA 3ZFZA 5CF1A 3G4S3 2W03A 1JNQA 3LT9A 1FYSA 2XGLA 3HX8A 4K1UA 3VSYA 3EJVA 3IMAB 3IPTA 4KFFA 2KF6A 3LH4A 3CMA3 1EEJA 3NUVA 1BOXA 4BTXA 2UGIA 4BTWA 3DMCA 5KP3A 2W0QA 1RKYA 1Q824 1QVG2 3F7XA 1VQ93 2CWUA 1MGWA 2CHCA 3BU4A 3K7CA 4EV5A 3OV4A 1BSCA 5BXQA 1OHOA 3L0RA 2YFJB 3CD63 2CFWA 3B8LA 2RCDA 1N5PA 1FUTA 2P38A 1YGEA 3NXJA 1N8QA 4N6OB 3DGMA 3AHWA 1GOVA 4XBTA 3H51A 1BUJA 1OACA 3MHEA 6STDA 1Q7HA 3B4OA 1MWTA 3LYGA 3DY5A 6GSPA 1I3FA 1B27A 4G1MB 3K9MC 1AY7A 1BRSA 3CPOA 2F5MA 2CX0A 3F14A 1A2PA 3S67A 4CDLA 3FG3A 1I0VA 2IY2A 1UDII 1VQ43 1VQ53 2K54A 3I0YA 4LYLB 4KFDA 3PXMA 1VQN3 4FCJA 3CPW2 3RNTA 1BGSA 1V58A 2F86B 2XFTA 1I70A 4HM3B 5M19A 1US1A 4K90B 1M1XB 3X3XA 3F9SA 3S5CA 4RZMA 4X2OA 1GY7A 1X1YA 2GXFA 1UCIA 1JBSA 1BRNL 1RGEA 1IK3A 1AVLA 3V99A 5JBSA 1YIJ3 2L1SA 2P05A 2Z77A 3AHSA 4L7KA 1ULJB 1MOLA 2XEPA 2CG0A 5IW9A 4I5QA 2K3DA 3B7CA 3GZRA 1M9GA 2W56A 1V74A 3LXUX 3ALAA 4FMBA 4HAAA 3CCJ3 3AMOA 4DKIA 1S5AA 3SVAA 1W01A 2BU4A 1B2XA 3EX9A 3G713 1RJOA 3I553 3N8BA 4IIAA 3UB1A 2KF5A 3GZXB 3HIIA 4L8PA 3J7Yd 1IQ8A 1JKGA 4R1KA 3WOFB 3LOYA 1TP6A 3ER7A 2XR8B 3MPHA 4N6LA 2XSHB 5D83A 1W6YA 3CCV3 3FGYA 4EXRA 3BNBA 1OUNA 3HZPA 1GYBA 2OTJ3 3EF8A 2BMQB 2KF4A 3BLZA 2YFLB 3E99A 3H3HA 1RGHA 2BHMA 4IT7A 1SARA 1FUSA 3ZG5A 1JZOA 1T3BA 3D9RA 4LZIA 1RN7A 6RNTA 1KC84 1AV4A 1BRHA 1JJ22 3HI7A 4RNZA 1AQZA 2A15A 1OCVA 3WA3A 1JBTA 2XH9A 1LOYA 2O9UX 3M8CA 1BRKA 1RNBA 1QAFA 1PY3A 1LQGC 1MWUA 1SPUA 1GMPA 2HMOB 3PS8A 3Q2PA 4JF8A 1B2UA 2C10A 3WHOA 8CHOA 3T0UA 3GZYB 1D6UA 4PEJA 2GU1A 2SBLA 1JB5A 1W5ZA 4HM6B 3SOYA 3NV0B 1U5OA 1DMMA 1NDOB 1KSIA 1B2ZA 3G16A 1QJGA 1RLSA 4HM8B 5IERA 1RCLA 4EBGA 3KN4A 3NM7A 2OTL3 5M18A 3D5IA 1JZDA 3DM8A 4RNYA 2W2CA 1JB2A 1FUWA 4IPBA 2C11A 2RGQA 4OK0A 4HZBB 9RNTA 1IVXA 3FH1A 1T2HA 1GY5A 1NO3A 4KT3B 1OPYA 1IQYA 2OQEA 1VQ63 3B4PA 5DREA 2HOHA 1B21A
chains in the Genus database with same CATH topology
2ML5A 1QALA 3O8YA 3JUOA 3GWRA 2OWPA 3CCE3 1ZX2A 2KRTA 3G0KA 5STDA 3VF1A 2JDIH 1LOXA 3F7SA 3PCRA 2IMJA 4HM4B 3UL6A 3LTBA 1K9M4 2BO9B 3IJEB 5BVBA 5D82A 4WHAA 5IG3A 1QVF2 4JRFA 3I563 1Q40B 3KE7A 1NWWA 1O7HB 3PZWA 5I97A 1ASKA 1FGTA 1WQLB 3X3ZA 4STDA 3CCQ3 3WODG 1OGXA 5AYSC 4AKZA 1N5HA 4XBYA 1GY6A 4XM4A 5EEOA 4J9AA 1W7CA 1DMQA 1FGQA 3BNCA 3EHCA 3RGRA 4AKYA 3FKAA 4EC6A 1VQ63 3X41A 1A2KA 2GU3A 1OF5B 4KVHA 3OWYA 3EC9A 1W6GA 5JPUA 4LEHA 3MSOA 1OF5A 3D3LA 3KFQC 4R9KA 3FF0A 4LGQA 2INXA 3ECFA 4HM0B 1VQK3 2OOVA 3F8HA 1CQSA 1O7PB 3FCSB 1IVWA 2QIYA 3CNMA 4HM1B 3MYTA 5LC7A 3MG3A 3CU3A 3EQQB 4MMYB 4KZ1A 3KZTA 1R4CA 1DVCA 1O7GB 3GZBA 2CWTA 1VZZA 2W6JH 3OXAA 3EBYA 5ELJA 3MG1A 1CYVA 4O02B 5EVHA 1M904 2JQ5A 1LVNA 2Z6BA 3K0ZA 1W4NA 5G2GA 1AR0A 4HJLB 3BNEA 3DGNA 1VQ73 1S723 2F98A 2B24B 1ISKA 5TGNA 3WDGB 1VQP3 4WP5A 4N6TA 3LTAA 2GBXB 3PCSA 1VQL3 1YJ93 2CFDA 3LT8A 4HM2B 4I4KA 5AIIA 1E3RA 3K5TA 2LYXA 1T5YA 3HK4A 3JUPA 1YJN3 2D42A 4MMZB 4FCZA 1DVDA 3KSPA 4FMAA 3CNXA 1KD14 3NV0A 5CLKA 2B1XB 4RBNA 3UNLA 2STDA 1WMOA 1IV9A 2GEYA 2O3OA 1K41A 3N9HA 5AIGA 2MF7A 2F99A 3K63A 1VQO3 3G6E3 1FGOA 2P0XA 3VGNA 3BB9A 1ROVA 1QMAA 4N6UA 3MG2A 2YX9A 2D1WA 1E3VA 2Z76A 1OHSA 1YIT3 2BMOB 1WMPA 2RFRA 2CH9A 3JUQA 1IVUA 2XF3A 4HYZA 3SX1A 4EYCA 1O7WB 1Z1SA 5AEWB 2Q07A 1PFPA 2P09A 5IENA 1W2ZA 1OH0A 3Q1CA 5D81A 3EN8A 2OQEC 1Q7Y4 1JRQA 1WMNA 4OVMA 3BNDA 4X2HA 3DXOA 3EB8A 4WFOA 2QGUA 3JUNA 3QK9A 2IUJA 3FF2A 3JUMA 3N54B 1SQWA 1HU9A 3HIGA 3SLUA 2HMMB 4AEQA 3FG4A 3X40A 3S28A 2Y73A 3GRDA 3ROBA 3CC73 2CK3H 4J8TA 4HZ9B 1LXEA 2UX0A 3SOAA 1O7NB 2XFSA 3KIIA 1PU4A 5AYRB 1MNLA 4WYKA 1HKXA 4XDWA 3U1WA 5HGRA 1GD4A 7STDA 1ULIB 1ZO2A 2OCTA 2WGOA 1WTHA 2FGTA 2P0MA 2BMRB 3KSED 3LTDA 3F8XA 5CF2A 4XDVA 2L4VA 3NQYA 4R80A 2WGQA 4NHFA 1EKMA 1N9EA 3NBBA 5LC6A 1IV7A 1DYUA 5A0OB 2WO0A 1EA2A 3FSDA 3X3YA 2CW9A 5IG0A 2R4IA 4XB5A 3UL5A 3DGLA 3MKIA 2GEXA 4OUQA 1TU5A 3OWUA 2IA7A 2KXGA 4R4KA 4HM7B 1IT8A 1UUWB 1GD3A 4WWUC 1VQM3 3FG1A 4QWTA 1EQKA 3STDA 3WMDA 1JKGB 2CFLA 1IT7A 1IDPA 1K28A 1Q864 1W02A 3FZWA 4HM5B 1DMNA 1W6CA 2CC3A 5IF6A 3CXC2 1CEWI 1D6YA 4BTYA 1F8NA 2W04A 3AMOB 2LQVA 1A2VA 3OX9A 3F40A 3EBTA 3X42A 4Q53A 5IG5A 3A76A 1Q814 1RRLA 4XBXA 3V98A 3LZAA 5AI1A 4FMCA 2M7OA 3CME3 1CYUA 3OW22 1K8A4 4L8OA 3EE1A 5FGOA 1Y4KA 3LTCA 3T8NA 3FLJA 5JPPA 5DRVA 1KQS2 5IG4A 1FA3A 4WYKB 3MWZA 2YFIB 3CCL3 3UJMA 2FXTA 3WOEB 1EG9B 1FGMA 2HMNB 2IUKA 2CIUA 1N8R4 1SJWA 1UI7A 1W00A 2MC8A 1RRHA 1TFKA 1SIIA 4LMIA 3U97A 1ROAA 3TDGA 4K61A 3V92A 3DZLA 1E97A 1W2B2 3LMLA 1YHQ3 1AVKA 1Q40A 2BNGA 2FNQA 1J2BA 3DGOA 1L5GB 4EV2A 1TFOA 4N6NB 2XSOB 3NBJA 4FR9A 1STDA 2PZVA 1JN5A 4U13A 1BUQA 3SEDA 5IEOA 3S29A 4MEIA 1IQXA 1KWIA 2CFKA 1G96A 3NQZA 3QRDA 4K1VA 3NX0A 1FGRA 1O7MB 4N6V0 1WNHA 3EN1B 1TIJA 1UUVB 3OWSA 4HBRA 2K0MA 4TX4A 1NU3A 2HMKB 4O2HA 4GB5A 4O8SA 1VQ83 5AIHA 2W56B 1NJI4 4MJDA 1IVVA 2CKFB 2HMJB 5FW5A 1C7HA 4H3UA 2QEX3 3DUKA 3JVCA 2CFGA 4HVNA 1D6ZA 2PNCA 1M1K4 2XRXB 1SIHA 3NBRA 3PGBA 1TUHA 1A67A 2I9WA 3CCS3 4N6MA 3G8ZA 4R9LA 1JV2B 3KKGA 4FCMA 2ZL8A 5AIFA 1LNHA 4O3VA 4CCVA 1Q42A 2E2TA 2E2VA 3Q90A 1NB5I 3GAXA 5IEPA 4NREA 1YI23 2GBWB 2ML6A 2W9QA 2OOVC 2KCDA 3SXXA 2WOHA 4ORLA 1K734 2Z7AA 4HKVB 3T8UA 1JN5B 1UI8A 1IU7A 1UW1A 2CG1A 1A90A 2RSXA 3CCR3 5EQLA 3RDEA 5CK6A 3S27A 4MMXB 4ZM8A 2CWVA 3WA2X 1U8CB 5AEUB 5KP4A 5KP1A 1JB4A 3RGAA 3CCU3 3CCM3 3CC43 1YJW3 5CXOA 1NB3I 3PYJA 1QAKA 2Y74A 4H61A 3NHXA 5ELUA 2XGNA 2WOFA 4KFEA 1STFI 2E2UA 1N9JA 2HMLB 4GL6A 4LSOA 2QA43 2V1LA 3NM2A 3CC23 1GS3A 2BT3A 1YVBI 4FMDA 3G4S3 1OGZA 1OHPA 5CF1A 4N3VA 2W03A 1JNQA 3LT9A 3HX8A 2XGLA 4K1UA 3VSYA 3EJVA 3IMAB 3IPTA 4KFFA 3LH4A 3CMA3 4BTWA 3NUVA 4BTXA 1Q824 1VQ93 3DMCA 5KP3A 2W0QA 1RKYA 1QVG2 3F7XA 2CWUA 2CHCA 3K7CA 4EV5A 3OV4A 5BXQA 1OHOA 3L0RA 2YFJB 3CD63 2CFWA 3B8LA 2RCDA 1N5PA 2P38A 1YGEA 3NXJA 1N8QA 4N6OB 3DGMA 4XBTA 3H51A 1OACA 3MHEA 6STDA 3B4OA 3LYGA 3DY5A 4G1MB 3K9MC 3CPOA 3F14A 3S67A 4CDLA 3FG3A 1VQ43 1VQ53 2K54A 3I0YA 4KFDA 3PXMA 1VQN3 4FCJA 3CPW2 2F86B 2XFTA 4HM3B 1US1A 4K90B 1M1XB 3X3XA 3F9SA 3S5CA 4RZMA 4X2OA 1GY7A 2GXFA 1IK3A 1AVLA 3V99A 5JBSA 1YIJ3 2P05A 2Z77A 4L7KA 1ULJB 1MOLA 2XEPA 2CG0A 5IW9A 3B7CA 3GZRA 1M9GA 2W56A 1V74A 3LXUX 3ALAA 4FMBA 3CCJ3 3AMOA 1S5AA 3SVAA 1W01A 3G713 3EX9A 1RJOA 3I553 3N8BA 4IIAA 3UB1A 3GZXB 3HIIA 3J7Yd 4L8PA 1IQ8A 1JKGA 4R1KA 3WOFB 3LOYA 1TP6A 3ER7A 2XR8B 3MPHA 4N6LA 2XSHB 5D83A 1W6YA 3CCV3 3FGYA 4EXRA 3BNBA 1OUNA 3HZPA 1GYBA 2OTJ3 3EF8A 2BMQB 3BLZA 2YFLB 3E99A 3H3HA 2BHMA 4IT7A 3D9RA 4LZIA 1RN7A 1KC84 1AV4A 1JJ22 3HI7A 4RNZA 2A15A 1OCVA 3WA3A 2XH9A 2O9UX 3M8CA 1QAFA 4JF8A 1SPUA 2HMOB 3PS8A 3Q2PA 2C10A 8CHOA 3T0UA 3GZYB 1D6UA 4PEJA 2GU1A 2SBLA 1JB5A 1W5ZA 4HM6B 3SOYA 3NV0B 1U5OA 1DMMA 1NDOB 1KSIA 3G16A 1QJGA 4HM8B 5IERA 4EBGA 3KN4A 3NM7A 2OTL3 3DM8A 4RNYA 2W2CA 1JB2A 1FUWA 4IPBA 2C11A 2RGQA 4OK0A 4HZBB 1IVXA 3FH1A 1GY5A 1NO3A 1OPYA 1IQYA 2OQEA 3B4PA 5DREA 2ZDJA 2W9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NJI 4;  1W2B 2;  1VQN 3;  3CC7 3;  3CPW 2;  1YHQ 3;  3CD6 3;  1YJN 3;  3CCE 3;  1VQ6 3;  1K73 4;  2QEX 3;  3CME 3;  3OW2 2;  1K8A 4;  1VQM 3;  1KD1 4;  2QA4 3;  3CCR 3;  1M90 4;  3CC2 3;  2OTJ 3;  1M1K 4;  2OTL 3;  1YIJ 3;  1KQS 2;  1Q7Y 4;  1Q86 4;  3G4S 3;  1K9M 4;  3CCL 3;  1VQ7 3;  1S72 3;  3CXC 2;  1QVF 2;  1VQO 3;  3I56 3;  3G6E 3;  3CCS 3;  1KC8 4;  1JJ2 2;  1VQP 3;  1N8R 4;  3CCU 3;  3CCJ 3;  1VQK 3;  3CMA 3;  3CCM 3;  3CC4 3;  3CCQ 3;  1Q82 4;  3G71 3;  1YJW 3;  1VQ4 3;  1VQ5 3;  1QVG 2;  1VQL 3;  1YIT 3;  1VQ9 3;  3I55 3;  1VQ8 3;  3CCV 3;  1YJ9 3;  1Q81 4;  1YI2 3; 
#chains in the Genus database with same CATH topology
 2ML5 A;  1QAL A;  3O8Y A;  3AGO A;  3JUO A;  3GWR A;  1BRG A;  2OWP A;  2KF3 A;  1ZX2 A;  2KRT A;  3G0K A;  5STD A;  3VF1 A;  3CCE 3;  2JDI H;  1DET A;  1LOX A;  1TRP A;  3F7S A;  5HOH A;  3PCR A;  1I2G A;  4RNT A;  2IMJ A;  4HM4 B;  1RN1 A;  3UL6 A;  3LTB A;  5BU4 A;  2RBI A;  1K9M 4;  2BO9 B;  3IJE B;  1UCK A;  1X1W A;  5BVB A;  5D82 A;  4WHA A;  5IG3 A;  1QVF 2;  4JRF A;  3I56 3;  1Q40 B;  3KE7 A;  1NWW A;  1O7H B;  3PZW A;  5I97 A;  1ASK A;  1FGT A;  1WQL B;  3X3Z A;  4STD A;  3CCQ 3;  1B2S A;  3WOD G;  1BNF A;  2ZHX B;  1OGX A;  5AYS C;  4AKZ A;  1N5H A;  4XBY A;  1GY6 A;  4XM4 A;  1LRA A;  2F56 A;  5EEO A;  4J9A A;  4BIR A;  1W7C A;  1HYF A;  1DMQ A;  1FGQ A;  3BNC A;  3EHC A;  1I2F A;  1Q9E A;  3FKA A;  3RGR A;  4AKY A;  4EC6 A;  1RMS A;  1BSE A;  3X41 A;  1A2K A;  2UUG C;  1TJD A;  2GU3 A;  1OF5 B;  4KVH A;  3OWY A;  3EC9 A;  1W6G A;  5JPU A;  1BNI A;  4LEH A;  3MSO A;  2W9P A;  3BIR A;  1OF5 A;  1BAN A;  3D3L A;  3KFQ C;  4R9K A;  3FF0 A;  1UCL A;  4LGQ A;  2INX A;  3ECF A;  4HM0 B;  3D4A A;  2OOV A;  1VQK 3;  3F8H A;  1CQS A;  1O7P B;  3FCS B;  1IVW A;  2QIY A;  3CNM A;  4HM1 B;  3MYT A;  5LC7 A;  5G1L A;  3MG3 A;  3CU3 A;  3EQQ B;  1YVS A;  4MMY B;  4KZ1 A;  3KZT A;  1R4C A;  1DVC A;  1O7G B;  3HOH A;  2R41 A;  3GZB A;  2J8X B;  2CWT A;  1VZZ A;  2W6J H;  3OXA A;  3EBY A;  5ELJ A;  3MG1 A;  1CYV A;  4O02 B;  5EVH A;  1M90 4;  2JQ5 A;  1LVN A;  2Z6B A;  3K0Z A;  1G0T A;  1W4N A;  4BL3 A;  5G2G A;  1AR0 A;  4HJL B;  3BNE A;  3DGN A;  1VQ7 3;  1S72 3;  2F98 A;  2B24 B;  1ISK A;  1RGA A;  1UUG B;  5TGN A;  3WDG B;  1RTU A;  1PYL A;  1VQP 3;  4WP5 A;  4N6T A;  3LTA A;  5M1A A;  2GBX B;  3PCS A;  1VQL 3;  1YJ9 3;  2CFD A;  3LT8 A;  4HM2 B;  4I4K A;  5AII A;  1E3R A;  3K5T A;  2LYX A;  1T5Y A;  3HK4 A;  3JUP A;  4NPB A;  2D42 A;  4MMZ B;  4FCZ A;  1YJN 3;  1DVD A;  3KSP A;  1B20 A;  3CNX A;  4FMA A;  1G02 A;  1ZGX A;  3NV0 A;  5CLK A;  1KD1 4;  2B1X B;  4RBN A;  1RGF A;  3UNL A;  2STD A;  4GHO A;  1WMO A;  1IV9 A;  1NNV A;  2GEY A;  2H0H A;  1K41 A;  2O3O A;  3N9H A;  5AIG A;  2MF7 A;  2F99 A;  4HOH A;  1CH0 A;  3K63 A;  1VQO 3;  4GSP A;  3G6E 3;  1FGO A;  2KAA A;  2P0X A;  3VGN A;  1JBR A;  3BB9 A;  2SAR A;  1ROV A;  1QMA A;  4N6U A;  3MG2 A;  2YX9 A;  2D1W A;  1E3V A;  2Z76 A;  1OHS A;  1YIT 3;  2BMO B;  1WMP A;  1I8V A;  2RFR A;  2CH9 A;  3JUQ A;  1IVU A;  2C4B A;  2XF3 A;  4HYZ A;  3SX1 A;  1O7W B;  3DGY A;  2RNT A;  4BU4 A;  4EYC A;  2CX1 A;  1RGG A;  1Z1S A;  5AEW B;  2Q07 A;  1PFP A;  2P09 A;  5IEN A;  1W2Z A;  1LNI A;  1OH0 A;  3SYU A;  3Q1C A;  5D81 A;  3EN8 A;  2OQE C;  1Q7Y 4;  1TTO A;  4CJN A;  1RGL A;  1JRQ A;  1WMN A;  1GMQ A;  3BND A;  4OVM A;  3DXO A;  4X2H A;  3EB8 A;  1I3I A;  2QGU A;  3JUN A;  1RGC A;  4WFO A;  3QK9 A;  2IUJ A;  2F4Y A;  3FF2 A;  3JUM A;  3N54 B;  1SQW A;  1HU9 A;  2ZA4 A;  1UCJ A;  2HMM B;  3HIG A;  3FG4 A;  1MWS A;  3SLU A;  4AEQ A;  3X40 A;  3S28 A;  2Y73 A;  3GRD A;  3ROB A;  3CC7 3;  2CK3 H;  3URP A;  4J8T A;  4HZ9 B;  1LXE A;  2UX0 A;  1BSD A;  1O7N B;  3SOA A;  2XFS A;  3KII A;  1PU4 A;  5AYR B;  1MNL A;  4WYK A;  1HKX A;  4XDW A;  3U1W A;  1BNR A;  5HGR A;  1GD4 A;  7STD A;  1ULI B;  1ZO2 A;  2OCT A;  2WGO A;  1WTH A;  2FGT A;  2P0M A;  2BMR B;  3KSE D;  3LTD A;  3F8X A;  5CF2 A;  4XDV A;  2L4V A;  3NQY A;  4R80 A;  2WGQ A;  4NHF A;  2H0I A;  1EKM A;  1N9E A;  3NBB A;  1YNV X;  5LC6 A;  1IV7 A;  1DYU A;  3KCH A;  5A0O B;  2WO0 A;  4J5K A;  1EA2 A;  1BNE A;  3FSD A;  5RNT A;  1BVI A;  1V57 A;  3X3Y A;  2CW9 A;  5IG0 A;  2R4I A;  4XB5 A;  3UL5 A;  3DGL A;  3MKI A;  2GEX A;  4OUQ A;  1TU5 A;  3OWU A;  2IA7 A;  2KXG A;  4R4K A;  4HM7 B;  1IT8 A;  1UUW B;  1GD3 A;  4WWU C;  1VQM 3;  3FG1 A;  4QWT A;  1X1U A;  1R4Y A;  1EQK A;  3STD A;  3WMD A;  1JKG B;  2CFL A;  1IT7 A;  1IDP A;  2BIR A;  1K28 A;  1LOV A;  1Q86 4;  1W02 A;  3FZW A;  4HM5 B;  1DMN A;  1W6C A;  2CC3 A;  5IF6 A;  3CXC 2;  1CEW I;  1YGW A;  1D6Y A;  4J5G A;  1F8N A;  4BTY A;  2W04 A;  1BNS A;  3AMO B;  2LQV A;  1RGK A;  1FZU A;  1A2V A;  3OX9 A;  3F40 A;  1I2E A;  3EBT A;  3X42 A;  4Q53 A;  5IG5 A;  3A76 A;  1Q81 4;  1BSB A;  1RRL A;  4XBX A;  3V98 A;  3LZA A;  1GOU A;  1X1X A;  5AI1 A;  1C54 A;  4FMC A;  2M7O A;  3CME 3;  1CYU A;  3OW2 2;  1K8A 4;  1BRI A;  4L8O A;  4ILF A;  3EE1 A;  5FGO A;  1Y4K A;  5GSP A;  1DE3 A;  3LTC A;  3T8N A;  2IYJ A;  3FLJ A;  5DRV A;  4CPK A;  5IG4 A;  5JPP A;  4WYK B;  1RDS A;  1KQS 2;  1FA3 A;  3MWZ A;  2YFI B;  3WR2 A;  3CCL 3;  3UJM A;  2FXT A;  3WOE B;  1EG9 B;  1FGM A;  2HMN B;  2IUK A;  1I0X A;  2CIU A;  3ZG0 A;  1N8R 4;  1W00 A;  1GSP A;  1BNG A;  1SJW A;  1UI7 A;  1RRH A;  1TFK A;  2MC8 A;  1SII A;  4LMI A;  3U97 A;  1ROA A;  3TDG A;  3Q3F A;  4K61 A;  3V92 A;  3DZL A;  1E97 A;  1W2B 2;  3LML A;  1RN4 A;  1YHQ 3;  1AVK A;  1Q40 A;  2BNG A;  2FNQ A;  1J2B A;  3DGO A;  1L5G B;  1MGR A;  1TFO A;  4EV2 A;  4N6N B;  2XSO B;  3NBJ A;  4FR9 A;  1STD A;  2PZV A;  1JN5 A;  4U13 A;  1HZ1 A;  1BUQ A;  3SED A;  5IEO A;  8RNT A;  3S29 A;  4MEI A;  1IQX A;  1KWI A;  2CFK A;  1G96 A;  3NQZ A;  3QRD A;  4K1V A;  3NX0 A;  1FGR A;  1O7M B;  4N6V 0;  1WNH A;  3EN1 B;  1TIJ A;  1UUV B;  3OWS A;  4HBR A;  2K0M A;  4TX4 A;  1NU3 A;  2HMK B;  1EUI C;  1GMR A;  4O2H A;  4GB5 A;  4O8S A;  1VQ8 3;  1BNJ A;  5AIH A;  2W56 B;  1NJI 4;  1LOW A;  4MJD A;  1IVV A;  2CKF B;  2HMJ B;  5FW5 A;  1C7H A;  2GSP A;  4H3U A;  4EW5 A;  2QEX 3;  1RHL A;  1FW7 A;  3DUK A;  3JVC A;  3AGN A;  2CFG A;  2ZDJ A;  4HVN A;  2AAD A;  1D6Z A;  1RCK A;  1B2M A;  2PNC A;  1VQQ A;  1M1K 4;  1GOY A;  2XRX B;  1SIH A;  3NBR A;  3PGB A;  1TUH A;  1A67 A;  2I9W A;  7RNT A;  3CCS 3;  4N6M A;  3G8Z A;  4R9L A;  1JV2 B;  3KKG A;  4FCM A;  2ZL8 A;  1BSA A;  5AIF A;  1LNH A;  4O3V A;  4CCV A;  1Q42 A;  2E2T A;  2E2V A;  3Q90 A;  1TRQ A;  1NB5 I;  3GAX A;  5IEP A;  4NRE A;  1YI2 3;  3A5E A;  2GBW B;  2ML6 A;  2W9Q A;  2OOV C;  2KCD A;  3SXX A;  2WOH A;  4ORL A;  1K73 4;  2Z7A A;  4HKV B;  3T8U A;  1BAO A;  1JN5 B;  1UI8 A;  1IU7 A;  5G1K A;  1T2I A;  1UW1 A;  2CG1 A;  2RSX A;  1A90 A;  3CCR 3;  3GSP A;  1IYY A;  1UGI A;  1UGH I;  5EQL A;  3RDE A;  5CK6 A;  3S27 A;  4MMX B;  4ZM8 A;  2CWV A;  3WA2 X;  1RSN A;  1U8C B;  5AEU B;  1RNT A;  5KP4 A;  5KP1 A;  1JB4 A;  3RGA A;  3CCU 3;  1MWR A;  3CCM 3;  3CC4 3;  1YJW 3;  5CXO A;  5BIR A;  1NB3 I;  3PYJ A;  1QAK A;  2Y74 A;  3D79 A;  3DH2 A;  4BL2 A;  4H61 A;  1BIR A;  2AAE A;  3NHX A;  5ELU A;  2XGN A;  2WOF A;  4KFE A;  1LQM B;  1STF I;  2E2U A;  1N9J A;  1BU4 A;  2HML B;  4GL6 A;  4LSO A;  1B3S A;  7GSP A;  2F5W A;  2QA4 3;  2V1L A;  2H0G A;  3NM2 A;  3CC2 3;  1GS3 A;  2BT3 A;  1YVB I;  4FMD A;  1BRJ A;  1ZS7 A;  1OGZ A;  1OHP A;  3D5G A;  4N3V A;  3ZFZ A;  5CF1 A;  3G4S 3;  2W03 A;  1JNQ A;  3LT9 A;  1FYS A;  2XGL A;  3HX8 A;  4K1U A;  3VSY A;  3EJV A;  3IMA B;  3IPT A;  4KFF A;  2KF6 A;  3LH4 A;  3CMA 3;  1EEJ A;  3NUV A;  1BOX A;  4BTX A;  2UGI A;  4BTW A;  3DMC A;  5KP3 A;  2W0Q A;  1RKY A;  1Q82 4;  1QVG 2;  3F7X A;  1VQ9 3;  2CWU A;  1MGW A;  2CHC A;  3BU4 A;  3K7C A;  4EV5 A;  3OV4 A;  1BSC A;  5BXQ A;  1OHO A;  3L0R A;  2YFJ B;  3CD6 3;  2CFW A;  3B8L A;  2RCD A;  1N5P A;  1FUT A;  2P38 A;  1YGE A;  3NXJ A;  1N8Q A;  4N6O B;  3DGM A;  3AHW A;  1GOV A;  4XBT A;  3H51 A;  1BUJ A;  1OAC A;  3MHE A;  6STD A;  1Q7H A;  3B4O A;  1MWT A;  3LYG A;  3DY5 A;  6GSP A;  1I3F A;  1B27 A;  4G1M B;  3K9M C;  1AY7 A;  1BRS A;  3CPO A;  2F5M A;  2CX0 A;  3F14 A;  1A2P A;  3S67 A;  4CDL A;  3FG3 A;  1I0V A;  2IY2 A;  1UDI I;  1VQ4 3;  1VQ5 3;  2K54 A;  3I0Y A;  4LYL B;  4KFD A;  3PXM A;  1VQN 3;  4FCJ A;  3CPW 2;  3RNT A;  1BGS A;  1V58 A;  2F86 B;  2XFT A;  1I70 A;  4HM3 B;  5M19 A;  1US1 A;  4K90 B;  1M1X B;  3X3X A;  3F9S A;  3S5C A;  4RZM A;  4X2O A;  1GY7 A;  1X1Y A;  2GXF A;  1UCI A;  1JBS A;  1BRN L;  1RGE A;  1IK3 A;  1AVL A;  3V99 A;  5JBS A;  1YIJ 3;  2L1S A;  2P05 A;  2Z77 A;  3AHS A;  4L7K A;  1ULJ B;  1MOL A;  2XEP A;  2CG0 A;  5IW9 A;  4I5Q A;  2K3D A;  3B7C A;  3GZR A;  1M9G A;  2W56 A;  1V74 A;  3LXU X;  3ALA A;  4FMB A;  4HAA A;  3CCJ 3;  3AMO A;  4DKI A;  1S5A A;  3SVA A;  1W01 A;  2BU4 A;  1B2X A;  3EX9 A;  3G71 3;  1RJO A;  3I55 3;  3N8B A;  4IIA A;  3UB1 A;  2KF5 A;  3GZX B;  3HII A;  4L8P A;  3J7Y d;  1IQ8 A;  1JKG A;  4R1K A;  3WOF B;  3LOY A;  1TP6 A;  3ER7 A;  2XR8 B;  3MPH A;  4N6L A;  2XSH B;  5D83 A;  1W6Y A;  3CCV 3;  3FGY A;  4EXR A;  3BNB A;  1OUN A;  3HZP A;  1GYB A;  2OTJ 3;  3EF8 A;  2BMQ B;  2KF4 A;  3BLZ A;  2YFL B;  3E99 A;  3H3H A;  1RGH A;  2BHM A;  4IT7 A;  1SAR A;  1FUS A;  3ZG5 A;  1JZO A;  1T3B A;  3D9R A;  4LZI A;  1RN7 A;  6RNT A;  1KC8 4;  1AV4 A;  1BRH A;  1JJ2 2;  3HI7 A;  4RNZ A;  1AQZ A;  2A15 A;  1OCV A;  3WA3 A;  1JBT A;  2XH9 A;  1LOY A;  2O9U X;  3M8C A;  1BRK A;  1RNB A;  1QAF A;  1PY3 A;  1LQG C;  1MWU A;  1SPU A;  1GMP A;  2HMO B;  3PS8 A;  3Q2P A;  4JF8 A;  1B2U A;  2C10 A;  3WHO A;  8CHO A;  3T0U A;  3GZY B;  1D6U A;  4PEJ A;  2GU1 A;  2SBL A;  1JB5 A;  1W5Z A;  4HM6 B;  3SOY A;  3NV0 B;  1U5O A;  1DMM A;  1NDO B;  1KSI A;  1B2Z A;  3G16 A;  1QJG A;  1RLS A;  4HM8 B;  5IER A;  1RCL A;  4EBG A;  3KN4 A;  3NM7 A;  2OTL 3;  5M18 A;  3D5I A;  1JZD A;  3DM8 A;  4RNY A;  2W2C A;  1JB2 A;  1FUW A;  4IPB A;  2C11 A;  2RGQ A;  4OK0 A;  4HZB B;  9RNT A;  1IVX A;  3FH1 A;  1T2H A;  1GY5 A;  1NO3 A;  4KT3 B;  1OPY A;  1IQY A;  2OQE A;  1VQ6 3;  3B4P A;  5DRE A;  2HOH A;  1B21 A; 
#chains in the Genus database with same CATH homology
 2ML5 A;  1QAL A;  3O8Y A;  3JUO A;  3GWR A;  2OWP A;  3CCE 3;  1ZX2 A;  2KRT A;  3G0K A;  5STD A;  3VF1 A;  2JDI H;  1LOX A;  3F7S A;  3PCR A;  2IMJ A;  4HM4 B;  3UL6 A;  3LTB A;  1K9M 4;  2BO9 B;  3IJE B;  5BVB A;  5D82 A;  4WHA A;  5IG3 A;  1QVF 2;  4JRF A;  3I56 3;  1Q40 B;  3KE7 A;  1NWW A;  1O7H B;  3PZW A;  5I97 A;  1ASK A;  1FGT A;  1WQL B;  3X3Z A;  4STD A;  3CCQ 3;  3WOD G;  1OGX A;  5AYS C;  4AKZ A;  1N5H A;  4XBY A;  1GY6 A;  4XM4 A;  5EEO A;  4J9A A;  1W7C A;  1DMQ A;  1FGQ A;  3BNC A;  3EHC A;  3RGR A;  4AKY A;  3FKA A;  4EC6 A;  1VQ6 3;  3X41 A;  1A2K A;  2GU3 A;  1OF5 B;  4KVH A;  3OWY A;  3EC9 A;  1W6G A;  5JPU A;  4LEH A;  3MSO A;  1OF5 A;  3D3L A;  3KFQ C;  4R9K A;  3FF0 A;  4LGQ A;  2INX A;  3ECF A;  4HM0 B;  1VQK 3;  2OOV A;  3F8H A;  1CQS A;  1O7P B;  3FCS B;  1IVW A;  2QIY A;  3CNM A;  4HM1 B;  3MYT A;  5LC7 A;  3MG3 A;  3CU3 A;  3EQQ B;  4MMY B;  4KZ1 A;  3KZT A;  1R4C A;  1DVC A;  1O7G B;  3GZB A;  2CWT A;  1VZZ A;  2W6J H;  3OXA A;  3EBY A;  5ELJ A;  3MG1 A;  1CYV A;  4O02 B;  5EVH A;  1M90 4;  2JQ5 A;  1LVN A;  2Z6B A;  3K0Z A;  1W4N A;  5G2G A;  1AR0 A;  4HJL B;  3BNE A;  3DGN A;  1VQ7 3;  1S72 3;  2F98 A;  2B24 B;  1ISK A;  5TGN A;  3WDG B;  1VQP 3;  4WP5 A;  4N6T A;  3LTA A;  2GBX B;  3PCS A;  1VQL 3;  1YJ9 3;  2CFD A;  3LT8 A;  4HM2 B;  4I4K A;  5AII A;  1E3R A;  3K5T A;  2LYX A;  1T5Y A;  3HK4 A;  3JUP A;  1YJN 3;  2D42 A;  4MMZ B;  4FCZ A;  1DVD A;  3KSP A;  4FMA A;  3CNX A;  1KD1 4;  3NV0 A;  5CLK A;  2B1X B;  4RBN A;  3UNL A;  2STD A;  1WMO A;  1IV9 A;  2GEY A;  2O3O A;  1K41 A;  3N9H A;  5AIG A;  2MF7 A;  2F99 A;  3K63 A;  1VQO 3;  3G6E 3;  1FGO A;  2P0X A;  3VGN A;  3BB9 A;  1ROV A;  1QMA A;  4N6U A;  3MG2 A;  2YX9 A;  2D1W A;  1E3V A;  2Z76 A;  1OHS A;  1YIT 3;  2BMO B;  1WMP A;  2RFR A;  2CH9 A;  3JUQ A;  1IVU A;  2XF3 A;  4HYZ A;  3SX1 A;  4EYC A;  1O7W B;  1Z1S A;  5AEW B;  2Q07 A;  1PFP A;  2P09 A;  5IEN A;  1W2Z A;  1OH0 A;  3Q1C A;  5D81 A;  3EN8 A;  2OQE C;  1Q7Y 4;  1JRQ A;  1WMN A;  4OVM A;  3BND A;  4X2H A;  3DXO A;  3EB8 A;  4WFO A;  2QGU A;  3JUN A;  3QK9 A;  2IUJ A;  3FF2 A;  3JUM A;  3N54 B;  1SQW A;  1HU9 A;  3HIG A;  3SLU A;  2HMM B;  4AEQ A;  3FG4 A;  3X40 A;  3S28 A;  2Y73 A;  3GRD A;  3ROB A;  3CC7 3;  2CK3 H;  4J8T A;  4HZ9 B;  1LXE A;  2UX0 A;  3SOA A;  1O7N B;  2XFS A;  3KII A;  1PU4 A;  5AYR B;  1MNL A;  4WYK A;  1HKX A;  4XDW A;  3U1W A;  5HGR A;  1GD4 A;  7STD A;  1ULI B;  1ZO2 A;  2OCT A;  2WGO A;  1WTH A;  2FGT A;  2P0M A;  2BMR B;  3KSE D;  3LTD A;  3F8X A;  5CF2 A;  4XDV A;  2L4V A;  3NQY A;  4R80 A;  2WGQ A;  4NHF A;  1EKM A;  1N9E A;  3NBB A;  5LC6 A;  1IV7 A;  1DYU A;  5A0O B;  2WO0 A;  1EA2 A;  3FSD A;  3X3Y A;  2CW9 A;  5IG0 A;  2R4I A;  4XB5 A;  3UL5 A;  3DGL A;  3MKI A;  2GEX A;  4OUQ A;  1TU5 A;  3OWU A;  2IA7 A;  2KXG A;  4R4K A;  4HM7 B;  1IT8 A;  1UUW B;  1GD3 A;  4WWU C;  1VQM 3;  3FG1 A;  4QWT A;  1EQK A;  3STD A;  3WMD A;  1JKG B;  2CFL A;  1IT7 A;  1IDP A;  1K28 A;  1Q86 4;  1W02 A;  3FZW A;  4HM5 B;  1DMN A;  1W6C A;  2CC3 A;  5IF6 A;  3CXC 2;  1CEW I;  1D6Y A;  4BTY A;  1F8N A;  2W04 A;  3AMO B;  2LQV A;  1A2V A;  3OX9 A;  3F40 A;  3EBT A;  3X42 A;  4Q53 A;  5IG5 A;  3A76 A;  1Q81 4;  1RRL A;  4XBX A;  3V98 A;  3LZA A;  5AI1 A;  4FMC A;  2M7O A;  3CME 3;  1CYU A;  3OW2 2;  1K8A 4;  4L8O A;  3EE1 A;  5FGO A;  1Y4K A;  3LTC A;  3T8N A;  3FLJ A;  5JPP A;  5DRV A;  1KQS 2;  5IG4 A;  1FA3 A;  4WYK B;  3MWZ A;  2YFI B;  3CCL 3;  3UJM A;  2FXT A;  3WOE B;  1EG9 B;  1FGM A;  2HMN B;  2IUK A;  2CIU A;  1N8R 4;  1SJW A;  1UI7 A;  1W00 A;  2MC8 A;  1RRH A;  1TFK A;  1SII A;  4LMI A;  3U97 A;  1ROA A;  3TDG A;  4K61 A;  3V92 A;  3DZL A;  1E97 A;  1W2B 2;  3LML A;  1YHQ 3;  1AVK A;  1Q40 A;  2BNG A;  2FNQ A;  1J2B A;  3DGO A;  1L5G B;  4EV2 A;  1TFO A;  4N6N B;  2XSO B;  3NBJ A;  4FR9 A;  1STD A;  2PZV A;  1JN5 A;  4U13 A;  1BUQ A;  3SED A;  5IEO A;  3S29 A;  4MEI A;  1IQX A;  1KWI A;  2CFK A;  1G96 A;  3NQZ A;  3QRD A;  4K1V A;  3NX0 A;  1FGR A;  1O7M B;  4N6V 0;  1WNH A;  3EN1 B;  1TIJ A;  1UUV B;  3OWS A;  4HBR A;  2K0M A;  4TX4 A;  1NU3 A;  2HMK B;  4O2H A;  4GB5 A;  4O8S A;  1VQ8 3;  5AIH A;  2W56 B;  1NJI 4;  4MJD A;  1IVV A;  2CKF B;  2HMJ B;  5FW5 A;  1C7H A;  4H3U A;  2QEX 3;  3DUK A;  3JVC A;  2CFG A;  4HVN A;  1D6Z A;  2PNC A;  1M1K 4;  2XRX B;  1SIH A;  3NBR A;  3PGB A;  1TUH A;  1A67 A;  2I9W A;  3CCS 3;  4N6M A;  3G8Z A;  4R9L A;  1JV2 B;  3KKG A;  4FCM A;  2ZL8 A;  5AIF A;  1LNH A;  4O3V A;  4CCV A;  1Q42 A;  2E2T A;  2E2V A;  3Q90 A;  1NB5 I;  3GAX A;  5IEP A;  4NRE A;  1YI2 3;  2GBW B;  2ML6 A;  2W9Q A;  2OOV C;  2KCD A;  3SXX A;  2WOH A;  4ORL A;  1K73 4;  2Z7A A;  4HKV B;  3T8U A;  1JN5 B;  1UI8 A;  1IU7 A;  1UW1 A;  2CG1 A;  1A90 A;  2RSX A;  3CCR 3;  5EQL A;  3RDE A;  5CK6 A;  3S27 A;  4MMX B;  4ZM8 A;  2CWV A;  3WA2 X;  1U8C B;  5AEU B;  5KP4 A;  5KP1 A;  1JB4 A;  3RGA A;  3CCU 3;  3CCM 3;  3CC4 3;  1YJW 3;  5CXO A;  1NB3 I;  3PYJ A;  1QAK A;  2Y74 A;  4H61 A;  3NHX A;  5ELU A;  2XGN A;  2WOF A;  4KFE A;  1STF I;  2E2U A;  1N9J A;  2HML B;  4GL6 A;  4LSO A;  2QA4 3;  2V1L A;  3NM2 A;  3CC2 3;  1GS3 A;  2BT3 A;  1YVB I;  4FMD A;  3G4S 3;  1OGZ A;  1OHP A;  5CF1 A;  4N3V A;  2W03 A;  1JNQ A;  3LT9 A;  3HX8 A;  2XGL A;  4K1U A;  3VSY A;  3EJV A;  3IMA B;  3IPT A;  4KFF A;  3LH4 A;  3CMA 3;  4BTW A;  3NUV A;  4BTX A;  1Q82 4;  1VQ9 3;  3DMC A;  5KP3 A;  2W0Q A;  1RKY A;  1QVG 2;  3F7X A;  2CWU A;  2CHC A;  3K7C A;  4EV5 A;  3OV4 A;  5BXQ A;  1OHO A;  3L0R A;  2YFJ B;  3CD6 3;  2CFW A;  3B8L A;  2RCD A;  1N5P A;  2P38 A;  1YGE A;  3NXJ A;  1N8Q A;  4N6O B;  3DGM A;  4XBT A;  3H51 A;  1OAC A;  3MHE A;  6STD A;  3B4O A;  3LYG A;  3DY5 A;  4G1M B;  3K9M C;  3CPO A;  3F14 A;  3S67 A;  4CDL A;  3FG3 A;  1VQ4 3;  1VQ5 3;  2K54 A;  3I0Y A;  4KFD A;  3PXM A;  1VQN 3;  4FCJ A;  3CPW 2;  2F86 B;  2XFT A;  4HM3 B;  1US1 A;  4K90 B;  1M1X B;  3X3X A;  3F9S A;  3S5C A;  4RZM A;  4X2O A;  1GY7 A;  2GXF A;  1IK3 A;  1AVL A;  3V99 A;  5JBS A;  1YIJ 3;  2P05 A;  2Z77 A;  4L7K A;  1ULJ B;  1MOL A;  2XEP A;  2CG0 A;  5IW9 A;  3B7C A;  3GZR A;  1M9G A;  2W56 A;  1V74 A;  3LXU X;  3ALA A;  4FMB A;  3CCJ 3;  3AMO A;  1S5A A;  3SVA A;  1W01 A;  3G71 3;  3EX9 A;  1RJO A;  3I55 3;  3N8B A;  4IIA A;  3UB1 A;  3GZX B;  3HII A;  3J7Y d;  4L8P A;  1IQ8 A;  1JKG A;  4R1K A;  3WOF B;  3LOY A;  1TP6 A;  3ER7 A;  2XR8 B;  3MPH A;  4N6L A;  2XSH B;  5D83 A;  1W6Y A;  3CCV 3;  3FGY A;  4EXR A;  3BNB A;  1OUN A;  3HZP A;  1GYB A;  2OTJ 3;  3EF8 A;  2BMQ B;  3BLZ A;  2YFL B;  3E99 A;  3H3H A;  2BHM A;  4IT7 A;  3D9R A;  4LZI A;  1RN7 A;  1KC8 4;  1AV4 A;  1JJ2 2;  3HI7 A;  4RNZ A;  2A15 A;  1OCV A;  3WA3 A;  2XH9 A;  2O9U X;  3M8C A;  1QAF A;  4JF8 A;  1SPU A;  2HMO B;  3PS8 A;  3Q2P A;  2C10 A;  8CHO A;  3T0U A;  3GZY B;  1D6U A;  4PEJ A;  2GU1 A;  2SBL A;  1JB5 A;  1W5Z A;  4HM6 B;  3SOY A;  3NV0 B;  1U5O A;  1DMM A;  1NDO B;  1KSI A;  3G16 A;  1QJG A;  4HM8 B;  5IER A;  4EBG A;  3KN4 A;  3NM7 A;  2OTL 3;  3DM8 A;  4RNY A;  2W2C A;  1JB2 A;  1FUW A;  4IPB A;  2C11 A;  2RGQ A;  4OK0 A;  4HZB B;  1IVX A;  3FH1 A;  1GY5 A;  1NO3 A;  1OPY A;  1IQY A;  2OQE A;  3B4P A;  5DRE A;  2ZDJ A;  2W9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...