3CXC2

The structure of an enhanced oxazolidinone inhibitor bound to the 50s ribosomal subunit of h. marismortui
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
92
structure length
92
Chain Sequence
b'MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
molecule tags Ribosome
publication title Design at the atomic level: design of biaryloxazolidinones as potent orally active antibiotics.
pubmed doi rcsb
total genus 17
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3cxc200
1K734 3CC73 3CCJ3 3CC43 1K9M4 1QVG2 3CD63 1VQP3 1Q864 1M904 1VQ73 1Q7Y4 1VQ53 2OTL3 3CCU3 1W2B2 1YJW3 2QEX3 1KQS2 3CCQ3 1S723 1M1K4 1YIJ3 3CPW2 3G6E3 3OW22 1VQM3 1YJN3 1N8R4 1NJI4 1VQL3 3CCS3 1KD14 3CCM3 3CCL3 1YI23 1VQ63 1VQ93 2OTJ3 3G4S3 1QVF2 1YHQ3 2QA43 1Q814 3CCE3 1VQ43 3CMA3 3CCR3 1VQK3 3G713 3I563 3CCV3 1Q824 1YJ93 1VQO3 3CXC2 1VQ83 1KC84 3I553 1JJ22 1VQN3 3CME3 1K8A4 1YIT3 3CC23
chains in the Genus database with same CATH superfamily
1EUIC 3IPTA 1FGQA 4RZMA 5G2GA 1NO3A 1JB4A 4XDVA 3JUQA 2K54A 3O8YA 4BL2A 1ULJB 4LYLB 5IEPA 3EQQB 2GSPA 1YJW3 1W2B2 1B2MA 1LOYA 3ZG0A 2W0QA 3EF8A 5HOHA 2MF7A 1B2SA 3KE7A 3BNBA 2OCTA 4I5QA 1VQL3 1I0VA 1B27A 1SQWA 4GHOA 1DMMA 2CC3A 1I3IA 3SOYA 3PS8A 3DY5A 1BSDA 1ASKA 3G4S3 4R4KA 1IVWA 2KF5A 1I2EA 1OHSA 1IT8A 1G02A 4HM8B 1JBSA 1BSCA 3CCV3 1BNSA 5IG0A 1IYYA 1GSPA 1O7HB 4AKZA 1JN5B 1RMSA 1CYVA 1N9JA 2IY2A 1N5HA 3S5CA 1K734 3HIIA 1K9M4 4J5GA 3D3LA 1M904 3RNTA 5I97A 5D81A 3SXXA 1VQ73 1BIRA 2AAEA 1GMQA 5CF2A 4HM2B 2P0MA 2CWUA 2Z6BA 3LT9A 3Q1CA 3F7SA 8CHOA 2LQVA 8RNTA 4N6UA 1TUHA 2QIYA 1IK3A 1OUNA 2F98A 3B4PA 3F7XA 4QWTA 2IYJA 2L4VA 1BSEA 3IMAB 1DE3A 2GXFA 4EW5A 5CXOA 3H51A 3B8LA 1JZOA 1DYUA 2F5WA 3ALAA 1DMNA 3ER7A 4HKVB 4AKYA 2PNCA 1J2BA 3VGNA 1OHPA 2HMOB 5IG3A 9RNTA 1RLSA 1W6GA 1FUTA 1WMNA 2SBLA 5EVHA 1O7GB 3SX1A 2A15A 3HK4A 2GU1A 5BXQA 1FZUA 3E99A 3JUMA 3UL5A 2YFIB 1D6YA 2KRTA 2XGLA 1B3SA 3V99A 1MWRA 3CNXA 5CK6A 5AIIA 3G6E3 1YJN3 4N6MA 4WP5A 5AYSC 1T5YA 4LGQA 5AYRB 1BRJA 1FW7A 1KD14 5M1AA 3U97A 4NREA 3JUOA 1YI23 1HU9A 1T3BA 3FGYA 1T2HA 4FCZA 5D82A 1C54A 3JUNA 2F99A 4RNTA 3V92A 3K9MC 2YX9A 4CPKA 1Q9EA 2Z7AA 1BSAA 5JBSA 1JJ22 3AGNA 3NBRA 1LOWA 1W4NA 3WHOA 1RGCA 3WMDA 1UGIA 3ROBA 1ZO2A 3BU4A 1D6UA 3NQZA 1A2VA 1FYSA 2LYXA 5AIHA 1IVUA 2CWTA 1JV2B 1DVDA 1W00A 2ML5A 1S723 1SIHA 3TDGA 1SJWA 5IENA 3MPHA 1VQM3 4U13A 1W5ZA 2OOVA 2WOFA 1RCLA 1I70A 2CX0A 1YHQ3 1V74A 4N6V0 4LZIA 3EJVA 3DGNA 1CEWI 3KCHA 4BTYA 3I563 3HZPA 2W6JH 2F4YA 5IEOA 3LZAA 3LMLA 1VQ83 1IQXA 3JUPA 5EQLA 3EX9A 1IQ8A 4GL6A 4FMDA 1K8A4 3GZXB 4N3VA 2OWPA 1MGWA 3CC73 2O3OA 1QAFA 1UCLA 1VQ53 3LTDA 3UL6A 4K90B 4WFOA 1I3FA 4NHFA 2INXA 4EV5A 3IJEB 5M18A 4X2HA 4WYKA 1ZS7A 1NU3A 3U1WA 4CJNA 2W56A 3AMOB 1JKGA 3KZTA 3QRDA 4XBTA 3BNDA 4H3UA 2ZL8A 1GY7A 3BNEA 1AQZA 3KN4A 3MHEA 1Q814 1UW1A 2HMJB 3PGBA 1GY6A 1LQMB 1WQLB 3RGRA 2CFDA 3LOYA 1KC84 2R41A 2I9WA 4L8OA 2HMLB 3CC43 1TFOA 2F5MA 4R9LA 3RGAA 3T0UA 3F14A 1BUJA 1KWIA 4OUQA 4RNZA 2MC8A 1RGKA 1LVNA 3Q2PA 2CG0A 1FGOA 1LRAA 3AMOA 4HM4B 3NV0B 2XSOB 4KFEA 3EB8A 3OW22 1OGXA 1O7PB 1BAOA 4FMBA 2P38A 1CYUA 3K7CA 3OV4A 4R80A 3NX0A 2P05A 4FCMA 1GS3A 1M9GA 4OK0A 3FSDA 1JB5A 3CMA3 2GEYA 4EXRA 3N9HA 1N8QA 1OACA 1GOUA 1W7CA 2BMOB 1GYBA 3HIGA 3NUVA 1PFPA 5G1LA 1T2IA 4KFFA 4TX4A 4K1VA 5IG5A 1YGEA 3NBJA 3WOFB 4HOHA 5BIRA 1MWUA 1Q864 4WYKB 3WOEB 4OVMA 3SEDA 3GZYB 1QJGA 3M8CA 3LTCA 3SYUA 3GZRA 5JPPA 5A0OB 3PXMA 4HM5B 3F9SA 5LC7A 4JRFA 4STDA 7GSPA 1NJI4 1O7NB 6STDA 3K0ZA 2BIRA 1SARA 1ZGXA 5AIFA 4XM4A 3FCSB 3DXOA 3J7Yd 2C4BA 2RFRA 3OX9A 5BU4A 3MG3A 1MGRA 3CCR3 3BNCA 2KAAA 1L5GB 1OPYA 2D42A 2E2VA 5DRVA 2BT3A 2IUJA 3DGOA 3GWRA 3QK9A 1S5AA 1UGHI 2B1XB 1EEJA 3FF0A 1JNQA 1YVSA 1VQP3 1I2FA 3DGYA 3FF2A 4EBGA 4EYCA 5KP4A 4LSOA 2STDA 3N8BA 3X41A 3VSYA 1UCJA 1NB3I 1MWSA 3K63A 4BTXA 2W9PA 5CF1A 5IG4A 1VQQA 2BU4A 3NXJA 3SLUA 1JBTA 2L1SA 3D9RA 1TU5A 1RDSA 1N9EA 3F8HA 3GSPA 4J8TA 1RTUA 3MKIA 3D5IA 1PYLA 4AEQA 1STDA 3L0RA 3NBBA 1E3RA 1BRNL 1RJOA 4O02B 4EC6A 1B21A 4G1MB 2K3DA 1K28A 1FGRA 5FGOA 4JF8A 7RNTA 3GRDA 1RRLA 2OQEC 4J9AA 4HYZA 3LTBA 1JBRA 1IVXA 4ZM8A 2GBWB 2KF6A 3BB9A 1AV4A 1GOVA 1RSNA 1UI7A 1RHLA 2B24B 3KSED 4HVNA 2ZDJA 4HBRA 4XB5A 4N6LA 1PY3A 5HGRA 1A67A 1MNLA 3UJMA 3NV0A 2SARA 2F56A 3NQYA 2W03A 1CQSA 1TP6A 1BVIA 2OOVC 1UUVB 2RSXA 3BIRA 2GU3A 4HZ9B 2RNTA 1EQKA 3G713 3UNLA 3EHCA 4K1UA 1WTHA 4XBXA 1AR0A 1A2KA 3X3XA 2ZA4A 1LXEA 1I0XA 5KP1A 1YIT3 1YGWA 2Q07A 3CC23 2R4IA 1V58A 5KP3A 3NM2A 4PEJA 2ML6A 1UUGB 1VZZA 3H3HA 4IT7A 2K0MA 4O8SA 4L7KA 2GEXA 3D5GA 2RCDA 2CK3H 2H0IA 1BRKA 3CCQ3 1AVLA 5M19A 1A90A 4MMZB 1DETA 2WGOA 2J8XB 3FLJA 2H0HA 1X1UA 3MWZA 3KSPA 3EE1A 2XF3A 2CKFB 4GSPA 3SOAA 3CU3A 3OWYA 1LOVA 2WGQA 3CNMA 4L8PA 1VQ63 4MMXB 2XSHB 3S27A 2CFKA 1FGMA 3T8UA 1GD3A 3FKAA 1LOXA 4ORLA 2W9QA 1JZDA 3MG1A 1FGTA 1YVBI 5GSPA 3S28A 1BNIA 2XFTA 4HM0B 1WMOA 2OTL3 4LMIA 2CWVA 2FGTA 5ELJA 1BNEA 2CHCA 3CCU3 5FW5A 1I8VA 1A2PA 5G1KA 1C7HA 4ILFA 2IUKA 3V98A 1MOLA 2W56B 4MMYB 5IF6A 4LEHA 3CPW2 1E3VA 2YFLB 4X2OA 5AI1A 3CCS3 1TFKA 4H61A 1EG9B 1GMPA 1Q40A 1FUWA 2BMRB 2H0GA 1K41A 4KZ1A 2OTJ3 1BGSA 1ZX2A 2QGUA 2BHMA 1MWTA 1DMQA 4N6TA 1Q824 5IERA 3KKGA 3DGLA 3EC9A 1WMPA 3DH2A 1RGHA 1RGFA 4WWUC 3DM8A 1IVVA 5LC6A 1I2GA 1UCKA 3K5TA 3D79A 3N54B 4GB5A 1U5OA 3X42A 1RN7A 3MSOA 1RGAA 3F40A 3BLZA 1Q40B 1G0TA 2C11A 4HAAA 4K61A 1IT7A 1Z1SA 1SPUA 1W02A 1EA2A 2JQ5A 2UX0A 1HZ1A 2YFJB 3B7CA 1NWWA 1BRHA 3NHXA 4HM1B 4I4KA 1RGGA 3KIIA 1BSBA 3DGMA 1G96A 2WO0A 3MG2A 3CCL3 1AVKA 1NNVA 4FR9A 2BNGA 1QVF2 3EBYA 1U8CB 3A5EA 5AIGA 3HOHA 4CDLA 1BRSA 3CXC2 2P09A 1QMAA 1TRQA 3I0YA 1OHOA 2BO9B 4NPBA 5D83A 1X1WA 1QAKA 2KF3A 2W2CA 3CCJ3 2AADA 1GY5A 4BL3A 2JDIH 3URPA 3X40A 3ZG5A 1QVG2 1DVCA 3CD63 3OXAA 1X1YA 1W2ZA 1BOXA 2KCDA 1E97A 3LH4A 3VF1A 1O7MB 1IDPA 1O7WB 1R4CA 1ULIB 3UB1A 5AEWB 2CIUA 3S67A 1X1XA 2M7OA 4KVHA 1CH0A 4HJLB 4XBYA 3FH1A 1RGLA 2C10A 3CCM3 3DMCA 3RDEA 4Q53A 1UUWB 2WOHA 1PU4A 3OWUA 4BU4A 2QA43 1TRPA 2PZVA 2BMQB 4O3VA 4R1KA 1OCVA 1VQO3 1ISKA 2HMMB 6GSPA 5IW9A 2IMJA 3PZWA 2XH9A 1OF5B 1VQN3 1N5PA 1UI8A 2CX1A 1IV7A 2RBIA 1JRQA 2XEPA 5BVBA 1Q7HA 2FNQA 4DKIA 3D4AA 3DUKA 3PYJA 1B2UA 1TJDA 2Y74A 3GAXA 1US1A 4RBNA 3S29A 1QALA 2QEX3 1UDII 4IIAA 1IV9A 1V57A 5ELUA 4FCJA 4EV2A 1IU7A 3B4OA 2XRXB 2GBXB 1YIJ3 2Z77A 3EN8A 4RNYA 4KT3B 1BNFA 3ZFZA 1N8R4 4HM3B 3EBTA 2UUGC 1BUQA 1B2ZA 2F86B 2P0XA 3NM7A 4HM6B 3WA2X 2CW9A 2KF4A 1OF5A 5RNTA 1VQ43 1JN5A 1R4YA 2CFWA 3PCRA 2FXTA 1TIJA 1RN4A 2D1WA 4O2HA 1F8NA 1OGZA 5STDA 1W01A 4FMAA 4WHAA 1BNGA 1BNJA 3I553 3AHWA 1FA3A 3WA3A 1W6CA 1STFI 2CFLA 2KXGA 3WODG 3OWSA 3X3YA 1YNVX 3WDGB 3Q3FA 1Q7Y4 2E2TA 1RCKA 3HX8A 3X3ZA 2ZHXB 5CLKA 1BRGA 1RNBA 1JB2A 1B2XA 1M1K4 3FZWA 5AEUB 2V1LA 4J5KA 4MEIA 5JPUA 1RKYA 1RNTA 5DREA 3FG4A 1W6YA 2XFSA 3T8NA 1RGEA 1EKMA 1Y4KA 1HKXA 2W04A 2XR8B 5TGNA 2CG1A 3CPOA 3F8XA 1AY7A 1M1XB 5EEOA 1ROVA 2RGQA 3CCE3 1Q42A 3DZLA 1RRHA 1NB5I 3LT8A 1ROAA 2CFGA 2CH9A 3JVCA 4IPBA 2OQEA 4CCVA 1GD4A 4KFDA 3CME3 1FUSA 3FG3A 3G0KA 2O9UX 1IQYA 3LTAA 1JKGB 3KFQC 3AHSA 1WNHA 1LQGC 3Q90A 4N6OB 3WR2A 1GMRA 3FG1A 1RN1A 1GOYA 3STDA 3GZBA 3HI7A 4BTWA 1KQS2 2XGNA 3MYTA 3LYGA 7STDA 1BU4A 2HMKB 2E2UA 2UGIA 1BRIA 4N6NB 4R9KA 1LNHA 1KSIA 3ECFA 1B20A 1LNIA 3LXUX 1SIIA 3PCSA 2HOHA 1OH0A 3G16A 1VQ93 2Y73A 1NDOB 3EN1B 4HM7B 4FMCA 3SVAA 1HYFA 1D6ZA 4XDWA 4BIRA 4HZBB 1VQK3 1BNRA 6RNTA 1YJ93 1TTOA 2IA7A 3G8ZA 2HMNB 3AGOA 4MJDA 3A76A 2Z76A 1BANA 1UCIA
chains in the Genus database with same CATH topology
3IPTA 1FGQA 4RZMA 5G2GA 1NO3A 1JB4A 4XDVA 3JUQA 2K54A 3O8YA 1ULJB 5IEPA 3EQQB 1YJW3 1W2B2 2W0QA 3EF8A 2MF7A 3KE7A 3BNBA 2OCTA 1VQL3 1SQWA 1DMMA 2CC3A 3SOYA 3PS8A 3DY5A 1ASKA 3G4S3 4R4KA 1IVWA 1OHSA 1IT8A 4HM8B 3CCV3 5IG0A 1O7HB 4AKZA 1JN5B 1CYVA 1N9JA 1N5HA 3S5CA 1K734 3HIIA 1K9M4 3D3LA 1M904 5I97A 5D81A 3SXXA 1VQ73 5CF2A 4HM2B 2P0MA 2CWUA 2Z6BA 3LT9A 8CHOA 3F7SA 2LQVA 4N6UA 1TUHA 2QIYA 1IK3A 1OUNA 2F98A 3B4PA 3F7XA 4QWTA 2L4VA 3IMAB 2GXFA 5CXOA 3H51A 3B8LA 1DYUA 3ALAA 1DMNA 3ER7A 4HKVB 4AKYA 2PNCA 1J2BA 3VGNA 1OHPA 2HMOB 5IG3A 1W6GA 1WMNA 2SBLA 5EVHA 1O7GB 3SX1A 2A15A 3HK4A 2GU1A 5BXQA 3E99A 3JUMA 3UL5A 2YFIB 1D6YA 2KRTA 2XGLA 3V99A 3CNXA 5AIIA 5CK6A 3G6E3 1YJN3 4N6MA 4WP5A 5AYSC 1T5YA 4LGQA 5AYRB 1KD14 3U97A 4NREA 3JUOA 1YI23 1HU9A 3FGYA 4FCZA 5D82A 3JUNA 2F99A 3V92A 3K9MC 2YX9A 2Z7AA 5JBSA 1JJ22 3NBRA 1W4NA 3WMDA 3ROBA 1ZO2A 3NQZA 1D6UA 1A2VA 2LYXA 5AIHA 1IVUA 2CWTA 1JV2B 1DVDA 1W00A 2ML5A 1S723 1SIHA 3TDGA 1SJWA 5IENA 3MPHA 1VQM3 4U13A 1W5ZA 2OOVA 2WOFA 1YHQ3 1V74A 4N6V0 4LZIA 3EJVA 3DGNA 1CEWI 4BTYA 3I563 3HZPA 2W6JH 5IEOA 3LZAA 3LMLA 1VQ83 1IQXA 3JUPA 5EQLA 3EX9A 1IQ8A 4GL6A 4FMDA 1K8A4 3GZXB 4N3VA 2OWPA 3CC73 2O3OA 1QAFA 1VQ53 3LTDA 3UL6A 4K90B 4WFOA 4NHFA 2INXA 4EV5A 3IJEB 4X2HA 4WYKA 3U1WA 1NU3A 2W56A 3AMOB 1JKGA 3KZTA 3QRDA 4XBTA 3BNDA 4H3UA 2ZL8A 1GY7A 3BNEA 3MHEA 3KN4A 1Q814 1UW1A 2HMJB 3PGBA 1GY6A 1WQLB 3RGRA 2CFDA 3LOYA 1KC84 2I9WA 4L8OA 2HMLB 3CC43 1TFOA 3T0UA 4R9LA 3RGAA 3F14A 1KWIA 4OUQA 4RNZA 2MC8A 1LVNA 3Q2PA 2CG0A 1FGOA 3AMOA 4HM4B 3NV0B 2XSOB 4KFEA 3EB8A 3OW22 1OGXA 1O7PB 4FMBA 2P38A 1CYUA 3K7CA 3OV4A 4R80A 3NX0A 2P05A 4FCMA 1GS3A 1M9GA 4OK0A 3FSDA 1JB5A 3CMA3 2GEYA 4EXRA 3N9HA 1N8QA 1OACA 1W7CA 2BMOB 1GYBA 3HIGA 3NUVA 1PFPA 4KFFA 4TX4A 4K1VA 5IG5A 1YGEA 3NBJA 3WOFB 1Q864 4WYKB 3WOEB 4OVMA 3SEDA 3GZYB 1QJGA 3M8CA 3LTCA 3GZRA 5JPPA 5A0OB 3PXMA 4HM5B 3F9SA 5LC7A 4JRFA 4STDA 1NJI4 1O7NB 6STDA 3K0ZA 5AIFA 4XM4A 3FCSB 3DXOA 3J7Yd 2RFRA 3OX9A 3MG3A 3CCR3 3BNCA 1L5GB 1OPYA 2D42A 2E2VA 5DRVA 2BT3A 2IUJA 3DGOA 3GWRA 3QK9A 1S5AA 2B1XB 3FF0A 1JNQA 1VQP3 4EBGA 3FF2A 4EYCA 5KP4A 4LSOA 2STDA 3N8BA 3X41A 3VSYA 1NB3I 3K63A 5IG4A 4BTXA 2W9PA 5CF1A 3NXJA 3SLUA 3D9RA 1TU5A 1N9EA 3F8HA 4J8TA 3MKIA 4AEQA 1STDA 3L0RA 3NBBA 1E3RA 1RJOA 4O02B 4EC6A 4G1MB 1K28A 1FGRA 5FGOA 4JF8A 3GRDA 1RRLA 2OQEC 4J9AA 4HYZA 3LTBA 1IVXA 4ZM8A 2GBWB 3BB9A 1AV4A 2B24B 3KSED 1UI7A 4HVNA 2ZDJA 4HBRA 4XB5A 4N6LA 5HGRA 1A67A 1MNLA 3UJMA 3NV0A 3NQYA 2W03A 1CQSA 1TP6A 2OOVC 1UUVB 2RSXA 2GU3A 4HZ9B 1EQKA 3G713 3UNLA 3EHCA 4K1UA 1WTHA 4XBXA 1AR0A 1A2KA 3X3XA 1LXEA 5KP1A 1YIT3 2Q07A 3CC23 2R4IA 5KP3A 3NM2A 4PEJA 2ML6A 3H3HA 1VZZA 4IT7A 2K0MA 4O8SA 4L7KA 2GEXA 2RCDA 2CK3H 1A90A 3CCQ3 1AVLA 4MMZB 3FLJA 2WGOA 3MWZA 3KSPA 3EE1A 2XF3A 2CKFB 3SOAA 3CU3A 3OWYA 2WGQA 3CNMA 1VQ63 4L8PA 4MMXB 2XSHB 3S27A 2CFKA 1FGMA 3T8UA 1GD3A 3FKAA 1LOXA 4ORLA 2W9QA 3MG1A 1FGTA 1YVBI 3S28A 2XFTA 4HM0B 1WMOA 2OTL3 4LMIA 2CWVA 2FGTA 5ELJA 2CHCA 3CCU3 5FW5A 1C7HA 2IUKA 3V98A 1MOLA 2W56B 4MMYB 5IF6A 4LEHA 3CPW2 1E3VA 2YFLB 4X2OA 5AI1A 3CCS3 1TFKA 4H61A 1EG9B 1Q40A 1FUWA 2BMRB 1K41A 4KZ1A 2OTJ3 1ZX2A 2QGUA 2BHMA 4N6TA 1DMQA 1Q824 5IERA 3KKGA 3DGLA 3EC9A 1WMPA 4WWUC 3DM8A 1IVVA 5LC6A 3K5TA 3N54B 4GB5A 1U5OA 3X42A 1RN7A 3MSOA 3F40A 3BLZA 1Q40B 2C11A 4K61A 1IT7A 1Z1SA 1SPUA 1W02A 1EA2A 2JQ5A 2UX0A 2YFJB 3B7CA 3NHXA 1NWWA 4HM1B 4I4KA 3KIIA 3DGMA 1G96A 2WO0A 3MG2A 3CCL3 1AVKA 4FR9A 2BNGA 1QVF2 3EBYA 1U8CB 5AIGA 4CDLA 3CXC2 2P09A 1QMAA 3I0YA 1OHOA 2BO9B 5D83A 2W2CA 1QAKA 3CCJ3 1GY5A 1QVG2 2JDIH 3X40A 3CD63 1DVCA 3OXAA 1W2ZA 2KCDA 1E97A 3LH4A 3VF1A 1O7MB 1IDPA 1O7WB 1R4CA 1ULIB 3UB1A 5AEWB 2CIUA 3S67A 2M7OA 4KVHA 4HJLB 4XBYA 3FH1A 2C10A 3CCM3 3DMCA 3RDEA 4Q53A 1UUWB 2WOHA 1PU4A 3OWUA 2QA43 2PZVA 2BMQB 4O3VA 4R1KA 1OCVA 1VQO3 1ISKA 2HMMB 5IW9A 2IMJA 3PZWA 2XH9A 1OF5B 1VQN3 1N5PA 1UI8A 1IV7A 1JRQA 2XEPA 5BVBA 2FNQA 3DUKA 3PYJA 2Y74A 3GAXA 1US1A 4RBNA 3S29A 1QALA 2QEX3 4IIAA 1IV9A 5ELUA 4FCJA 4EV2A 1IU7A 3B4OA 2XRXB 2GBXB 1YIJ3 2Z77A 3EN8A 4RNYA 1N8R4 4HM3B 3EBTA 1BUQA 2F86B 2P0XA 3NM7A 4HM6B 3WA2X 2CW9A 1OF5A 1VQ43 1JN5A 2CFWA 3PCRA 2FXTA 1TIJA 2D1WA 4O2HA 1F8NA 1OGZA 5STDA 1W01A 4FMAA 4WHAA 3I553 1FA3A 3WA3A 1W6CA 1STFI 2CFLA 2KXGA 3WODG 3OWSA 3X3YA 3WDGB 1Q7Y4 2E2TA 3HX8A 3X3ZA 5CLKA 1JB2A 1M1K4 3FZWA 5AEUB 2V1LA 4MEIA 1RKYA 5JPUA 5DREA 3FG4A 1W6YA 2XFSA 3T8NA 1EKMA 1Y4KA 1HKXA 2W04A 2XR8B 5TGNA 2CG1A 3CPOA 3F8XA 5EEOA 1M1XB 1ROVA 2RGQA 3CCE3 1Q42A 3DZLA 1RRHA 1NB5I 3LT8A 1ROAA 2CFGA 2CH9A 3JVCA 4IPBA 2OQEA 4CCVA 1GD4A 4KFDA 3CME3 3FG3A 3G0KA 2O9UX 1IQYA 3LTAA 1JKGB 3KFQC 4N6OB 1WNHA 3Q90A 3FG1A 3STDA 3GZBA 3HI7A 4BTWA 1KQS2 2XGNA 3MYTA 3LYGA 7STDA 2HMKB 2E2UA 4N6NB 4R9KA 1LNHA 1KSIA 3ECFA 3LXUX 1SIIA 3PCSA 1OH0A 3G16A 1VQ93 2Y73A 1NDOB 3EN1B 4HM7B 4FMCA 3SVAA 1D6ZA 4XDWA 1VQK3 4HZBB 1YJ93 2IA7A 3G8ZA 2HMNB 4MJDA 3A76A 2Z76A 3Q1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K73 4;  3CC7 3;  3CCJ 3;  3CC4 3;  1K9M 4;  1QVG 2;  3CD6 3;  1VQP 3;  1Q86 4;  1M90 4;  1VQ7 3;  1Q7Y 4;  1VQ5 3;  2OTL 3;  3CCU 3;  1W2B 2;  1YJW 3;  2QEX 3;  1KQS 2;  3CCQ 3;  1S72 3;  1M1K 4;  1YIJ 3;  3CPW 2;  3G6E 3;  3OW2 2;  1VQM 3;  1YJN 3;  1N8R 4;  1NJI 4;  1VQL 3;  3CCS 3;  1KD1 4;  3CCM 3;  3CCL 3;  1YI2 3;  1VQ6 3;  1VQ9 3;  2OTJ 3;  3G4S 3;  1QVF 2;  1YHQ 3;  2QA4 3;  1Q81 4;  3CCE 3;  1VQ4 3;  3CMA 3;  3CCR 3;  1VQK 3;  3G71 3;  3I56 3;  3CCV 3;  1Q82 4;  1YJ9 3;  1VQO 3;  3CXC 2;  1VQ8 3;  1KC8 4;  3I55 3;  1JJ2 2;  1VQN 3;  3CME 3;  1K8A 4;  1YIT 3;  3CC2 3; 
#chains in the Genus database with same CATH topology
 1EUI C;  3IPT A;  1FGQ A;  4RZM A;  5G2G A;  1NO3 A;  1JB4 A;  4XDV A;  3JUQ A;  2K54 A;  3O8Y A;  4BL2 A;  1ULJ B;  4LYL B;  5IEP A;  3EQQ B;  2GSP A;  1YJW 3;  1W2B 2;  1B2M A;  1LOY A;  3ZG0 A;  2W0Q A;  3EF8 A;  5HOH A;  2MF7 A;  1B2S A;  3KE7 A;  3BNB A;  2OCT A;  4I5Q A;  1VQL 3;  1I0V A;  1B27 A;  1SQW A;  4GHO A;  1DMM A;  2CC3 A;  1I3I A;  3SOY A;  3PS8 A;  3DY5 A;  1BSD A;  1ASK A;  3G4S 3;  4R4K A;  1IVW A;  2KF5 A;  1I2E A;  1OHS A;  1IT8 A;  1G02 A;  4HM8 B;  1JBS A;  1BSC A;  3CCV 3;  1BNS A;  5IG0 A;  1IYY A;  1GSP A;  1O7H B;  4AKZ A;  1JN5 B;  1RMS A;  1CYV A;  1N9J A;  2IY2 A;  1N5H A;  3S5C A;  1K73 4;  3HII A;  1K9M 4;  4J5G A;  3D3L A;  1M90 4;  3RNT A;  5I97 A;  5D81 A;  3SXX A;  1VQ7 3;  1BIR A;  2AAE A;  1GMQ A;  5CF2 A;  4HM2 B;  2P0M A;  2CWU A;  2Z6B A;  3LT9 A;  3Q1C A;  3F7S A;  8CHO A;  2LQV A;  8RNT A;  4N6U A;  1TUH A;  2QIY A;  1IK3 A;  1OUN A;  2F98 A;  3B4P A;  3F7X A;  4QWT A;  2IYJ A;  2L4V A;  1BSE A;  3IMA B;  1DE3 A;  2GXF A;  4EW5 A;  5CXO A;  3H51 A;  3B8L A;  1JZO A;  1DYU A;  2F5W A;  3ALA A;  1DMN A;  3ER7 A;  4HKV B;  4AKY A;  2PNC A;  1J2B A;  3VGN A;  1OHP A;  2HMO B;  5IG3 A;  9RNT A;  1RLS A;  1W6G A;  1FUT A;  1WMN A;  2SBL A;  5EVH A;  1O7G B;  3SX1 A;  2A15 A;  3HK4 A;  2GU1 A;  5BXQ A;  1FZU A;  3E99 A;  3JUM A;  3UL5 A;  2YFI B;  1D6Y A;  2KRT A;  2XGL A;  1B3S A;  3V99 A;  1MWR A;  3CNX A;  5CK6 A;  5AII A;  3G6E 3;  1YJN 3;  4N6M A;  4WP5 A;  5AYS C;  1T5Y A;  4LGQ A;  5AYR B;  1BRJ A;  1FW7 A;  1KD1 4;  5M1A A;  3U97 A;  4NRE A;  3JUO A;  1YI2 3;  1HU9 A;  1T3B A;  3FGY A;  1T2H A;  4FCZ A;  5D82 A;  1C54 A;  3JUN A;  2F99 A;  4RNT A;  3V92 A;  3K9M C;  2YX9 A;  4CPK A;  1Q9E A;  2Z7A A;  1BSA A;  5JBS A;  1JJ2 2;  3AGN A;  3NBR A;  1LOW A;  1W4N A;  3WHO A;  1RGC A;  3WMD A;  1UGI A;  3ROB A;  1ZO2 A;  3BU4 A;  1D6U A;  3NQZ A;  1A2V A;  1FYS A;  2LYX A;  5AIH A;  1IVU A;  2CWT A;  1JV2 B;  1DVD A;  1W00 A;  2ML5 A;  1S72 3;  1SIH A;  3TDG A;  1SJW A;  5IEN A;  3MPH A;  1VQM 3;  4U13 A;  1W5Z A;  2OOV A;  2WOF A;  1RCL A;  1I70 A;  2CX0 A;  1YHQ 3;  1V74 A;  4N6V 0;  4LZI A;  3EJV A;  3DGN A;  1CEW I;  3KCH A;  4BTY A;  3I56 3;  3HZP A;  2W6J H;  2F4Y A;  5IEO A;  3LZA A;  3LML A;  1VQ8 3;  1IQX A;  3JUP A;  5EQL A;  3EX9 A;  1IQ8 A;  4GL6 A;  4FMD A;  1K8A 4;  3GZX B;  4N3V A;  2OWP A;  1MGW A;  3CC7 3;  2O3O A;  1QAF A;  1UCL A;  1VQ5 3;  3LTD A;  3UL6 A;  4K90 B;  4WFO A;  1I3F A;  4NHF A;  2INX A;  4EV5 A;  3IJE B;  5M18 A;  4X2H A;  4WYK A;  1ZS7 A;  1NU3 A;  3U1W A;  4CJN A;  2W56 A;  3AMO B;  1JKG A;  3KZT A;  3QRD A;  4XBT A;  3BND A;  4H3U A;  2ZL8 A;  1GY7 A;  3BNE A;  1AQZ A;  3KN4 A;  3MHE A;  1Q81 4;  1UW1 A;  2HMJ B;  3PGB A;  1GY6 A;  1LQM B;  1WQL B;  3RGR A;  2CFD A;  3LOY A;  1KC8 4;  2R41 A;  2I9W A;  4L8O A;  2HML B;  3CC4 3;  1TFO A;  2F5M A;  4R9L A;  3RGA A;  3T0U A;  3F14 A;  1BUJ A;  1KWI A;  4OUQ A;  4RNZ A;  2MC8 A;  1RGK A;  1LVN A;  3Q2P A;  2CG0 A;  1FGO A;  1LRA A;  3AMO A;  4HM4 B;  3NV0 B;  2XSO B;  4KFE A;  3EB8 A;  3OW2 2;  1OGX A;  1O7P B;  1BAO A;  4FMB A;  2P38 A;  1CYU A;  3K7C A;  3OV4 A;  4R80 A;  3NX0 A;  2P05 A;  4FCM A;  1GS3 A;  1M9G A;  4OK0 A;  3FSD A;  1JB5 A;  3CMA 3;  2GEY A;  4EXR A;  3N9H A;  1N8Q A;  1OAC A;  1GOU A;  1W7C A;  2BMO B;  1GYB A;  3HIG A;  3NUV A;  1PFP A;  5G1L A;  1T2I A;  4KFF A;  4TX4 A;  4K1V A;  5IG5 A;  1YGE A;  3NBJ A;  3WOF B;  4HOH A;  5BIR A;  1MWU A;  1Q86 4;  4WYK B;  3WOE B;  4OVM A;  3SED A;  3GZY B;  1QJG A;  3M8C A;  3LTC A;  3SYU A;  3GZR A;  5JPP A;  5A0O B;  3PXM A;  4HM5 B;  3F9S A;  5LC7 A;  4JRF A;  4STD A;  7GSP A;  1NJI 4;  1O7N B;  6STD A;  3K0Z A;  2BIR A;  1SAR A;  1ZGX A;  5AIF A;  4XM4 A;  3FCS B;  3DXO A;  3J7Y d;  2C4B A;  2RFR A;  3OX9 A;  5BU4 A;  3MG3 A;  1MGR A;  3CCR 3;  3BNC A;  2KAA A;  1L5G B;  1OPY A;  2D42 A;  2E2V A;  5DRV A;  2BT3 A;  2IUJ A;  3DGO A;  3GWR A;  3QK9 A;  1S5A A;  1UGH I;  2B1X B;  1EEJ A;  3FF0 A;  1JNQ A;  1YVS A;  1VQP 3;  1I2F A;  3DGY A;  3FF2 A;  4EBG A;  4EYC A;  5KP4 A;  4LSO A;  2STD A;  3N8B A;  3X41 A;  3VSY A;  1UCJ A;  1NB3 I;  1MWS A;  3K63 A;  4BTX A;  2W9P A;  5CF1 A;  5IG4 A;  1VQQ A;  2BU4 A;  3NXJ A;  3SLU A;  1JBT A;  2L1S A;  3D9R A;  1TU5 A;  1RDS A;  1N9E A;  3F8H A;  3GSP A;  4J8T A;  1RTU A;  3MKI A;  3D5I A;  1PYL A;  4AEQ A;  1STD A;  3L0R A;  3NBB A;  1E3R A;  1BRN L;  1RJO A;  4O02 B;  4EC6 A;  1B21 A;  4G1M B;  2K3D A;  1K28 A;  1FGR A;  5FGO A;  4JF8 A;  7RNT A;  3GRD A;  1RRL A;  2OQE C;  4J9A A;  4HYZ A;  3LTB A;  1JBR A;  1IVX A;  4ZM8 A;  2GBW B;  2KF6 A;  3BB9 A;  1AV4 A;  1GOV A;  1RSN A;  1UI7 A;  1RHL A;  2B24 B;  3KSE D;  4HVN A;  2ZDJ A;  4HBR A;  4XB5 A;  4N6L A;  1PY3 A;  5HGR A;  1A67 A;  1MNL A;  3UJM A;  3NV0 A;  2SAR A;  2F56 A;  3NQY A;  2W03 A;  1CQS A;  1TP6 A;  1BVI A;  2OOV C;  1UUV B;  2RSX A;  3BIR A;  2GU3 A;  4HZ9 B;  2RNT A;  1EQK A;  3G71 3;  3UNL A;  3EHC A;  4K1U A;  1WTH A;  4XBX A;  1AR0 A;  1A2K A;  3X3X A;  2ZA4 A;  1LXE A;  1I0X A;  5KP1 A;  1YIT 3;  1YGW A;  2Q07 A;  3CC2 3;  2R4I A;  1V58 A;  5KP3 A;  3NM2 A;  4PEJ A;  2ML6 A;  1UUG B;  1VZZ A;  3H3H A;  4IT7 A;  2K0M A;  4O8S A;  4L7K A;  2GEX A;  3D5G A;  2RCD A;  2CK3 H;  2H0I A;  1BRK A;  3CCQ 3;  1AVL A;  5M19 A;  1A90 A;  4MMZ B;  1DET A;  2WGO A;  2J8X B;  3FLJ A;  2H0H A;  1X1U A;  3MWZ A;  3KSP A;  3EE1 A;  2XF3 A;  2CKF B;  4GSP A;  3SOA A;  3CU3 A;  3OWY A;  1LOV A;  2WGQ A;  3CNM A;  4L8P A;  1VQ6 3;  4MMX B;  2XSH B;  3S27 A;  2CFK A;  1FGM A;  3T8U A;  1GD3 A;  3FKA A;  1LOX A;  4ORL A;  2W9Q A;  1JZD A;  3MG1 A;  1FGT A;  1YVB I;  5GSP A;  3S28 A;  1BNI A;  2XFT A;  4HM0 B;  1WMO A;  2OTL 3;  4LMI A;  2CWV A;  2FGT A;  5ELJ A;  1BNE A;  2CHC A;  3CCU 3;  5FW5 A;  1I8V A;  1A2P A;  5G1K A;  1C7H A;  4ILF A;  2IUK A;  3V98 A;  1MOL A;  2W56 B;  4MMY B;  5IF6 A;  4LEH A;  3CPW 2;  1E3V A;  2YFL B;  4X2O A;  5AI1 A;  3CCS 3;  1TFK A;  4H61 A;  1EG9 B;  1GMP A;  1Q40 A;  1FUW A;  2BMR B;  2H0G A;  1K41 A;  4KZ1 A;  2OTJ 3;  1BGS A;  1ZX2 A;  2QGU A;  2BHM A;  1MWT A;  1DMQ A;  4N6T A;  1Q82 4;  5IER A;  3KKG A;  3DGL A;  3EC9 A;  1WMP A;  3DH2 A;  1RGH A;  1RGF A;  4WWU C;  3DM8 A;  1IVV A;  5LC6 A;  1I2G A;  1UCK A;  3K5T A;  3D79 A;  3N54 B;  4GB5 A;  1U5O A;  3X42 A;  1RN7 A;  3MSO A;  1RGA A;  3F40 A;  3BLZ A;  1Q40 B;  1G0T A;  2C11 A;  4HAA A;  4K61 A;  1IT7 A;  1Z1S A;  1SPU A;  1W02 A;  1EA2 A;  2JQ5 A;  2UX0 A;  1HZ1 A;  2YFJ B;  3B7C A;  1NWW A;  1BRH A;  3NHX A;  4HM1 B;  4I4K A;  1RGG A;  3KII A;  1BSB A;  3DGM A;  1G96 A;  2WO0 A;  3MG2 A;  3CCL 3;  1AVK A;  1NNV A;  4FR9 A;  2BNG A;  1QVF 2;  3EBY A;  1U8C B;  3A5E A;  5AIG A;  3HOH A;  4CDL A;  1BRS A;  3CXC 2;  2P09 A;  1QMA A;  1TRQ A;  3I0Y A;  1OHO A;  2BO9 B;  4NPB A;  5D83 A;  1X1W A;  1QAK A;  2KF3 A;  2W2C A;  3CCJ 3;  2AAD A;  1GY5 A;  4BL3 A;  2JDI H;  3URP A;  3X40 A;  3ZG5 A;  1QVG 2;  1DVC A;  3CD6 3;  3OXA A;  1X1Y A;  1W2Z A;  1BOX A;  2KCD A;  1E97 A;  3LH4 A;  3VF1 A;  1O7M B;  1IDP A;  1O7W B;  1R4C A;  1ULI B;  3UB1 A;  5AEW B;  2CIU A;  3S67 A;  1X1X A;  2M7O A;  4KVH A;  1CH0 A;  4HJL B;  4XBY A;  3FH1 A;  1RGL A;  2C10 A;  3CCM 3;  3DMC A;  3RDE A;  4Q53 A;  1UUW B;  2WOH A;  1PU4 A;  3OWU A;  4BU4 A;  2QA4 3;  1TRP A;  2PZV A;  2BMQ B;  4O3V A;  4R1K A;  1OCV A;  1VQO 3;  1ISK A;  2HMM B;  6GSP A;  5IW9 A;  2IMJ A;  3PZW A;  2XH9 A;  1OF5 B;  1VQN 3;  1N5P A;  1UI8 A;  2CX1 A;  1IV7 A;  2RBI A;  1JRQ A;  2XEP A;  5BVB A;  1Q7H A;  2FNQ A;  4DKI A;  3D4A A;  3DUK A;  3PYJ A;  1B2U A;  1TJD A;  2Y74 A;  3GAX A;  1US1 A;  4RBN A;  3S29 A;  1QAL A;  2QEX 3;  1UDI I;  4IIA A;  1IV9 A;  1V57 A;  5ELU A;  4FCJ A;  4EV2 A;  1IU7 A;  3B4O A;  2XRX B;  2GBX B;  1YIJ 3;  2Z77 A;  3EN8 A;  4RNY A;  4KT3 B;  1BNF A;  3ZFZ A;  1N8R 4;  4HM3 B;  3EBT A;  2UUG C;  1BUQ A;  1B2Z A;  2F86 B;  2P0X A;  3NM7 A;  4HM6 B;  3WA2 X;  2CW9 A;  2KF4 A;  1OF5 A;  5RNT A;  1VQ4 3;  1JN5 A;  1R4Y A;  2CFW A;  3PCR A;  2FXT A;  1TIJ A;  1RN4 A;  2D1W A;  4O2H A;  1F8N A;  1OGZ A;  5STD A;  1W01 A;  4FMA A;  4WHA A;  1BNG A;  1BNJ A;  3I55 3;  3AHW A;  1FA3 A;  3WA3 A;  1W6C A;  1STF I;  2CFL A;  2KXG A;  3WOD G;  3OWS A;  3X3Y A;  1YNV X;  3WDG B;  3Q3F A;  1Q7Y 4;  2E2T A;  1RCK A;  3HX8 A;  3X3Z A;  2ZHX B;  5CLK A;  1BRG A;  1RNB A;  1JB2 A;  1B2X A;  1M1K 4;  3FZW A;  5AEU B;  2V1L A;  4J5K A;  4MEI A;  5JPU A;  1RKY A;  1RNT A;  5DRE A;  3FG4 A;  1W6Y A;  2XFS A;  3T8N A;  1RGE A;  1EKM A;  1Y4K A;  1HKX A;  2W04 A;  2XR8 B;  5TGN A;  2CG1 A;  3CPO A;  3F8X A;  1AY7 A;  1M1X B;  5EEO A;  1ROV A;  2RGQ A;  3CCE 3;  1Q42 A;  3DZL A;  1RRH A;  1NB5 I;  3LT8 A;  1ROA A;  2CFG A;  2CH9 A;  3JVC A;  4IPB A;  2OQE A;  4CCV A;  1GD4 A;  4KFD A;  3CME 3;  1FUS A;  3FG3 A;  3G0K A;  2O9U X;  1IQY A;  3LTA A;  1JKG B;  3KFQ C;  3AHS A;  1WNH A;  1LQG C;  3Q90 A;  4N6O B;  3WR2 A;  1GMR A;  3FG1 A;  1RN1 A;  1GOY A;  3STD A;  3GZB A;  3HI7 A;  4BTW A;  1KQS 2;  2XGN A;  3MYT A;  3LYG A;  7STD A;  1BU4 A;  2HMK B;  2E2U A;  2UGI A;  1BRI A;  4N6N B;  4R9K A;  1LNH A;  1KSI A;  3ECF A;  1B20 A;  1LNI A;  3LXU X;  1SII A;  3PCS A;  2HOH A;  1OH0 A;  3G16 A;  1VQ9 3;  2Y73 A;  1NDO B;  3EN1 B;  4HM7 B;  4FMC A;  3SVA A;  1HYF A;  1D6Z A;  4XDW A;  4BIR A;  4HZB B;  1VQK 3;  1BNR A;  6RNT A;  1YJ9 3;  1TTO A;  2IA7 A;  3G8Z A;  2HMN B;  3AGO A;  4MJD A;  3A76 A;  2Z76 A;  1BAN A;  1UCI A; 
#chains in the Genus database with same CATH homology
 3IPT A;  1FGQ A;  4RZM A;  5G2G A;  1NO3 A;  1JB4 A;  4XDV A;  3JUQ A;  2K54 A;  3O8Y A;  1ULJ B;  5IEP A;  3EQQ B;  1YJW 3;  1W2B 2;  2W0Q A;  3EF8 A;  2MF7 A;  3KE7 A;  3BNB A;  2OCT A;  1VQL 3;  1SQW A;  1DMM A;  2CC3 A;  3SOY A;  3PS8 A;  3DY5 A;  1ASK A;  3G4S 3;  4R4K A;  1IVW A;  1OHS A;  1IT8 A;  4HM8 B;  3CCV 3;  5IG0 A;  1O7H B;  4AKZ A;  1JN5 B;  1CYV A;  1N9J A;  1N5H A;  3S5C A;  1K73 4;  3HII A;  1K9M 4;  3D3L A;  1M90 4;  5I97 A;  5D81 A;  3SXX A;  1VQ7 3;  5CF2 A;  4HM2 B;  2P0M A;  2CWU A;  2Z6B A;  3LT9 A;  8CHO A;  3F7S A;  2LQV A;  4N6U A;  1TUH A;  2QIY A;  1IK3 A;  1OUN A;  2F98 A;  3B4P A;  3F7X A;  4QWT A;  2L4V A;  3IMA B;  2GXF A;  5CXO A;  3H51 A;  3B8L A;  1DYU A;  3ALA A;  1DMN A;  3ER7 A;  4HKV B;  4AKY A;  2PNC A;  1J2B A;  3VGN A;  1OHP A;  2HMO B;  5IG3 A;  1W6G A;  1WMN A;  2SBL A;  5EVH A;  1O7G B;  3SX1 A;  2A15 A;  3HK4 A;  2GU1 A;  5BXQ A;  3E99 A;  3JUM A;  3UL5 A;  2YFI B;  1D6Y A;  2KRT A;  2XGL A;  3V99 A;  3CNX A;  5AII A;  5CK6 A;  3G6E 3;  1YJN 3;  4N6M A;  4WP5 A;  5AYS C;  1T5Y A;  4LGQ A;  5AYR B;  1KD1 4;  3U97 A;  4NRE A;  3JUO A;  1YI2 3;  1HU9 A;  3FGY A;  4FCZ A;  5D82 A;  3JUN A;  2F99 A;  3V92 A;  3K9M C;  2YX9 A;  2Z7A A;  5JBS A;  1JJ2 2;  3NBR A;  1W4N A;  3WMD A;  3ROB A;  1ZO2 A;  3NQZ A;  1D6U A;  1A2V A;  2LYX A;  5AIH A;  1IVU A;  2CWT A;  1JV2 B;  1DVD A;  1W00 A;  2ML5 A;  1S72 3;  1SIH A;  3TDG A;  1SJW A;  5IEN A;  3MPH A;  1VQM 3;  4U13 A;  1W5Z A;  2OOV A;  2WOF A;  1YHQ 3;  1V74 A;  4N6V 0;  4LZI A;  3EJV A;  3DGN A;  1CEW I;  4BTY A;  3I56 3;  3HZP A;  2W6J H;  5IEO A;  3LZA A;  3LML A;  1VQ8 3;  1IQX A;  3JUP A;  5EQL A;  3EX9 A;  1IQ8 A;  4GL6 A;  4FMD A;  1K8A 4;  3GZX B;  4N3V A;  2OWP A;  3CC7 3;  2O3O A;  1QAF A;  1VQ5 3;  3LTD A;  3UL6 A;  4K90 B;  4WFO A;  4NHF A;  2INX A;  4EV5 A;  3IJE B;  4X2H A;  4WYK A;  3U1W A;  1NU3 A;  2W56 A;  3AMO B;  1JKG A;  3KZT A;  3QRD A;  4XBT A;  3BND A;  4H3U A;  2ZL8 A;  1GY7 A;  3BNE A;  3MHE A;  3KN4 A;  1Q81 4;  1UW1 A;  2HMJ B;  3PGB A;  1GY6 A;  1WQL B;  3RGR A;  2CFD A;  3LOY A;  1KC8 4;  2I9W A;  4L8O A;  2HML B;  3CC4 3;  1TFO A;  3T0U A;  4R9L A;  3RGA A;  3F14 A;  1KWI A;  4OUQ A;  4RNZ A;  2MC8 A;  1LVN A;  3Q2P A;  2CG0 A;  1FGO A;  3AMO A;  4HM4 B;  3NV0 B;  2XSO B;  4KFE A;  3EB8 A;  3OW2 2;  1OGX A;  1O7P B;  4FMB A;  2P38 A;  1CYU A;  3K7C A;  3OV4 A;  4R80 A;  3NX0 A;  2P05 A;  4FCM A;  1GS3 A;  1M9G A;  4OK0 A;  3FSD A;  1JB5 A;  3CMA 3;  2GEY A;  4EXR A;  3N9H A;  1N8Q A;  1OAC A;  1W7C A;  2BMO B;  1GYB A;  3HIG A;  3NUV A;  1PFP A;  4KFF A;  4TX4 A;  4K1V A;  5IG5 A;  1YGE A;  3NBJ A;  3WOF B;  1Q86 4;  4WYK B;  3WOE B;  4OVM A;  3SED A;  3GZY B;  1QJG A;  3M8C A;  3LTC A;  3GZR A;  5JPP A;  5A0O B;  3PXM A;  4HM5 B;  3F9S A;  5LC7 A;  4JRF A;  4STD A;  1NJI 4;  1O7N B;  6STD A;  3K0Z A;  5AIF A;  4XM4 A;  3FCS B;  3DXO A;  3J7Y d;  2RFR A;  3OX9 A;  3MG3 A;  3CCR 3;  3BNC A;  1L5G B;  1OPY A;  2D42 A;  2E2V A;  5DRV A;  2BT3 A;  2IUJ A;  3DGO A;  3GWR A;  3QK9 A;  1S5A A;  2B1X B;  3FF0 A;  1JNQ A;  1VQP 3;  4EBG A;  3FF2 A;  4EYC A;  5KP4 A;  4LSO A;  2STD A;  3N8B A;  3X41 A;  3VSY A;  1NB3 I;  3K63 A;  5IG4 A;  4BTX A;  2W9P A;  5CF1 A;  3NXJ A;  3SLU A;  3D9R A;  1TU5 A;  1N9E A;  3F8H A;  4J8T A;  3MKI A;  4AEQ A;  1STD A;  3L0R A;  3NBB A;  1E3R A;  1RJO A;  4O02 B;  4EC6 A;  4G1M B;  1K28 A;  1FGR A;  5FGO A;  4JF8 A;  3GRD A;  1RRL A;  2OQE C;  4J9A A;  4HYZ A;  3LTB A;  1IVX A;  4ZM8 A;  2GBW B;  3BB9 A;  1AV4 A;  2B24 B;  3KSE D;  1UI7 A;  4HVN A;  2ZDJ A;  4HBR A;  4XB5 A;  4N6L A;  5HGR A;  1A67 A;  1MNL A;  3UJM A;  3NV0 A;  3NQY A;  2W03 A;  1CQS A;  1TP6 A;  2OOV C;  1UUV B;  2RSX A;  2GU3 A;  4HZ9 B;  1EQK A;  3G71 3;  3UNL A;  3EHC A;  4K1U A;  1WTH A;  4XBX A;  1AR0 A;  1A2K A;  3X3X A;  1LXE A;  5KP1 A;  1YIT 3;  2Q07 A;  3CC2 3;  2R4I A;  5KP3 A;  3NM2 A;  4PEJ A;  2ML6 A;  3H3H A;  1VZZ A;  4IT7 A;  2K0M A;  4O8S A;  4L7K A;  2GEX A;  2RCD A;  2CK3 H;  1A90 A;  3CCQ 3;  1AVL A;  4MMZ B;  3FLJ A;  2WGO A;  3MWZ A;  3KSP A;  3EE1 A;  2XF3 A;  2CKF B;  3SOA A;  3CU3 A;  3OWY A;  2WGQ A;  3CNM A;  1VQ6 3;  4L8P A;  4MMX B;  2XSH B;  3S27 A;  2CFK A;  1FGM A;  3T8U A;  1GD3 A;  3FKA A;  1LOX A;  4ORL A;  2W9Q A;  3MG1 A;  1FGT A;  1YVB I;  3S28 A;  2XFT A;  4HM0 B;  1WMO A;  2OTL 3;  4LMI A;  2CWV A;  2FGT A;  5ELJ A;  2CHC A;  3CCU 3;  5FW5 A;  1C7H A;  2IUK A;  3V98 A;  1MOL A;  2W56 B;  4MMY B;  5IF6 A;  4LEH A;  3CPW 2;  1E3V A;  2YFL B;  4X2O A;  5AI1 A;  3CCS 3;  1TFK A;  4H61 A;  1EG9 B;  1Q40 A;  1FUW A;  2BMR B;  1K41 A;  4KZ1 A;  2OTJ 3;  1ZX2 A;  2QGU A;  2BHM A;  4N6T A;  1DMQ A;  1Q82 4;  5IER A;  3KKG A;  3DGL A;  3EC9 A;  1WMP A;  4WWU C;  3DM8 A;  1IVV A;  5LC6 A;  3K5T A;  3N54 B;  4GB5 A;  1U5O A;  3X42 A;  1RN7 A;  3MSO A;  3F40 A;  3BLZ A;  1Q40 B;  2C11 A;  4K61 A;  1IT7 A;  1Z1S A;  1SPU A;  1W02 A;  1EA2 A;  2JQ5 A;  2UX0 A;  2YFJ B;  3B7C A;  3NHX A;  1NWW A;  4HM1 B;  4I4K A;  3KII A;  3DGM A;  1G96 A;  2WO0 A;  3MG2 A;  3CCL 3;  1AVK A;  4FR9 A;  2BNG A;  1QVF 2;  3EBY A;  1U8C B;  5AIG A;  4CDL A;  3CXC 2;  2P09 A;  1QMA A;  3I0Y A;  1OHO A;  2BO9 B;  5D83 A;  2W2C A;  1QAK A;  3CCJ 3;  1GY5 A;  1QVG 2;  2JDI H;  3X40 A;  3CD6 3;  1DVC A;  3OXA A;  1W2Z A;  2KCD A;  1E97 A;  3LH4 A;  3VF1 A;  1O7M B;  1IDP A;  1O7W B;  1R4C A;  1ULI B;  3UB1 A;  5AEW B;  2CIU A;  3S67 A;  2M7O A;  4KVH A;  4HJL B;  4XBY A;  3FH1 A;  2C10 A;  3CCM 3;  3DMC A;  3RDE A;  4Q53 A;  1UUW B;  2WOH A;  1PU4 A;  3OWU A;  2QA4 3;  2PZV A;  2BMQ B;  4O3V A;  4R1K A;  1OCV A;  1VQO 3;  1ISK A;  2HMM B;  5IW9 A;  2IMJ A;  3PZW A;  2XH9 A;  1OF5 B;  1VQN 3;  1N5P A;  1UI8 A;  1IV7 A;  1JRQ A;  2XEP A;  5BVB A;  2FNQ A;  3DUK A;  3PYJ A;  2Y74 A;  3GAX A;  1US1 A;  4RBN A;  3S29 A;  1QAL A;  2QEX 3;  4IIA A;  1IV9 A;  5ELU A;  4FCJ A;  4EV2 A;  1IU7 A;  3B4O A;  2XRX B;  2GBX B;  1YIJ 3;  2Z77 A;  3EN8 A;  4RNY A;  1N8R 4;  4HM3 B;  3EBT A;  1BUQ A;  2F86 B;  2P0X A;  3NM7 A;  4HM6 B;  3WA2 X;  2CW9 A;  1OF5 A;  1VQ4 3;  1JN5 A;  2CFW A;  3PCR A;  2FXT A;  1TIJ A;  2D1W A;  4O2H A;  1F8N A;  1OGZ A;  5STD A;  1W01 A;  4FMA A;  4WHA A;  3I55 3;  1FA3 A;  3WA3 A;  1W6C A;  1STF I;  2CFL A;  2KXG A;  3WOD G;  3OWS A;  3X3Y A;  3WDG B;  1Q7Y 4;  2E2T A;  3HX8 A;  3X3Z A;  5CLK A;  1JB2 A;  1M1K 4;  3FZW A;  5AEU B;  2V1L A;  4MEI A;  1RKY A;  5JPU A;  5DRE A;  3FG4 A;  1W6Y A;  2XFS A;  3T8N A;  1EKM A;  1Y4K A;  1HKX A;  2W04 A;  2XR8 B;  5TGN A;  2CG1 A;  3CPO A;  3F8X A;  5EEO A;  1M1X B;  1ROV A;  2RGQ A;  3CCE 3;  1Q42 A;  3DZL A;  1RRH A;  1NB5 I;  3LT8 A;  1ROA A;  2CFG A;  2CH9 A;  3JVC A;  4IPB A;  2OQE A;  4CCV A;  1GD4 A;  4KFD A;  3CME 3;  3FG3 A;  3G0K A;  2O9U X;  1IQY A;  3LTA A;  1JKG B;  3KFQ C;  4N6O B;  1WNH A;  3Q90 A;  3FG1 A;  3STD A;  3GZB A;  3HI7 A;  4BTW A;  1KQS 2;  2XGN A;  3MYT A;  3LYG A;  7STD A;  2HMK B;  2E2U A;  4N6N B;  4R9K A;  1LNH A;  1KSI A;  3ECF A;  3LXU X;  1SII A;  3PCS A;  1OH0 A;  3G16 A;  1VQ9 3;  2Y73 A;  1NDO B;  3EN1 B;  4HM7 B;  4FMC A;  3SVA A;  1D6Z A;  4XDW A;  1VQK 3;  4HZB B;  1YJ9 3;  2IA7 A;  3G8Z A;  2HMN B;  4MJD A;  3A76 A;  2Z76 A;  3Q1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...