3CXC2

The structure of an enhanced oxazolidinone inhibitor bound to the 50s ribosomal subunit of h. marismortui
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design at the atomic level: design of biaryloxazolidinones as potent orally active antibiotics.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RIBOSOMAL RNA
total genus 17
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3cxc200
3CCE3 3CCV3 3CD63 1YIJ3 1S723 3CCQ3 1K734 2QEX3 2OTJ3 3CC43 1QVG2 3G4S3 1QVF2 3CME3 1YHQ3 1Q864 3CPW2 3CCR3 3CCS3 1VQP3 1JJ22 1VQ43 1VQ53 1VQ93 2OTL3 1YJN3 3CMA3 1VQK3 3I563 3CCU3 3CC23 1Q7Y4 1VQ83 1YJW3 1YIT3 1W2B2 2QA43 1VQ73 1YI23 3CXC2 3CC73 1VQM3 1K9M4 1KQS2 1N8R4 1KC84 1Q814 1VQN3 1KD14 3CCJ3 1VQO3 1M904 1VQ63 3G713 3G6E3 1YJ93 1VQL3 1Q824 3CCL3 1K8A4 3I553 1NJI4 3CCM3 1M1K4 3OW22
chains in the Genus database with same CATH superfamily
1VQQA 3IMAB 3Q90A 1MWSA 4NPBA 3OV4A 3CCQ3 1K734 1CQSA 1NB5I 3AHWA 4STDA 5IG5A 1OF5B 4HM1B 1MWUA 4FCZA 4HVNA 3WOEB 5G1KA 1VQ83 3WDGB 4EV5A 2CIUA 1EA2A 3DGMA 1TFKA 4PEJA 4TX4A 1W00A 3WA3A 1W2ZA 2XR8B 1GOYA 1TU5A 1JZDA 2OQEC 2P0MA 4XBYA 5JBSA 2OQEA 5HGRA 4GL6A 1W7CA 1TFOA 1FGQA 1B2SA 3UJMA 3WHOA 1QAKA 1A90A 2XGNA 1G02A 2BMOB 2H0IA 1GY5A 2HOHA 3BIRA 3FCSB 3LTAA 3DXOA 2KXGA 2M7OA 1RGKA 1YNVX 2F99A 3LOYA 4AKZA 4KVHA 1OPYA 3KE7A 3MKIA 2CFDA 1I70A 4HZ9B 4KZ1A 1O7WB 1C7HA 2MC8A 3K63A 2KF3A 1DVDA 1BU4A 3CXC2 1FZUA 4LGQA 5M1AA 4GHOA 1CH0A 3CC73 3HOHA 1BUQA 1W4NA 2BO9B 1RJOA 1U5OA 3UB1A 4CDLA 3D5IA 1AVLA 4BL3A 3ALAA 3GZRA 4J9AA 1NNVA 5FW5A 4XDVA 3SEDA 1BGSA 1JKGA 1UGHI 3NQYA 2Z7AA 1FYSA 1MGRA 2CFLA 2ML5A 6STDA 2F5WA 1ZO2A 1EG9B 2GXFA 3FKAA 3FF0A 1Q40B 3LZAA 3MG2A 3D9RA 2ZDJA 1LQGC 3RGAA 1LOXA 3OXAA 3BNEA 1UGIA 1O7PB 3GRDA 4H61A 3NM2A 2WOHA 3X3XA 2CWVA 3D5GA 1JKGB 5EVHA 1STFI 1HU9A 5M18A 4FMBA 1V74A 3S67A 1KC84 2CC3A 3NV0A 2HMMB 5BIRA 3WOFB 5BVBA 1SIHA 2BT3A 6GSPA 1MNLA 4HM5B 1TRQA 1DMNA 1MOLA 4FMCA 3OW22 1RNBA 2W56A 1PFPA 3GSPA 1TRPA 3D4AA 1PU4A 4N6MA 2YFLB 1FUWA 1JBSA 2QEX3 3PCRA 5DREA 2YX9A 1RHLA 4HM0B 3WMDA 1OCVA 4R9KA 3I0YA 3G16A 1Z1SA 3EC9A 4KFEA 3VSYA 4EV2A 3LTDA 1JN5B 1Q9EA 3J7Yd 1B3SA 1A2VA 3DGNA 1IV9A 2RFRA 1GY6A 1UUWB 4WWUC 5IF6A 1Q814 2D42A 1VQN3 3HIGA 4RZMA 1YGEA 3Q1CA 1D6ZA 1Q824 1JNQA 2HMNB 5CXOA 1CEWI 1RTUA 1I0VA 1RGGA 2OCTA 3N8BA 8RNTA 5IW9A 1T2IA 2C4BA 3MWZA 1YIJ3 3WA2X 1RGLA 1WMPA 1LOYA 4XBXA 1N5HA 1LVNA 4NREA 4X2OA 3EE1A 3S29A 3V99A 1GD3A 2GU3A 2XFSA 3NHXA 7RNTA 1QAFA 4LSOA 5ELJA 2CH9A 5TGNA 1WTHA 3LMLA 1RDSA 4WP5A 1W6GA 1OH0A 1AV4A 1RKYA 3X42A 2HMKB 3AMOA 3U1WA 1LNHA 2QIYA 1N9JA 5IG4A 1GOVA 3GZBA 2RBIA 4IIAA 1X1YA 2OOVA 3JVCA 2XSOB 4K61A 4OK0A 1MGWA 2P09A 1Y4KA 4EBGA 1DMMA 5IG3A 5AEWB 2H0GA 1HKXA 3CCL3 2GEYA 4N6V0 1OHSA 2W03A 3F8XA 1RGAA 1OGZA 1GY7A 3PS8A 4O02B 1B2XA 3LYGA 4G1MB 1GMPA 3BLZA 3EQQB 3LT8A 2JQ5A 1QVG2 1IYYA 1N5PA 1FW7A 1JB5A 3K5TA 1ROAA 1BRJA 3K7CA 3IJEB 4RNTA 1FUSA 3KSED 2C10A 3WODG 4FCJA 5GSPA 2CFWA 3EN1B 4XBTA 1IQYA 3FG1A 1SARA 3H51A 5LC6A 1YIT3 3HZPA 4LYLB 3HK4A 3T8NA 6RNTA 1VQM3 1B27A 1RN7A 2XF3A 1N8R4 1KQS2 1O7NB 4MMYB 3N9HA 4N3VA 1S5AA 2PNCA 1GMRA 3EHCA 3G8ZA 4X2HA 1DVCA 4FR9A 3VGNA 4DKIA 3S28A 4QWTA 4LZIA 1EEJA 1A2KA 1Q42A 1RN4A 1O7MB 3QK9A 2SARA 1JN5A 1BRGA 3SOAA 4CCVA 1NJI4 3FG4A 1IQ8A 1NDOB 5IG0A 4HYZA 2IMJA 1A2PA 4K1UA 4NHFA 5IENA 1I8VA 3FGYA 4H3UA 1JB2A 4BIRA 2W0QA 4HM2B 3F7XA 4R80A 4HM6B 1VQ43 1BRNL 4U13A 3CNXA 3CCU3 3CC23 1KSIA 4HAAA 4HJLB 3MYTA 2Q07A 1ROVA 3D3LA 1YI23 1YVSA 3DGLA 3DZLA 3RGRA 4ORLA 1N9EA 1HZ1A 1M904 2C11A 3VF1A 1SIIA 2Z77A 1F8NA 3MHEA 3G6E3 1YJ93 3DY5A 2IUJA 3EN8A 2ML6A 3CU3A 3MPHA 2Y73A 4J5GA 4EC6A 2LQVA 2W9QA 3SYUA 5JPPA 5JPUA 1OACA 1RCLA 1ULIB 3CPOA 2HMOB 3EBYA 3AGNA 1RGCA 2V1LA 2RGQA 4EW5A 1UCJA 1BRSA 3F8HA 2OTJ3 3B7CA 4EXRA 3A76A 1VQ53 3CCR3 1R4YA 1NB3I 1GD4A 4L7KA 1RNTA 2B24B 4IPBA 2WOFA 2GSPA 1ZS7A 2INXA 3NQZA 4BTWA 1VQ73 2KF4A 4OVMA 3LH4A 1B20A 1CYVA 2F98A 1GOUA 1OF5A 1CYUA 3HI7A 4J8TA 4BTXA 1IVVA 1LQMB 1R4CA 2YFIB 4AEQA 1ZX2A 4FMDA 2XRXB 4AKYA 3AHSA 1RLSA 3FLJA 1UI7A 3ER7A 3FH1A 5EQLA 3OX9A 4O2HA 3GZYB 3BB9A 3NBRA 1OHPA 1O7GB 1E97A 2STDA 4BTYA 3EB8A 1YHQ3 1W6YA 2F86B 3G0KA 3M8CA 1OUNA 1FGRA 2UGIA 1X1XA 1IU7A 3FZWA 3F40A 2W6JH 3KIIA 4HM8B 3SX1A 1YJW3 2GBXB 2LYXA 1W02A 3EX9A 1TJDA 1IK3A 3MG3A 2P0XA 2W56B 4MMZB 3D79A 4N6UA 1K9M4 2J8XB 2AADA 1DMQA 2IYJA 3CCJ3 1VQO3 2KRTA 5D82A 1BUJA 1RSNA 1BNRA 3BNBA 2HMLB 1M1K4 2W2CA 3KCHA 4LMIA 4KT3B 3CCE3 3CNMA 1FGOA 2L4VA 1T2HA 7STDA 1UUGB 1M1XB 1M9GA 5AYSC 5IEPA 5RNTA 1O7HB 2R41A 5AYRB 3G4S3 2HMJB 4L8PA 5ELUA 1K41A 4BU4A 2WO0A 4GSPA 1I3IA 5FGOA 1BOXA 4RNYA 2FXTA 4K1VA 3LTCA 2QA43 1HYFA 1FUTA 1BAOA 1V58A 1YGWA 2GEXA 4FMAA 4O8SA 3PGBA 3STDA 1N8QA 2CX1A 4HOHA 4R1KA 1OGXA 1ZGXA 2CFKA 2K54A 1FA3A 1IVUA 5IEOA 2F4YA 3N54B 2P38A 5EEOA 5I97A 1BIRA 2IY2A 1TTOA 1AY7A 1RCKA 1BNFA 3DGOA 1LOVA 4LEHA 5AIIA 4ZM8A 1YVBI 3Q3FA 3MG1A 3CCV3 2KF5A 3GZXB 3NV0B 3PXMA 3ZG0A 1BSCA 1BSDA 2KCDA 2L1SA 3B4PA 3NX0A 5G2GA 3DM8A 1WNHA 3GWRA 2OTL3 3DUKA 1RGFA 5LC7A 3ROBA 2XEPA 1FGTA 1TUHA 3B4OA 1BRIA 3KFQC 4HBRA 1RRHA 2OWPA 5KP1A 3JUQA 3PYJA 2AAEA 2WGQA 5CK6A 5BU4A 3WR2A 1GYBA 5BXQA 3S27A 1WMOA 3X3YA 1KD14 1AR0A 3H3HA 1UI8A 4WYKB 1EKMA 4L8OA 1VQL3 1W01A 2WGOA 5AEUB 5CLKA 3LTBA 1W2B2 1BVIA 1I0XA 2YFJB 3GAXA 9RNTA 2RCDA 1A67A 2B1XB 3E99A 5CF2A 3EJVA 2BIRA 3V98A 4EYCA 3CMA3 3MSOA 3KKGA 1YJN3 2ZL8A 3QRDA 2IA7A 2OOVC 3TDGA 1Q7Y4 1EQKA 2K0MA 1JBTA 2E2TA 2SBLA 1JB4A 1IDPA 4K90B 1ULJB 3KZTA 3ZG5A 2CK3H 1WMNA 1UW1A 5AIFA 3RDEA 4JRFA 3KSPA 2BU4A 2Z76A 2CX0A 3FG3A 2H0HA 3ECFA 2CFGA 2P05A 3A5EA 1D6YA 3O8YA 1JBRA 2GBWB 2I9WA 5D83A 3U97A 2R4IA 4XM4A 3SOYA 1GSPA 3DH2A 3BNCA 2XSHB 3CD63 2PZVA 1ASKA 4OUQA 2KF6A 3RNTA 1S723 4HM3B 4MEIA 1LXEA 1SQWA 1UUVB 3IPTA 2CG0A 1UDII 1BANA 1T5YA 2E2UA 1B2ZA 3AGOA 3F7SA 1UCKA 1VQK3 3LT9A 4CPKA 1DE3A 1C54A 3FF2A 1BRKA 1BSEA 4MMXB 2BMRB 3NBBA 4GB5A 1BNJA 3BU4A 4I4KA 5AI1A 3BNDA 4BL2A 1LNIA 1IVXA 1IT8A 1I2GA 1WQLB 3F9SA 3SXXA 4CJNA 4JF8A 5G1LA 3S5CA 7GSPA 4N6OB 3OWSA 1VZZA 1STDA 3UNLA 2CW9A 1RN1A 2Z6BA 3X3ZA 1VQ93 2BNGA 2RSXA 1U8CB 3T0UA 1OHOA 1KWIA 3JUPA 4I5QA 4R9LA 1T3BA 3ZFZA 4WYKA 3JUNA 1RGHA 3CPW2 1QMAA 1VQP3 1JJ22 2QGUA 4KFFA 3I563 3NBJA 4RBNA 4WHAA 1BRHA 5M19A 5KP3A 2CG1A 4FCMA 2XFTA 1ISKA 3PCSA 4XDWA 4N6TA 2BMQB 1JV2B 2A15A 3Q2PA 2CKFB 4HM7B 3T8UA 4HZBB 1JZOA 1MWRA 1DYUA 2E2VA 3OWUA 3NM7A 5IERA 1W6CA 1PYLA 1IVWA 2IUKA 1J2BA 3SLUA 1QJGA 3UL6A 3FSDA 2UUGC 1RMSA 1DETA 1AQZA 4ILFA 5HOHA 2K3DA 1JRQA 1BSBA 1BSAA 3L0RA 3CC43 3NXJA 2MF7A 1L5GB 1X1UA 1QALA 1RGEA 3K0ZA 1QVF2 4HM4B 5CF1A 1RRLA 2D1WA 1BNGA 2O3OA 1Q7HA 2JDIH 4MJDA 1SPUA 1I3FA 2GU1A 2FGTA 2W04A 2XH9A 4WFOA 1D6UA 1BNIA 4KFDA 1V57A 3K9MC 4N6NB 2F56A 1IQXA 5KP4A 5AIGA 1IV7A 2RNTA 5DRVA 3UL5A 5D81A 1LOWA 1G96A 5A0OB 4IT7A 3DGYA 1I2FA 4J5KA 4O3VA 1EUIC 2CWTA 1B2MA 1AVKA 1FGMA 1PY3A 2Y74A 2ZHXB 3AMOB 3EF8A 3LXUX 3NUVA 3F14A 5STDA 1GMQA 5AIHA 2BHMA 1E3RA 1G0TA 1UCLA 1E3VA 2FNQA 3CME3 1Q864 1W5ZA 1TP6A 3CCS3 1B21A 2XGLA 1IT7A 3JUOA 1TIJA 3X41A 1K28A 2F5MA 1NO3A 2KAAA 4RNZA 3V92A 8CHOA 4HKVB 1US1A 3KN4A 1UCIA 3HX8A 3PZWA 3X40A 1LRAA 1SJWA 3SVAA 3URPA 2O9UX 4Q53A 1BNSA 2UX0A 3EBTA 3OWYA 4N6LA 1NWWA 1B2UA 2W9PA 3B8LA 1BNEA 1GS3A 1VQ63 2CHCA 4XB5A 3G713 1NU3A 3HIIA 3JUMA 4R4KA 1Q40A 1K8A4 3I553 3CCM3 1MWTA 3DMCA 2CWUA 1X1WA 1I2EA 2ZA4A
chains in the Genus database with same CATH topology
3IMAB 3Q90A 3OV4A 3CCQ3 1K734 1CQSA 1NB5I 4STDA 5IG5A 1OF5B 4HM1B 4FCZA 4HVNA 3WOEB 1VQ83 3WDGB 4EV5A 2CIUA 1EA2A 3DGMA 1TFKA 4PEJA 4TX4A 1W00A 3WA3A 1W2ZA 2XR8B 1TU5A 2OQEC 2P0MA 4XBYA 5JBSA 2OQEA 5HGRA 4GL6A 1W7CA 1TFOA 1FGQA 3UJMA 1QAKA 1A90A 2XGNA 2BMOB 1GY5A 3FCSB 3LTAA 3DXOA 2KXGA 2M7OA 2F99A 3LOYA 4AKZA 4KVHA 1OPYA 3KE7A 3MKIA 2CFDA 4HZ9B 4KZ1A 1O7WB 1C7HA 2MC8A 3K63A 1DVDA 3CXC2 4LGQA 3CC73 1BUQA 1W4NA 2BO9B 1RJOA 1U5OA 3UB1A 4CDLA 1AVLA 3ALAA 3GZRA 4J9AA 5FW5A 4XDVA 3SEDA 1JKGA 3NQYA 2Z7AA 2CFLA 2ML5A 6STDA 1ZO2A 1EG9B 2GXFA 3FKAA 3FF0A 1Q40B 3LZAA 3MG2A 3D9RA 2ZDJA 3RGAA 1LOXA 3OXAA 3BNEA 1O7PB 3GRDA 4H61A 3NM2A 2WOHA 3X3XA 2CWVA 1JKGB 5EVHA 1STFI 1HU9A 4FMBA 1V74A 3S67A 1KC84 2CC3A 3NV0A 2HMMB 3WOFB 5BVBA 1SIHA 2BT3A 1MNLA 4HM5B 1DMNA 1MOLA 4FMCA 3OW22 2W56A 1PFPA 1PU4A 4N6MA 2YFLB 1FUWA 2QEX3 3PCRA 5DREA 2YX9A 4HM0B 3WMDA 1OCVA 4R9KA 3I0YA 3G16A 1Z1SA 3EC9A 4KFEA 3VSYA 4EV2A 3LTDA 1JN5B 3J7Yd 3DGNA 1A2VA 1IV9A 2RFRA 1GY6A 1UUWB 4WWUC 5IF6A 1Q814 2D42A 1VQN3 3HIGA 4RZMA 1YGEA 3Q1CA 2CWUA 1D6ZA 1Q824 1JNQA 2HMNB 5CXOA 1CEWI 3N8BA 5IW9A 2OCTA 3MWZA 1YIJ3 3WA2X 1WMPA 4XBXA 1N5HA 1LVNA 4NREA 4X2OA 3EE1A 3S29A 3V99A 1GD3A 2GU3A 2XFSA 3NHXA 1QAFA 4LSOA 5ELJA 2CH9A 5TGNA 1WTHA 3LMLA 4WP5A 1W6GA 1OH0A 1AV4A 1RKYA 3X42A 2HMKB 3AMOA 3U1WA 1LNHA 2QIYA 1N9JA 5IG4A 3GZBA 4IIAA 2OOVA 3JVCA 2XSOB 4K61A 4OK0A 2P09A 4EBGA 1Y4KA 5IG3A 1DMMA 5AEWB 1HKXA 3CCL3 2GEYA 4N6V0 1OHSA 2W03A 3F8XA 1OGZA 1GY7A 3PS8A 4O02B 3LYGA 4G1MB 3BLZA 3EQQB 3LT8A 1QVG2 2JQ5A 1N5PA 1JB5A 3K5TA 1ROAA 3K7CA 3IJEB 3KSED 2C10A 3WODG 4FCJA 1W2B2 2CFWA 3EN1B 4XBTA 1IQYA 3FG1A 5LC6A 3H51A 1YIT3 3HZPA 3HK4A 3T8NA 1VQM3 1RN7A 2XF3A 1N8R4 1KQS2 1O7NB 4MMYB 3N9HA 4N3VA 1S5AA 2PNCA 3EHCA 4X2HA 3G8ZA 3VGNA 1DVCA 4FR9A 3S28A 4QWTA 4LZIA 3QK9A 1A2KA 1Q42A 1NJI4 1O7MB 4CCVA 1JN5A 3SOAA 3FG4A 1IQ8A 1NDOB 5IG0A 4HYZA 2IMJA 4K1UA 4NHFA 5IENA 3FGYA 4H3UA 1JB2A 2W0QA 4HM2B 3F7XA 4R80A 4HM6B 1VQ43 4U13A 3CNXA 3CCU3 3CC23 1KSIA 4HJLB 3MYTA 2Q07A 1ROVA 3D3LA 1YI23 3DGLA 3DZLA 3RGRA 4ORLA 1N9EA 1M904 2C11A 3VF1A 1SIIA 2Z77A 1F8NA 3MHEA 3G6E3 1YJ93 3DY5A 2IUJA 3EN8A 2ML6A 3CU3A 3MPHA 2Y73A 4EC6A 2LQVA 2W9QA 5JPPA 5JPUA 1OACA 1ULIB 3CPOA 2HMOB 3EBYA 2V1LA 2OTJ3 2RGQA 3F8HA 3B7CA 4EXRA 3A76A 1VQ53 3CCR3 1NB3I 1GD4A 4L7KA 2B24B 4IPBA 2WOFA 2INXA 3NQZA 4BTWA 1VQ73 4OVMA 3LH4A 1CYVA 2F98A 1OF5A 1CYUA 3HI7A 4J8TA 4BTXA 1IVVA 1R4CA 4AEQA 1ZX2A 4FMDA 2XRXB 4AKYA 3FLJA 1UI7A 3ER7A 3FH1A 5EQLA 3OX9A 4O2HA 3GZYB 3BB9A 3NBRA 1OHPA 1O7GB 1E97A 2STDA 4BTYA 3EB8A 1YHQ3 1W6YA 2F86B 3G0KA 3M8CA 1OUNA 1FGRA 1IU7A 3FZWA 3F40A 2W6JH 3KIIA 4HM8B 3SX1A 1YJW3 2GBXB 2LYXA 1W02A 3EX9A 1IK3A 3MG3A 2P0XA 2W56B 4MMZB 4N6UA 1K9M4 3CCJ3 1DMQA 1VQO3 2KRTA 5D82A 3BNBA 2HMLB 1M1K4 2W2CA 4LMIA 3CCE3 3CNMA 1FGOA 2L4VA 7STDA 1M1XB 1M9GA 5AYSC 5IEPA 1O7HB 5AYRB 3G4S3 2HMJB 4L8PA 5ELUA 1K41A 2WO0A 5FGOA 4RNYA 2FXTA 4K1VA 3LTCA 2QA43 4FMAA 2GEXA 4O8SA 3STDA 3PGBA 1N8QA 4R1KA 1OGXA 2CFKA 2K54A 1FA3A 1IVUA 5IEOA 3N54B 2P38A 5EEOA 5I97A 3DGOA 5AIIA 4LEHA 4ZM8A 1YVBI 3CCV3 3MG1A 3GZXB 3PXMA 3NV0B 2KCDA 3B4PA 5G2GA 3NX0A 3DM8A 1WNHA 3GWRA 2OTL3 3DUKA 5LC7A 3ROBA 2XEPA 1FGTA 1TUHA 3B4OA 3KFQC 4HBRA 1RRHA 2OWPA 5KP1A 3JUQA 3PYJA 2WGQA 5CK6A 1GYBA 5BXQA 3S27A 1WMOA 3X3YA 1KD14 1AR0A 3H3HA 1UI8A 4WYKB 1EKMA 4L8OA 1VQL3 1W01A 2WGOA 5AEUB 5CLKA 3LTBA 2YFJB 3GAXA 2RCDA 1A67A 2B1XB 3E99A 5CF2A 3EJVA 3V98A 4EYCA 3CMA3 3MSOA 3KKGA 1YJN3 2ZL8A 3QRDA 2IA7A 2OOVC 3TDGA 1Q7Y4 1EQKA 2K0MA 2E2TA 2SBLA 1JB4A 1IDPA 4K90B 1ULJB 3KZTA 2CK3H 1WMNA 1UW1A 5AIFA 3RDEA 4JRFA 3KSPA 2Z76A 3FG3A 3ECFA 2CFGA 2P05A 1D6YA 3O8YA 2GBWB 2I9WA 5D83A 3U97A 2R4IA 4XM4A 3SOYA 3BNCA 2XSHB 3CD63 2PZVA 1ASKA 4OUQA 1S723 4HM3B 4MEIA 1LXEA 1SQWA 1UUVB 3IPTA 2CG0A 1T5YA 2E2UA 3F7SA 1VQK3 3LT9A 3FF2A 4MMXB 2BMRB 3NBBA 4GB5A 5AI1A 4I4KA 3BNDA 1IVXA 1IT8A 1WQLB 3F9SA 3SXXA 4JF8A 3S5CA 4N6OB 3OWSA 1VZZA 1STDA 3UNLA 2CW9A 2Z6BA 3X3ZA 1VQ93 2BNGA 2RSXA 1U8CB 3T0UA 1OHOA 1KWIA 3JUPA 4R9LA 4WYKA 3JUNA 3CPW2 1QMAA 1VQP3 1JJ22 2QGUA 4KFFA 3I563 3NBJA 4RBNA 4WHAA 5KP3A 2CG1A 4FCMA 2XFTA 1ISKA 3PCSA 4XDWA 4N6TA 2BMQB 1JV2B 2A15A 3Q2PA 2CKFB 4HM7B 3T8UA 4HZBB 1DYUA 2E2VA 3OWUA 3NM7A 5IERA 1W6CA 1IVWA 2IUKA 1J2BA 3SLUA 1QJGA 3UL6A 3FSDA 3CC43 3L0RA 1JRQA 3NXJA 2MF7A 1L5GB 1QALA 3K0ZA 1QVF2 4HM4B 5CF1A 1RRLA 2D1WA 2O3OA 2JDIH 4MJDA 1SPUA 2GU1A 2FGTA 2W04A 2XH9A 4WFOA 1D6UA 5KP4A 4KFDA 3K9MC 4N6NB 1IQXA 5AIGA 1IV7A 5DRVA 3UL5A 5D81A 1G96A 5A0OB 4IT7A 4O3VA 2CWTA 1AVKA 1FGMA 2Y74A 3AMOB 3EF8A 3LXUX 3NUVA 3F14A 5STDA 5AIHA 2BHMA 1E3RA 1E3VA 2FNQA 3CME3 1Q864 1W5ZA 1TP6A 3CCS3 2XGLA 1IT7A 3JUOA 1TIJA 3X41A 1K28A 1NO3A 3V92A 4RNZA 8CHOA 4HKVB 1US1A 3KN4A 3HX8A 3PZWA 3X40A 1SJWA 3SVAA 2O9UX 4Q53A 3OWYA 2UX0A 3EBTA 4N6LA 1NWWA 3B8LA 2W9PA 1GS3A 1VQ63 2CHCA 4XB5A 3G713 1NU3A 3HIIA 3JUMA 4R4KA 1Q40A 1K8A4 3I553 3CCM3 3DMCA 2YFIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCE 3;  3CCV 3;  3CD6 3;  1YIJ 3;  1S72 3;  3CCQ 3;  1K73 4;  2QEX 3;  2OTJ 3;  3CC4 3;  1QVG 2;  3G4S 3;  1QVF 2;  3CME 3;  1YHQ 3;  1Q86 4;  3CPW 2;  3CCR 3;  3CCS 3;  1VQP 3;  1JJ2 2;  1VQ4 3;  1VQ5 3;  1VQ9 3;  2OTL 3;  1YJN 3;  3CMA 3;  1VQK 3;  3I56 3;  3CCU 3;  3CC2 3;  1Q7Y 4;  1VQ8 3;  1YJW 3;  1YIT 3;  1W2B 2;  2QA4 3;  1VQ7 3;  1YI2 3;  3CXC 2;  3CC7 3;  1VQM 3;  1K9M 4;  1KQS 2;  1N8R 4;  1KC8 4;  1Q81 4;  1VQN 3;  1KD1 4;  3CCJ 3;  1VQO 3;  1M90 4;  1VQ6 3;  3G71 3;  3G6E 3;  1YJ9 3;  1VQL 3;  1Q82 4;  3CCL 3;  1K8A 4;  3I55 3;  1NJI 4;  3CCM 3;  1M1K 4;  3OW2 2; 
#chains in the Genus database with same CATH topology
 1VQQ A;  3IMA B;  3Q90 A;  1MWS A;  4NPB A;  3OV4 A;  3CCQ 3;  1K73 4;  1CQS A;  1NB5 I;  3AHW A;  4STD A;  5IG5 A;  1OF5 B;  4HM1 B;  1MWU A;  4FCZ A;  4HVN A;  3WOE B;  5G1K A;  1VQ8 3;  3WDG B;  4EV5 A;  2CIU A;  1EA2 A;  3DGM A;  1TFK A;  4PEJ A;  4TX4 A;  1W00 A;  3WA3 A;  1W2Z A;  2XR8 B;  1GOY A;  1TU5 A;  1JZD A;  2OQE C;  2P0M A;  4XBY A;  5JBS A;  2OQE A;  5HGR A;  4GL6 A;  1W7C A;  1TFO A;  1FGQ A;  1B2S A;  3UJM A;  3WHO A;  1QAK A;  1A90 A;  2XGN A;  1G02 A;  2BMO B;  2H0I A;  1GY5 A;  2HOH A;  3BIR A;  3FCS B;  3LTA A;  3DXO A;  2KXG A;  2M7O A;  1RGK A;  1YNV X;  2F99 A;  3LOY A;  4AKZ A;  4KVH A;  1OPY A;  3KE7 A;  3MKI A;  2CFD A;  1I70 A;  4HZ9 B;  4KZ1 A;  1O7W B;  1C7H A;  2MC8 A;  3K63 A;  2KF3 A;  1DVD A;  1BU4 A;  3CXC 2;  1FZU A;  4LGQ A;  5M1A A;  4GHO A;  1CH0 A;  3CC7 3;  3HOH A;  1BUQ A;  1W4N A;  2BO9 B;  1RJO A;  1U5O A;  3UB1 A;  4CDL A;  3D5I A;  1AVL A;  4BL3 A;  3ALA A;  3GZR A;  4J9A A;  1NNV A;  5FW5 A;  4XDV A;  3SED A;  1BGS A;  1JKG A;  1UGH I;  3NQY A;  2Z7A A;  1FYS A;  1MGR A;  2CFL A;  2ML5 A;  6STD A;  2F5W A;  1ZO2 A;  1EG9 B;  2GXF A;  3FKA A;  3FF0 A;  1Q40 B;  3LZA A;  3MG2 A;  3D9R A;  2ZDJ A;  1LQG C;  3RGA A;  1LOX A;  3OXA A;  3BNE A;  1UGI A;  1O7P B;  3GRD A;  4H61 A;  3NM2 A;  2WOH A;  3X3X A;  2CWV A;  3D5G A;  1JKG B;  5EVH A;  1STF I;  1HU9 A;  5M18 A;  4FMB A;  1V74 A;  3S67 A;  1KC8 4;  2CC3 A;  3NV0 A;  2HMM B;  5BIR A;  3WOF B;  5BVB A;  1SIH A;  2BT3 A;  6GSP A;  1MNL A;  4HM5 B;  1TRQ A;  1DMN A;  1MOL A;  4FMC A;  3OW2 2;  1RNB A;  2W56 A;  1PFP A;  3GSP A;  1TRP A;  3D4A A;  1PU4 A;  4N6M A;  2YFL B;  1FUW A;  1JBS A;  2QEX 3;  3PCR A;  5DRE A;  2YX9 A;  1RHL A;  4HM0 B;  3WMD A;  1OCV A;  4R9K A;  3I0Y A;  3G16 A;  1Z1S A;  3EC9 A;  4KFE A;  3VSY A;  4EV2 A;  3LTD A;  1JN5 B;  1Q9E A;  3J7Y d;  1B3S A;  1A2V A;  3DGN A;  1IV9 A;  2RFR A;  1GY6 A;  1UUW B;  4WWU C;  5IF6 A;  1Q81 4;  2D42 A;  1VQN 3;  3HIG A;  4RZM A;  1YGE A;  3Q1C A;  1D6Z A;  1Q82 4;  1JNQ A;  2HMN B;  5CXO A;  1CEW I;  1RTU A;  1I0V A;  1RGG A;  2OCT A;  3N8B A;  8RNT A;  5IW9 A;  1T2I A;  2C4B A;  3MWZ A;  1YIJ 3;  3WA2 X;  1RGL A;  1WMP A;  1LOY A;  4XBX A;  1N5H A;  1LVN A;  4NRE A;  4X2O A;  3EE1 A;  3S29 A;  3V99 A;  1GD3 A;  2GU3 A;  2XFS A;  3NHX A;  7RNT A;  1QAF A;  4LSO A;  5ELJ A;  2CH9 A;  5TGN A;  1WTH A;  3LML A;  1RDS A;  4WP5 A;  1W6G A;  1OH0 A;  1AV4 A;  1RKY A;  3X42 A;  2HMK B;  3AMO A;  3U1W A;  1LNH A;  2QIY A;  1N9J A;  5IG4 A;  1GOV A;  3GZB A;  2RBI A;  4IIA A;  1X1Y A;  2OOV A;  3JVC A;  2XSO B;  4K61 A;  4OK0 A;  1MGW A;  2P09 A;  1Y4K A;  4EBG A;  1DMM A;  5IG3 A;  5AEW B;  2H0G A;  1HKX A;  3CCL 3;  2GEY A;  4N6V 0;  1OHS A;  2W03 A;  3F8X A;  1RGA A;  1OGZ A;  1GY7 A;  3PS8 A;  4O02 B;  1B2X A;  3LYG A;  4G1M B;  1GMP A;  3BLZ A;  3EQQ B;  3LT8 A;  2JQ5 A;  1QVG 2;  1IYY A;  1N5P A;  1FW7 A;  1JB5 A;  3K5T A;  1ROA A;  1BRJ A;  3K7C A;  3IJE B;  4RNT A;  1FUS A;  3KSE D;  2C10 A;  3WOD G;  4FCJ A;  5GSP A;  2CFW A;  3EN1 B;  4XBT A;  1IQY A;  3FG1 A;  1SAR A;  3H51 A;  5LC6 A;  1YIT 3;  3HZP A;  4LYL B;  3HK4 A;  3T8N A;  6RNT A;  1VQM 3;  1B27 A;  1RN7 A;  2XF3 A;  1N8R 4;  1KQS 2;  1O7N B;  4MMY B;  3N9H A;  4N3V A;  1S5A A;  2PNC A;  1GMR A;  3EHC A;  3G8Z A;  4X2H A;  1DVC A;  4FR9 A;  3VGN A;  4DKI A;  3S28 A;  4QWT A;  4LZI A;  1EEJ A;  1A2K A;  1Q42 A;  1RN4 A;  1O7M B;  3QK9 A;  2SAR A;  1JN5 A;  1BRG A;  3SOA A;  4CCV A;  1NJI 4;  3FG4 A;  1IQ8 A;  1NDO B;  5IG0 A;  4HYZ A;  2IMJ A;  1A2P A;  4K1U A;  4NHF A;  5IEN A;  1I8V A;  3FGY A;  4H3U A;  1JB2 A;  4BIR A;  2W0Q A;  4HM2 B;  3F7X A;  4R80 A;  4HM6 B;  1VQ4 3;  1BRN L;  4U13 A;  3CNX A;  3CCU 3;  3CC2 3;  1KSI A;  4HAA A;  4HJL B;  3MYT A;  2Q07 A;  1ROV A;  3D3L A;  1YI2 3;  1YVS A;  3DGL A;  3DZL A;  3RGR A;  4ORL A;  1N9E A;  1HZ1 A;  1M90 4;  2C11 A;  3VF1 A;  1SII A;  2Z77 A;  1F8N A;  3MHE A;  3G6E 3;  1YJ9 3;  3DY5 A;  2IUJ A;  3EN8 A;  2ML6 A;  3CU3 A;  3MPH A;  2Y73 A;  4J5G A;  4EC6 A;  2LQV A;  2W9Q A;  3SYU A;  5JPP A;  5JPU A;  1OAC A;  1RCL A;  1ULI B;  3CPO A;  2HMO B;  3EBY A;  3AGN A;  1RGC A;  2V1L A;  2RGQ A;  4EW5 A;  1UCJ A;  1BRS A;  3F8H A;  2OTJ 3;  3B7C A;  4EXR A;  3A76 A;  1VQ5 3;  3CCR 3;  1R4Y A;  1NB3 I;  1GD4 A;  4L7K A;  1RNT A;  2B24 B;  4IPB A;  2WOF A;  2GSP A;  1ZS7 A;  2INX A;  3NQZ A;  4BTW A;  1VQ7 3;  2KF4 A;  4OVM A;  3LH4 A;  1B20 A;  1CYV A;  2F98 A;  1GOU A;  1OF5 A;  1CYU A;  3HI7 A;  4J8T A;  4BTX A;  1IVV A;  1LQM B;  1R4C A;  2YFI B;  4AEQ A;  1ZX2 A;  4FMD A;  2XRX B;  4AKY A;  3AHS A;  1RLS A;  3FLJ A;  1UI7 A;  3ER7 A;  3FH1 A;  5EQL A;  3OX9 A;  4O2H A;  3GZY B;  3BB9 A;  3NBR A;  1OHP A;  1O7G B;  1E97 A;  2STD A;  4BTY A;  3EB8 A;  1YHQ 3;  1W6Y A;  2F86 B;  3G0K A;  3M8C A;  1OUN A;  1FGR A;  2UGI A;  1X1X A;  1IU7 A;  3FZW A;  3F40 A;  2W6J H;  3KII A;  4HM8 B;  3SX1 A;  1YJW 3;  2GBX B;  2LYX A;  1W02 A;  3EX9 A;  1TJD A;  1IK3 A;  3MG3 A;  2P0X A;  2W56 B;  4MMZ B;  3D79 A;  4N6U A;  1K9M 4;  2J8X B;  2AAD A;  1DMQ A;  2IYJ A;  3CCJ 3;  1VQO 3;  2KRT A;  5D82 A;  1BUJ A;  1RSN A;  1BNR A;  3BNB A;  2HML B;  1M1K 4;  2W2C A;  3KCH A;  4LMI A;  4KT3 B;  3CCE 3;  3CNM A;  1FGO A;  2L4V A;  1T2H A;  7STD A;  1UUG B;  1M1X B;  1M9G A;  5AYS C;  5IEP A;  5RNT A;  1O7H B;  2R41 A;  5AYR B;  3G4S 3;  2HMJ B;  4L8P A;  5ELU A;  1K41 A;  4BU4 A;  2WO0 A;  4GSP A;  1I3I A;  5FGO A;  1BOX A;  4RNY A;  2FXT A;  4K1V A;  3LTC A;  2QA4 3;  1HYF A;  1FUT A;  1BAO A;  1V58 A;  1YGW A;  2GEX A;  4FMA A;  4O8S A;  3PGB A;  3STD A;  1N8Q A;  2CX1 A;  4HOH A;  4R1K A;  1OGX A;  1ZGX A;  2CFK A;  2K54 A;  1FA3 A;  1IVU A;  5IEO A;  2F4Y A;  3N54 B;  2P38 A;  5EEO A;  5I97 A;  1BIR A;  2IY2 A;  1TTO A;  1AY7 A;  1RCK A;  1BNF A;  3DGO A;  1LOV A;  4LEH A;  5AII A;  4ZM8 A;  1YVB I;  3Q3F A;  3MG1 A;  3CCV 3;  2KF5 A;  3GZX B;  3NV0 B;  3PXM A;  3ZG0 A;  1BSC A;  1BSD A;  2KCD A;  2L1S A;  3B4P A;  3NX0 A;  5G2G A;  3DM8 A;  1WNH A;  3GWR A;  2OTL 3;  3DUK A;  1RGF A;  5LC7 A;  3ROB A;  2XEP A;  1FGT A;  1TUH A;  3B4O A;  1BRI A;  3KFQ C;  4HBR A;  1RRH A;  2OWP A;  5KP1 A;  3JUQ A;  3PYJ A;  2AAE A;  2WGQ A;  5CK6 A;  5BU4 A;  3WR2 A;  1GYB A;  5BXQ A;  3S27 A;  1WMO A;  3X3Y A;  1KD1 4;  1AR0 A;  3H3H A;  1UI8 A;  4WYK B;  1EKM A;  4L8O A;  1VQL 3;  1W01 A;  2WGO A;  5AEU B;  5CLK A;  3LTB A;  1W2B 2;  1BVI A;  1I0X A;  2YFJ B;  3GAX A;  9RNT A;  2RCD A;  1A67 A;  2B1X B;  3E99 A;  5CF2 A;  3EJV A;  2BIR A;  3V98 A;  4EYC A;  3CMA 3;  3MSO A;  3KKG A;  1YJN 3;  2ZL8 A;  3QRD A;  2IA7 A;  2OOV C;  3TDG A;  1Q7Y 4;  1EQK A;  2K0M A;  1JBT A;  2E2T A;  2SBL A;  1JB4 A;  1IDP A;  4K90 B;  1ULJ B;  3KZT A;  3ZG5 A;  2CK3 H;  1WMN A;  1UW1 A;  5AIF A;  3RDE A;  4JRF A;  3KSP A;  2BU4 A;  2Z76 A;  2CX0 A;  3FG3 A;  2H0H A;  3ECF A;  2CFG A;  2P05 A;  3A5E A;  1D6Y A;  3O8Y A;  1JBR A;  2GBW B;  2I9W A;  5D83 A;  3U97 A;  2R4I A;  4XM4 A;  3SOY A;  1GSP A;  3DH2 A;  3BNC A;  2XSH B;  3CD6 3;  2PZV A;  1ASK A;  4OUQ A;  2KF6 A;  3RNT A;  1S72 3;  4HM3 B;  4MEI A;  1LXE A;  1SQW A;  1UUV B;  3IPT A;  2CG0 A;  1UDI I;  1BAN A;  1T5Y A;  2E2U A;  1B2Z A;  3AGO A;  3F7S A;  1UCK A;  1VQK 3;  3LT9 A;  4CPK A;  1DE3 A;  1C54 A;  3FF2 A;  1BRK A;  1BSE A;  4MMX B;  2BMR B;  3NBB A;  4GB5 A;  1BNJ A;  3BU4 A;  4I4K A;  5AI1 A;  3BND A;  4BL2 A;  1LNI A;  1IVX A;  1IT8 A;  1I2G A;  1WQL B;  3F9S A;  3SXX A;  4CJN A;  4JF8 A;  5G1L A;  3S5C A;  7GSP A;  4N6O B;  3OWS A;  1VZZ A;  1STD A;  3UNL A;  2CW9 A;  1RN1 A;  2Z6B A;  3X3Z A;  1VQ9 3;  2BNG A;  2RSX A;  1U8C B;  3T0U A;  1OHO A;  1KWI A;  3JUP A;  4I5Q A;  4R9L A;  1T3B A;  3ZFZ A;  4WYK A;  3JUN A;  1RGH A;  3CPW 2;  1QMA A;  1VQP 3;  1JJ2 2;  2QGU A;  4KFF A;  3I56 3;  3NBJ A;  4RBN A;  4WHA A;  1BRH A;  5M19 A;  5KP3 A;  2CG1 A;  4FCM A;  2XFT A;  1ISK A;  3PCS A;  4XDW A;  4N6T A;  2BMQ B;  1JV2 B;  2A15 A;  3Q2P A;  2CKF B;  4HM7 B;  3T8U A;  4HZB B;  1JZO A;  1MWR A;  1DYU A;  2E2V A;  3OWU A;  3NM7 A;  5IER A;  1W6C A;  1PYL A;  1IVW A;  2IUK A;  1J2B A;  3SLU A;  1QJG A;  3UL6 A;  3FSD A;  2UUG C;  1RMS A;  1DET A;  1AQZ A;  4ILF A;  5HOH A;  2K3D A;  1JRQ A;  1BSB A;  1BSA A;  3L0R A;  3CC4 3;  3NXJ A;  2MF7 A;  1L5G B;  1X1U A;  1QAL A;  1RGE A;  3K0Z A;  1QVF 2;  4HM4 B;  5CF1 A;  1RRL A;  2D1W A;  1BNG A;  2O3O A;  1Q7H A;  2JDI H;  4MJD A;  1SPU A;  1I3F A;  2GU1 A;  2FGT A;  2W04 A;  2XH9 A;  4WFO A;  1D6U A;  1BNI A;  4KFD A;  1V57 A;  3K9M C;  4N6N B;  2F56 A;  1IQX A;  5KP4 A;  5AIG A;  1IV7 A;  2RNT A;  5DRV A;  3UL5 A;  5D81 A;  1LOW A;  1G96 A;  5A0O B;  4IT7 A;  3DGY A;  1I2F A;  4J5K A;  4O3V A;  1EUI C;  2CWT A;  1B2M A;  1AVK A;  1FGM A;  1PY3 A;  2Y74 A;  2ZHX B;  3AMO B;  3EF8 A;  3LXU X;  3NUV A;  3F14 A;  5STD A;  1GMQ A;  5AIH A;  2BHM A;  1E3R A;  1G0T A;  1UCL A;  1E3V A;  2FNQ A;  3CME 3;  1Q86 4;  1W5Z A;  1TP6 A;  3CCS 3;  1B21 A;  2XGL A;  1IT7 A;  3JUO A;  1TIJ A;  3X41 A;  1K28 A;  2F5M A;  1NO3 A;  2KAA A;  4RNZ A;  3V92 A;  8CHO A;  4HKV B;  1US1 A;  3KN4 A;  1UCI A;  3HX8 A;  3PZW A;  3X40 A;  1LRA A;  1SJW A;  3SVA A;  3URP A;  2O9U X;  4Q53 A;  1BNS A;  2UX0 A;  3EBT A;  3OWY A;  4N6L A;  1NWW A;  1B2U A;  2W9P A;  3B8L A;  1BNE A;  1GS3 A;  1VQ6 3;  2CHC A;  4XB5 A;  3G71 3;  1NU3 A;  3HII A;  3JUM A;  4R4K A;  1Q40 A;  1K8A 4;  3I55 3;  3CCM 3;  1MWT A;  3DMC A;  2CWU A;  1X1W A;  1I2E A;  2ZA4 A; 
#chains in the Genus database with same CATH homology
 3IMA B;  3Q90 A;  3OV4 A;  3CCQ 3;  1K73 4;  1CQS A;  1NB5 I;  4STD A;  5IG5 A;  1OF5 B;  4HM1 B;  4FCZ A;  4HVN A;  3WOE B;  1VQ8 3;  3WDG B;  4EV5 A;  2CIU A;  1EA2 A;  3DGM A;  1TFK A;  4PEJ A;  4TX4 A;  1W00 A;  3WA3 A;  1W2Z A;  2XR8 B;  1TU5 A;  2OQE C;  2P0M A;  4XBY A;  5JBS A;  2OQE A;  5HGR A;  4GL6 A;  1W7C A;  1TFO A;  1FGQ A;  3UJM A;  1QAK A;  1A90 A;  2XGN A;  2BMO B;  1GY5 A;  3FCS B;  3LTA A;  3DXO A;  2KXG A;  2M7O A;  2F99 A;  3LOY A;  4AKZ A;  4KVH A;  1OPY A;  3KE7 A;  3MKI A;  2CFD A;  4HZ9 B;  4KZ1 A;  1O7W B;  1C7H A;  2MC8 A;  3K63 A;  1DVD A;  3CXC 2;  4LGQ A;  3CC7 3;  1BUQ A;  1W4N A;  2BO9 B;  1RJO A;  1U5O A;  3UB1 A;  4CDL A;  1AVL A;  3ALA A;  3GZR A;  4J9A A;  5FW5 A;  4XDV A;  3SED A;  1JKG A;  3NQY A;  2Z7A A;  2CFL A;  2ML5 A;  6STD A;  1ZO2 A;  1EG9 B;  2GXF A;  3FKA A;  3FF0 A;  1Q40 B;  3LZA A;  3MG2 A;  3D9R A;  2ZDJ A;  3RGA A;  1LOX A;  3OXA A;  3BNE A;  1O7P B;  3GRD A;  4H61 A;  3NM2 A;  2WOH A;  3X3X A;  2CWV A;  1JKG B;  5EVH A;  1STF I;  1HU9 A;  4FMB A;  1V74 A;  3S67 A;  1KC8 4;  2CC3 A;  3NV0 A;  2HMM B;  3WOF B;  5BVB A;  1SIH A;  2BT3 A;  1MNL A;  4HM5 B;  1DMN A;  1MOL A;  4FMC A;  3OW2 2;  2W56 A;  1PFP A;  1PU4 A;  4N6M A;  2YFL B;  1FUW A;  2QEX 3;  3PCR A;  5DRE A;  2YX9 A;  4HM0 B;  3WMD A;  1OCV A;  4R9K A;  3I0Y A;  3G16 A;  1Z1S A;  3EC9 A;  4KFE A;  3VSY A;  4EV2 A;  3LTD A;  1JN5 B;  3J7Y d;  3DGN A;  1A2V A;  1IV9 A;  2RFR A;  1GY6 A;  1UUW B;  4WWU C;  5IF6 A;  1Q81 4;  2D42 A;  1VQN 3;  3HIG A;  4RZM A;  1YGE A;  3Q1C A;  2CWU A;  1D6Z A;  1Q82 4;  1JNQ A;  2HMN B;  5CXO A;  1CEW I;  3N8B A;  5IW9 A;  2OCT A;  3MWZ A;  1YIJ 3;  3WA2 X;  1WMP A;  4XBX A;  1N5H A;  1LVN A;  4NRE A;  4X2O A;  3EE1 A;  3S29 A;  3V99 A;  1GD3 A;  2GU3 A;  2XFS A;  3NHX A;  1QAF A;  4LSO A;  5ELJ A;  2CH9 A;  5TGN A;  1WTH A;  3LML A;  4WP5 A;  1W6G A;  1OH0 A;  1AV4 A;  1RKY A;  3X42 A;  2HMK B;  3AMO A;  3U1W A;  1LNH A;  2QIY A;  1N9J A;  5IG4 A;  3GZB A;  4IIA A;  2OOV A;  3JVC A;  2XSO B;  4K61 A;  4OK0 A;  2P09 A;  4EBG A;  1Y4K A;  5IG3 A;  1DMM A;  5AEW B;  1HKX A;  3CCL 3;  2GEY A;  4N6V 0;  1OHS A;  2W03 A;  3F8X A;  1OGZ A;  1GY7 A;  3PS8 A;  4O02 B;  3LYG A;  4G1M B;  3BLZ A;  3EQQ B;  3LT8 A;  1QVG 2;  2JQ5 A;  1N5P A;  1JB5 A;  3K5T A;  1ROA A;  3K7C A;  3IJE B;  3KSE D;  2C10 A;  3WOD G;  4FCJ A;  1W2B 2;  2CFW A;  3EN1 B;  4XBT A;  1IQY A;  3FG1 A;  5LC6 A;  3H51 A;  1YIT 3;  3HZP A;  3HK4 A;  3T8N A;  1VQM 3;  1RN7 A;  2XF3 A;  1N8R 4;  1KQS 2;  1O7N B;  4MMY B;  3N9H A;  4N3V A;  1S5A A;  2PNC A;  3EHC A;  4X2H A;  3G8Z A;  3VGN A;  1DVC A;  4FR9 A;  3S28 A;  4QWT A;  4LZI A;  3QK9 A;  1A2K A;  1Q42 A;  1NJI 4;  1O7M B;  4CCV A;  1JN5 A;  3SOA A;  3FG4 A;  1IQ8 A;  1NDO B;  5IG0 A;  4HYZ A;  2IMJ A;  4K1U A;  4NHF A;  5IEN A;  3FGY A;  4H3U A;  1JB2 A;  2W0Q A;  4HM2 B;  3F7X A;  4R80 A;  4HM6 B;  1VQ4 3;  4U13 A;  3CNX A;  3CCU 3;  3CC2 3;  1KSI A;  4HJL B;  3MYT A;  2Q07 A;  1ROV A;  3D3L A;  1YI2 3;  3DGL A;  3DZL A;  3RGR A;  4ORL A;  1N9E A;  1M90 4;  2C11 A;  3VF1 A;  1SII A;  2Z77 A;  1F8N A;  3MHE A;  3G6E 3;  1YJ9 3;  3DY5 A;  2IUJ A;  3EN8 A;  2ML6 A;  3CU3 A;  3MPH A;  2Y73 A;  4EC6 A;  2LQV A;  2W9Q A;  5JPP A;  5JPU A;  1OAC A;  1ULI B;  3CPO A;  2HMO B;  3EBY A;  2V1L A;  2OTJ 3;  2RGQ A;  3F8H A;  3B7C A;  4EXR A;  3A76 A;  1VQ5 3;  3CCR 3;  1NB3 I;  1GD4 A;  4L7K A;  2B24 B;  4IPB A;  2WOF A;  2INX A;  3NQZ A;  4BTW A;  1VQ7 3;  4OVM A;  3LH4 A;  1CYV A;  2F98 A;  1OF5 A;  1CYU A;  3HI7 A;  4J8T A;  4BTX A;  1IVV A;  1R4C A;  4AEQ A;  1ZX2 A;  4FMD A;  2XRX B;  4AKY A;  3FLJ A;  1UI7 A;  3ER7 A;  3FH1 A;  5EQL A;  3OX9 A;  4O2H A;  3GZY B;  3BB9 A;  3NBR A;  1OHP A;  1O7G B;  1E97 A;  2STD A;  4BTY A;  3EB8 A;  1YHQ 3;  1W6Y A;  2F86 B;  3G0K A;  3M8C A;  1OUN A;  1FGR A;  1IU7 A;  3FZW A;  3F40 A;  2W6J H;  3KII A;  4HM8 B;  3SX1 A;  1YJW 3;  2GBX B;  2LYX A;  1W02 A;  3EX9 A;  1IK3 A;  3MG3 A;  2P0X A;  2W56 B;  4MMZ B;  4N6U A;  1K9M 4;  3CCJ 3;  1DMQ A;  1VQO 3;  2KRT A;  5D82 A;  3BNB A;  2HML B;  1M1K 4;  2W2C A;  4LMI A;  3CCE 3;  3CNM A;  1FGO A;  2L4V A;  7STD A;  1M1X B;  1M9G A;  5AYS C;  5IEP A;  1O7H B;  5AYR B;  3G4S 3;  2HMJ B;  4L8P A;  5ELU A;  1K41 A;  2WO0 A;  5FGO A;  4RNY A;  2FXT A;  4K1V A;  3LTC A;  2QA4 3;  4FMA A;  2GEX A;  4O8S A;  3STD A;  3PGB A;  1N8Q A;  4R1K A;  1OGX A;  2CFK A;  2K54 A;  1FA3 A;  1IVU A;  5IEO A;  3N54 B;  2P38 A;  5EEO A;  5I97 A;  3DGO A;  5AII A;  4LEH A;  4ZM8 A;  1YVB I;  3CCV 3;  3MG1 A;  3GZX B;  3PXM A;  3NV0 B;  2KCD A;  3B4P A;  5G2G A;  3NX0 A;  3DM8 A;  1WNH A;  3GWR A;  2OTL 3;  3DUK A;  5LC7 A;  3ROB A;  2XEP A;  1FGT A;  1TUH A;  3B4O A;  3KFQ C;  4HBR A;  1RRH A;  2OWP A;  5KP1 A;  3JUQ A;  3PYJ A;  2WGQ A;  5CK6 A;  1GYB A;  5BXQ A;  3S27 A;  1WMO A;  3X3Y A;  1KD1 4;  1AR0 A;  3H3H A;  1UI8 A;  4WYK B;  1EKM A;  4L8O A;  1VQL 3;  1W01 A;  2WGO A;  5AEU B;  5CLK A;  3LTB A;  2YFJ B;  3GAX A;  2RCD A;  1A67 A;  2B1X B;  3E99 A;  5CF2 A;  3EJV A;  3V98 A;  4EYC A;  3CMA 3;  3MSO A;  3KKG A;  1YJN 3;  2ZL8 A;  3QRD A;  2IA7 A;  2OOV C;  3TDG A;  1Q7Y 4;  1EQK A;  2K0M A;  2E2T A;  2SBL A;  1JB4 A;  1IDP A;  4K90 B;  1ULJ B;  3KZT A;  2CK3 H;  1WMN A;  1UW1 A;  5AIF A;  3RDE A;  4JRF A;  3KSP A;  2Z76 A;  3FG3 A;  3ECF A;  2CFG A;  2P05 A;  1D6Y A;  3O8Y A;  2GBW B;  2I9W A;  5D83 A;  3U97 A;  2R4I A;  4XM4 A;  3SOY A;  3BNC A;  2XSH B;  3CD6 3;  2PZV A;  1ASK A;  4OUQ A;  1S72 3;  4HM3 B;  4MEI A;  1LXE A;  1SQW A;  1UUV B;  3IPT A;  2CG0 A;  1T5Y A;  2E2U A;  3F7S A;  1VQK 3;  3LT9 A;  3FF2 A;  4MMX B;  2BMR B;  3NBB A;  4GB5 A;  5AI1 A;  4I4K A;  3BND A;  1IVX A;  1IT8 A;  1WQL B;  3F9S A;  3SXX A;  4JF8 A;  3S5C A;  4N6O B;  3OWS A;  1VZZ A;  1STD A;  3UNL A;  2CW9 A;  2Z6B A;  3X3Z A;  1VQ9 3;  2BNG A;  2RSX A;  1U8C B;  3T0U A;  1OHO A;  1KWI A;  3JUP A;  4R9L A;  4WYK A;  3JUN A;  3CPW 2;  1QMA A;  1VQP 3;  1JJ2 2;  2QGU A;  4KFF A;  3I56 3;  3NBJ A;  4RBN A;  4WHA A;  5KP3 A;  2CG1 A;  4FCM A;  2XFT A;  1ISK A;  3PCS A;  4XDW A;  4N6T A;  2BMQ B;  1JV2 B;  2A15 A;  3Q2P A;  2CKF B;  4HM7 B;  3T8U A;  4HZB B;  1DYU A;  2E2V A;  3OWU A;  3NM7 A;  5IER A;  1W6C A;  1IVW A;  2IUK A;  1J2B A;  3SLU A;  1QJG A;  3UL6 A;  3FSD A;  3CC4 3;  3L0R A;  1JRQ A;  3NXJ A;  2MF7 A;  1L5G B;  1QAL A;  3K0Z A;  1QVF 2;  4HM4 B;  5CF1 A;  1RRL A;  2D1W A;  2O3O A;  2JDI H;  4MJD A;  1SPU A;  2GU1 A;  2FGT A;  2W04 A;  2XH9 A;  4WFO A;  1D6U A;  5KP4 A;  4KFD A;  3K9M C;  4N6N B;  1IQX A;  5AIG A;  1IV7 A;  5DRV A;  3UL5 A;  5D81 A;  1G96 A;  5A0O B;  4IT7 A;  4O3V A;  2CWT A;  1AVK A;  1FGM A;  2Y74 A;  3AMO B;  3EF8 A;  3LXU X;  3NUV A;  3F14 A;  5STD A;  5AIH A;  2BHM A;  1E3R A;  1E3V A;  2FNQ A;  3CME 3;  1Q86 4;  1W5Z A;  1TP6 A;  3CCS 3;  2XGL A;  1IT7 A;  3JUO A;  1TIJ A;  3X41 A;  1K28 A;  1NO3 A;  3V92 A;  4RNZ A;  8CHO A;  4HKV B;  1US1 A;  3KN4 A;  3HX8 A;  3PZW A;  3X40 A;  1SJW A;  3SVA A;  2O9U X;  4Q53 A;  3OWY A;  2UX0 A;  3EBT A;  4N6L A;  1NWW A;  3B8L A;  2W9P A;  1GS3 A;  1VQ6 3;  2CHC A;  4XB5 A;  3G71 3;  1NU3 A;  3HII A;  3JUM A;  4R4K A;  1Q40 A;  1K8A 4;  3I55 3;  3CCM 3;  3DMC A;  2YFI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...