3CXC2

The structure of an enhanced oxazolidinone inhibitor bound to the 50s ribosomal subunit of h. marismortui
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
92
structure length
92
Chain Sequence
b'MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Design at the atomic level: design of biaryloxazolidinones as potent orally active antibiotics.
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3cxc200
1VQM3 3CME3 1VQP3 3CCL3 1VQ43 1KD14 3CCV3 1K9M4 1VQ53 3CMA3 1VQN3 3G6E3 1K8A4 2QEX3 3CPW2 1VQK3 3CCE3 1VQ73 1YJ93 1QVF2 1S723 2OTJ3 2QA43 1K734 3CCU3 3CC43 3CCJ3 1NJI4 1Q824 1VQ83 3CCQ3 1Q814 1M904 3I553 3CCR3 3CC23 1YIJ3 1W2B2 1M1K4 1YJW3 1JJ22 2OTL3 1YI23 1VQL3 3G4S3 1YHQ3 3G713 3I563 1Q864 1KQS2 1VQ63 1YJN3 1Q7Y4 3CC73 3CXC2 1VQO3 1KC84 3CCS3 1QVG2 1VQ93 3OW22 3CD63 1N8R4 1YIT3 3CCM3
chains in the Genus database with same CATH superfamily
3K63A 2K0MA 1VQ53 1KD14 1T2IA 4JRFA 3G6E3 3SOAA 4GB5A 3S5CA 3S27A 3SYUA 2QA43 2RNTA 5IENA 4EYCA 1RGCA 1ZS7A 4ZM8A 3A76A 3NQYA 5RNTA 1NB5I 4N6NB 3D4AA 4NHFA 1N9JA 4NPBA 4N6UA 5G1LA 4I5QA 1AQZA 3IMAB 1YHQ3 1IV7A 4O02B 1FZUA 2GU3A 3S28A 1WTHA 1I8VA 1NO3A 3WA3A 1YGWA 4HBRA 5IF6A 2Y73A 1BVIA 1OH0A 3LXUX 1ROVA 1BNSA 1BNGA 4BU4A 1RMSA 3AGOA 1B21A 2W03A 2CIUA 2PZVA 1VZZA 1V57A 1RGKA 2GEYA 1M9GA 1OGZA 3EBTA 1QAFA 3X42A 3NXJA 1K9M4 3HX8A 4AKYA 1O7WB 3WOEB 4R4KA 1OF5A 2OOVA 1N8QA 1X1YA 3VGNA 1VQK3 2KAAA 2CWVA 1T5YA 1JKGA 1BSAA 1KWIA 2F99A 3X41A 5IG5A 2Z6BA 1B2MA 3CCQ3 2C11A 1W2B2 1ROAA 1GYBA 2CG0A 5JBSA 1YJW3 1BRSA 2INXA 4OK0A 3QK9A 1IQ8A 4FCMA 1HU9A 2JQ5A 1BSDA 4R1KA 1RCKA 2BT3A 3KFQC 1SARA 1W6CA 3T8NA 1RLSA 2SARA 5IERA 1FUWA 3PYJA 1ULJB 3WA2X 2LYXA 3CNXA 5AEUB 1RTUA 5EEOA 2KF6A 1CYVA 1BGSA 4HM8B 2ZL8A 1UI8A 1O7PB 3CC23 1VQM3 4TX4A 3LTDA 1Q40A 1EA2A 1OF5B 1W6GA 2OCTA 1QAKA 2CKFB 2IUJA 2QEX3 1JKGB 3JUPA 2WGQA 3FG4A 2E2VA 3Q90A 1PFPA 4GSPA 1EG9B 4RBNA 4X2HA 2H0GA 5AIGA 5IG4A 2ZHXB 1JB2A 1O7HB 4KZ1A 2ZDJA 5EVHA 3DGLA 1V58A 2XGLA 3EX9A 1ZGXA 4RNTA 1X1UA 2CFWA 1BUJA 1PYLA 1STFI 3AMOA 1HZ1A 2E2UA 2HMJB 1X1XA 1I0XA 4J9AA 5IG0A 2F56A 5EQLA 1B2UA 2YX9A 4BL2A 1GMQA 2O3OA 2H0IA 3UJMA 3FSDA 3CCS3 1FA3A 4CPKA 4HAAA 2OOVC 1E3VA 4N6TA 1OHPA 2P0MA 3DUKA 1PY3A 1UUWB 2KF5A 3E99A 1I3FA 1Q40B 4N6OB 1IU7A 1IQXA 1BANA 3TDGA 2CW9A 1BRKA 4WWUC 1IVVA 2XH9A 3BU4A 1W7CA 2H0HA 1A2KA 5M19A 1VQ73 1JBTA 2CWUA 1I70A 4FMCA 5JPPA 2XFTA 3HOHA 5M18A 3AGNA 3EHCA 2F5WA 2D1WA 1JV2B 1B27A 1W4NA 4R9LA 3I553 4J5GA 3AMOB 4J5KA 5AI1A 1RGAA 2W9QA 3K7CA 8CHOA 4XDVA 3RNTA 2OTL3 1F8NA 2CFGA 1DVDA 1RRHA 1EKMA 1BNFA 1D6YA 3IJEB 1G0TA 1YJN3 1J2BA 3CXC2 2IMJA 5AYRB 1JBSA 2UGIA 1JZOA 1YVSA 3KCHA 4XDWA 4CCVA 1E3RA 2E2TA 3MHEA 3NV0A 3WDGB 2RGQA 5CF2A 4R9KA 3KSED 3CCM3 3JUQA 1VQP3 1EUIC 3ALAA 5CXOA 1YVBI 1IDPA 3D5GA 3STDA 2CHCA 5A0OB 2IUKA 2LQVA 3N9HA 1GY7A 1S5AA 4LMIA 1BSCA 1WMOA 4RNYA 1TU5A 3X40A 3CC43 1A2PA 2CX0A 2L4VA 3AHWA 3PCSA 3EN1B 3DH2A 3LTAA 3WMDA 1BNEA 1ISKA 5I97A 2Z76A 1IT7A 1RKYA 4O3VA 4STDA 3WODG 1GOVA 1OACA 1RHLA 1SJWA 2ZA4A 4K61A 1O7NB 1Q42A 2GSPA 1MWUA 2L1SA 5M1AA 3MG1A 3NV0B 5GSPA 5BXQA 1A2VA 4N3VA 3HI7A 3JUMA 5G2GA 1CQSA 1VQQA 1N8R4 1A67A 1GSPA 1RN4A 5G1KA 8RNTA 3X3ZA 4EBGA 1CYUA 4H3UA 1YJ93 4GHOA 5AIIA 1GS3A 1K734 1AY7A 3B7CA 9RNTA 1Q814 2IY2A 1O7MB 4OVMA 3CCR3 1BSBA 4WHAA 3V98A 2RSXA 1STDA 2Q07A 3IPTA 4KFEA 3DXOA 3OX9A 5AYSC 1IVWA 3S67A 2XR8B 1AV4A 2FXTA 1GMPA 1WNHA 2B24B 3B4OA 3FH1A 3KE7A 4R80A 3EB8A 3S29A 3SVAA 5KP4A 2XRXB 1B20A 3FF2A 1RGFA 3LOYA 2K3DA 3CD63 4LGQA 1BUQA 3LYGA 1C54A 1OPYA 1Q7HA 2UUGC 3WHOA 1NNVA 1PU4A 1MWSA 1JBRA 2AAEA 3OWUA 4EC6A 2C4BA 4HVNA 2GEXA 3FCSB 4FMBA 4EW5A 2P09A 5D81A 7RNTA 1NJI4 1SIIA 3PS8A 3DGOA 2OWPA 1US1A 1GOYA 2XGNA 3CU3A 1NB3I 1IVUA 1VQL3 2XSOB 2KF4A 3DGMA 3X3XA 3BIRA 1R4YA 3ER7A 2MC8A 1LXEA 3PXMA 2W0QA 4CJNA 3V92A 3VF1A 1VQ93 1WMPA 1C7HA 5FW5A 4BTYA 4RNZA 5IEOA 2CX1A 3DGYA 3RGAA 1BRGA 2W9PA 4J8TA 4HZBB 3KN4A 2OQEA 5CF1A 1MOLA 1RGLA 1GY5A 1GMRA 3UL5A 2A15A 3DY5A 2RCDA 4KFDA 1UW1A 4HKVB 2OTJ3 2BO9B 4Q53A 1DMQA 4DKIA 3CCU3 5ELUA 5HGRA 1HYFA 1ZX2A 4LSOA 4WP5A 3M8CA 4X2OA 1YGEA 2K54A 1NU3A 3RDEA 1GY6A 1I2GA 2D42A 5BU4A 5KP3A 1BNJA 1DE3A 1VQ63 5JPUA 1ULIB 1MWRA 4ILFA 1WMNA 2YFIB 1KC84 2GBWB 1FGMA 1UUVB 1LOWA 1TP6A 1RGHA 4BL3A 3K9MC 4AEQA 3BLZA 1GD3A 4MEIA 2QGUA 3JUOA 3T8UA 4HM1B 1DYUA 1K41A 3CCL3 4EXRA 1TJDA 3HZPA 3CCV3 2XSHB 1RRLA 1K8A4 3H3HA 2GBXB 5CK6A 2HMMB 3B8LA 3F9SA 1B2ZA 5DRVA 5D83A 3X3YA 1TRPA 1W2ZA 3D3LA 3GWRA 2WGOA 5BVBA 3F8XA 1K28A 1B2SA 2W6JH 3EE1A 1YIJ3 2RBIA 3LZAA 1FGRA 2CC3A 4BTXA 4O2HA 1QALA 4MMXB 3HIGA 1TFOA 2Y74A 1I0VA 2P0XA 3N54B 1YNVX 3D79A 1G96A 2KRTA 3LT8A 1UCLA 3PCRA 4OUQA 1LRAA 5IW9A 3MYTA 4HM5B 1BU4A 4ORLA 2CK3H 1TUHA 1UUGB 4IIAA 1QMAA 1JB4A 3FLJA 3T0UA 3U1WA 1Z1SA 2F5MA 2Z7AA 1RCLA 2C10A 1LQMB 3F7SA 1LQGC 1M904 2PNCA 2R4IA 3V99A 4MMYB 2ML5A 1M1K4 4EV5A 1MWTA 2I9WA 3FKAA 3I0YA 4AKZA 3I563 2KF3A 5AEWB 1LOYA 4FMAA 1UI7A 3NHXA 3WOFB 2CWTA 2B1XB 3MKIA 3BB9A 1MGWA 4LEHA 3FG1A 2P38A 1QJGA 1RGEA 4I4KA 4HZ9B 1A90A 1RN1A 1YIT3 1EQKA 4MJDA 3Q1CA 1CEWI 1OHOA 1N5HA 5AIHA 1JRQA 3WR2A 1B3SA 1I2FA 4FMDA 1RNBA 3F14A 1UDII 1MGRA 2W56A 1B2XA 3LT9A 3KKGA 2WOHA 4EV2A 1N9EA 1I3IA 3NBJA 4H61A 4KVHA 1BOXA 1JJ22 1LVNA 1OGXA 3UL6A 5IEPA 3EC9A 2Z77A 3DMCA 4HM3B 2KCDA 2F98A 1O7GB 3CC73 1IV9A 6STDA 1TTOA 3BNCA 1IK3A 1FW7A 3BNBA 2FGTA 3HIIA 2YFJB 4FCZA 7GSPA 1TIJA 2BMRB 2CFLA 2IYJA 1AR0A 3FG3A 1X1WA 1IVXA 3NBBA 3CME3 3OXAA 2M7OA 1NWWA 3NQZA 3OV4A 1W02A 1WQLB 1W5ZA 2UX0A 3CCE3 2W56B 3NM7A 1V74A 3F8HA 3ROBA 1DVCA 2WOFA 4L7KA 3H51A 1N5PA 4N6LA 1Y4KA 2ML6A 5TGNA 2XFSA 1RNTA 4N6V0 3NX0A 3NBRA 3KZTA 4WYKA 3JVCA 5HOHA 1JB5A 2F86B 3G713 1JNQA 7STDA 5FGOA 5ELJA 1AVLA 1RJOA 1KSIA 2J8XB 1Q7Y4 1ASKA 1VQO3 3OWYA 3J7Yd 3KSPA 1LNIA 1W6YA 1W00A 1T2HA 1RSNA 3ECFA 3DGNA 3SX1A 3L0RA 3QRDA 1BNRA 3MSOA 1D6UA 1BAOA 1UCJA 3GZBA 4L8OA 1G02A 1RGGA 1FUTA 2BNGA 2JDIH 3SEDA 1S723 1E97A 3EN8A 1HKXA 2BHMA 1DETA 4BIRA 1CH0A 4NREA 1BRHA 5LC6A 4L8PA 1AVKA 5STDA 1L5GB 4HYZA 4WYKB 2HOHA 4BTWA 1YI23 1R4CA 3HK4A 1GOUA 1Q864 1BRNL 1IYYA 1LOXA 1ZO2A 2XEPA 3NM2A 3LMLA 4HOHA 1D6ZA 1SPUA 3OW22 1FGOA 1Q9EA 2XF3A 3LH4A 1JZDA 1FGTA 2CFDA 3CPOA 4IT7A 1VQ43 5KP1A 2HMLB 5BIRA 4HM6B 3CPW2 1IT8A 3EBYA 1QVF2 3GRDA 3URPA 4LZIA 2STDA 1LOVA 4GL6A 3BNEA 4JF8A 4HJLB 3N8BA 3U97A 2MF7A 3ZG0A 1SQWA 1EEJA 2BU4A 2CFKA 4K90B 3B4PA 3FGYA 1JN5A 1I2EA 4MMZB 4RZMA 2P05A 1LNHA 4U13A 1OCVA 3GZRA 6RNTA 1U5OA 5IG3A 2KXGA 4QWTA 1BRIA 3FZWA 3Q2PA 2BMOB 1SIHA 3K0ZA 3G16A 3LTCA 4G1MB 3MWZA 2OQEC 4O8SA 4IPBA 3PZWA 2QIYA 3ZG5A 3EQQB 1NDOB 2FNQA 3MG3A 4HM4B 1RN7A 1UCIA 2WO0A 2W04A 3FF0A 1OHSA 1DMNA 1TRQA 2BIRA 1BRJA 3G8ZA 2HMKB 2IA7A 1VQN3 2F4YA 3A5EA 4XBTA 4CDLA 2GU1A 4HM2B 4N6MA 3D9RA 3K5TA 1RDSA 1Q824 2RFRA 4HM0B 1T3BA 1DMMA 1U8CB 3UB1A 3RGRA 3GAXA 3VSYA 5LC7A 1JN5B 2AADA 3GSPA 3Q3FA 3G4S3 1BNIA 3PGBA 2CG1A 4K1VA 1OUNA 4FR9A 3LTBA 1M1XB 1UGIA 2GXFA 1FYSA 1UCKA 3CNMA 3MPHA 3KIIA 4XB5A 5D82A 2O9UX 3GZYB 2HMNB 3SOYA 2V1LA 4HM7B 4PEJA 3DM8A 3OWSA 4FCJA 5CLKA 1BIRA 3CMA3 2CH9A 3SLUA 2SBLA 4XBXA 4LYLB 5DREA 1IQYA 4WFOA 3SXXA 3CCJ3 1GD4A 1VQ83 2R41A 3G0KA 3ZFZA 3MG2A 4XBYA 3AHSA 2BMQB 3D5IA 2HMOB 3JUNA 3EJVA 1FGQA 6GSPA 4XM4A 1W01A 5AIFA 2YFLB 1KQS2 3DZLA 3NUVA 3EF8A 1TFKA 1MNLA 1BSEA 4KFFA 1UGHI 3UNLA 3BNDA 4K1UA 1QVG2 3F7XA 3O8YA 1FUSA 3F40A 4KT3B 3GZXB 2W2CA
chains in the Genus database with same CATH topology
3K63A 2K0MA 1VQ53 1KD14 4JRFA 3G6E3 3SOAA 4GB5A 3S5CA 3S27A 2QA43 5IENA 4EYCA 4ZM8A 3A76A 3NQYA 1NB5I 4N6NB 4NHFA 1N9JA 4N6UA 3IMAB 1YHQ3 1IV7A 4O02B 2GU3A 3S28A 1WTHA 1NO3A 3WA3A 4HBRA 5IF6A 2Y73A 1OH0A 3LXUX 1ROVA 2W03A 2CIUA 2PZVA 1VZZA 2GEYA 1M9GA 1OGZA 3EBTA 1QAFA 3X42A 3NXJA 1K9M4 3HX8A 4AKYA 1O7WB 3WOEB 4R4KA 1OF5A 2OOVA 1N8QA 1VQK3 3VGNA 2CWVA 1T5YA 1JKGA 1KWIA 2F99A 3X41A 5IG5A 2Z6BA 3CCQ3 2C11A 1W2B2 1ROAA 1GYBA 2CG0A 5JBSA 1YJW3 2INXA 4OK0A 3QK9A 1IQ8A 4FCMA 1HU9A 2JQ5A 4R1KA 2BT3A 3KFQC 1W6CA 3T8NA 5IERA 1FUWA 3PYJA 1ULJB 3WA2X 2LYXA 3CNXA 5AEUB 5EEOA 1CYVA 4HM8B 2ZL8A 1UI8A 1O7PB 3CC23 1VQM3 4TX4A 3LTDA 1Q40A 1EA2A 1OF5B 1W6GA 2OCTA 1QAKA 2CKFB 2IUJA 2QEX3 1JKGB 3JUPA 2WGQA 3FG4A 2E2VA 3Q90A 1PFPA 1EG9B 4RBNA 4X2HA 5AIGA 5IG4A 1JB2A 1O7HB 4KZ1A 2ZDJA 5EVHA 3DGLA 2XGLA 3EX9A 2CFWA 1STFI 3AMOA 2E2UA 2HMJB 4J9AA 5IG0A 5EQLA 2YX9A 2O3OA 3UJMA 1FA3A 3FSDA 3CCS3 2OOVC 1E3VA 4N6TA 1OHPA 2P0MA 3DUKA 1UUWB 3E99A 4N6OB 1Q40B 1IU7A 1IQXA 3TDGA 2CW9A 4WWUC 1IVVA 2XH9A 1W7CA 1A2KA 1VQ73 2CWUA 4FMCA 5JPPA 2XFTA 3EHCA 2D1WA 1JV2B 1W4NA 4R9LA 3I553 3AMOB 5AI1A 2W9QA 8CHOA 3K7CA 4XDVA 1F8NA 2CFGA 1DVDA 1RRHA 1EKMA 1D6YA 3IJEB 1YJN3 1J2BA 3CXC2 2IMJA 5AYRB 4CCVA 4XDWA 1E3RA 2E2TA 3MHEA 3NV0A 3WDGB 2RGQA 5CF2A 4R9KA 3KSED 3CCM3 3JUQA 1VQP3 3ALAA 5CXOA 1YVBI 1IDPA 3STDA 5A0OB 2CHCA 2IUKA 2LQVA 3N9HA 1GY7A 1S5AA 4LMIA 3CC43 1WMOA 4RNYA 1TU5A 3X40A 2L4VA 3PCSA 3EN1B 3LTAA 3WMDA 1ISKA 5I97A 2Z76A 1IT7A 1RKYA 4O3VA 4STDA 3WODG 1OACA 1SJWA 4K61A 1O7NB 1Q42A 3MG1A 3NV0B 5BXQA 1A2VA 4N3VA 3HI7A 3JUMA 5G2GA 1CQSA 1N8R4 1A67A 3X3ZA 4EBGA 1CYUA 4H3UA 1YJ93 5AIIA 1GS3A 1K734 3B7CA 1Q814 1O7MB 4OVMA 3CCR3 4WHAA 3V98A 2RSXA 1STDA 2Q07A 3IPTA 4KFEA 3DXOA 3OX9A 5AYSC 1IVWA 3S67A 2XR8B 1AV4A 2FXTA 1WNHA 2B24B 3B4OA 3FH1A 3KE7A 4R80A 3S29A 3EB8A 3SVAA 5KP4A 2XRXB 3FF2A 3LOYA 3CD63 4LGQA 1BUQA 3LYGA 1OPYA 1PU4A 3OWUA 4EC6A 4HVNA 2GEXA 3FCSB 4FMBA 2P09A 5D81A 1NJI4 1SIIA 3PS8A 3DGOA 2OWPA 1US1A 2XGNA 3CU3A 1NB3I 1IVUA 1VQL3 2XSOB 3DGMA 3X3XA 3ER7A 2MC8A 1LXEA 3PXMA 2W0QA 3V92A 3VF1A 1VQ93 1WMPA 1C7HA 5FW5A 4BTYA 4RNZA 5IEOA 3RGAA 2W9PA 4J8TA 4HZBB 3KN4A 2OQEA 5CF1A 1MOLA 1GY5A 2A15A 3DY5A 2RCDA 4KFDA 1UW1A 4HKVB 2OTJ3 2BO9B 4Q53A 1DMQA 3CCU3 5ELUA 5HGRA 1ZX2A 4LSOA 4WP5A 3M8CA 4X2OA 1YGEA 2K54A 1NU3A 3RDEA 1GY6A 2D42A 5KP3A 1VQ63 5JPUA 1ULIB 1WMNA 2YFIB 1KC84 2GBWB 1FGMA 1UUVB 1TP6A 3K9MC 4AEQA 3BLZA 1GD3A 4MEIA 2QGUA 3JUOA 3T8UA 4HM1B 1DYUA 1K41A 3CCL3 4EXRA 3HZPA 3CCV3 2XSHB 1RRLA 1K8A4 3H3HA 2GBXB 5CK6A 2HMMB 3B8LA 3F9SA 5DRVA 5D83A 3X3YA 1W2ZA 3D3LA 3GWRA 2WGOA 5BVBA 3F8XA 1K28A 2W6JH 3EE1A 1YIJ3 3LZAA 1FGRA 2CC3A 4BTXA 4O2HA 1QALA 4MMXB 3HIGA 1TFOA 2Y74A 2P0XA 3N54B 1G96A 2KRTA 3LT8A 3PCRA 4OUQA 5IW9A 3MYTA 4HM5B 4ORLA 2CK3H 1TUHA 4IIAA 1QMAA 1JB4A 3FLJA 3T0UA 3U1WA 1Z1SA 2Z7AA 3F7SA 2C10A 1M904 2PNCA 2R4IA 3V99A 4MMYB 2ML5A 1M1K4 4EV5A 3FKAA 2I9WA 3I0YA 4AKZA 3I563 5AEWB 4FMAA 1UI7A 3NHXA 3WOFB 2CWTA 2B1XB 3MKIA 3BB9A 4LEHA 3FG1A 2P38A 1QJGA 4I4KA 1A90A 4HZ9B 1YIT3 1EQKA 4MJDA 3Q1CA 1CEWI 1OHOA 1N5HA 5AIHA 1JRQA 4FMDA 3F14A 2W56A 3LT9A 3KKGA 2WOHA 4EV2A 1N9EA 3NBJA 4H61A 4KVHA 1JJ22 1LVNA 1OGXA 3UL6A 5IEPA 3EC9A 2Z77A 3DMCA 4HM3B 2KCDA 2F98A 1O7GB 3CC73 1IV9A 6STDA 3BNCA 1IK3A 3BNBA 2FGTA 3HIIA 2YFJB 4FCZA 1TIJA 2BMRB 2CFLA 1AR0A 3FG3A 1IVXA 3NBBA 3CME3 3OXAA 2M7OA 1NWWA 3NQZA 3OV4A 1W02A 1WQLB 1W5ZA 2UX0A 3CCE3 2W56B 3NM7A 1V74A 3F8HA 3ROBA 1DVCA 2WOFA 4L7KA 3H51A 1N5PA 4N6LA 1Y4KA 2ML6A 5TGNA 2XFSA 4N6V0 3NX0A 3NBRA 3KZTA 4WYKA 3JVCA 1JB5A 2F86B 3G713 1JNQA 7STDA 5FGOA 5ELJA 1AVLA 1RJOA 1KSIA 1Q7Y4 1ASKA 1VQO3 3OWYA 3J7Yd 3KSPA 1W6YA 1W00A 3ECFA 3DGNA 3SX1A 3L0RA 3QRDA 3MSOA 1D6UA 4L8OA 3GZBA 2BNGA 2JDIH 3SEDA 1S723 1E97A 3EN8A 1HKXA 2BHMA 4NREA 5LC6A 4L8PA 1AVKA 5STDA 1L5GB 4HYZA 4WYKB 4BTWA 1YI23 1R4CA 3HK4A 1Q864 1LOXA 1ZO2A 2XEPA 3NM2A 3LMLA 1D6ZA 1SPUA 3OW22 1FGOA 2XF3A 3LH4A 1FGTA 2CFDA 3CPOA 4IT7A 1VQ43 5KP1A 2HMLB 4HM6B 3CPW2 1IT8A 3EBYA 1QVF2 3GRDA 4LZIA 2STDA 4GL6A 3BNEA 4JF8A 4HJLB 3N8BA 3U97A 2MF7A 1SQWA 2OTL3 2CFKA 4K90B 3B4PA 3FGYA 1JN5A 4MMZB 4RZMA 4U13A 2P05A 1LNHA 3UL5A 1OCVA 3GZRA 1U5OA 5IG3A 2KXGA 4QWTA 3FZWA 3Q2PA 2BMOB 1SIHA 3K0ZA 3G16A 3LTCA 4G1MB 3MWZA 2OQEC 4O8SA 4IPBA 3PZWA 2QIYA 3EQQB 1NDOB 2FNQA 3MG3A 4HM4B 2WO0A 1RN7A 2W04A 3FF0A 1OHSA 1DMNA 3G8ZA 1VQN3 2HMKB 2IA7A 4XBTA 4CDLA 2GU1A 4HM2B 4N6MA 3D9RA 3K5TA 1Q824 2RFRA 4HM0B 1DMMA 1U8CB 3UB1A 3RGRA 3GAXA 3VSYA 5LC7A 1JN5B 3G4S3 3PGBA 2CG1A 4K1VA 1OUNA 4FR9A 3LTBA 1M1XB 2GXFA 3CNMA 3MPHA 3KIIA 4XB5A 5D82A 2O9UX 3GZYB 2HMNB 3SOYA 2V1LA 4HM7B 4PEJA 3DM8A 3OWSA 4FCJA 5CLKA 3CMA3 2CH9A 3SLUA 2SBLA 4XBXA 5DREA 1IQYA 4WFOA 3SXXA 3CCJ3 1GD4A 1VQ83 3G0KA 3MG2A 4XBYA 2BMQB 2HMOB 3JUNA 3EJVA 1FGQA 4XM4A 1W01A 5AIFA 2YFLB 1KQS2 3DZLA 3NUVA 3EF8A 1TFKA 1MNLA 4KFFA 1QVG2 3UNLA 3BNDA 4K1UA 3F7XA 3O8YA 3F40A 3GZXB 2W2CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQM 3;  3CME 3;  1VQP 3;  3CCL 3;  1VQ4 3;  1KD1 4;  3CCV 3;  1K9M 4;  1VQ5 3;  3CMA 3;  1VQN 3;  3G6E 3;  1K8A 4;  2QEX 3;  3CPW 2;  1VQK 3;  3CCE 3;  1VQ7 3;  1YJ9 3;  1QVF 2;  1S72 3;  2OTJ 3;  2QA4 3;  1K73 4;  3CCU 3;  3CC4 3;  3CCJ 3;  1NJI 4;  1Q82 4;  1VQ8 3;  3CCQ 3;  1Q81 4;  1M90 4;  3I55 3;  3CCR 3;  3CC2 3;  1YIJ 3;  1W2B 2;  1M1K 4;  1YJW 3;  1JJ2 2;  2OTL 3;  1YI2 3;  1VQL 3;  3G4S 3;  1YHQ 3;  3G71 3;  3I56 3;  1Q86 4;  1KQS 2;  1VQ6 3;  1YJN 3;  1Q7Y 4;  3CC7 3;  3CXC 2;  1VQO 3;  1KC8 4;  3CCS 3;  1QVG 2;  1VQ9 3;  3OW2 2;  3CD6 3;  1N8R 4;  1YIT 3;  3CCM 3; 
#chains in the Genus database with same CATH topology
 3K63 A;  2K0M A;  1VQ5 3;  1KD1 4;  1T2I A;  4JRF A;  3G6E 3;  3SOA A;  4GB5 A;  3S5C A;  3S27 A;  3SYU A;  2QA4 3;  2RNT A;  5IEN A;  4EYC A;  1RGC A;  1ZS7 A;  4ZM8 A;  3A76 A;  3NQY A;  5RNT A;  1NB5 I;  4N6N B;  3D4A A;  4NHF A;  1N9J A;  4NPB A;  4N6U A;  5G1L A;  4I5Q A;  1AQZ A;  3IMA B;  1YHQ 3;  1IV7 A;  4O02 B;  1FZU A;  2GU3 A;  3S28 A;  1WTH A;  1I8V A;  1NO3 A;  3WA3 A;  1YGW A;  4HBR A;  5IF6 A;  2Y73 A;  1BVI A;  1OH0 A;  3LXU X;  1ROV A;  1BNS A;  1BNG A;  4BU4 A;  1RMS A;  3AGO A;  1B21 A;  2W03 A;  2CIU A;  2PZV A;  1VZZ A;  1V57 A;  1RGK A;  2GEY A;  1M9G A;  1OGZ A;  3EBT A;  1QAF A;  3X42 A;  3NXJ A;  1K9M 4;  3HX8 A;  4AKY A;  1O7W B;  3WOE B;  4R4K A;  1OF5 A;  2OOV A;  1N8Q A;  1X1Y A;  3VGN A;  1VQK 3;  2KAA A;  2CWV A;  1T5Y A;  1JKG A;  1BSA A;  1KWI A;  2F99 A;  3X41 A;  5IG5 A;  2Z6B A;  1B2M A;  3CCQ 3;  2C11 A;  1W2B 2;  1ROA A;  1GYB A;  2CG0 A;  5JBS A;  1YJW 3;  1BRS A;  2INX A;  4OK0 A;  3QK9 A;  1IQ8 A;  4FCM A;  1HU9 A;  2JQ5 A;  1BSD A;  4R1K A;  1RCK A;  2BT3 A;  3KFQ C;  1SAR A;  1W6C A;  3T8N A;  1RLS A;  2SAR A;  5IER A;  1FUW A;  3PYJ A;  1ULJ B;  3WA2 X;  2LYX A;  3CNX A;  5AEU B;  1RTU A;  5EEO A;  2KF6 A;  1CYV A;  1BGS A;  4HM8 B;  2ZL8 A;  1UI8 A;  1O7P B;  3CC2 3;  1VQM 3;  4TX4 A;  3LTD A;  1Q40 A;  1EA2 A;  1OF5 B;  1W6G A;  2OCT A;  1QAK A;  2CKF B;  2IUJ A;  2QEX 3;  1JKG B;  3JUP A;  2WGQ A;  3FG4 A;  2E2V A;  3Q90 A;  1PFP A;  4GSP A;  1EG9 B;  4RBN A;  4X2H A;  2H0G A;  5AIG A;  5IG4 A;  2ZHX B;  1JB2 A;  1O7H B;  4KZ1 A;  2ZDJ A;  5EVH A;  3DGL A;  1V58 A;  2XGL A;  3EX9 A;  1ZGX A;  4RNT A;  1X1U A;  2CFW A;  1BUJ A;  1PYL A;  1STF I;  3AMO A;  1HZ1 A;  2E2U A;  2HMJ B;  1X1X A;  1I0X A;  4J9A A;  5IG0 A;  2F56 A;  5EQL A;  1B2U A;  2YX9 A;  4BL2 A;  1GMQ A;  2O3O A;  2H0I A;  3UJM A;  3FSD A;  3CCS 3;  1FA3 A;  4CPK A;  4HAA A;  2OOV C;  1E3V A;  4N6T A;  1OHP A;  2P0M A;  3DUK A;  1PY3 A;  1UUW B;  2KF5 A;  3E99 A;  1I3F A;  1Q40 B;  4N6O B;  1IU7 A;  1IQX A;  1BAN A;  3TDG A;  2CW9 A;  1BRK A;  4WWU C;  1IVV A;  2XH9 A;  3BU4 A;  1W7C A;  2H0H A;  1A2K A;  5M19 A;  1VQ7 3;  1JBT A;  2CWU A;  1I70 A;  4FMC A;  5JPP A;  2XFT A;  3HOH A;  5M18 A;  3AGN A;  3EHC A;  2F5W A;  2D1W A;  1JV2 B;  1B27 A;  1W4N A;  4R9L A;  3I55 3;  4J5G A;  3AMO B;  4J5K A;  5AI1 A;  1RGA A;  2W9Q A;  3K7C A;  8CHO A;  4XDV A;  3RNT A;  2OTL 3;  1F8N A;  2CFG A;  1DVD A;  1RRH A;  1EKM A;  1BNF A;  1D6Y A;  3IJE B;  1G0T A;  1YJN 3;  1J2B A;  3CXC 2;  2IMJ A;  5AYR B;  1JBS A;  2UGI A;  1JZO A;  1YVS A;  3KCH A;  4XDW A;  4CCV A;  1E3R A;  2E2T A;  3MHE A;  3NV0 A;  3WDG B;  2RGQ A;  5CF2 A;  4R9K A;  3KSE D;  3CCM 3;  3JUQ A;  1VQP 3;  1EUI C;  3ALA A;  5CXO A;  1YVB I;  1IDP A;  3D5G A;  3STD A;  2CHC A;  5A0O B;  2IUK A;  2LQV A;  3N9H A;  1GY7 A;  1S5A A;  4LMI A;  1BSC A;  1WMO A;  4RNY A;  1TU5 A;  3X40 A;  3CC4 3;  1A2P A;  2CX0 A;  2L4V A;  3AHW A;  3PCS A;  3EN1 B;  3DH2 A;  3LTA A;  3WMD A;  1BNE A;  1ISK A;  5I97 A;  2Z76 A;  1IT7 A;  1RKY A;  4O3V A;  4STD A;  3WOD G;  1GOV A;  1OAC A;  1RHL A;  1SJW A;  2ZA4 A;  4K61 A;  1O7N B;  1Q42 A;  2GSP A;  1MWU A;  2L1S A;  5M1A A;  3MG1 A;  3NV0 B;  5GSP A;  5BXQ A;  1A2V A;  4N3V A;  3HI7 A;  3JUM A;  5G2G A;  1CQS A;  1VQQ A;  1N8R 4;  1A67 A;  1GSP A;  1RN4 A;  5G1K A;  8RNT A;  3X3Z A;  4EBG A;  1CYU A;  4H3U A;  1YJ9 3;  4GHO A;  5AII A;  1GS3 A;  1K73 4;  1AY7 A;  3B7C A;  9RNT A;  1Q81 4;  2IY2 A;  1O7M B;  4OVM A;  3CCR 3;  1BSB A;  4WHA A;  3V98 A;  2RSX A;  1STD A;  2Q07 A;  3IPT A;  4KFE A;  3DXO A;  3OX9 A;  5AYS C;  1IVW A;  3S67 A;  2XR8 B;  1AV4 A;  2FXT A;  1GMP A;  1WNH A;  2B24 B;  3B4O A;  3FH1 A;  3KE7 A;  4R80 A;  3EB8 A;  3S29 A;  3SVA A;  5KP4 A;  2XRX B;  1B20 A;  3FF2 A;  1RGF A;  3LOY A;  2K3D A;  3CD6 3;  4LGQ A;  1BUQ A;  3LYG A;  1C54 A;  1OPY A;  1Q7H A;  2UUG C;  3WHO A;  1NNV A;  1PU4 A;  1MWS A;  1JBR A;  2AAE A;  3OWU A;  4EC6 A;  2C4B A;  4HVN A;  2GEX A;  3FCS B;  4FMB A;  4EW5 A;  2P09 A;  5D81 A;  7RNT A;  1NJI 4;  1SII A;  3PS8 A;  3DGO A;  2OWP A;  1US1 A;  1GOY A;  2XGN A;  3CU3 A;  1NB3 I;  1IVU A;  1VQL 3;  2XSO B;  2KF4 A;  3DGM A;  3X3X A;  3BIR A;  1R4Y A;  3ER7 A;  2MC8 A;  1LXE A;  3PXM A;  2W0Q A;  4CJN A;  3V92 A;  3VF1 A;  1VQ9 3;  1WMP A;  1C7H A;  5FW5 A;  4BTY A;  4RNZ A;  5IEO A;  2CX1 A;  3DGY A;  3RGA A;  1BRG A;  2W9P A;  4J8T A;  4HZB B;  3KN4 A;  2OQE A;  5CF1 A;  1MOL A;  1RGL A;  1GY5 A;  1GMR A;  3UL5 A;  2A15 A;  3DY5 A;  2RCD A;  4KFD A;  1UW1 A;  4HKV B;  2OTJ 3;  2BO9 B;  4Q53 A;  1DMQ A;  4DKI A;  3CCU 3;  5ELU A;  5HGR A;  1HYF A;  1ZX2 A;  4LSO A;  4WP5 A;  3M8C A;  4X2O A;  1YGE A;  2K54 A;  1NU3 A;  3RDE A;  1GY6 A;  1I2G A;  2D42 A;  5BU4 A;  5KP3 A;  1BNJ A;  1DE3 A;  1VQ6 3;  5JPU A;  1ULI B;  1MWR A;  4ILF A;  1WMN A;  2YFI B;  1KC8 4;  2GBW B;  1FGM A;  1UUV B;  1LOW A;  1TP6 A;  1RGH A;  4BL3 A;  3K9M C;  4AEQ A;  3BLZ A;  1GD3 A;  4MEI A;  2QGU A;  3JUO A;  3T8U A;  4HM1 B;  1DYU A;  1K41 A;  3CCL 3;  4EXR A;  1TJD A;  3HZP A;  3CCV 3;  2XSH B;  1RRL A;  1K8A 4;  3H3H A;  2GBX B;  5CK6 A;  2HMM B;  3B8L A;  3F9S A;  1B2Z A;  5DRV A;  5D83 A;  3X3Y A;  1TRP A;  1W2Z A;  3D3L A;  3GWR A;  2WGO A;  5BVB A;  3F8X A;  1K28 A;  1B2S A;  2W6J H;  3EE1 A;  1YIJ 3;  2RBI A;  3LZA A;  1FGR A;  2CC3 A;  4BTX A;  4O2H A;  1QAL A;  4MMX B;  3HIG A;  1TFO A;  2Y74 A;  1I0V A;  2P0X A;  3N54 B;  1YNV X;  3D79 A;  1G96 A;  2KRT A;  3LT8 A;  1UCL A;  3PCR A;  4OUQ A;  1LRA A;  5IW9 A;  3MYT A;  4HM5 B;  1BU4 A;  4ORL A;  2CK3 H;  1TUH A;  1UUG B;  4IIA A;  1QMA A;  1JB4 A;  3FLJ A;  3T0U A;  3U1W A;  1Z1S A;  2F5M A;  2Z7A A;  1RCL A;  2C10 A;  1LQM B;  3F7S A;  1LQG C;  1M90 4;  2PNC A;  2R4I A;  3V99 A;  4MMY B;  2ML5 A;  1M1K 4;  4EV5 A;  1MWT A;  2I9W A;  3FKA A;  3I0Y A;  4AKZ A;  3I56 3;  2KF3 A;  5AEW B;  1LOY A;  4FMA A;  1UI7 A;  3NHX A;  3WOF B;  2CWT A;  2B1X B;  3MKI A;  3BB9 A;  1MGW A;  4LEH A;  3FG1 A;  2P38 A;  1QJG A;  1RGE A;  4I4K A;  4HZ9 B;  1A90 A;  1RN1 A;  1YIT 3;  1EQK A;  4MJD A;  3Q1C A;  1CEW I;  1OHO A;  1N5H A;  5AIH A;  1JRQ A;  3WR2 A;  1B3S A;  1I2F A;  4FMD A;  1RNB A;  3F14 A;  1UDI I;  1MGR A;  2W56 A;  1B2X A;  3LT9 A;  3KKG A;  2WOH A;  4EV2 A;  1N9E A;  1I3I A;  3NBJ A;  4H61 A;  4KVH A;  1BOX A;  1JJ2 2;  1LVN A;  1OGX A;  3UL6 A;  5IEP A;  3EC9 A;  2Z77 A;  3DMC A;  4HM3 B;  2KCD A;  2F98 A;  1O7G B;  3CC7 3;  1IV9 A;  6STD A;  1TTO A;  3BNC A;  1IK3 A;  1FW7 A;  3BNB A;  2FGT A;  3HII A;  2YFJ B;  4FCZ A;  7GSP A;  1TIJ A;  2BMR B;  2CFL A;  2IYJ A;  1AR0 A;  3FG3 A;  1X1W A;  1IVX A;  3NBB A;  3CME 3;  3OXA A;  2M7O A;  1NWW A;  3NQZ A;  3OV4 A;  1W02 A;  1WQL B;  1W5Z A;  2UX0 A;  3CCE 3;  2W56 B;  3NM7 A;  1V74 A;  3F8H A;  3ROB A;  1DVC A;  2WOF A;  4L7K A;  3H51 A;  1N5P A;  4N6L A;  1Y4K A;  2ML6 A;  5TGN A;  2XFS A;  1RNT A;  4N6V 0;  3NX0 A;  3NBR A;  3KZT A;  4WYK A;  3JVC A;  5HOH A;  1JB5 A;  2F86 B;  3G71 3;  1JNQ A;  7STD A;  5FGO A;  5ELJ A;  1AVL A;  1RJO A;  1KSI A;  2J8X B;  1Q7Y 4;  1ASK A;  1VQO 3;  3OWY A;  3J7Y d;  3KSP A;  1LNI A;  1W6Y A;  1W00 A;  1T2H A;  1RSN A;  3ECF A;  3DGN A;  3SX1 A;  3L0R A;  3QRD A;  1BNR A;  3MSO A;  1D6U A;  1BAO A;  1UCJ A;  3GZB A;  4L8O A;  1G02 A;  1RGG A;  1FUT A;  2BNG A;  2JDI H;  3SED A;  1S72 3;  1E97 A;  3EN8 A;  1HKX A;  2BHM A;  1DET A;  4BIR A;  1CH0 A;  4NRE A;  1BRH A;  5LC6 A;  4L8P A;  1AVK A;  5STD A;  1L5G B;  4HYZ A;  4WYK B;  2HOH A;  4BTW A;  1YI2 3;  1R4C A;  3HK4 A;  1GOU A;  1Q86 4;  1BRN L;  1IYY A;  1LOX A;  1ZO2 A;  2XEP A;  3NM2 A;  3LML A;  4HOH A;  1D6Z A;  1SPU A;  3OW2 2;  1FGO A;  1Q9E A;  2XF3 A;  3LH4 A;  1JZD A;  1FGT A;  2CFD A;  3CPO A;  4IT7 A;  1VQ4 3;  5KP1 A;  2HML B;  5BIR A;  4HM6 B;  3CPW 2;  1IT8 A;  3EBY A;  1QVF 2;  3GRD A;  3URP A;  4LZI A;  2STD A;  1LOV A;  4GL6 A;  3BNE A;  4JF8 A;  4HJL B;  3N8B A;  3U97 A;  2MF7 A;  3ZG0 A;  1SQW A;  1EEJ A;  2BU4 A;  2CFK A;  4K90 B;  3B4P A;  3FGY A;  1JN5 A;  1I2E A;  4MMZ B;  4RZM A;  2P05 A;  1LNH A;  4U13 A;  1OCV A;  3GZR A;  6RNT A;  1U5O A;  5IG3 A;  2KXG A;  4QWT A;  1BRI A;  3FZW A;  3Q2P A;  2BMO B;  1SIH A;  3K0Z A;  3G16 A;  3LTC A;  4G1M B;  3MWZ A;  2OQE C;  4O8S A;  4IPB A;  3PZW A;  2QIY A;  3ZG5 A;  3EQQ B;  1NDO B;  2FNQ A;  3MG3 A;  4HM4 B;  1RN7 A;  1UCI A;  2WO0 A;  2W04 A;  3FF0 A;  1OHS A;  1DMN A;  1TRQ A;  2BIR A;  1BRJ A;  3G8Z A;  2HMK B;  2IA7 A;  1VQN 3;  2F4Y A;  3A5E A;  4XBT A;  4CDL A;  2GU1 A;  4HM2 B;  4N6M A;  3D9R A;  3K5T A;  1RDS A;  1Q82 4;  2RFR A;  4HM0 B;  1T3B A;  1DMM A;  1U8C B;  3UB1 A;  3RGR A;  3GAX A;  3VSY A;  5LC7 A;  1JN5 B;  2AAD A;  3GSP A;  3Q3F A;  3G4S 3;  1BNI A;  3PGB A;  2CG1 A;  4K1V A;  1OUN A;  4FR9 A;  3LTB A;  1M1X B;  1UGI A;  2GXF A;  1FYS A;  1UCK A;  3CNM A;  3MPH A;  3KII A;  4XB5 A;  5D82 A;  2O9U X;  3GZY B;  2HMN B;  3SOY A;  2V1L A;  4HM7 B;  4PEJ A;  3DM8 A;  3OWS A;  4FCJ A;  5CLK A;  1BIR A;  3CMA 3;  2CH9 A;  3SLU A;  2SBL A;  4XBX A;  4LYL B;  5DRE A;  1IQY A;  4WFO A;  3SXX A;  3CCJ 3;  1GD4 A;  1VQ8 3;  2R41 A;  3G0K A;  3ZFZ A;  3MG2 A;  4XBY A;  3AHS A;  2BMQ B;  3D5I A;  2HMO B;  3JUN A;  3EJV A;  1FGQ A;  6GSP A;  4XM4 A;  1W01 A;  5AIF A;  2YFL B;  1KQS 2;  3DZL A;  3NUV A;  3EF8 A;  1TFK A;  1MNL A;  1BSE A;  4KFF A;  1UGH I;  3UNL A;  3BND A;  4K1U A;  1QVG 2;  3F7X A;  3O8Y A;  1FUS A;  3F40 A;  4KT3 B;  3GZX B;  2W2C A; 
#chains in the Genus database with same CATH homology
 3K63 A;  2K0M A;  1VQ5 3;  1KD1 4;  4JRF A;  3G6E 3;  3SOA A;  4GB5 A;  3S5C A;  3S27 A;  2QA4 3;  5IEN A;  4EYC A;  4ZM8 A;  3A76 A;  3NQY A;  1NB5 I;  4N6N B;  4NHF A;  1N9J A;  4N6U A;  3IMA B;  1YHQ 3;  1IV7 A;  4O02 B;  2GU3 A;  3S28 A;  1WTH A;  1NO3 A;  3WA3 A;  4HBR A;  5IF6 A;  2Y73 A;  1OH0 A;  3LXU X;  1ROV A;  2W03 A;  2CIU A;  2PZV A;  1VZZ A;  2GEY A;  1M9G A;  1OGZ A;  3EBT A;  1QAF A;  3X42 A;  3NXJ A;  1K9M 4;  3HX8 A;  4AKY A;  1O7W B;  3WOE B;  4R4K A;  1OF5 A;  2OOV A;  1N8Q A;  1VQK 3;  3VGN A;  2CWV A;  1T5Y A;  1JKG A;  1KWI A;  2F99 A;  3X41 A;  5IG5 A;  2Z6B A;  3CCQ 3;  2C11 A;  1W2B 2;  1ROA A;  1GYB A;  2CG0 A;  5JBS A;  1YJW 3;  2INX A;  4OK0 A;  3QK9 A;  1IQ8 A;  4FCM A;  1HU9 A;  2JQ5 A;  4R1K A;  2BT3 A;  3KFQ C;  1W6C A;  3T8N A;  5IER A;  1FUW A;  3PYJ A;  1ULJ B;  3WA2 X;  2LYX A;  3CNX A;  5AEU B;  5EEO A;  1CYV A;  4HM8 B;  2ZL8 A;  1UI8 A;  1O7P B;  3CC2 3;  1VQM 3;  4TX4 A;  3LTD A;  1Q40 A;  1EA2 A;  1OF5 B;  1W6G A;  2OCT A;  1QAK A;  2CKF B;  2IUJ A;  2QEX 3;  1JKG B;  3JUP A;  2WGQ A;  3FG4 A;  2E2V A;  3Q90 A;  1PFP A;  1EG9 B;  4RBN A;  4X2H A;  5AIG A;  5IG4 A;  1JB2 A;  1O7H B;  4KZ1 A;  2ZDJ A;  5EVH A;  3DGL A;  2XGL A;  3EX9 A;  2CFW A;  1STF I;  3AMO A;  2E2U A;  2HMJ B;  4J9A A;  5IG0 A;  5EQL A;  2YX9 A;  2O3O A;  3UJM A;  1FA3 A;  3FSD A;  3CCS 3;  2OOV C;  1E3V A;  4N6T A;  1OHP A;  2P0M A;  3DUK A;  1UUW B;  3E99 A;  4N6O B;  1Q40 B;  1IU7 A;  1IQX A;  3TDG A;  2CW9 A;  4WWU C;  1IVV A;  2XH9 A;  1W7C A;  1A2K A;  1VQ7 3;  2CWU A;  4FMC A;  5JPP A;  2XFT A;  3EHC A;  2D1W A;  1JV2 B;  1W4N A;  4R9L A;  3I55 3;  3AMO B;  5AI1 A;  2W9Q A;  8CHO A;  3K7C A;  4XDV A;  1F8N A;  2CFG A;  1DVD A;  1RRH A;  1EKM A;  1D6Y A;  3IJE B;  1YJN 3;  1J2B A;  3CXC 2;  2IMJ A;  5AYR B;  4CCV A;  4XDW A;  1E3R A;  2E2T A;  3MHE A;  3NV0 A;  3WDG B;  2RGQ A;  5CF2 A;  4R9K A;  3KSE D;  3CCM 3;  3JUQ A;  1VQP 3;  3ALA A;  5CXO A;  1YVB I;  1IDP A;  3STD A;  5A0O B;  2CHC A;  2IUK A;  2LQV A;  3N9H A;  1GY7 A;  1S5A A;  4LMI A;  3CC4 3;  1WMO A;  4RNY A;  1TU5 A;  3X40 A;  2L4V A;  3PCS A;  3EN1 B;  3LTA A;  3WMD A;  1ISK A;  5I97 A;  2Z76 A;  1IT7 A;  1RKY A;  4O3V A;  4STD A;  3WOD G;  1OAC A;  1SJW A;  4K61 A;  1O7N B;  1Q42 A;  3MG1 A;  3NV0 B;  5BXQ A;  1A2V A;  4N3V A;  3HI7 A;  3JUM A;  5G2G A;  1CQS A;  1N8R 4;  1A67 A;  3X3Z A;  4EBG A;  1CYU A;  4H3U A;  1YJ9 3;  5AII A;  1GS3 A;  1K73 4;  3B7C A;  1Q81 4;  1O7M B;  4OVM A;  3CCR 3;  4WHA A;  3V98 A;  2RSX A;  1STD A;  2Q07 A;  3IPT A;  4KFE A;  3DXO A;  3OX9 A;  5AYS C;  1IVW A;  3S67 A;  2XR8 B;  1AV4 A;  2FXT A;  1WNH A;  2B24 B;  3B4O A;  3FH1 A;  3KE7 A;  4R80 A;  3S29 A;  3EB8 A;  3SVA A;  5KP4 A;  2XRX B;  3FF2 A;  3LOY A;  3CD6 3;  4LGQ A;  1BUQ A;  3LYG A;  1OPY A;  1PU4 A;  3OWU A;  4EC6 A;  4HVN A;  2GEX A;  3FCS B;  4FMB A;  2P09 A;  5D81 A;  1NJI 4;  1SII A;  3PS8 A;  3DGO A;  2OWP A;  1US1 A;  2XGN A;  3CU3 A;  1NB3 I;  1IVU A;  1VQL 3;  2XSO B;  3DGM A;  3X3X A;  3ER7 A;  2MC8 A;  1LXE A;  3PXM A;  2W0Q A;  3V92 A;  3VF1 A;  1VQ9 3;  1WMP A;  1C7H A;  5FW5 A;  4BTY A;  4RNZ A;  5IEO A;  3RGA A;  2W9P A;  4J8T A;  4HZB B;  3KN4 A;  2OQE A;  5CF1 A;  1MOL A;  1GY5 A;  2A15 A;  3DY5 A;  2RCD A;  4KFD A;  1UW1 A;  4HKV B;  2OTJ 3;  2BO9 B;  4Q53 A;  1DMQ A;  3CCU 3;  5ELU A;  5HGR A;  1ZX2 A;  4LSO A;  4WP5 A;  3M8C A;  4X2O A;  1YGE A;  2K54 A;  1NU3 A;  3RDE A;  1GY6 A;  2D42 A;  5KP3 A;  1VQ6 3;  5JPU A;  1ULI B;  1WMN A;  2YFI B;  1KC8 4;  2GBW B;  1FGM A;  1UUV B;  1TP6 A;  3K9M C;  4AEQ A;  3BLZ A;  1GD3 A;  4MEI A;  2QGU A;  3JUO A;  3T8U A;  4HM1 B;  1DYU A;  1K41 A;  3CCL 3;  4EXR A;  3HZP A;  3CCV 3;  2XSH B;  1RRL A;  1K8A 4;  3H3H A;  2GBX B;  5CK6 A;  2HMM B;  3B8L A;  3F9S A;  5DRV A;  5D83 A;  3X3Y A;  1W2Z A;  3D3L A;  3GWR A;  2WGO A;  5BVB A;  3F8X A;  1K28 A;  2W6J H;  3EE1 A;  1YIJ 3;  3LZA A;  1FGR A;  2CC3 A;  4BTX A;  4O2H A;  1QAL A;  4MMX B;  3HIG A;  1TFO A;  2Y74 A;  2P0X A;  3N54 B;  1G96 A;  2KRT A;  3LT8 A;  3PCR A;  4OUQ A;  5IW9 A;  3MYT A;  4HM5 B;  4ORL A;  2CK3 H;  1TUH A;  4IIA A;  1QMA A;  1JB4 A;  3FLJ A;  3T0U A;  3U1W A;  1Z1S A;  2Z7A A;  3F7S A;  2C10 A;  1M90 4;  2PNC A;  2R4I A;  3V99 A;  4MMY B;  2ML5 A;  1M1K 4;  4EV5 A;  3FKA A;  2I9W A;  3I0Y A;  4AKZ A;  3I56 3;  5AEW B;  4FMA A;  1UI7 A;  3NHX A;  3WOF B;  2CWT A;  2B1X B;  3MKI A;  3BB9 A;  4LEH A;  3FG1 A;  2P38 A;  1QJG A;  4I4K A;  1A90 A;  4HZ9 B;  1YIT 3;  1EQK A;  4MJD A;  3Q1C A;  1CEW I;  1OHO A;  1N5H A;  5AIH A;  1JRQ A;  4FMD A;  3F14 A;  2W56 A;  3LT9 A;  3KKG A;  2WOH A;  4EV2 A;  1N9E A;  3NBJ A;  4H61 A;  4KVH A;  1JJ2 2;  1LVN A;  1OGX A;  3UL6 A;  5IEP A;  3EC9 A;  2Z77 A;  3DMC A;  4HM3 B;  2KCD A;  2F98 A;  1O7G B;  3CC7 3;  1IV9 A;  6STD A;  3BNC A;  1IK3 A;  3BNB A;  2FGT A;  3HII A;  2YFJ B;  4FCZ A;  1TIJ A;  2BMR B;  2CFL A;  1AR0 A;  3FG3 A;  1IVX A;  3NBB A;  3CME 3;  3OXA A;  2M7O A;  1NWW A;  3NQZ A;  3OV4 A;  1W02 A;  1WQL B;  1W5Z A;  2UX0 A;  3CCE 3;  2W56 B;  3NM7 A;  1V74 A;  3F8H A;  3ROB A;  1DVC A;  2WOF A;  4L7K A;  3H51 A;  1N5P A;  4N6L A;  1Y4K A;  2ML6 A;  5TGN A;  2XFS A;  4N6V 0;  3NX0 A;  3NBR A;  3KZT A;  4WYK A;  3JVC A;  1JB5 A;  2F86 B;  3G71 3;  1JNQ A;  7STD A;  5FGO A;  5ELJ A;  1AVL A;  1RJO A;  1KSI A;  1Q7Y 4;  1ASK A;  1VQO 3;  3OWY A;  3J7Y d;  3KSP A;  1W6Y A;  1W00 A;  3ECF A;  3DGN A;  3SX1 A;  3L0R A;  3QRD A;  3MSO A;  1D6U A;  4L8O A;  3GZB A;  2BNG A;  2JDI H;  3SED A;  1S72 3;  1E97 A;  3EN8 A;  1HKX A;  2BHM A;  4NRE A;  5LC6 A;  4L8P A;  1AVK A;  5STD A;  1L5G B;  4HYZ A;  4WYK B;  4BTW A;  1YI2 3;  1R4C A;  3HK4 A;  1Q86 4;  1LOX A;  1ZO2 A;  2XEP A;  3NM2 A;  3LML A;  1D6Z A;  1SPU A;  3OW2 2;  1FGO A;  2XF3 A;  3LH4 A;  1FGT A;  2CFD A;  3CPO A;  4IT7 A;  1VQ4 3;  5KP1 A;  2HML B;  4HM6 B;  3CPW 2;  1IT8 A;  3EBY A;  1QVF 2;  3GRD A;  4LZI A;  2STD A;  4GL6 A;  3BNE A;  4JF8 A;  4HJL B;  3N8B A;  3U97 A;  2MF7 A;  1SQW A;  2OTL 3;  2CFK A;  4K90 B;  3B4P A;  3FGY A;  1JN5 A;  4MMZ B;  4RZM A;  4U13 A;  2P05 A;  1LNH A;  3UL5 A;  1OCV A;  3GZR A;  1U5O A;  5IG3 A;  2KXG A;  4QWT A;  3FZW A;  3Q2P A;  2BMO B;  1SIH A;  3K0Z A;  3G16 A;  3LTC A;  4G1M B;  3MWZ A;  2OQE C;  4O8S A;  4IPB A;  3PZW A;  2QIY A;  3EQQ B;  1NDO B;  2FNQ A;  3MG3 A;  4HM4 B;  2WO0 A;  1RN7 A;  2W04 A;  3FF0 A;  1OHS A;  1DMN A;  3G8Z A;  1VQN 3;  2HMK B;  2IA7 A;  4XBT A;  4CDL A;  2GU1 A;  4HM2 B;  4N6M A;  3D9R A;  3K5T A;  1Q82 4;  2RFR A;  4HM0 B;  1DMM A;  1U8C B;  3UB1 A;  3RGR A;  3GAX A;  3VSY A;  5LC7 A;  1JN5 B;  3G4S 3;  3PGB A;  2CG1 A;  4K1V A;  1OUN A;  4FR9 A;  3LTB A;  1M1X B;  2GXF A;  3CNM A;  3MPH A;  3KII A;  4XB5 A;  5D82 A;  2O9U X;  3GZY B;  2HMN B;  3SOY A;  2V1L A;  4HM7 B;  4PEJ A;  3DM8 A;  3OWS A;  4FCJ A;  5CLK A;  3CMA 3;  2CH9 A;  3SLU A;  2SBL A;  4XBX A;  5DRE A;  1IQY A;  4WFO A;  3SXX A;  3CCJ 3;  1GD4 A;  1VQ8 3;  3G0K A;  3MG2 A;  4XBY A;  2BMQ B;  2HMO B;  3JUN A;  3EJV A;  1FGQ A;  4XM4 A;  1W01 A;  5AIF A;  2YFL B;  1KQS 2;  3DZL A;  3NUV A;  3EF8 A;  1TFK A;  1MNL A;  4KFF A;  1QVG 2;  3UNL A;  3BND A;  4K1U A;  3F7X A;  3O8Y A;  3F40 A;  3GZX B;  2W2C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...