3CXCE

The structure of an enhanced oxazolidinone inhibitor bound to the 50s ribosomal subunit of h. marismortui
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
172
structure length
172
Chain Sequence
b'PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Design at the atomic level: design of biaryloxazolidinones as potent orally active antibiotics.
pubmed doi rcsb
molecule tags Ribosome
total genus 37
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2008-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00347 Ribosomal_L6 Ribosomal protein L6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 3cxcE02
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 3cxcE01
1YIJE 1YJWE 3CMEE 1VQNE 1VQ5E 1YI2E 3G71E 1VQ6E 3G4SE 3CCLE 1Q86G 3CCEE 4WFNE 5JVHE 4WF9E 2ZJQE 1Q7YG 2QEXE 5GADG 4IOCE 1K73G 1JJ2E 1KQSE 3CCVE 1S72E 1Q82G 1Q81G 5GAHG 1K9MG 4IOAE 1YITE 5MLCH 5AN9B 4WFBE 3CCSE 3CCUE 2QA4E 3CCME 1VQME 2OTLE 4WFAE 1W2BE 5HL7E 4WCEE 1YHQE 2ZJRE 3CF5E 1NJIG 5JVGE 2OTJE 4IO9E 3J7ZG 1YJNE 4UY8G 3I56E 3PIPE 2CQLA 3G6EE 3CCQE 1QVGE 5DM6E 3CMAE 1M90G 3CCRE 3DLLE 3CPWE 3OW2E 1N8RG 1VQ8E 2ZJPE 5DM7E 5GAEG 1VQKE 3PIOE 3I55E 1YJ9E 3CCJE 4U67E 3CC2E 1VQ7E 5H1SI 1RL6A 1VQOE 3CD6E 1KC8G 3CC4E 1VQ9E 1QVFE 1KD1G 1VQ4E 1VQPE 3CXCE 1K8AG 1VQLE 5GAGG 1M1KG 3CC7E
chains in the Genus database with same CATH superfamily
1YIJE 2OYBO 2I5ZO 1YJWE 3CMEE 2AF5A 1VQNE 1VQ5E 3CKGA 1YI2E 3G71E 1VQ6E 3G4SE 3CCLE 1P4PA 3CCEE 2OL8O 1Q86G 4WFNE 5JVHE 3EC5A 2OL7A 4WF9E 3IG9A 2OY5O 2G8CO 2ZJQE 3CKFA 2QEXE 5GADG 4IOCE 2OY7A 1K73G 1JJ2E 2PI3O 3CCVE 1KQSE 1S72E 5B3MO 1Q82G 2FKJA 1Q81G 5GAHG 1K9MG 4IOAE 1YITE 1OSPO 5MLCH 5AN9B 4WFBE 3CCSE 3CCUE 2QA4E 3CCME 1VQME 2OTLE 2HKDA 1RJLC 4WFAE 1W2BE 5B2AO 5B11O 5HL7E 4WCEE 3IGEA 1YHQE 2ZJRE 3CF5E 1NJIG 1M1KG 5JVGE 2FKGA 2OTJE 2OY8A 4IO9E 3J7ZG 1YJNE 4UY8G 3AUMO 3I56E 2OY1O 3PIPE 2CQLA 2I5VO 3G6EE 3CCQE 1QVGE 5DM6E 3CMAE 1M90G 2OL6O 3CCRE 3DLLE 3CPWE 3OW2E 1N8RG 1VQ8E 2ZJPE 5DM7E 5GAEG 1VQKE 3PIOE 3I55E 1YJ9E 3CCJE 4U67E 3CC2E 1VQ7E 5H1SI 1RL6A 1VQOE 1FJ1E 5B10O 3CD6E 1KC8G 3CC4E 1VQ9E 1QVFE 1KD1G 1VQ4E 1VQPE 3CXCE 1K8AG 1VQLE 5GAGG 1Q7YG 3CC7E
chains in the Genus database with same CATH topology
1YIJE 1YJWE 3CMEE 1VQNE 1VQ5E 1YI2E 3G71E 1VQ6E 3G4SE 3CCLE 1Q86G 3CCEE 4WFNE 5JVHE 4WF9E 2ZJQE 1Q7YG 2QEXE 5GADG 4IOCE 1K73G 1JJ2E 1KQSE 3CCVE 1S72E 1Q82G 1Q81G 5GAHG 1K9MG 4IOAE 1YITE 5MLCH 5AN9B 4WFBE 3CCSE 3CCUE 2QA4E 3CCME 1VQME 2OTLE 4WFAE 1W2BE 5HL7E 4WCEE 1YHQE 2ZJRE 3CF5E 1NJIG 5JVGE 2OTJE 4IO9E 3J7ZG 1YJNE 4UY8G 3I56E 3PIPE 2CQLA 3G6EE 3CCQE 1QVGE 5DM6E 3CMAE 1M90G 3CCRE 3DLLE 3CPWE 3OW2E 1N8RG 1VQ8E 2ZJPE 5DM7E 5GAEG 1VQKE 3PIOE 3I55E 1YJ9E 3CCJE 4U67E 3CC2E 1VQ7E 5H1SI 1RL6A 1VQOE 3CD6E 1KC8G 3CC4E 1VQ9E 1QVFE 1KD1G 1VQ4E 1VQPE 3CXCE 1K8AG 1VQLE 5GAGG 1M1KG 3CC7E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIJ E;  1YJW E;  3CME E;  1VQN E;  1VQ5 E;  1YI2 E;  3G71 E;  1VQ6 E;  3G4S E;  3CCL E;  1Q86 G;  3CCE E;  4WFN E;  5JVH E;  4WF9 E;  2ZJQ E;  1Q7Y G;  2QEX E;  5GAD G;  4IOC E;  1K73 G;  1JJ2 E;  1KQS E;  3CCV E;  1S72 E;  1Q82 G;  1Q81 G;  5GAH G;  1K9M G;  4IOA E;  1YIT E;  5MLC H;  5AN9 B;  4WFB E;  3CCS E;  3CCU E;  2QA4 E;  3CCM E;  1VQM E;  2OTL E;  4WFA E;  1W2B E;  5HL7 E;  4WCE E;  1YHQ E;  2ZJR E;  3CF5 E;  1NJI G;  5JVG E;  2OTJ E;  4IO9 E;  3J7Z G;  1YJN E;  4UY8 G;  3I56 E;  3PIP E;  2CQL A;  3G6E E;  3CCQ E;  1QVG E;  5DM6 E;  3CMA E;  1M90 G;  3CCR E;  3DLL E;  3CPW E;  3OW2 E;  1N8R G;  1VQ8 E;  2ZJP E;  5DM7 E;  5GAE G;  1VQK E;  3PIO E;  3I55 E;  1YJ9 E;  3CCJ E;  4U67 E;  3CC2 E;  1VQ7 E;  5H1S I;  1RL6 A;  1VQO E;  3CD6 E;  1KC8 G;  3CC4 E;  1VQ9 E;  1QVF E;  1KD1 G;  1VQ4 E;  1VQP E;  3CXC E;  1K8A G;  1VQL E;  5GAG G;  1M1K G;  3CC7 E; 
#chains in the Genus database with same CATH topology
 1YIJ E;  2OYB O;  2I5Z O;  1YJW E;  3CME E;  2AF5 A;  1VQN E;  1VQ5 E;  3CKG A;  1YI2 E;  3G71 E;  1VQ6 E;  3G4S E;  3CCL E;  1P4P A;  3CCE E;  2OL8 O;  1Q86 G;  4WFN E;  5JVH E;  3EC5 A;  2OL7 A;  4WF9 E;  3IG9 A;  2OY5 O;  2G8C O;  2ZJQ E;  3CKF A;  2QEX E;  5GAD G;  4IOC E;  2OY7 A;  1K73 G;  1JJ2 E;  2PI3 O;  3CCV E;  1KQS E;  1S72 E;  5B3M O;  1Q82 G;  2FKJ A;  1Q81 G;  5GAH G;  1K9M G;  4IOA E;  1YIT E;  1OSP O;  5MLC H;  5AN9 B;  4WFB E;  3CCS E;  3CCU E;  2QA4 E;  3CCM E;  1VQM E;  2OTL E;  2HKD A;  1RJL C;  4WFA E;  1W2B E;  5B2A O;  5B11 O;  5HL7 E;  4WCE E;  3IGE A;  1YHQ E;  2ZJR E;  3CF5 E;  1NJI G;  1M1K G;  5JVG E;  2FKG A;  2OTJ E;  2OY8 A;  4IO9 E;  3J7Z G;  1YJN E;  4UY8 G;  3AUM O;  3I56 E;  2OY1 O;  3PIP E;  2CQL A;  2I5V O;  3G6E E;  3CCQ E;  1QVG E;  5DM6 E;  3CMA E;  1M90 G;  2OL6 O;  3CCR E;  3DLL E;  3CPW E;  3OW2 E;  1N8R G;  1VQ8 E;  2ZJP E;  5DM7 E;  5GAE G;  1VQK E;  3PIO E;  3I55 E;  1YJ9 E;  3CCJ E;  4U67 E;  3CC2 E;  1VQ7 E;  5H1S I;  1RL6 A;  1VQO E;  1FJ1 E;  5B10 O;  3CD6 E;  1KC8 G;  3CC4 E;  1VQ9 E;  1QVF E;  1KD1 G;  1VQ4 E;  1VQP E;  3CXC E;  1K8A G;  1VQL E;  5GAG G;  1Q7Y G;  3CC7 E; 
#chains in the Genus database with same CATH homology
 1YIJ E;  1YJW E;  3CME E;  1VQN E;  1VQ5 E;  1YI2 E;  3G71 E;  1VQ6 E;  3G4S E;  3CCL E;  1Q86 G;  3CCE E;  4WFN E;  5JVH E;  4WF9 E;  2ZJQ E;  1Q7Y G;  2QEX E;  5GAD G;  4IOC E;  1K73 G;  1JJ2 E;  1KQS E;  3CCV E;  1S72 E;  1Q82 G;  1Q81 G;  5GAH G;  1K9M G;  4IOA E;  1YIT E;  5MLC H;  5AN9 B;  4WFB E;  3CCS E;  3CCU E;  2QA4 E;  3CCM E;  1VQM E;  2OTL E;  4WFA E;  1W2B E;  5HL7 E;  4WCE E;  1YHQ E;  2ZJR E;  3CF5 E;  1NJI G;  5JVG E;  2OTJ E;  4IO9 E;  3J7Z G;  1YJN E;  4UY8 G;  3I56 E;  3PIP E;  2CQL A;  3G6E E;  3CCQ E;  1QVG E;  5DM6 E;  3CMA E;  1M90 G;  3CCR E;  3DLL E;  3CPW E;  3OW2 E;  1N8R G;  1VQ8 E;  2ZJP E;  5DM7 E;  5GAE G;  1VQK E;  3PIO E;  3I55 E;  1YJ9 E;  3CCJ E;  4U67 E;  3CC2 E;  1VQ7 E;  5H1S I;  1RL6 A;  1VQO E;  3CD6 E;  1KC8 G;  3CC4 E;  1VQ9 E;  1QVF E;  1KD1 G;  1VQ4 E;  1VQP E;  3CXC E;  1K8A G;  1VQL E;  5GAG G;  1M1K G;  3CC7 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...