3CXCU

The structure of an enhanced oxazolidinone inhibitor bound to the 50s ribosomal subunit of h. marismortui
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Design at the atomic level: design of biaryloxazolidinones as potent orally active antibiotics.
pubmed doi rcsb
molecule tags Ribosome
total genus 25
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3cxcU00
1W2BU 1KC8W 3I55V 3OW2U 1JJ2U 1VQ5V 3CC2V 1VQ6V 2OTJV 2OTLV 1YI2V 1KQSU 1VQOV 2QEXV 1K8AW 4WFAV 1M1KW 4WFBV 3CC7V 1R73A 1VQPV 3CPWU 4WCEV 1YJ9V 1K9MW 1VQMV 3CCSV 1Q82W 1VQ9V 1YJNV 1QVFU 1Q86W 3CMEV 3CCRV 1YJWV 1VQNV 3CCEV 3CCJV 1S72V 1YHQV 1QVGU 1K73W 3CCVV 1KD1W 2D3OW 1YIJV 1Q7YW 3I56V 1VQLV 3CC4V 1NJIW 3CCUV 1VQKV 5DM6V 1Q81W 3CXCU 1YITV 4WF9V 2QA4V 1VQ7V 1VQ4V 1VQ8V 3CMAV 3CCMV 3CCQV 3G6EV 3G71V 1M90W 3CD6V 1N8RW 3G4SV 3CCLV
chains in the Genus database with same CATH superfamily
4JZ2A 3Q4HB 2YIDA 3EHBB 4F4LA 1AI7A 3SJCC 1BT8A 2ZIOA 2E5LB 2JGDB 5LXTA 3JAWB 4I4TA 4O4JA 5EC2C 2UUCO 2WLIB 2EIKB 5B5EZ 5JH7B 3QTCA 2A3QA 1AJPA 3CD6V 4J9YB 3ZMUA 1NTZH 3KCXA 4JI1O 2YI8A 1FXHA 2B9ZA 3CB2A 1K8AW 5IT9N 3MDSA 3OEEG 1GAXA 4P30A 5KHHA 3E35A 3UM7A 2ADQB 2JJ2G 3LUTB 2DMXA 4GZRB 1BHAA 3ZHQA 1MG1A 4H44B 2FKXA 1AR1B 3RYIB 2LJ2A 1OCZB 4LF9O 4NXNO 1VQOV 3K5OA 3ASOB 5HFMA 3ZIAG 1QCEA 1Q86W 1BQ0A 2QWQB 3T4ZA 4DV4O 5LL6Y 1ORQC 1EZJA 3C90A 2GSMB 2LW1A 4FFKA 4WFHA 3QVNA 2P4KA 4O4LB 1HNZO 4X62O 4K8XA 2DYRB 2FMLA 2LGQA 2ZDIC 4O4IA 2JRIA 1VF6A 4TV9B 2E5LO 1Y67A 1S5HC 1Q3EA 1K4CC 3UO3A 1WB8A 2GV9A 1UPGA 4L8JA 5KAIZ 1WPXA 2HHHB 3HKBA 1I94B 5EZYA 2X6CA 4BW5A 4TQFA 1Q6IA 4DV5B 4EFEA 2FYUH 3OEHG 2RJZA 2F4VB 2DYSB 4LFBB 2EJRA 4TV8B 4CH4A 2YC0A 3LDDA 2M6YA 3MAQA 4XBFA 4YXWG 2LW7A 5B3SB 3WB0A 4X1IB 2ZNIA 2UU9O 3JYCA 1R3LC 3T1CA 4UCUA 5H6QA 3AG4B 2D3OW 4B3SO 1YTFB 2WLMA 2DYRC 1XOUA 4QPKA 3G80A 2AHZA 1V55B 1T5EA 3KG2A 3ABTA 1SQXH 4GLXA 4PI0A 4U3JB 2ZE7A 3HR0A 4LFCB 1TA8A 1KP3A 4X1KB 3K0DA 1I7FA 3CMEV 2X0LA 3B40A 2DYSC 5JCOC 3H1LH 5CB4B 2YEVB 3BABA 2A79B 2EBOA 4UB6Z 2ITDC 2IW5A 3MD0A 4QNHB 2OTJV 5L3CA 1FXKC 1FFXB 1R6KA 3RT3C 5LA6A 3EXAA 2IBZH 3D36A 4DV3B 4MVSA 2RDCA 1EN5A 4YJ3B 2HHHO 1NT2B 1QBZA 2QWPB 1I94O 3IC9A 5KHGA 5B1BC 1VQ7V 4DV5O 3BFRA 3O9OA 5BY1A 2HLDG 3OTFA 1RSOB 3DC6A 4YHHB 4LFBO 1COWG 1K33A 2G38A 5KA6A 5KX5B 3S3XA 2ILMA 3VQWA 5J2TA 1YHQV 1HNXB 4FM0A 4FLXA 3T2MA 1S5JA 3K57A 4YIPA 5BMVB 3SYPA 3B77A 1M90W 1R6TA 3ETGA 5CA1A 2HR3A 4LFCO 4MVRA 1MA1A 4JAVA 1WP7A 4CH3A 2OT5A 1V54B 5K1XA 3W7TA 3AG1B 1B3QA 1K4DC 1I5XA 2QKSA 3RFRA 2N04A 2PYLA 3B4SA 1VQ4V 1OZ0A 1QNMA 1SF9A 5K1PA 3P30A 1NS1A 1YDXA 3ZRWB 2OIEA 5FNVB 3B8MA 1Q8IA 1G1XB 4FLYA 3JASB 1Q90D 4DV3O 2XAGA 4AHCA 4PA6A 1ZTEA 4RO2A 2BOCC 5ITZA 4DV0B 4I0XB 3B2EE 3AG7A 4J7ZA 1GN6A 1US6A 1BHBA 4LR3A 4OX9B 1CXZB 1MOFA 3STLC 4FLUA 3BEHA 1P49A 2BTQA 3OW2U 4TUYA 3HKCB 1V54C 4IT5A 4K8ZA 2CK3G 4JF3A 1W0JG 3E22A 3W7SA 4O2BA 2ADPA 4DO2A 3IGAC 2Q4PA 2E75B 1G4YB 3RYFB 3U11A 1HNXO 4I9WA 2ETNA 2KKWA 1H38A 5GTHZ 3CCQV 1TAEA 4H33A 1R1BA 5LGTA 2YXYA 3ABKC 4BIZA 1PNKA 2PTMA 4WFBV 4JYBA 4MTXA 2YXHA 3OFNG 1YEWA 3N2KA 2MK3A 1VARA 3TK1A 3A0BZ 1FYJA 2QWOB 3IAYA 1CPYA 2IJHA 3VQVA 3RW0A 1K7DA 2H8PC 3ZS8C 5EIBD 2A0LA 1WP8A 4EFBA 2ZIMA 1QVFU 1DGSA 4X9QA 4NR1A 3R65A 4MTGA 2ZQMA 3ABLB 4JAUA 2YIAA 3FD9A 4CS2A 1M4UA 1YSCA 4DV0O 2OCCB 3H1HH 2CTRA 1ENVA 3ZRSA 4OX9O 1PP9H 1N33O 3A8TA 4ZKIA 1J95A 2QKCA 1QQCA 1JR9A 1SQFA 3B8NA 4DR2B 1ZWIC 4E2LA 5IE9A 4CC5A 3CCJV 4B3TB 1QR9A 1WB7A 2Q73A 4L87A 3HB3B 3C3SA 4NTYA 3VOUA 2UUBO 4FIPC 5KMGB 4CZZA 3UQ8A 4KFMA 4I55B 4JI3B 4CC6A 3SYCA 4R6ZA 1Q5OA 4O2AA 1M57B 4JI6B 3Q4HA 4U7OA 3RVZA 2HJDA 4LWSB 4H0LB 4D7TA 2HEPA 5EBMC 3JAWA 4I7ZB 1JA8A 2YICA 4DV2B 2WA3A 4W4LA 1PNLA 5JH7A 5D5QA 1H2MA 1XEQA 5LHIA 4XDJA 5CMUA 2V7QG 3E86A 2XUMA 2UXCB 2CGOA 3OGIB 1R3IC 4MW8A 5JJJB 4UCVA 1P4RA 4BAYA 1DK1A 1GN3A 2XT9A 3OM3B 4LF4B 4PI2A 4Q20A 3P32A 4IHJA 1M56B 3CCMV 4BWAA 4TOIA 4PDVA 1R3KC 2CE4A 1GKFA 2IM9A 1M57C 1S0VA 1AJQA 3RYIA 4JYYA 4JPRA 2P90A 2ITCC 3HKDB 5B66Z 3KZIZ 1NR1A 3ICXA 3UO2A 2NR5A 1H8HG 4DR2O 2IU3A 2DQ3A 3CSXA 3SYAA 4B3TO 2QDOA 3L70H 1D5NA 1KUQA 5FPRA 4O4HB 2YS8A 4FJCC 1IZ3A 4DXWA 4GX2A 1KC8W 3JCZA 2R9IA 1GK9A 3ZRVA 1Y66A 3JARA 2GTAA 2HKOA 4FLWA 1EN6A 1H2SB 4X64B 1K9MW 1F4MA 4JI3O 3ASNC 1BQZA 3K9AA 4DK1A 1N34B 4TV9A 4JI6O 4JTDB 1K92A 3CCUV 1YITV 4JTAB 3X2QB 2X7RB 2P7TC 5EYPB 4DV2O 4KHPB 4UVBA 1N0NA 2LO1A 2R72A 3F7YC 4G27B 4TV8A 1F4NA 2UXCO 2UUCB 4FK5C 4ICGA 4I9QA 2HFEC 5KA5A 1F7YA 3JALA 1IVSA 2LP7A 2XNDG 2CTPA 4LF4O 1ZLZA 3JATB 5J2UA 5LMNB 2DJVA 1BS3A 3FB7C 1YTFD 4RQEA 5F2VO 1PD3A 3JAKB 3LSQA 3C3TA 5E1AC 4U3JA 1FS0G 2CTWA 2BE3A 2KG7B 3K5NA 4FM1A 4X1KA 5FPOA 5KLVH 3WFVA 1ZX3A 4DR6B 1EBOA 1SKVA 4U7NA 4WFGA 2OYQA 1NVPD 1EFRG 5CB4A 2YEVA 3KCYA 2RN9A 3BRCA 4B3MB 3CJHB 4JI8B 1VQ9V 4X64O 3K03A 4FVMA 5JQGB 3T4DA 2Z0AA 1N34O 5LMUB 2CDYA 4P9OA 4YJ3A 3GWOA 3JAMN 4QIWF 1F51A 4PJ0Z 2HVKC 5LP6B 1TVKB 5J9PC 4KHPO 1RSOA 1NI8A 2WPDG 1NTKH 5KX5A 4CBCA 1N32B 1JFFB 1UFIA 4IIJA 1D5AA 3DGEA 2AHYA 5H6RA 3E8FA 4IYIA 3F5TA 2BSKA 3K04A 1IXMA 1ZL8A 4Z1MG 1EM1A 5LMNO 1XILA 1LUVA 5BMVA 4NXMB 2UU9B 3FYIB 3K58A 3TCUA 2VWJA 3OTOB 1KP2A 5IWAO 2Z3YA 3ZJZA 3ZHVA 4B3SB 4LBEC 1QLEC 1NKDA 1MZEA 5JVDB 5LP6C 3VQXA 2JS5A 4DR6O 1DLBA 5KUKA 4PDLA 1JJ2U 3TGUH 1KB9F 1YZBA 1WN7A 4PDMA 1M1KW 4JI0B 4A5UB 4B3MO 4KUMA 1Q82W 3CYOA 4JI8O 4LNUB 4PV1B 2GDSA 1FPOA 4CS3A 1KKDA 4R8CA 1BE3H 3N2GA 3JASA 5LMUO 3WG7C 4Z2WA 3ZX6A 4I0XA 2AXTZ 2ZXWC 4FFBB 2BOBC 4JZGA 2Q8VA 4NB5A 2N05A 1ZSPA 4GYCB 1U96A 2YXLA 2EJ7A 3OMNB 2H3OA 3D3IA 5B1OA 3AEIA 2W0XA 5GONB 1Q81W 1SERA 4B7KA 1N32O 1FKAO 2P67A 1A32A 3N27A 1L1FA 3I55V 4P9PA 3AK2A 3FB6C 3UT5B 5IJ0A 1EN4A 4X1YB 3CCSV 4NXMO 3SPHA 1U97A 4BIUA 4DK0A 1FXKB 2ZR3A 2Q67A 3OTOO 1LUWA 1NR7A 3WU2Z 1TUBA 3LSUA 4OPAA 4K3AA 2LFRA 3U0ZA 3JD4A 5B1BB 1L0NH 4J9ZB 4JAAA 3DXRB 2HVJC 1V9PA 4JI0O 2JS3A 3LDEA 4R7CA 4AI8A 3ZRXA 3CC4V 1VQKV 2ZNJA 2V1DA 1L8DA 1YXBA 3BAAA 2EILC 1NH2B 5L3DA 1SA0A 1THZA 5KHJA 1OCCB 4FMTA 2FL4A 5DECA 4QGPA 3TXQA 4DUYB 4I5SA 3CCRV 1NU1H 4TWKA 4FM2A 2QE7G 1IXBA 1PPJH 2Y0PA 1B04A 4MVUA 2B1IA 1RFYA 1XQ8A 4TQDA 1JMKC 3RN4A 4ZHQB 3RWRD 4WFFA 4DRXB 5IJ9B 1VMGA 1P84F 3E8HA 4WCEV 4KXRA 4LFAO 1OCRB 2Q7EA 1Q6HA 3R66A 2XAJA 1QVGU 2XAFA 3CCVV 3ETQA 1YIJV 1P7GA 1OCCC 4RQFA 1VQ8V 3HKEB 3OR7C 2LQTA 2Q69A 3P3PA 4LWSA 2JGUA 2ZT9B 4DW0A 4DV1B 4O4JB 3E83A 2WA4A 1N4CA 5L3GA 1NQTA 1YJNV 3GVMA 4EB6B 2Q0OC 3FFQA 1XUQA 1NTMH 3L9DA 1Q7YW 3APQA 4HAMA 4PA9A 1I5YA 3OT7A 1Q43A 4FLZA 2ZD9A 1OCRC 3MHHC 5C8YB 2QSAA 4HNAB 1AR5A 3OE7G 5LYJB 4J7JA 4DV6B 5KHIA 2JK5C 1VQNV 3ABKB 4DUYO 1KYOF 2OCHA 5IY5C 5JWPA 3HKDA 3JSLA 3H9VA 3BY6A 3L72H 2ODMA 1N33B 1KMIZ 1NZ6A 5IYCO 2A7WA 4OXSA 1H2NA 3G67A 1MSWD 3SJBC 4O4HA 4YIOA 5EK0A 1Y6XA 4N23A 1ZUQA 2XAHA 5BZBA 3LNNA 1OCOB 4RUFA 4I50B 4J7KA 1AP5A 2UUBB 4O4IB 4X89A 1SRYA 2NLJC 5LHGA 1XL6A 3MHSC 3SJAC 3H01A 1VF7A 4DV1O 4NTWA 2WSSG 5EYPA 1WA8A 4FLVA 4GX1A 2VQFB 1SQVH 1HNWB 4RUEA 1E1QG 1CEZA 3OD4A 1SZXA 4ZOLA 2GUZB 1W0KG 3FB8C 4BIOA 2JEXA 3E89A 3OUFA 1Y74A 4TT3G 1OCOC 4CH6A 1XDCA 3JATA 4DR3B 2PUSA 4H13B 4JI4O 3JAKA 4AILC 1VF6C 2CAZC 3RGBA 3E2EA 1BMFG 4DV6O 4LCUC 3T1YB 3CXCU 2KG7A 3H1JH 1B06A 3KKYA 1E79G 2UXDB 1GM9A 1FFTB 2LGWA 2NNUA 4QE7A 3W7WA 3CRMA 5EBWC 2ZCEA 3RYHB 5LGUA 1MSDA 4MT8A 3ZN1A 3CJHA 2F95B 3FYEB 3OR6C 1KD1W 4J42A 2VQEB 1NJIW 2H94A 5JQGA 2PI5A 1Y4MA 4LF6B 1GTOA 3QNEA 4NVPA 1N0JA 4QE9A 4ZI7A 5L3BA 2PY5A 1XL4A 2QTSA 3CPWU 2HP8A 2IJIA 5FLXN 2F93B 2VQFO 2PZSA 1HNWO 1TVKA 2ZE6A 2F43G 2JGDA 4PHZA 4FZ1A 3AK3A 2WLLB 1D2DA 2B1GA 2EIMC 3SGIA 1WJZA 3AG3C 2WLIA 3HPLC 4YY3O 4N21A 1WNSA 4MVMA 5J2TB 4X65B 4X66B 1I08A 1B6QA 4DR3O 2QM8A 3OMIB 3D36C 2YIBA 3QO5A 3UKMA 2YIBD 3ASNB 2Q5ZA 4JV5B 1KBHA 2ZDIA 4WF9V 1K5SA 1CP9A 1URFA 3FX7A 3T1YO 2IJKA 4P2ZA 2EZOA 2JVDA 1G8MA 2UXDO 1M9NA 2YDEA 4YJ2B 1R73A 2X6BA 4J11A 1YJWV 4LF8B 2Y69B 1BL8A 4DV7B 4LNUA 2VQEO 2QA4V 1SQBH 1E1RG 2VWKA 1HW7A 4LF6O 1TUEB 2EULA 4IYHA 4X20B 4O4LA 5ITZB 3JD3A 1VQMV 1IX9A 4FFBA 4QJFB 4TUYB 5DM6V 3SYQA 1SQQH 1QHTA 3K3WA 2DE0X 4O2BB 5GONA 1Z5WA 4UV9A 2K1EA 2Y69C 3VQYA 1RP3B 4X65O 4X66O 3RYCB 5L3FA 1Y76B 5JCOA 3OUSA 3BPZA 2EINC 5C93A 3K5MA 4U3FH 1BGYH 3ZMZA 1AI4A 2A9HA 3UT5A 3OAAG 4X1YA 1YF2A 4X1IA 4UB8Z 1SS3A 3SPGA 1N36B 4C7UA 1FXKA 3L73H 3NXSA 2PF4E 4JV5O 3A0HZ 3CEIA 1RM1C 3K79A 2R9RB 1OV9A 2W6IG 1X59A 4HYOA 3EFFK 3K06A 5IWAB 5LOVB 2Q0AA 2ZM6O 4LH6A 2CH7B 2IH3C 1OJHA 1XI1A 5CBGA 3UCSC 4LF8O 3DXRA 1BZKA 1AR4A 5B1AC 3ZHSA 2E74B 4DV7O 1VP7A 2V4DA 1TGOA 3CS5A 4NKGB 3TJTA 3CC2V 1S3JA 1AI5A 1NH2D 3J80N 5KHKA 2QJ1A 4RAIA 5HFLA 3FB5C 1FFXA 2IJJA 2B5UA 2DWDC 4KL1A 3APOA 4BR6A 4DR5B 3G6EV 4DR1B 1W2BU 1XMOB 2Q6AA 2QM7A 5IYZB 3SPCA 1QLEB 2O57A 2KB1A 4K0KB 2YSUB 2QTOA 5A9GA 4LC1A 1L0LH 1ZAUA 1JCHA 4ZHQA 4F6RB 4DRXA 3ZHRA 5IJ9A 2ZE5A 1QR8A 2CUGA 4MVZA 2EIJC 1IDSA 4O2AB 1N36O 2Q7HA 4MSWC 2N74A 3ZCCA 3HKEA 3WG7B 4LF7B 4PA7A 2E3CA 1JPXA 2ZKOA 2ZXWB 2AZ0A 2DW4A 2RNBA 1DTOA 3CP1A 2AW9A 4JGSA 4NYKA 2XHBA 3W7UA 5CBHA 1AJNA 1KU9A 4EB6A 2DWEC 4PD4F 1K3EA 3M7MX 2P06A 4MVOA 4UXNA 4ABMA 3H1IH 1PNMA 1PKXA 4IHJB 3ZHTA 5AG2A 5C8YA 4HNAA 1HR0B 3GB7C 3ZRWA 2OWOA 1HDJA 5LYJA 2ZR2A 5FNVA 4R50A 4JYCA 1LR1A 1FAFA 3G71V 2WAMA 3SR2C 4DR5O 5FL7G 4DR1O 1XMOO 4ZIBA 4KP4A 1FXVA 1OHHG 2EIKC 3SYOA 1YJ9V 4K0KO 4GKKB 1IURA 2PYJA 1AI6A 3HKCA 4UCTA 3JD1A 4UCSA 3BCCH 4I50A 3JARB 3CMAV 4DW1A 5DN6G 1N8RW 4D6TH 3M99B 4PA4A 3RYFA 3JSNA 2P5OA 1SQGA 4TSFG 4LFAB 2EILB 5LBQA 4Q6GA 1R3JC 4OGQB 3DSQA 4LF7O 4GT1A 1NBMG 5EC1C 3LNMB 1SETA 2AGAA 2Y48A 3I5DA 1OCZC 3QO7A 5JJEB 3ASOC 3OGCC 2GUZA 2EX3A 4MVQA 4PELA 2JEUA 4WFEA 4GX0A 3BA9A 2JIZG 2QR4A 1JOYA 2QM4A 1DF4A 3JALB 4PA3A 1LNQA 1ROPA 4J10A 1J5EB 5J2UB 3CE2A 4MTFA 1FJGB 3J7AU 3FAVB 4UV8A 1HR0O 3LSSA 3CWBH 5H2FZ 4NTXA 5CBFA 1JVMA 2VRZA 2OTLV 2Q68A 2F23A 3CRAA 2UXBB 3CC7V 1AVMA 1K34A 4GKKO 1NVPB 1QLNA 5JJNB 1RPRA 3THOA 3RYHA 3A0RA 3NR7A 1Z5VA 5DEDA 5B3SC 1H2KA 5CA0B 1IBMB 1GO3F 3L74H 1IBKB 2K9PA 4H37A 2P6JA 3D3QA 3ZHUA 3AG4C 3OMAB 5KMGA 1S77D 4WBNB 1VF5B 1GN2A 1HWYA 1VIBA 2UXNA 2VS0A 1V55C 4I55A 2CTQA 3B09A 3CRQA 3WB1A 3A2FA 4JI7B 3IFXA 3AK1A 5IY5B 5LXTB 2F4VO 5KAFZ 2WLLA 2UXXA 1YI2V 4LF5B 4I4TB 1AILA 1XBLA 1XNRB 4IIJB 3STZC 4GKJB 3WB2A 2BSKB 3QG5A 1ZL8B 3ZN0A 1J5EO 1FJGO 2W6JG 5E79Z 1QU7A 4LP8A 3BVOA 2QEXV 1PL4A 4JI4B 4JI5B 4DR7B 1PL0A 2IH1C 1MABG 5IYDO 2UXBO 2R9AA 3LDCA 4YJ2A 1JQ0A 1UJWB 1G6UA 3ZMSA 3FKSG 3SPJA 3ZMVA 2WLNA 2CGNA 1WPBA 2LFSA 3J81N 2WLJA 4X8AA 1MNGA 3K0GA 4QPJA 4B08A 1IBMO 3D8CA 2JJ1G 5L3EA 4WFAV 1IBKO 3N2GB 3PN1A 4JI2B 2R70A 3ETEA 4X20A 1XREA 3TETA 1O9GA 2DN9A 1MMMA 4JI7O 2W0FC 4YHHO 3HKBB 5EZYB 3AG1C 1VQPV 1SC5B 3GWKC 1XHZA 4LF5O 1YVWA 2WLKA 2QKAA 4DUZB 3K9SA 1XNRO 4GKJO 1WAZA 1BCCH 3ABMB 3BHPA 1FD9A 1Y76A 3RYCA 1XHXA 3ETDA 4B3RB 1Z2GA 2RQ6A 3SJQC 5IJ0B 4UCRA 4YY3B 1F23A 3G4SV 2HG5C 3ABUA 2XOKG 4IL6Z 1X4TA 3G6BA 2AZ2A 3JD2A 4JI5O 4IGGA 4E4EA 4DR7O 1TUBB 4ASUG 2YI9A 2YUAA 4G2KA 2E76B 3H1KH 4MTOA 2KSDA 3K08A 3U10A 5LOVA 1SQPH 5A2QN 4LH7A 2CH7A 3PJSK 4F6EA 3F7VC 1I0HA 1VQ6V 4JTCB 1R6NA 3QO8A 2EIMB 2FTKA 3ABMC 3AG3B 4JASA 2L35A 4B7EA 3SDLA 3DC5A 4JI2O 2XAQA 3K5LA 2NN4A 1SA0B 2GBOA 5CA3A 5LA6B 4MW3A 3RBZA 2FB5A 2HJFC 3K59A 2RMKB 2F1MA 1S76D 1HP8A 4CS4A 3EVKA 5IYBO 2F66C 2WLHA 1XMQB 5IYZA 3CRRA 3W7XA 4GCZA 1S72V 3T1HB 1K73W 2MW2B 5LP6A 2ATKC 4DUZO 1IBLB 4HBNA 4F6RA 2Z5UA 3AG2B 1K97A 4B3RO 1S5LZ 2ARHA 1YCIA 1VQ5V 1JFFA 1H8EG 4D7SA 5EBLC 3E8GA 4EKWA 3ABLC 2OCCC 3BA8A 3CRCA 3ML0A 4K35A 3I56V 1H2GA 3JD0A 4AQYB 4OPHA 5CA1B 5IDJA 2A06H 4XDLA 1GH6A 4PDRA 2Y0IA 5BR8B 3CCLV 3O65A 3IJ4A 5JVDA 5H9CA 1DF5A 2UUAB 3ZBHA 3IC7A 2ZM6B 1GN4A 3AG2C 2KQXA 1VQLV 1SZTA 2EINB 1XNQB 1GM8A 2Y4TA 3L71H 3RVYA 2ZINA 4FPPA 2Q9LA 5GTIZ 1KQSU 3L75H 1RM1B 3CCEV 1XMQO 1PV0A 4X88A 1KKCA 4DR4B 5LHHA 1Q6UA 2BTQB 4HZ3A 3T1HO 3S3WA 2PI4A 1JX9A 4UVAA 1BSMA 3M8AA 4BW9A 2D2CB 2M7WA 1IBLO 3E22B 1GRJA 2DOSA 4JYAB 5B1AB 1PM9A 2PGGA 2BTOA 4DYLA 4GUNA 1JJOA 3DTUB 2L6LA 4MS2A 2OIGA 1M56C 2RCVA 1P7BA 1GM7A 4EEQA 1K5QA 1H2LA 2Y4UA 3E8BA 2X6AA 2XTAA 4FZ0A 3SPIA 1WA8B 4AQYO 1GMGA 1WLEA 5BR8O 4ZOLB 2QWRB 1AB3A 3N2KB 1MZFA 2GTSA 1M5IA 5D5PA 2UUAO 1W59A 2JDIG 2WWWA 2P22C 1Y74B 5GW7A 4W4KA 1EZVH 3P3NA 2EZPA 1VEWA 2C2AA 1XNQO 4FLTA 4JI1B 3FAVA 2ZE8A 5BXZA 4J80A 4ZBMA 1AROP 2EIJB 5LGNA 2XASA 1AP6A 3CHXA 2P4VA 4J41A 2QWNB 3X2QC 4UFZA 1O9HA 1KECA 4DR4O 1SESA 4UUJC 3TXSA 2Q7GA 4GX5A 2IU0A 4LF9B 4NXNB 4XDKA 3CX5F 3CXHF 3QF7A 3JCUZ 5CN0A 4JYAO 4UVCA 2QGNA 4G28B 5B1NA 5CA0A 4DV4B 1RPOA 5KUMA 3ZEDA 4RWUA 5EIBC 4Z1VA 2GHYA 3ZMTA 2BCCH 3F5WC 4WBNA 5TISZ 1HNZB 5H5NA 4X62B 4ZI7B 4CH5A 1M93A 3VBBA 2DQ0A 4UCOA
chains in the Genus database with same CATH topology
1GKFA 3MHSC 1M57C 3H01A 3EHBB 4F4LA 1AI7A 2OTLV 1S0VA 1AJQA 2Q68A 4JPRA 3CC7V 1K34A 2P90A 2WSSG 2ITCC 4GX1A 1NR1A 1H8HG 2IU3A 2DQ3A 1E1QG 4RUEA 1CEZA 1NVPB 5EC2C 3SYAA 1QLNA 2WLIB 1RPRA 2EIKB 1W0KG 3A0RA 3FB8C 4FJCC 2JEXA 5B3SC 3E89A 4DXWA 1AJPA 3OUFA 4GX2A 1GO3F 3CD6V 4J9YB 4TT3G 1OCOC 3ZMUA 3JCZA 2R9IA 1KC8W 1GK9A 4H37A 2P6JA 3ZRVA 1Y66A 1FXHA 1K8AW 3AG4C 2HKOA 3OMAB 1S77D 1K9MW 1F4MA 3ASNC 1HWYA 2UXNA 3K9AA 3OEEG 1V55C 3E2EA 4P30A 1BMFG 4LCUC 3E35A 4JTDB 1K92A 3UM7A 2JJ2G 3LUTB 3CCUV 3CXCU 1BHAA 1YITV 1MG1A 4JTAB 3X2QB 2X7RB 1AR1B 2P7TC 1E79G 3IFXA 5IY5B 1GM9A 1OCZB 1FFTB 2WLLA 2UXXA 1YI2V 4UVBA 1VQOV 2NNUA 3ASOB 4QE7A 3W7WA 3F7YC 5EBWC 5HFMA 3ZIAG 4G27B 1QCEA 5LGUA 1Q86W 1F4NA 3STZC 4MT8A 3ZN1A 3T4ZA 4FK5C 3FYEB 3OR6C 1KD1W 3ZN0A 2HFEC 5KA5A 1ORQC 1NJIW 2W6JG 2H94A 2LP7A 1EZJA 2PI5A 2XNDG 2GSMB 4LP8A 1Y4MA 4WFHA 1GTOA 3FB7C 1YTFD 2DYRB 3QNEA 4RQEA 1PD3A 2ZDIC 4QE9A 2QEXV 5L3BA 3LSQA 1XL4A 3CPWU 1PL0A 2IH1C 1MABG 5IYDO 1S5HC 5E1AC 2IJIA 1FS0G 1K4CC 3LDCA 1WPXA 1JQ0A 1UJWB 3ZMSA 3FKSG 2F43G 2X6CA 4BW5A 3SPJA 3WFVA 2WLLB 3ZMVA 2WLNA 1EBOA 2B1GA 2EIMC 4U7NA 3OEHG 4WFGA 2LFSA 2DYSB 3AG3C 1NVPD 1EFRG 2WLJA 2EJRA 2WLIA 3HPLC 4X8AA 2YEVA 3K0GA 4N21A 3LDDA 4QPJA 4MVMA 4XBFA 2JJ1G 5L3EA 4YXWG 4WFAV 5B3SB 1B6QA 1VQ9V 3K03A 2QM8A 3JYCA 1R3LC 3OMIB 3T1CA 5H6QA 3T4DA 3ETEA 3AG4B 2D3OW 3QO5A 3UKMA 3TETA 1YTFB 2WLMA 2DYRC 4QPKA 3ASNB 4P9OA 2ZDIA 4WF9V 1K5SA 1CP9A 2AHZA 1V55B 3KG2A 3ABTA 3GWOA 2IJKA 4P2ZA 4QIWF 1F51A 2EZOA 2HVKC 2W0FC 1G8MA 1KP3A 1M9NA 1R73A 3AG1C 5J9PC 1VQPV 2X6BA 3K0DA 2WLKA 3CMEV 1YJWV 2WPDG 2Y69B 2X0LA 2DYSC 3ABMB 1BL8A 4CBCA 2YEVB 3ETDA 2A79B 3DGEA 2AHYA 5H6RA 2QA4V 3E8FA 3SJQC 2EBOA 2ITDC 1E1RG 3K04A 1F23A 1IXMA 4Z1MG 2IW5A 3G4SV 2HG5C 3ABUA 3MD0A 4QNHB 2OTJV 5L3CA 2XOKG 1FXKC 1TUEB 1R6KA 3D36A 3JD3A 1VQMV 3FYIB 3JD2A 4MVSA 3TCUA 1KP2A 2Z3YA 3ZJZA 4ASUG 4G2KA 4QJFB 4LBEC 4MTOA 1QBZA 5DM6V 3K08A 3SYQA 1QLEC 1NKDA 5B1BC 1VQ7V 3PJSK 3F7VC 3K3WA 1DLBA 5KUKA 4PDLA 1JJ2U 2HLDG 4UV9A 1VQ6V 4JTCB 1R6NA 1COWG 1K33A 4PDMA 3QO8A 2EIMB 1M1KW 2K1EA 5KA6A 2Y69C 2FTKA 3ABMC 4KUMA 5L3FA 3AG3B 1Q82W 3OUSA 3CYOA 2EINC 5C93A 4JASA 3ZMZA 1AI4A 1YHQV 2A9HA 2XAQA 3OAAG 1KKDA 4R8CA 3SPGA 3T2MA 5CA3A 1FXKA 3WG7C 3SYPA 3NXSA 3B77A 4MW3A 1M90W 3ETGA 3RBZA 2HJFC 1RM1C 2ZXWC 1S76D 2BOBC 3K79A 2R9RB 2HR3A 2W6IG 4HYOA 3EFFK 4MVRA 5IYBO 4JAVA 3K06A 2WLHA 3OMNB 2OT5A 3W7XA 4GCZA 1S72V 1V54B 3D3IA 1K73W 5B1OA 2IH3C 5CBGA 2ATKC 3AEIA 3W7TA 3AG1B 1K4DC 1Q81W 5B1AC 1I5XA 2QKSA 1SERA 2Z5UA 3AG2B 1VQ4V 2P67A 1OZ0A 1K97A 1L1FA 3CC2V 3I55V 1VQ5V 3P30A 4P9PA 1S3JA 1H8EG 3FB6C 3ZRWB 1AI5A 1NH2D 5EBLC 3E8GA 4EKWA 3ABLC 3CCSV 3B8MA 4RAIA 3SPHA 5HFLA 4BIUA 2OCCC 2XAGA 3FB5C 1FXKB 3ML0A 4PA6A 2ZR3A 4RO2A 2IJJA 2B5UA 2Q67A 2BOCC 1NR7A 3I56V 2DWDC 1H2GA 3JD0A 5IDJA 1BHBA 4XDLA 3G6EV 1MOFA 4PDRA 3STLC 3BEHA 3CCLV 1W2BU 2Q6AA 3OW2U 2QM7A 2LFRA 3SPCA 1QLEB 1V54C 2KB1A 2YSUB 2QTOA 3JD4A 5B1BB 2CK3G 4JF3A 4PDVA 4J9ZB 1DF5A 4LC1A 1W0JG 5H9CA 2HVJC 3W7SA 1JCHA 4DO2A 3IC7A 3LDEA 3AG2C 3IGAC 4R7CA 3ZRXA 3CC4V 1VQLV 1VQKV 1QR8A 2V1DA 1G4YB 1SZTA 2EINB 4I9WA 4MVZA 1GM8A 3RVYA 2EIJC 1H38A 2EILC 1NH2B 5L3DA 3CCQV 4H33A 1THZA 4FPPA 5LGTA 3ABKC 1OCCB 1KQSU 4MSWC 4BIZA 3ZCCA 1PNKA 4FMTA 4WFBV 3WG7B 4JYBA 4PA7A 4MTXA 3OFNG 1JPXA 1RM1B 2ZXWB 4I5SA 3CCRV 3CCEV 2DW4A 1DTOA 3CP1A 4TWKA 4X88A 4JGSA 2MK3A 5LHHA 2QE7G 4HZ3A 3TK1A 3W7UA 5CBHA 1AJNA 4MVUA 2PI4A 1JX9A 2B1IA 4UVAA 1CPYA 2DWEC 2IJHA 2M7WA 1K3EA 4MVOA 4UXNA 3RW0A 4WFFA 1K7DA 5B1AB 2H8PC 3E8HA 2A0LA 4WCEV 1OCRB 1QVFU 1PNMA 3DTUB 1PKXA 4MS2A 2XAJA 1M56C 1QVGU 3R65A 2XAFA 1P7BA 2ZQMA 3GB7C 4MTGA 3ZRWA 3CCVV 1YIJV 1GM7A 3ABLB 2ZR2A 1K5QA 4JAUA 4R50A 1YSCA 3E8BA 1OCCC 2X6AA 4JYCA 2OCCB 4RQFA 1VQ8V 3OR7C 3G71V 2WAMA 3SPIA 2Q69A 1ENVA 3ZRSA 1GMGA 4ZKIA 1J95A 1WLEA 5FL7G 3E83A 5L3GA 4KP4A 1NQTA 1FXVA 1OHHG 2EIKC 3B8NA 3SYOA 1YJ9V 1YJNV 1ZWIC 4E2LA 3CCJV 1QR9A 1AI6A 2JDIG 2WWWA 5GW7A 1Q7YW 3JD1A 2EZPA 4L87A 4HAMA 4PA9A 3HB3B 1I5YA 3VOUA 4FIPC 3CMAV 2C2AA 2ZD9A 5DN6G 1N8RW 1OCRC 4CZZA 3M99B 4PA4A 4KFMA 3MHHC 4ZBMA 1AROP 2EIJB 4TSFG 3SYCA 2EILB 5LGNA 3OE7G 5LBQA 4R6ZA 1R3JC 2XASA 1M57B 4U7OA 4GT1A 2JK5C 1VQNV 3ABKB 3RVZA 1NBMG 3X2QC 5EC1C 3LNMB 1SETA 5IY5C 2Y48A 1OCZC 3QO7A 1KECA 5EBMC 1SESA 4UUJC 3ASOC 3BY6A 3OGCC 4GX5A 2IU0A 1PNLA 5IYCO 4XDKA 4OXSA 4MVQA 1MSWD 4PELA 2JEUA 4WFEA 4GX0A 2JIZG 5LHIA 5CN0A 4UVCA 4XDJA 5EK0A 5CMUA 4G28B 4N23A 2XAHA 5B1NA 2V7QG 3E86A 5BZBA 1DF4A 1JOYA 1OCOB 4PA3A 1LNQA 1ROPA 4RUFA 1RPOA 4MTFA 1R3IC 4MW8A 5KUMA 1P4RA 4BAYA 2GHYA 3ZMTA 3OM3B 3F5WC 4UV8A 3LSSA 4Q20A 3P32A 4X89A 1SRYA 2NLJC 5CBFA 3VBBA 1JVMA 1M56B 2DQ0A 5LHGA 3CCMV 1R3KC 1XL6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W2B U;  1KC8 W;  3I55 V;  3OW2 U;  1JJ2 U;  1VQ5 V;  3CC2 V;  1VQ6 V;  2OTJ V;  2OTL V;  1YI2 V;  1KQS U;  1VQO V;  2QEX V;  1K8A W;  4WFA V;  1M1K W;  4WFB V;  3CC7 V;  1R73 A;  1VQP V;  3CPW U;  4WCE V;  1YJ9 V;  1K9M W;  1VQM V;  3CCS V;  1Q82 W;  1VQ9 V;  1YJN V;  1QVF U;  1Q86 W;  3CME V;  3CCR V;  1YJW V;  1VQN V;  3CCE V;  3CCJ V;  1S72 V;  1YHQ V;  1QVG U;  1K73 W;  3CCV V;  1KD1 W;  2D3O W;  1YIJ V;  1Q7Y W;  3I56 V;  1VQL V;  3CC4 V;  1NJI W;  3CCU V;  1VQK V;  5DM6 V;  1Q81 W;  3CXC U;  1YIT V;  4WF9 V;  2QA4 V;  1VQ7 V;  1VQ4 V;  1VQ8 V;  3CMA V;  3CCM V;  3CCQ V;  3G6E V;  3G71 V;  1M90 W;  3CD6 V;  1N8R W;  3G4S V;  3CCL V; 
#chains in the Genus database with same CATH topology
 4JZ2 A;  3Q4H B;  2YID A;  3EHB B;  4F4L A;  1AI7 A;  3SJC C;  1BT8 A;  2ZIO A;  2E5L B;  2JGD B;  5LXT A;  3JAW B;  4I4T A;  4O4J A;  5EC2 C;  2UUC O;  2WLI B;  2EIK B;  5B5E Z;  5JH7 B;  3QTC A;  2A3Q A;  1AJP A;  3CD6 V;  4J9Y B;  3ZMU A;  1NTZ H;  3KCX A;  4JI1 O;  2YI8 A;  1FXH A;  2B9Z A;  3CB2 A;  1K8A W;  5IT9 N;  3MDS A;  3OEE G;  1GAX A;  4P30 A;  5KHH A;  3E35 A;  3UM7 A;  2ADQ B;  2JJ2 G;  3LUT B;  2DMX A;  4GZR B;  1BHA A;  3ZHQ A;  1MG1 A;  4H44 B;  2FKX A;  1AR1 B;  3RYI B;  2LJ2 A;  1OCZ B;  4LF9 O;  4NXN O;  1VQO V;  3K5O A;  3ASO B;  5HFM A;  3ZIA G;  1QCE A;  1Q86 W;  1BQ0 A;  2QWQ B;  3T4Z A;  4DV4 O;  5LL6 Y;  1ORQ C;  1EZJ A;  3C90 A;  2GSM B;  2LW1 A;  4FFK A;  4WFH A;  3QVN A;  2P4K A;  4O4L B;  1HNZ O;  4X62 O;  4K8X A;  2DYR B;  2FML A;  2LGQ A;  2ZDI C;  4O4I A;  2JRI A;  1VF6 A;  4TV9 B;  2E5L O;  1Y67 A;  1S5H C;  1Q3E A;  1K4C C;  3UO3 A;  1WB8 A;  2GV9 A;  1UPG A;  4L8J A;  5KAI Z;  1WPX A;  2HHH B;  3HKB A;  1I94 B;  5EZY A;  2X6C A;  4BW5 A;  4TQF A;  1Q6I A;  4DV5 B;  4EFE A;  2FYU H;  3OEH G;  2RJZ A;  2F4V B;  2DYS B;  4LFB B;  2EJR A;  4TV8 B;  4CH4 A;  2YC0 A;  3LDD A;  2M6Y A;  3MAQ A;  4XBF A;  4YXW G;  2LW7 A;  5B3S B;  3WB0 A;  4X1I B;  2ZNI A;  2UU9 O;  3JYC A;  1R3L C;  3T1C A;  4UCU A;  5H6Q A;  3AG4 B;  2D3O W;  4B3S O;  1YTF B;  2WLM A;  2DYR C;  1XOU A;  4QPK A;  3G80 A;  2AHZ A;  1V55 B;  1T5E A;  3KG2 A;  3ABT A;  1SQX H;  4GLX A;  4PI0 A;  4U3J B;  2ZE7 A;  3HR0 A;  4LFC B;  1TA8 A;  1KP3 A;  4X1K B;  3K0D A;  1I7F A;  3CME V;  2X0L A;  3B40 A;  2DYS C;  5JCO C;  3H1L H;  5CB4 B;  2YEV B;  3BAB A;  2A79 B;  2EBO A;  4UB6 Z;  2ITD C;  2IW5 A;  3MD0 A;  4QNH B;  2OTJ V;  5L3C A;  1FXK C;  1FFX B;  1R6K A;  3RT3 C;  5LA6 A;  3EXA A;  2IBZ H;  3D36 A;  4DV3 B;  4MVS A;  2RDC A;  1EN5 A;  4YJ3 B;  2HHH O;  1NT2 B;  1QBZ A;  2QWP B;  1I94 O;  3IC9 A;  5KHG A;  5B1B C;  1VQ7 V;  4DV5 O;  3BFR A;  3O9O A;  5BY1 A;  2HLD G;  3OTF A;  1RSO B;  3DC6 A;  4YHH B;  4LFB O;  1COW G;  1K33 A;  2G38 A;  5KA6 A;  5KX5 B;  3S3X A;  2ILM A;  3VQW A;  5J2T A;  1YHQ V;  1HNX B;  4FM0 A;  4FLX A;  3T2M A;  1S5J A;  3K57 A;  4YIP A;  5BMV B;  3SYP A;  3B77 A;  1M90 W;  1R6T A;  3ETG A;  5CA1 A;  2HR3 A;  4LFC O;  4MVR A;  1MA1 A;  4JAV A;  1WP7 A;  4CH3 A;  2OT5 A;  1V54 B;  5K1X A;  3W7T A;  3AG1 B;  1B3Q A;  1K4D C;  1I5X A;  2QKS A;  3RFR A;  2N04 A;  2PYL A;  3B4S A;  1VQ4 V;  1OZ0 A;  1QNM A;  1SF9 A;  5K1P A;  3P30 A;  1NS1 A;  1YDX A;  3ZRW B;  2OIE A;  5FNV B;  3B8M A;  1Q8I A;  1G1X B;  4FLY A;  3JAS B;  1Q90 D;  4DV3 O;  2XAG A;  4AHC A;  4PA6 A;  1ZTE A;  4RO2 A;  2BOC C;  5ITZ A;  4DV0 B;  4I0X B;  3B2E E;  3AG7 A;  4J7Z A;  1GN6 A;  1US6 A;  1BHB A;  4LR3 A;  4OX9 B;  1CXZ B;  1MOF A;  3STL C;  4FLU A;  3BEH A;  1P49 A;  2BTQ A;  3OW2 U;  4TUY A;  3HKC B;  1V54 C;  4IT5 A;  4K8Z A;  2CK3 G;  4JF3 A;  1W0J G;  3E22 A;  3W7S A;  4O2B A;  2ADP A;  4DO2 A;  3IGA C;  2Q4P A;  2E75 B;  1G4Y B;  3RYF B;  3U11 A;  1HNX O;  4I9W A;  2ETN A;  2KKW A;  1H38 A;  5GTH Z;  3CCQ V;  1TAE A;  4H33 A;  1R1B A;  5LGT A;  2YXY A;  3ABK C;  4BIZ A;  1PNK A;  2PTM A;  4WFB V;  4JYB A;  4MTX A;  2YXH A;  3OFN G;  1YEW A;  3N2K A;  2MK3 A;  1VAR A;  3TK1 A;  3A0B Z;  1FYJ A;  2QWO B;  3IAY A;  1CPY A;  2IJH A;  3VQV A;  3RW0 A;  1K7D A;  2H8P C;  3ZS8 C;  5EIB D;  2A0L A;  1WP8 A;  4EFB A;  2ZIM A;  1QVF U;  1DGS A;  4X9Q A;  4NR1 A;  3R65 A;  4MTG A;  2ZQM A;  3ABL B;  4JAU A;  2YIA A;  3FD9 A;  4CS2 A;  1M4U A;  1YSC A;  4DV0 O;  2OCC B;  3H1H H;  2CTR A;  1ENV A;  3ZRS A;  4OX9 O;  1PP9 H;  1N33 O;  3A8T A;  4ZKI A;  1J95 A;  2QKC A;  1QQC A;  1JR9 A;  1SQF A;  3B8N A;  4DR2 B;  1ZWI C;  4E2L A;  5IE9 A;  4CC5 A;  3CCJ V;  4B3T B;  1QR9 A;  1WB7 A;  2Q73 A;  4L87 A;  3HB3 B;  3C3S A;  4NTY A;  3VOU A;  2UUB O;  4FIP C;  5KMG B;  4CZZ A;  3UQ8 A;  4KFM A;  4I55 B;  4JI3 B;  4CC6 A;  3SYC A;  4R6Z A;  1Q5O A;  4O2A A;  1M57 B;  4JI6 B;  3Q4H A;  4U7O A;  3RVZ A;  2HJD A;  4LWS B;  4H0L B;  4D7T A;  2HEP A;  5EBM C;  3JAW A;  4I7Z B;  1JA8 A;  2YIC A;  4DV2 B;  2WA3 A;  4W4L A;  1PNL A;  5JH7 A;  5D5Q A;  1H2M A;  1XEQ A;  5LHI A;  4XDJ A;  5CMU A;  2V7Q G;  3E86 A;  2XUM A;  2UXC B;  2CGO A;  3OGI B;  1R3I C;  4MW8 A;  5JJJ B;  4UCV A;  1P4R A;  4BAY A;  1DK1 A;  1GN3 A;  2XT9 A;  3OM3 B;  4LF4 B;  4PI2 A;  4Q20 A;  3P32 A;  4IHJ A;  1M56 B;  3CCM V;  4BWA A;  4TOI A;  4PDV A;  1R3K C;  2CE4 A;  1GKF A;  2IM9 A;  1M57 C;  1S0V A;  1AJQ A;  3RYI A;  4JYY A;  4JPR A;  2P90 A;  2ITC C;  3HKD B;  5B66 Z;  3KZI Z;  1NR1 A;  3ICX A;  3UO2 A;  2NR5 A;  1H8H G;  4DR2 O;  2IU3 A;  2DQ3 A;  3CSX A;  3SYA A;  4B3T O;  2QDO A;  3L70 H;  1D5N A;  1KUQ A;  5FPR A;  4O4H B;  2YS8 A;  4FJC C;  1IZ3 A;  4DXW A;  4GX2 A;  1KC8 W;  3JCZ A;  2R9I A;  1GK9 A;  3ZRV A;  1Y66 A;  3JAR A;  2GTA A;  2HKO A;  4FLW A;  1EN6 A;  1H2S B;  4X64 B;  1K9M W;  1F4M A;  4JI3 O;  3ASN C;  1BQZ A;  3K9A A;  4DK1 A;  1N34 B;  4TV9 A;  4JI6 O;  4JTD B;  1K92 A;  3CCU V;  1YIT V;  4JTA B;  3X2Q B;  2X7R B;  2P7T C;  5EYP B;  4DV2 O;  4KHP B;  4UVB A;  1N0N A;  2LO1 A;  2R72 A;  3F7Y C;  4G27 B;  4TV8 A;  1F4N A;  2UXC O;  2UUC B;  4FK5 C;  4ICG A;  4I9Q A;  2HFE C;  5KA5 A;  1F7Y A;  3JAL A;  1IVS A;  2LP7 A;  2XND G;  2CTP A;  4LF4 O;  1ZLZ A;  3JAT B;  5J2U A;  5LMN B;  2DJV A;  1BS3 A;  3FB7 C;  1YTF D;  4RQE A;  5F2V O;  1PD3 A;  3JAK B;  3LSQ A;  3C3T A;  5E1A C;  4U3J A;  1FS0 G;  2CTW A;  2BE3 A;  2KG7 B;  3K5N A;  4FM1 A;  4X1K A;  5FPO A;  5KLV H;  3WFV A;  1ZX3 A;  4DR6 B;  1EBO A;  1SKV A;  4U7N A;  4WFG A;  2OYQ A;  1NVP D;  1EFR G;  5CB4 A;  2YEV A;  3KCY A;  2RN9 A;  3BRC A;  4B3M B;  3CJH B;  4JI8 B;  1VQ9 V;  4X64 O;  3K03 A;  4FVM A;  5JQG B;  3T4D A;  2Z0A A;  1N34 O;  5LMU B;  2CDY A;  4P9O A;  4YJ3 A;  3GWO A;  3JAM N;  4QIW F;  1F51 A;  4PJ0 Z;  2HVK C;  5LP6 B;  1TVK B;  5J9P C;  4KHP O;  1RSO A;  1NI8 A;  2WPD G;  1NTK H;  5KX5 A;  4CBC A;  1N32 B;  1JFF B;  1UFI A;  4IIJ A;  1D5A A;  3DGE A;  2AHY A;  5H6R A;  3E8F A;  4IYI A;  3F5T A;  2BSK A;  3K04 A;  1IXM A;  1ZL8 A;  4Z1M G;  1EM1 A;  5LMN O;  1XIL A;  1LUV A;  5BMV A;  4NXM B;  2UU9 B;  3FYI B;  3K58 A;  3TCU A;  2VWJ A;  3OTO B;  1KP2 A;  5IWA O;  2Z3Y A;  3ZJZ A;  3ZHV A;  4B3S B;  4LBE C;  1QLE C;  1NKD A;  1MZE A;  5JVD B;  5LP6 C;  3VQX A;  2JS5 A;  4DR6 O;  1DLB A;  5KUK A;  4PDL A;  1JJ2 U;  3TGU H;  1KB9 F;  1YZB A;  1WN7 A;  4PDM A;  1M1K W;  4JI0 B;  4A5U B;  4B3M O;  4KUM A;  1Q82 W;  3CYO A;  4JI8 O;  4LNU B;  4PV1 B;  2GDS A;  1FPO A;  4CS3 A;  1KKD A;  4R8C A;  1BE3 H;  3N2G A;  3JAS A;  5LMU O;  3WG7 C;  4Z2W A;  3ZX6 A;  4I0X A;  2AXT Z;  2ZXW C;  4FFB B;  2BOB C;  4JZG A;  2Q8V A;  4NB5 A;  2N05 A;  1ZSP A;  4GYC B;  1U96 A;  2YXL A;  2EJ7 A;  3OMN B;  2H3O A;  3D3I A;  5B1O A;  3AEI A;  2W0X A;  5GON B;  1Q81 W;  1SER A;  4B7K A;  1N32 O;  1FKA O;  2P67 A;  1A32 A;  3N27 A;  1L1F A;  3I55 V;  4P9P A;  3AK2 A;  3FB6 C;  3UT5 B;  5IJ0 A;  1EN4 A;  4X1Y B;  3CCS V;  4NXM O;  3SPH A;  1U97 A;  4BIU A;  4DK0 A;  1FXK B;  2ZR3 A;  2Q67 A;  3OTO O;  1LUW A;  1NR7 A;  3WU2 Z;  1TUB A;  3LSU A;  4OPA A;  4K3A A;  2LFR A;  3U0Z A;  3JD4 A;  5B1B B;  1L0N H;  4J9Z B;  4JAA A;  3DXR B;  2HVJ C;  1V9P A;  4JI0 O;  2JS3 A;  3LDE A;  4R7C A;  4AI8 A;  3ZRX A;  3CC4 V;  1VQK V;  2ZNJ A;  2V1D A;  1L8D A;  1YXB A;  3BAA A;  2EIL C;  1NH2 B;  5L3D A;  1SA0 A;  1THZ A;  5KHJ A;  1OCC B;  4FMT A;  2FL4 A;  5DEC A;  4QGP A;  3TXQ A;  4DUY B;  4I5S A;  3CCR V;  1NU1 H;  4TWK A;  4FM2 A;  2QE7 G;  1IXB A;  1PPJ H;  2Y0P A;  1B04 A;  4MVU A;  2B1I A;  1RFY A;  1XQ8 A;  4TQD A;  1JMK C;  3RN4 A;  4ZHQ B;  3RWR D;  4WFF A;  4DRX B;  5IJ9 B;  1VMG A;  1P84 F;  3E8H A;  4WCE V;  4KXR A;  4LFA O;  1OCR B;  2Q7E A;  1Q6H A;  3R66 A;  2XAJ A;  1QVG U;  2XAF A;  3CCV V;  3ETQ A;  1YIJ V;  1P7G A;  1OCC C;  4RQF A;  1VQ8 V;  3HKE B;  3OR7 C;  2LQT A;  2Q69 A;  3P3P A;  4LWS A;  2JGU A;  2ZT9 B;  4DW0 A;  4DV1 B;  4O4J B;  3E83 A;  2WA4 A;  1N4C A;  5L3G A;  1NQT A;  1YJN V;  3GVM A;  4EB6 B;  2Q0O C;  3FFQ A;  1XUQ A;  1NTM H;  3L9D A;  1Q7Y W;  3APQ A;  4HAM A;  4PA9 A;  1I5Y A;  3OT7 A;  1Q43 A;  4FLZ A;  2ZD9 A;  1OCR C;  3MHH C;  5C8Y B;  2QSA A;  4HNA B;  1AR5 A;  3OE7 G;  5LYJ B;  4J7J A;  4DV6 B;  5KHI A;  2JK5 C;  1VQN V;  3ABK B;  4DUY O;  1KYO F;  2OCH A;  5IY5 C;  5JWP A;  3HKD A;  3JSL A;  3H9V A;  3BY6 A;  3L72 H;  2ODM A;  1N33 B;  1KMI Z;  1NZ6 A;  5IYC O;  2A7W A;  4OXS A;  1H2N A;  3G67 A;  1MSW D;  3SJB C;  4O4H A;  4YIO A;  5EK0 A;  1Y6X A;  4N23 A;  1ZUQ A;  2XAH A;  5BZB A;  3LNN A;  1OCO B;  4RUF A;  4I50 B;  4J7K A;  1AP5 A;  2UUB B;  4O4I B;  4X89 A;  1SRY A;  2NLJ C;  5LHG A;  1XL6 A;  3MHS C;  3SJA C;  3H01 A;  1VF7 A;  4DV1 O;  4NTW A;  2WSS G;  5EYP A;  1WA8 A;  4FLV A;  4GX1 A;  2VQF B;  1SQV H;  1HNW B;  4RUE A;  1E1Q G;  1CEZ A;  3OD4 A;  1SZX A;  4ZOL A;  2GUZ B;  1W0K G;  3FB8 C;  4BIO A;  2JEX A;  3E89 A;  3OUF A;  1Y74 A;  4TT3 G;  1OCO C;  4CH6 A;  1XDC A;  3JAT A;  4DR3 B;  2PUS A;  4H13 B;  4JI4 O;  3JAK A;  4AIL C;  1VF6 C;  2CAZ C;  3RGB A;  3E2E A;  1BMF G;  4DV6 O;  4LCU C;  3T1Y B;  3CXC U;  2KG7 A;  3H1J H;  1B06 A;  3KKY A;  1E79 G;  2UXD B;  1GM9 A;  1FFT B;  2LGW A;  2NNU A;  4QE7 A;  3W7W A;  3CRM A;  5EBW C;  2ZCE A;  3RYH B;  5LGU A;  1MSD A;  4MT8 A;  3ZN1 A;  3CJH A;  2F95 B;  3FYE B;  3OR6 C;  1KD1 W;  4J42 A;  2VQE B;  1NJI W;  2H94 A;  5JQG A;  2PI5 A;  1Y4M A;  4LF6 B;  1GTO A;  3QNE A;  4NVP A;  1N0J A;  4QE9 A;  4ZI7 A;  5L3B A;  2PY5 A;  1XL4 A;  2QTS A;  3CPW U;  2HP8 A;  2IJI A;  5FLX N;  2F93 B;  2VQF O;  2PZS A;  1HNW O;  1TVK A;  2ZE6 A;  2F43 G;  2JGD A;  4PHZ A;  4FZ1 A;  3AK3 A;  2WLL B;  1D2D A;  2B1G A;  2EIM C;  3SGI A;  1WJZ A;  3AG3 C;  2WLI A;  3HPL C;  4YY3 O;  4N21 A;  1WNS A;  4MVM A;  5J2T B;  4X65 B;  4X66 B;  1I08 A;  1B6Q A;  4DR3 O;  2QM8 A;  3OMI B;  3D36 C;  2YIB A;  3QO5 A;  3UKM A;  2YIB D;  3ASN B;  2Q5Z A;  4JV5 B;  1KBH A;  2ZDI A;  4WF9 V;  1K5S A;  1CP9 A;  1URF A;  3FX7 A;  3T1Y O;  2IJK A;  4P2Z A;  2EZO A;  2JVD A;  1G8M A;  2UXD O;  1M9N A;  2YDE A;  4YJ2 B;  1R73 A;  2X6B A;  4J11 A;  1YJW V;  4LF8 B;  2Y69 B;  1BL8 A;  4DV7 B;  4LNU A;  2VQE O;  2QA4 V;  1SQB H;  1E1R G;  2VWK A;  1HW7 A;  4LF6 O;  1TUE B;  2EUL A;  4IYH A;  4X20 B;  4O4L A;  5ITZ B;  3JD3 A;  1VQM V;  1IX9 A;  4FFB A;  4QJF B;  4TUY B;  5DM6 V;  3SYQ A;  1SQQ H;  1QHT A;  3K3W A;  2DE0 X;  4O2B B;  5GON A;  1Z5W A;  4UV9 A;  2K1E A;  2Y69 C;  3VQY A;  1RP3 B;  4X65 O;  4X66 O;  3RYC B;  5L3F A;  1Y76 B;  5JCO A;  3OUS A;  3BPZ A;  2EIN C;  5C93 A;  3K5M A;  4U3F H;  1BGY H;  3ZMZ A;  1AI4 A;  2A9H A;  3UT5 A;  3OAA G;  4X1Y A;  1YF2 A;  4X1I A;  4UB8 Z;  1SS3 A;  3SPG A;  1N36 B;  4C7U A;  1FXK A;  3L73 H;  3NXS A;  2PF4 E;  4JV5 O;  3A0H Z;  3CEI A;  1RM1 C;  3K79 A;  2R9R B;  1OV9 A;  2W6I G;  1X59 A;  4HYO A;  3EFF K;  3K06 A;  5IWA B;  5LOV B;  2Q0A A;  2ZM6 O;  4LH6 A;  2CH7 B;  2IH3 C;  1OJH A;  1XI1 A;  5CBG A;  3UCS C;  4LF8 O;  3DXR A;  1BZK A;  1AR4 A;  5B1A C;  3ZHS A;  2E74 B;  4DV7 O;  1VP7 A;  2V4D A;  1TGO A;  3CS5 A;  4NKG B;  3TJT A;  3CC2 V;  1S3J A;  1AI5 A;  1NH2 D;  3J80 N;  5KHK A;  2QJ1 A;  4RAI A;  5HFL A;  3FB5 C;  1FFX A;  2IJJ A;  2B5U A;  2DWD C;  4KL1 A;  3APO A;  4BR6 A;  4DR5 B;  3G6E V;  4DR1 B;  1W2B U;  1XMO B;  2Q6A A;  2QM7 A;  5IYZ B;  3SPC A;  1QLE B;  2O57 A;  2KB1 A;  4K0K B;  2YSU B;  2QTO A;  5A9G A;  4LC1 A;  1L0L H;  1ZAU A;  1JCH A;  4ZHQ A;  4F6R B;  4DRX A;  3ZHR A;  5IJ9 A;  2ZE5 A;  1QR8 A;  2CUG A;  4MVZ A;  2EIJ C;  1IDS A;  4O2A B;  1N36 O;  2Q7H A;  4MSW C;  2N74 A;  3ZCC A;  3HKE A;  3WG7 B;  4LF7 B;  4PA7 A;  2E3C A;  1JPX A;  2ZKO A;  2ZXW B;  2AZ0 A;  2DW4 A;  2RNB A;  1DTO A;  3CP1 A;  2AW9 A;  4JGS A;  4NYK A;  2XHB A;  3W7U A;  5CBH A;  1AJN A;  1KU9 A;  4EB6 A;  2DWE C;  4PD4 F;  1K3E A;  3M7M X;  2P06 A;  4MVO A;  4UXN A;  4ABM A;  3H1I H;  1PNM A;  1PKX A;  4IHJ B;  3ZHT A;  5AG2 A;  5C8Y A;  4HNA A;  1HR0 B;  3GB7 C;  3ZRW A;  2OWO A;  1HDJ A;  5LYJ A;  2ZR2 A;  5FNV A;  4R50 A;  4JYC A;  1LR1 A;  1FAF A;  3G71 V;  2WAM A;  3SR2 C;  4DR5 O;  5FL7 G;  4DR1 O;  1XMO O;  4ZIB A;  4KP4 A;  1FXV A;  1OHH G;  2EIK C;  3SYO A;  1YJ9 V;  4K0K O;  4GKK B;  1IUR A;  2PYJ A;  1AI6 A;  3HKC A;  4UCT A;  3JD1 A;  4UCS A;  3BCC H;  4I50 A;  3JAR B;  3CMA V;  4DW1 A;  5DN6 G;  1N8R W;  4D6T H;  3M99 B;  4PA4 A;  3RYF A;  3JSN A;  2P5O A;  1SQG A;  4TSF G;  4LFA B;  2EIL B;  5LBQ A;  4Q6G A;  1R3J C;  4OGQ B;  3DSQ A;  4LF7 O;  4GT1 A;  1NBM G;  5EC1 C;  3LNM B;  1SET A;  2AGA A;  2Y48 A;  3I5D A;  1OCZ C;  3QO7 A;  5JJE B;  3ASO C;  3OGC C;  2GUZ A;  2EX3 A;  4MVQ A;  4PEL A;  2JEU A;  4WFE A;  4GX0 A;  3BA9 A;  2JIZ G;  2QR4 A;  1JOY A;  2QM4 A;  1DF4 A;  3JAL B;  4PA3 A;  1LNQ A;  1ROP A;  4J10 A;  1J5E B;  5J2U B;  3CE2 A;  4MTF A;  1FJG B;  3J7A U;  3FAV B;  4UV8 A;  1HR0 O;  3LSS A;  3CWB H;  5H2F Z;  4NTX A;  5CBF A;  1JVM A;  2VRZ A;  2OTL V;  2Q68 A;  2F23 A;  3CRA A;  2UXB B;  3CC7 V;  1AVM A;  1K34 A;  4GKK O;  1NVP B;  1QLN A;  5JJN B;  1RPR A;  3THO A;  3RYH A;  3A0R A;  3NR7 A;  1Z5V A;  5DED A;  5B3S C;  1H2K A;  5CA0 B;  1IBM B;  1GO3 F;  3L74 H;  1IBK B;  2K9P A;  4H37 A;  2P6J A;  3D3Q A;  3ZHU A;  3AG4 C;  3OMA B;  5KMG A;  1S77 D;  4WBN B;  1VF5 B;  1GN2 A;  1HWY A;  1VIB A;  2UXN A;  2VS0 A;  1V55 C;  4I55 A;  2CTQ A;  3B09 A;  3CRQ A;  3WB1 A;  3A2F A;  4JI7 B;  3IFX A;  3AK1 A;  5IY5 B;  5LXT B;  2F4V O;  5KAF Z;  2WLL A;  2UXX A;  1YI2 V;  4LF5 B;  4I4T B;  1AIL A;  1XBL A;  1XNR B;  4IIJ B;  3STZ C;  4GKJ B;  3WB2 A;  2BSK B;  3QG5 A;  1ZL8 B;  3ZN0 A;  1J5E O;  1FJG O;  2W6J G;  5E79 Z;  1QU7 A;  4LP8 A;  3BVO A;  2QEX V;  1PL4 A;  4JI4 B;  4JI5 B;  4DR7 B;  1PL0 A;  2IH1 C;  1MAB G;  5IYD O;  2UXB O;  2R9A A;  3LDC A;  4YJ2 A;  1JQ0 A;  1UJW B;  1G6U A;  3ZMS A;  3FKS G;  3SPJ A;  3ZMV A;  2WLN A;  2CGN A;  1WPB A;  2LFS A;  3J81 N;  2WLJ A;  4X8A A;  1MNG A;  3K0G A;  4QPJ A;  4B08 A;  1IBM O;  3D8C A;  2JJ1 G;  5L3E A;  4WFA V;  1IBK O;  3N2G B;  3PN1 A;  4JI2 B;  2R70 A;  3ETE A;  4X20 A;  1XRE A;  3TET A;  1O9G A;  2DN9 A;  1MMM A;  4JI7 O;  2W0F C;  4YHH O;  3HKB B;  5EZY B;  3AG1 C;  1VQP V;  1SC5 B;  3GWK C;  1XHZ A;  4LF5 O;  1YVW A;  2WLK A;  2QKA A;  4DUZ B;  3K9S A;  1XNR O;  4GKJ O;  1WAZ A;  1BCC H;  3ABM B;  3BHP A;  1FD9 A;  1Y76 A;  3RYC A;  1XHX A;  3ETD A;  4B3R B;  1Z2G A;  2RQ6 A;  3SJQ C;  5IJ0 B;  4UCR A;  4YY3 B;  1F23 A;  3G4S V;  2HG5 C;  3ABU A;  2XOK G;  4IL6 Z;  1X4T A;  3G6B A;  2AZ2 A;  3JD2 A;  4JI5 O;  4IGG A;  4E4E A;  4DR7 O;  1TUB B;  4ASU G;  2YI9 A;  2YUA A;  4G2K A;  2E76 B;  3H1K H;  4MTO A;  2KSD A;  3K08 A;  3U10 A;  5LOV A;  1SQP H;  5A2Q N;  4LH7 A;  2CH7 A;  3PJS K;  4F6E A;  3F7V C;  1I0H A;  1VQ6 V;  4JTC B;  1R6N A;  3QO8 A;  2EIM B;  2FTK A;  3ABM C;  3AG3 B;  4JAS A;  2L35 A;  4B7E A;  3SDL A;  3DC5 A;  4JI2 O;  2XAQ A;  3K5L A;  2NN4 A;  1SA0 B;  2GBO A;  5CA3 A;  5LA6 B;  4MW3 A;  3RBZ A;  2FB5 A;  2HJF C;  3K59 A;  2RMK B;  2F1M A;  1S76 D;  1HP8 A;  4CS4 A;  3EVK A;  5IYB O;  2F66 C;  2WLH A;  1XMQ B;  5IYZ A;  3CRR A;  3W7X A;  4GCZ A;  1S72 V;  3T1H B;  1K73 W;  2MW2 B;  5LP6 A;  2ATK C;  4DUZ O;  1IBL B;  4HBN A;  4F6R A;  2Z5U A;  3AG2 B;  1K97 A;  4B3R O;  1S5L Z;  2ARH A;  1YCI A;  1VQ5 V;  1JFF A;  1H8E G;  4D7S A;  5EBL C;  3E8G A;  4EKW A;  3ABL C;  2OCC C;  3BA8 A;  3CRC A;  3ML0 A;  4K35 A;  3I56 V;  1H2G A;  3JD0 A;  4AQY B;  4OPH A;  5CA1 B;  5IDJ A;  2A06 H;  4XDL A;  1GH6 A;  4PDR A;  2Y0I A;  5BR8 B;  3CCL V;  3O65 A;  3IJ4 A;  5JVD A;  5H9C A;  1DF5 A;  2UUA B;  3ZBH A;  3IC7 A;  2ZM6 B;  1GN4 A;  3AG2 C;  2KQX A;  1VQL V;  1SZT A;  2EIN B;  1XNQ B;  1GM8 A;  2Y4T A;  3L71 H;  3RVY A;  2ZIN A;  4FPP A;  2Q9L A;  5GTI Z;  1KQS U;  3L75 H;  1RM1 B;  3CCE V;  1XMQ O;  1PV0 A;  4X88 A;  1KKC A;  4DR4 B;  5LHH A;  1Q6U A;  2BTQ B;  4HZ3 A;  3T1H O;  3S3W A;  2PI4 A;  1JX9 A;  4UVA A;  1BSM A;  3M8A A;  4BW9 A;  2D2C B;  2M7W A;  1IBL O;  3E22 B;  1GRJ A;  2DOS A;  4JYA B;  5B1A B;  1PM9 A;  2PGG A;  2BTO A;  4DYL A;  4GUN A;  1JJO A;  3DTU B;  2L6L A;  4MS2 A;  2OIG A;  1M56 C;  2RCV A;  1P7B A;  1GM7 A;  4EEQ A;  1K5Q A;  1H2L A;  2Y4U A;  3E8B A;  2X6A A;  2XTA A;  4FZ0 A;  3SPI A;  1WA8 B;  4AQY O;  1GMG A;  1WLE A;  5BR8 O;  4ZOL B;  2QWR B;  1AB3 A;  3N2K B;  1MZF A;  2GTS A;  1M5I A;  5D5P A;  2UUA O;  1W59 A;  2JDI G;  2WWW A;  2P22 C;  1Y74 B;  5GW7 A;  4W4K A;  1EZV H;  3P3N A;  2EZP A;  1VEW A;  2C2A A;  1XNQ O;  4FLT A;  4JI1 B;  3FAV A;  2ZE8 A;  5BXZ A;  4J80 A;  4ZBM A;  1ARO P;  2EIJ B;  5LGN A;  2XAS A;  1AP6 A;  3CHX A;  2P4V A;  4J41 A;  2QWN B;  3X2Q C;  4UFZ A;  1O9H A;  1KEC A;  4DR4 O;  1SES A;  4UUJ C;  3TXS A;  2Q7G A;  4GX5 A;  2IU0 A;  4LF9 B;  4NXN B;  4XDK A;  3CX5 F;  3CXH F;  3QF7 A;  3JCU Z;  5CN0 A;  4JYA O;  4UVC A;  2QGN A;  4G28 B;  5B1N A;  5CA0 A;  4DV4 B;  1RPO A;  5KUM A;  3ZED A;  4RWU A;  5EIB C;  4Z1V A;  2GHY A;  3ZMT A;  2BCC H;  3F5W C;  4WBN A;  5TIS Z;  1HNZ B;  5H5N A;  4X62 B;  4ZI7 B;  4CH5 A;  1M93 A;  3VBB A;  2DQ0 A;  4UCO A; 
#chains in the Genus database with same CATH homology
 1GKF A;  3MHS C;  1M57 C;  3H01 A;  3EHB B;  4F4L A;  1AI7 A;  2OTL V;  1S0V A;  1AJQ A;  2Q68 A;  4JPR A;  3CC7 V;  1K34 A;  2P90 A;  2WSS G;  2ITC C;  4GX1 A;  1NR1 A;  1H8H G;  2IU3 A;  2DQ3 A;  1E1Q G;  4RUE A;  1CEZ A;  1NVP B;  5EC2 C;  3SYA A;  1QLN A;  2WLI B;  1RPR A;  2EIK B;  1W0K G;  3A0R A;  3FB8 C;  4FJC C;  2JEX A;  5B3S C;  3E89 A;  4DXW A;  1AJP A;  3OUF A;  4GX2 A;  1GO3 F;  3CD6 V;  4J9Y B;  4TT3 G;  1OCO C;  3ZMU A;  3JCZ A;  2R9I A;  1KC8 W;  1GK9 A;  4H37 A;  2P6J A;  3ZRV A;  1Y66 A;  1FXH A;  1K8A W;  3AG4 C;  2HKO A;  3OMA B;  1S77 D;  1K9M W;  1F4M A;  3ASN C;  1HWY A;  2UXN A;  3K9A A;  3OEE G;  1V55 C;  3E2E A;  4P30 A;  1BMF G;  4LCU C;  3E35 A;  4JTD B;  1K92 A;  3UM7 A;  2JJ2 G;  3LUT B;  3CCU V;  3CXC U;  1BHA A;  1YIT V;  1MG1 A;  4JTA B;  3X2Q B;  2X7R B;  1AR1 B;  2P7T C;  1E79 G;  3IFX A;  5IY5 B;  1GM9 A;  1OCZ B;  1FFT B;  2WLL A;  2UXX A;  1YI2 V;  4UVB A;  1VQO V;  2NNU A;  3ASO B;  4QE7 A;  3W7W A;  3F7Y C;  5EBW C;  5HFM A;  3ZIA G;  4G27 B;  1QCE A;  5LGU A;  1Q86 W;  1F4N A;  3STZ C;  4MT8 A;  3ZN1 A;  3T4Z A;  4FK5 C;  3FYE B;  3OR6 C;  1KD1 W;  3ZN0 A;  2HFE C;  5KA5 A;  1ORQ C;  1NJI W;  2W6J G;  2H94 A;  2LP7 A;  1EZJ A;  2PI5 A;  2XND G;  2GSM B;  4LP8 A;  1Y4M A;  4WFH A;  1GTO A;  3FB7 C;  1YTF D;  2DYR B;  3QNE A;  4RQE A;  1PD3 A;  2ZDI C;  4QE9 A;  2QEX V;  5L3B A;  3LSQ A;  1XL4 A;  3CPW U;  1PL0 A;  2IH1 C;  1MAB G;  5IYD O;  1S5H C;  5E1A C;  2IJI A;  1FS0 G;  1K4C C;  3LDC A;  1WPX A;  1JQ0 A;  1UJW B;  3ZMS A;  3FKS G;  2F43 G;  2X6C A;  4BW5 A;  3SPJ A;  3WFV A;  2WLL B;  3ZMV A;  2WLN A;  1EBO A;  2B1G A;  2EIM C;  4U7N A;  3OEH G;  4WFG A;  2LFS A;  2DYS B;  3AG3 C;  1NVP D;  1EFR G;  2WLJ A;  2EJR A;  2WLI A;  3HPL C;  4X8A A;  2YEV A;  3K0G A;  4N21 A;  3LDD A;  4QPJ A;  4MVM A;  4XBF A;  2JJ1 G;  5L3E A;  4YXW G;  4WFA V;  5B3S B;  1B6Q A;  1VQ9 V;  3K03 A;  2QM8 A;  3JYC A;  1R3L C;  3OMI B;  3T1C A;  5H6Q A;  3T4D A;  3ETE A;  3AG4 B;  2D3O W;  3QO5 A;  3UKM A;  3TET A;  1YTF B;  2WLM A;  2DYR C;  4QPK A;  3ASN B;  4P9O A;  2ZDI A;  4WF9 V;  1K5S A;  1CP9 A;  2AHZ A;  1V55 B;  3KG2 A;  3ABT A;  3GWO A;  2IJK A;  4P2Z A;  4QIW F;  1F51 A;  2EZO A;  2HVK C;  2W0F C;  1G8M A;  1KP3 A;  1M9N A;  1R73 A;  3AG1 C;  5J9P C;  1VQP V;  2X6B A;  3K0D A;  2WLK A;  3CME V;  1YJW V;  2WPD G;  2Y69 B;  2X0L A;  2DYS C;  3ABM B;  1BL8 A;  4CBC A;  2YEV B;  3ETD A;  2A79 B;  3DGE A;  2AHY A;  5H6R A;  2QA4 V;  3E8F A;  3SJQ C;  2EBO A;  2ITD C;  1E1R G;  3K04 A;  1F23 A;  1IXM A;  4Z1M G;  2IW5 A;  3G4S V;  2HG5 C;  3ABU A;  3MD0 A;  4QNH B;  2OTJ V;  5L3C A;  2XOK G;  1FXK C;  1TUE B;  1R6K A;  3D36 A;  3JD3 A;  1VQM V;  3FYI B;  3JD2 A;  4MVS A;  3TCU A;  1KP2 A;  2Z3Y A;  3ZJZ A;  4ASU G;  4G2K A;  4QJF B;  4LBE C;  4MTO A;  1QBZ A;  5DM6 V;  3K08 A;  3SYQ A;  1QLE C;  1NKD A;  5B1B C;  1VQ7 V;  3PJS K;  3F7V C;  3K3W A;  1DLB A;  5KUK A;  4PDL A;  1JJ2 U;  2HLD G;  4UV9 A;  1VQ6 V;  4JTC B;  1R6N A;  1COW G;  1K33 A;  4PDM A;  3QO8 A;  2EIM B;  1M1K W;  2K1E A;  5KA6 A;  2Y69 C;  2FTK A;  3ABM C;  4KUM A;  5L3F A;  3AG3 B;  1Q82 W;  3OUS A;  3CYO A;  2EIN C;  5C93 A;  4JAS A;  3ZMZ A;  1AI4 A;  1YHQ V;  2A9H A;  2XAQ A;  3OAA G;  1KKD A;  4R8C A;  3SPG A;  3T2M A;  5CA3 A;  1FXK A;  3WG7 C;  3SYP A;  3NXS A;  3B77 A;  4MW3 A;  1M90 W;  3ETG A;  3RBZ A;  2HJF C;  1RM1 C;  2ZXW C;  1S76 D;  2BOB C;  3K79 A;  2R9R B;  2HR3 A;  2W6I G;  4HYO A;  3EFF K;  4MVR A;  5IYB O;  4JAV A;  3K06 A;  2WLH A;  3OMN B;  2OT5 A;  3W7X A;  4GCZ A;  1S72 V;  1V54 B;  3D3I A;  1K73 W;  5B1O A;  2IH3 C;  5CBG A;  2ATK C;  3AEI A;  3W7T A;  3AG1 B;  1K4D C;  1Q81 W;  5B1A C;  1I5X A;  2QKS A;  1SER A;  2Z5U A;  3AG2 B;  1VQ4 V;  2P67 A;  1OZ0 A;  1K97 A;  1L1F A;  3CC2 V;  3I55 V;  1VQ5 V;  3P30 A;  4P9P A;  1S3J A;  1H8E G;  3FB6 C;  3ZRW B;  1AI5 A;  1NH2 D;  5EBL C;  3E8G A;  4EKW A;  3ABL C;  3CCS V;  3B8M A;  4RAI A;  3SPH A;  5HFL A;  4BIU A;  2OCC C;  2XAG A;  3FB5 C;  1FXK B;  3ML0 A;  4PA6 A;  2ZR3 A;  4RO2 A;  2IJJ A;  2B5U A;  2Q67 A;  2BOC C;  1NR7 A;  3I56 V;  2DWD C;  1H2G A;  3JD0 A;  5IDJ A;  1BHB A;  4XDL A;  3G6E V;  1MOF A;  4PDR A;  3STL C;  3BEH A;  3CCL V;  1W2B U;  2Q6A A;  3OW2 U;  2QM7 A;  2LFR A;  3SPC A;  1QLE B;  1V54 C;  2KB1 A;  2YSU B;  2QTO A;  3JD4 A;  5B1B B;  2CK3 G;  4JF3 A;  4PDV A;  4J9Z B;  1DF5 A;  4LC1 A;  1W0J G;  5H9C A;  2HVJ C;  3W7S A;  1JCH A;  4DO2 A;  3IC7 A;  3LDE A;  3AG2 C;  3IGA C;  4R7C A;  3ZRX A;  3CC4 V;  1VQL V;  1VQK V;  1QR8 A;  2V1D A;  1G4Y B;  1SZT A;  2EIN B;  4I9W A;  4MVZ A;  1GM8 A;  3RVY A;  2EIJ C;  1H38 A;  2EIL C;  1NH2 B;  5L3D A;  3CCQ V;  4H33 A;  1THZ A;  4FPP A;  5LGT A;  3ABK C;  1OCC B;  1KQS U;  4MSW C;  4BIZ A;  3ZCC A;  1PNK A;  4FMT A;  4WFB V;  3WG7 B;  4JYB A;  4PA7 A;  4MTX A;  3OFN G;  1JPX A;  1RM1 B;  2ZXW B;  4I5S A;  3CCR V;  3CCE V;  2DW4 A;  1DTO A;  3CP1 A;  4TWK A;  4X88 A;  4JGS A;  2MK3 A;  5LHH A;  2QE7 G;  4HZ3 A;  3TK1 A;  3W7U A;  5CBH A;  1AJN A;  4MVU A;  2PI4 A;  1JX9 A;  2B1I A;  4UVA A;  1CPY A;  2DWE C;  2IJH A;  2M7W A;  1K3E A;  4MVO A;  4UXN A;  3RW0 A;  4WFF A;  1K7D A;  5B1A B;  2H8P C;  3E8H A;  2A0L A;  4WCE V;  1OCR B;  1QVF U;  1PNM A;  3DTU B;  1PKX A;  4MS2 A;  2XAJ A;  1M56 C;  1QVG U;  3R65 A;  2XAF A;  1P7B A;  2ZQM A;  3GB7 C;  4MTG A;  3ZRW A;  3CCV V;  1YIJ V;  1GM7 A;  3ABL B;  2ZR2 A;  1K5Q A;  4JAU A;  4R50 A;  1YSC A;  3E8B A;  1OCC C;  2X6A A;  4JYC A;  2OCC B;  4RQF A;  1VQ8 V;  3OR7 C;  3G71 V;  2WAM A;  3SPI A;  2Q69 A;  1ENV A;  3ZRS A;  1GMG A;  4ZKI A;  1J95 A;  1WLE A;  5FL7 G;  3E83 A;  5L3G A;  4KP4 A;  1NQT A;  1FXV A;  1OHH G;  2EIK C;  3B8N A;  3SYO A;  1YJ9 V;  1YJN V;  1ZWI C;  4E2L A;  3CCJ V;  1QR9 A;  1AI6 A;  2JDI G;  2WWW A;  5GW7 A;  1Q7Y W;  3JD1 A;  2EZP A;  4L87 A;  4HAM A;  4PA9 A;  3HB3 B;  1I5Y A;  3VOU A;  4FIP C;  3CMA V;  2C2A A;  2ZD9 A;  5DN6 G;  1N8R W;  1OCR C;  4CZZ A;  3M99 B;  4PA4 A;  4KFM A;  3MHH C;  4ZBM A;  1ARO P;  2EIJ B;  4TSF G;  3SYC A;  2EIL B;  5LGN A;  3OE7 G;  5LBQ A;  4R6Z A;  1R3J C;  2XAS A;  1M57 B;  4U7O A;  4GT1 A;  2JK5 C;  1VQN V;  3ABK B;  3RVZ A;  1NBM G;  3X2Q C;  5EC1 C;  3LNM B;  1SET A;  5IY5 C;  2Y48 A;  1OCZ C;  3QO7 A;  1KEC A;  5EBM C;  1SES A;  4UUJ C;  3ASO C;  3BY6 A;  3OGC C;  4GX5 A;  2IU0 A;  1PNL A;  5IYC O;  4XDK A;  4OXS A;  4MVQ A;  1MSW D;  4PEL A;  2JEU A;  4WFE A;  4GX0 A;  2JIZ G;  5LHI A;  5CN0 A;  4UVC A;  4XDJ A;  5EK0 A;  5CMU A;  4G28 B;  4N23 A;  2XAH A;  5B1N A;  2V7Q G;  3E86 A;  5BZB A;  1DF4 A;  1JOY A;  1OCO B;  4PA3 A;  1LNQ A;  1ROP A;  4RUF A;  1RPO A;  4MTF A;  1R3I C;  4MW8 A;  5KUM A;  1P4R A;  4BAY A;  2GHY A;  3ZMT A;  3OM3 B;  3F5W C;  4UV8 A;  3LSS A;  4Q20 A;  3P32 A;  4X89 A;  1SRY A;  2NLJ C;  5CBF A;  3VBB A;  1JVM A;  1M56 B;  2DQ0 A;  5LHG A;  3CCM V;  1R3K C;  1XL6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...