3CXDH

Crystal structure of anti-osteopontin antibody 23c3 in complex with its epitope peptide
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
216
structure length
216
Chain Sequence
b'EVQLVESGGGLVQPKGSLKISCAASGFTFNIYAMNWVRQAPGKGLEWVARIRSQSNNYTTYYADSVKDRFTISRDDSQSMLYLQMNNLKTEDTAMYYCVRQMGDYWGQGTTLTVSSAVKTPPSVYPLAPGGGAISNSMVTLGCLVNGYFPEPVTVTWNAGSLGSGVHTFPAVLQSDLYTLSSSVTVPVSTWPSEAVTCNVAHPASATSVDKAISPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of recognition of human osteopontin by 23C3, a potential therapeutic antibody for treatment of rheumatoid arthritis
pubmed doi rcsb
molecule keywords Fab fragment of anti-osteopontin antibody 23C3, Light chain
molecule tags Immune system
total genus 46
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2008-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cxdH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cxdH01
1D5XA 1KGCE 1NKRA 5EBGA 1MJ8L 4HIJA 3M17A 4FN0A 3DETD 4C56D 3TM6A 4GW5A 3U83A 2VNCA 4PREB 4JGJA 3STZB 3QCUL 4LVOB 1VFMA 1GZQB 1J5OH 3SJVE 3ZDYF 3KHQA 1FNAA 5DD1H 4MJIE 3VH8B 1C5CH 2HRPH 3FAXA 3SE8L 2XWJB 5C0JA 2ADIB 3LQAL 4X9IA 4L29B 2KDGA 3ARBC 4X6DF 5BMFL 3NCCB 3UDWC 1EV2E 5I1GL 2QJDA 5E2WH 5BRZA 3S3SA 4M9OA 5DRXA 4H1LH 3RVXD 4DUWA 4PV8B 4NZRH 1RUQL 1LO5B 3SDDD 4NQEA 3U7WH 5HPOA 1C12B 3QDJE 5ADPH 1RZJC 3OAYK 4M03A 4KMLB 4KV5F 3PDOB 4J7RA 3Q5YA 1K3ZA 2VISA 3EOBA 3MLPA 3VWJC 4AJ0A 3FT3B 4P46B 3QEGH 2JJWA 1G1CA 3JV4B 3QIBD 5E8DH 3QPXH 4DKFL 3SPVA 4OGXH 3MFFB 5C07D 3L6FA 1M7IA 1YEGL 4JLRA 1CFQB 1PFCA 2H2SC 1QQDB 4MA7L 3EOTL 3INUH 1UXSA 4NO5A 5FGBC 3P0YH 4GRLD 1LHZA 1MCNA 1RK1A 3ECBB 3QZWA 5HY9B 3OJVC 4CVZA 4ZPVB 3SHSA 3VD5A 2I9TB 2PXYB 1RI8A 4XWOC 4JFDE 5ALCL 4TSCH 3PG2A 3VGDA 3O6KL 1KTLB 2WQ8A 2NY5L 2D4DA 3H9SD 3C60C 3U4EB 2DJ4A 3SEPA 2H45A 3TO4B 3PGDA 4RZCA 3SGKC 5JHDD 4YHOL 3MA9H 5T3XH 1S9XB 1FSKC 3VH8A 1FDLH 3OKOA 4ORGB 4Y4HA 2W59A 5F96H 1IC7H 1JHKL 4S2SB 4DTGH 5IHBA 1YJDC 3QWRD 3I3EA 2FEDC 2ADIA 4N90D 3V7AG 1LK2B 1PKQB 1A2YA 2BNQB 4Z7OE 3DV4B 2MCPH 3RKDC 4CBPA 1N7ML 4L29A 2XPGB 4YDLB 2MOVA 1GZPB 3BZFB 2E7CA 4S1QH 5FYJD 1Q1JH 3GMNA 3TO2B 1IMHC 2BY0A 2XZCL 5DC4B 1UJ3C 2P5WB 4PV8A 5DMIH 2PW1B 1LO5A 5JXED 2GY5A 4XP5H 3GSOB 1QRND 5F7LB 3NBNA 4UNTA 2DKSA 1A0QH 4FQCL 5TQ0H 3GI8L 2J6EH 5DRNB 2OTWB 3PDOA 2LVCA 3BEWA 4XCCH 4KKBD 4PRIE 5JOPE 5L0QC 5E1AB 4P46A 4HIEB 3JV4A 1WC7B 2CKNA 5KVGL 3CH1B 1ZHLA 1BGXL 5DJCB 1XGUA 5HHMB 1D6VL 4O51B 3RTQD 5CUSL 3G6DL 3WO3B 1P7HL 4FXLA 4M1GH 3HFML 2BDNL 3TT3L 5T5NF 1MCEA 2WWMD 1DBBL 4LP4A 4OZGB 2E7MA 1A14L 3ARFB 1T7VA 3QDMB 3QEHB 4PP1C 4KZEL 5HY9A 4QHNB 1ZLWK 3GHBL 2OR9H 3H7LA 4Z8FL 2AJVH 1TVHB 4IRJC 4BZ2L 2G5RA 2I9TA 4U0RC 1SY6H 3IXTB 2GJ6D 2IC2A 3L7FA 2PW2B 4KKAD 4ZUSB 5ISZB 4Z7QE 5DMJB 4PRAB 1BIIB 4EUPB 1PX3A 2BRRL 4S1SH 4QXTA 4U1SB 4ZQKB 1JI1A 5DEZA 4X0KB 5C8JA 3U4EA 1LGVA 3MLWH 5I19L 1AD9A 5E08H 4JDTL 4WCYL 5I1IH 3TO4A 1F8TL 1P69B 5HGDB 1N2RB 3NIFF 5EZIH 2NX5E 3QH3B 1S9XA 4DAGL 5IF0B 1CGSH 1DUZA 3LY6A 4F8TA 5FYLL 1I1CA 2BNQA 1JGDA 4FQ2L 2HT2D 4K7FB 3CCHA 3M45A 3BZFA 1GZPA 2Z92B 3QWOB 4JFZH 2DQHL 1NGZB 4ODTH 3VXRD 5KJRL 1JWSA 3TO2A 4BZ1L 5KN5B 2X4SA 1LO2L 1QFHA 4JQVA 3D48R 5E6ZA 4HWNA 1JPST 2DRUA 1FLRL 1ORSA 1H3GA 2P5WA 2QHRL 3F8UB 4KHTH 3ULVL 2EE3A 2QQQA 1G84A 1TJHH 3MRHB 5D1XB 5DUBB 3WDIA 1NGPH 4KZDH 3KPQB 3B6SB 4YDIH 3WD5H 3QI9C 2R39A 5CJ8A 4M4PA 3IFLH 5DRNA 2IANB 1IVLA 1KB9K 1I9JH 2VZOA 5TFSH 5IK3B 5ABDE 3LEYH 4ONGH 3UPRB 1CE6B 1I9RH 3OGOE 3CH1A 4PJIB 3DSFH 1DE4B 3BFOA 5GSRA 1CDJA 3IKCB 4HJ0C 4O51A 1UQSB 1OQXA 2HWZL 4ZAKD 2CUIA 4OD2B 4PJCF 4OZHF 3SOBH 3U0WL 4BK4A 5CSZB 3QDMA 1SVCP 4QHNA 3ARDD 1YDPB 1HEZA 3MRDB 1UENA 4B41A 2WM0A 1FYHB 2YMXL 3IXTA 3BZEA 2PW2A 5IBTH 3G6JB 1QFWI 4ZUSA 5ISZA 3D3VD 2HJLB 4ZUVA 1DBKL 1P4IH 4U1SA 4X6CE 2F54B 4ZQKA 5IP4A 3ILPB 5TDPB 4HEPG 43CAB 2JJTA 5SX4H 3IS0X 4MQTB 4TOYH 3QCVL 5HGDA 1N2RA 3PWJA 2R4SH 4X6BB 1NBVH 3LQZA 4KK8D 1BX2B 2D7MA 4UU9B 4LSVH 3W0WA 4P2RB 4Q9RH 5DI8B 3CVIH 4WO4C 1RIUL 3ZZ1A 1SEQL 3ZKMC 4K7FA 2J5LC 4AEHL 1HXMA 3QWOA 2EYRB 1NGZA 3WFZA 5KN5A 5LG1A 3H42L 4X4ZA 3BHBA 1C5BL 5I1CL 1OAYL 3TVMA 3LQAC 3T4YB 2R56L 3TJEH 5D1XA 3MRHA 5DUBA 4ZXBB 1LQSR 3KPQA 5E4EB 5EG6C 3B6SA 4U7MA 2GKIA 5ACZA 3ME0A 2JKXA 4N8PA 2YK1L 5SWQB 1UWEL 4FTVB 3SO5A 2B0SH 2IANA 1EO7A 2C3GA 4KJQD 2FX7L 4P4KC 3S4SG 4X4YB 2BSRB 3TPKA 5C0AE 3PWPA 3RJDA 3IT8D 5L2KD 1Q0YH 1NCDH 2AK4E 3QUZA 2YXMA 4PJ5E 3IKCA 3O3DB 15C8L 1UQSA 2HTKD 5BO1L 5LVEA 3QDGD 1M7XA 2R0KL 1CLYL 3HZMB 2NW2B 4OD2A 4PLJD 5FYKL 1VADB 2X4TB 5CSZA 1F3RB 1OTSD 1WICA 1NAMH 4YHZH 1YDPA 3U1SH 5D93B 2ZCKH 2XRAH 5HXMA 2Y06H 4JRXE 3W11C 3Q2CA 1NFKA 4L4JA 1MRCH 3WXWL 3C5SB 1Z6JT 1FE8L 2F54A 4KI5F 2IQ9H 3FFCE 3ILPA 1MCKA 3TBSB 1F58L 1T0NB 4TSAH 2C7UB 1JYWA 1JN6A 3QFJA 5F21B 2OP4H 2AJSH 3UJJL 2VLMD 3MRKA 4KUCF 2P45B 1F45A 1BX2A 4Q9QL 1CLZH 5JW3L 1XF2B 4KI5D 2OI9B 5DI8A 4IHOB 4GAYB 1UZ6E 1T03L 2EYRA 3UPCA 4HUWB 3BAEL 1CFNB 1N8ZA 5I16B 1L0XA 2BXZA 4M6OL 4NN6C 3KXFA 4KUCD 3EIFA 5GRJL 4PJBF 2X70B 4HFWB 4TRPH 3T4YA 2B20A 4ZXBA 1WTGT 5LXGL 2EH7H 5F9JB 4G7VL 3VFUB 2H2PC 4FTVA 1XR8B 3EJJX 4RGMC 4EI6A 2EIBA 4HMEA 4X4YA 2BSRA 2J8UE 2WV3A 1P9MA 1YEHL 3VD3A 4F37K 4NT6A 5KVDH 5DD5L 3O3DA 1S7WA 3QR2A 5M94B 3CX5K 3NOIA 2FD6H 4GXVL 3DMMD 3EDEA 2IGFL 3OWEA 4OLEA 3EDKA 5HGHA 2DIAA 1KIPB 2DLHA 1F4XL 1N3NA 2X4TA 1MCRA 3RJQB 4EBQH 3MR9B 2AJZB 5DT1H 4ZPTB 2XFXB 5LAXA 1EMTL 1EAPB 3RGVD 4EOWL 1V3MA 1RK0B 4ONFL 1DEEB 2R2EB 3QEUB 1JNNL 2LU4A 5CHNB 3VXUE 4ELKB 2YPVL 4YFDB 2KQNA 1LDPH 4DWHA 1JL8A 4WW2B 3TBSA 2VXSH 4HLJA 1T0NA 1JMZA 2C7UA 2HAZA 3RU8H 2IBZX 3QEQE 2NXYC 3RPIB 1G0YR 1HWHB 2JB5H 3BPCB 5C08A 2F19H 1XF2A 3DRTB 4GQ9L 1UWXK 3RRQA 1QLEL 2DJSA 5TPWH 3VFGH 1BZ7B 1KJMB 3TN0B 2NZ9D 4HUWA 1OP9A 1CFNA 4G6KL 2OL3B 2OK0L 4XP9H 4RBPH 5B3NA 1NJ9B 2X70A 1KPUB 3N9GH 4NZTH 3WIIL 1MEXH 4PGEA 1GHFH 1UGNA 5F9JA 1P4LB 1CFVH 4WWKA 2IBGA 3D9AH 4OGXL 4JHBA 5JLZA 4I9WD 2D3VA 3H6JA 1XR8A 2AEQL 3N50A 4JPVH 2A6KB 1R3IL 2XA8H 1FYTA 3CAFA 1KLFA 5BVJB 5DSCB 2MKWA 5FB8B 5C0NC 4LDEB 3VH8G 2N4IA 1C1EL 3O2WL 4CN1A 5CSGA 2E9WA 1I8KB 2NLJA 3SGJC 4GQPH 2DKUA 5DC0A 3FTGA 1TNNA 2BC4B 3EYOA 1CXKA 1WBYB 2ARJB 4X8JA 3MR9A 2XFXA 4JM4H 5FKPA 4FMFA 4NGHL 1OWRM 3VXTA 4F80A 3BQUB 3LKNB 4PJEE 3DO7B 2GJZB 4FZ8L 3QEUA 3QIUD 1B4RA 2Y07H 3VWKB 1LO3H 1XF4B 4X9GA 3IFNL 4ELKA 1RIVH 3MA9L 3HE6D 3IDNA 4QT5B 4PJ8B 1NCBH 5BS0B 4WW2A 5F96L 1IC7L 3WCYA 3ARRA 1REIA 4G8GD 3WJJA 1ETZB 2HMID 3V52L 1GL4B 4GG8B 4YXHL 4A6YL 3RPIA 1RJZB 2F58L 4S1QL 3SDAB 3BPCA 1TITA 4R4BA 5AUMB 2X1PA 3FONB 1Q9KB 3K8MA 2GTWB 1L7TL 3NFSH 3NH7L 3TGXA 1KULA 5SWSA 3EJYD 2ZUSA 1OB1B 3SGDI 5JUEL 2DYPB 3K1DA 1CLCA 1RJYB 3IDXL 2NW3B 4OIBA 5JR1H 4OF6A 3G08A 5K93A 5TQ0L 4JGMA 2OL3A 3MRGA 3LMJH 2J6EL 3KPTA 4XTRC 4KMTH 3D18A 1UM4L 1JPSH 1KPUA 1FNLA 3SDYL 1QSFB 1SMAA 2GY7B 1DN2A 4YDKL 1K85A 4QRPE 1P4LA 4R96B 4IOIA 3L3KA 1FGNL 1P5UA 4BH8B 4XB8A 1VB9A 5JIKA 4UNVA 3N0PB 1EBPA 3TBWB 2A6KA 3ZHDA 2VABB 2X4OA 3HNSL 3MXWL 5FB8A 1UKSA 3MV7E 2NY3B 5E2VH 2AJVL 1SHMA 5J12C 2VLRE 1QYGL 1WEJH 2JLLA 3PQYA 3KJ4C 4I2XA 2BC4A 2X4UB 1JV5B 1WBYA 2ARJA 1T21B 4S1SL 1T1YB 5IW1B 1RPQA 2VWEE 5MENB 5IIEB 1NCCH 4B7LA 2E8YA 1CL7H 1S7QA 1X44A 2YS4A 1Y6NR 2GJZA 2W9DL 5FGRA 2Y7QA 4S1DD 3U2SA 1EJOL 5JA8B 3FQRB 3VWKA 5EZIL 1YEEH 3IDIB 5SV3A 4YE4H 4KROD 4KY1H 3FN0H 1E4KC 3FFDB 1WIPA 1QEWA 5BS0A 1EUTA 5DS8B 1KGCD 4MLSA 3CFKB 4PJAF 4U05A 1JGEB 4Q6IB 12E8L 1ETZA 1RJZA 1U3JA 2FYYA 1FJ1B 3CXHK 4NQTA 1C8PA 3SDAA 1KIRA 2R0ZH 5GGVH 5AUMA 3SJVD 3V6OC 3FONA 5DA0B 1Q9KA 2CK0H 2GTWA 4MJID 5IEKA 1JGUH 3H7BB 5I1EH 4TQEH 3F7PC 4S1RH 1T6VN 1OB1A 3UTSE 1EGJH 3V6OE 2DYPA 4F7TB 1RUML 4PJHA 4KHTL 3SE3C 4NQCE 1RJYA 3AXLB 4U6YA 3HZKB 1NGPL 2NW3A 4IBLT 3IFLL 1JK8B 1G7PB 3FQTB 5IUSA 3LEVH 4ISVB 3NABH 4EEEA 3ARBD 4ONGL 3N1FC 4HK3J 4WHYG 1FCCA 3ARQA 1S8DB 4Z76A 5DD6B 4R96A 4EUPG 2BK8A 2DJUA 5BOPA 3QDJD 4S10A 1X4ZA 5DRZA 2BXYA 3QUXC 5FV2A 4F9PA 3QCTL 2VABA 3BKCL 2E9JA 1IM3B 1RUPL 3EOAB 3KG5A 1S5HB 4W70A 1QA9B 5EDXA 1GOFA 1VGEL 4ZNEE 1UYWH 2FEEI 2DB8A 4C56B 1AJ7H 2XY2A 4OLZL 1GSMA 2FLRT 2X4UA 4HUMB 4KU1A 3FKUS 1T21A 1N5AB 3O81A 5IVXB 5IW1A 5MENA 4D3CH 1FIEA 3MJ9H 4TVSa 2EO9A 2H2SD 2R2CA 5KVFH 1CIUA 4I18B 4K9EH 3TCLB 3MJ8B 5IROA 4ZYKA 5LGHH 4ZFGH 2MMXA 4IRSC 1KIQB 1XCQB 4P5TD 3VD7A 1CLOL 2ID5A 3IDIA 1T1WB 4JFDD 3KPPB 3ALWA 1OSPH 3V8CA 3FFDA 2NYYD 2Z91B 4F7PB 4XWOD 3U7AA 2AAVA 3PGFL 5DS8A 3CFKA 1GGIH 1JGEA 4Q6IA 4YPGA 4XCEB 4Z7OF 1BFTA 1J1PH 3O3EA 4UT9L 1FJ1A 1OAZH 4Y8DC 3SDDB 2NTFB 2Z8SA 3ULSB 3C60D 5EC1B 2N56A 2N7AA 4W6XB 5IBLC 1G7MA 3H7BA 1XGRA 1J0ZA 5DA4A 3MRIB 5D70L 1CDHA 4O00A 1KOAA 3ARGA 3MRCB 3HZKA 4P2QE 4U1LA 4H8WH 1UVQA 1B0GB 1FAIH 1JK8A 1G7PA 2FEDD 3FQTA 3QIBB 4MGXA 2RHEA 5L88H 1FL3B 1E6JL 5ESVB 4NN5C 3GK8L 3RKDD 5C07B 2F9BT 3ZKQD 5GS1C 5F9OL 1S8DA 3U7YH 1XR9B 2D4FA 4GRLB 5DD6A 1SYVA 4PJFE 2R1XB 1Q0YL 5ELIA 1JYNA 1JJUA 3VRJB 3TT1H 2BY3A 2NY4C 4OSUL 1IAOA 4JY4B 3EOAA 4PRID 1Q72L 5JOPD 1L9MA 2J7LA 2F74B 2ITDA 5E2TH 3O8XC 4YHZL 5I8KH 5DK0B 1QA9A 3TYFB 3U1SL 1GYAA 1O7VA 2OM5A 2ZCKL 3WNNA 4GRMA 4GXUM 5JQHC 5F8RC 2VLKE 2PYEE 3MRMB 4C56A 1FL5B 3F5WA 3VGHA 2CKBH 2HYMA 4Z7QF 1BIHA 3GIZL 3TA3B 5GGSY 5IVXA 5JIPA 1WQVT 3DVFA 4OD3H 5JHDB 2ED7A 2QBWA 2IQ9L 4OAWA 1J8HA 5IB1B 1BWWA 4PGCB 1N0XH 4RMUA 1XCQA 4J23A 5KSAA 4CVXB 5LQBL 4OGAC 1T1WA 2YZ8A 3KPPA 4H20H 1QPPA 4GRWB 1VEPA 4IRJD 4M6MH 2Z91A 1BD2E 5JQ6H 3KPMA 1JHLH 2HTLC 3MRJA 2ICCA 4PY8J 4ZOAA 1V7NL 4OCWH 4XCEA 2YD1A 1TTGA 4FQJH 4YDJA 4HQQH 1MIMH 4RIRB 3SDDA 2DQCH 5T1DL 3ULSA 5B8CB 3VW3L 3GSWB 1QRNB 1VFOA 2NX5D 5I1AB 1TJGH 1T4KA 4X6DA 5DJ0A 5T3XE 4ZOCA 4AQ1B 3AAZB 4K3HA 5IB5A 3ZE1E 3MRCA 2FO4B 1YNTB 1KG0B 2QL1A 3C09C 3BDYH 1EFXA 5A1AA 1YNKL 4I77L 3QIBA 4O02L 3EDDA 3KYMB 1S7VA 5DD0L 1WLHA 3WFBH 3RTQB 1LEKB 1N0LA 4RFOL 4HGKC 3S3PA 2BVUA 4LASH 2AXFB 3UTQB 1K2DB 5KVDL 1ZA6A 1FQ9C 4Q2ZB 3DPBA 3VRJA 3QT2A 4XCFH 3DX8B 2FD6L 3QI9D 2GJ6B 4JY4A 3H3KA 1A6UL 1ZTXL 4MNGE 3RUGB 1L7IL 4YHML 1U92B 2IG2L 4YEFA 1TXKA 3SQOL 1WZMA 2VDNH 3MRMA 4MB4A 4EIGB 1FL5A 3RP1A 3PWNB 3H9SA 3OKMB 2ADJB 5DLML 3BP6B 4OLXH 1H5BC 3ILQD 2VB5A 2ATKA 4HJ0D 1JGLH 4BQ8A 1LDPL 1CQKA 3OQ3B 4X80H 1I1YB 2J88L 3UTZB 3ROLB 5IB1A 1AGCB 3RU8L 3MBED 3S88H 2EEDA 3QWRA 5FAAA 2XQYG 3QJHB 5T1KD 1MOEA 1LO0L 3T2OA 5JZ7C 4WU7B 1W2KT 2K7QA 3VXRB 4ODUA 5D7LB 3BPOB 3LKRB 3RQ3A 4URTB 1J7VR 4F7EA 5TPWL 3VFGL 5K9OB 5JXEA 3IDMA 1MFBH 1GPOL 2IPTH 5B8CA 2EDOA 3GSWA 3D0LB 1NLDH 4JN2A 5I1AA 4HG4K 5D2LE 4DCQB 4XPHH 5DD3L 5CD3B 1FO0H 5C0DB 3QXDB 2F8VA 3VXQB 2DIJA 1HHHB 3N9GL 4JY6A 4Q7DA 3AAZA 2FO4A 1YNTA 1GHFL 3W9EB 3IS1X 3BGMA 4UAOC 1AQDA 1X5JA 4IMKC 4Y4KD 1IM9D 3KYMA 4WO4D 3SCMC 1A7QH 5IHZB 3VMNA 3ZKMD 4JKMA 3RTQA 3TEUA 1DUYB 4H26B 2B2XL 2OXGA 5INCA 3UTQA 4JKPL 1TCRB 2DQJH 2V5SA 1OAKL 2J12B 3OPZL 4YK4C 1TDQA 5EU4A 3ARDB 4NRXB 1M4KA 3DX8A 3LKSB 2ZUQC 1QKZH 3GM0A 4FQQA 3FT2B 5D7IE 2GJ6A 4P99A 1NAKH 5DJZB 5GGVY 5J8OA 3X14B 4EIZC 2CPCA 3D3VB 5HBBA 5C0AD 2PCPB 3NCYS 1MJJB 3KPRE 4XVSH 2WQRA 4P4KD 5DC9B 2AK4D 1U92A 4LLYB 1NBYA 4KRPB 1GVIA 4Z77B 4DEPC 4OCYH 1H3PH 5E2JA 1MJ7L 2Q8BL 1NCBL 4MLIA 1I1YA 3FB8A 3UTZA 4HJJL 3MOBL 1AGCA 4M9PA 4PD4J 1P2CB 4XC1L 4L4VA 3QJHA 3WLBA 4JRXD 5F8QC 3ZKXB 4LRIA 5HI4C 2DQIH 4WU7A 2Q6WB 3MLYH 2DLGA 4XNYH 3O45B 3W11D 3VXRA 1VKXB 5JPMA 1MLCA 5GS2H 2LE9A 4HS8L 1MFCH 1B88A 2HLAB 3FFCD 5IEHB 4BFGA 5J13B 2XN9E 5CCKH 3G04B 4MWFB 3VFTB 1UZ6F 3U0TB 2JJSA 5K9OA 3D0LA 4DCQA 2O5XH 3EJZC 2P5EE 3DLQR 4LDLB 2R0WH 3QPQC 3QXDA 4F57H 3VXQA 1HHHA 1IC5H 5ITFA 4LGRB 4JO1L 5I74B 1WZLA 5L2KB 5IHZA 2EZ0C 5HVHC 1KCVH 3R8BB 2RBLA 1IAIM 3FB6A 5CLTA 3WHXB 2P46B 2J8UF 3QDGB 4HC1H 4ZAKA 2B7DT 4UV4H 1TCRA 3UZQA 3QDHA 4HKBB 1NFDB 2Z31B 4YBHA 3HPLA 2X5PA 5E2VL 3ARDA 1KJ2A 2AQ3A 5C9KA 3LKSA 2P43B 3FT2A 4L3EE 2ZUVA 3MC0A 3D3VA 4C58B 1JWMA 4WUUE 1JNLH 1CL7L 4OZHA 2WNGA 4LLYA 5DK2B 3QNZB 5CILH 2ERJB 1HSBB 3A6CH 3BP5A 3OAZK 2VLJA 4H5SB 1ZHNA 4UT6L 3IU3A 5E5MB 3R1GH 4XZUB 1NUFA 4Z7UE 1KFAH 2EDDA 1P2CA 1F4WH 3HNVH 2A6JB 2HKFH 3S97C 1PBYA 3VXMD 4OKVA 1GAFH 1I3GL 1FIGH 4NNPH 3VXUD 4XNMB 3WN5B 1VFUA 1NPUA 3O45A 1KJVA 1F4YL 1VKXA 4GXUN 2I60H 5I1EL 4G8EB 5KSBE 2D9CA 3MNZA 4S1RL 2HLAA 4Y5VB 3WO4B 2FO1A 2Y36L 4MWFA 3BYYA 4OBRA 4Y1AB 4OCXL 3VFTA 3U0TA 4Q0XH 2CDGB 2V5RA 3QEQD 1Y6KR 5DO2C 2DL9A 1LK3L 2HP4A 3QG7H 5I30H 3C5JA 5HD8C 3LEVL 4AL8H 1U41A 2NXYD 2B5IC 1WISA 5K59E 2WP3T 1EEZB 5F7WC 2EIEA 4YHYC 2AJYL 1T83A 2XOTA 2R2HA 1LILA 1UM5L 4NWTH 2J3SA 1BM3H 5L2KA 2I5YL 1RIHH 3OR7A 3V5HA 1ZS8A 5HDBF 5FHBH 4A2MA 3IRZA 3QDGA 4CKVX 4E9LA 3DMMB 3CSGA 2JJVA 1D5MB 3QHTC 1NFDA 1BZQK 5HHXH 4ZDHB 1ZHBB 3CSPA 4RWYH 3LB6C 5C70A 1AHWA 3RGVB 1AJ7L 5E94A 1IFHH 2YPKB 1OL0A 4P2OC 2QQLL 1HCVA 4G8IB 4DGIH 4QTHB 4UBDD 2ICES 1BZ9B 2R1WA 4O2EB 4PJ7E 2VXVL 3GKWH 3E6HB 2QR0B 4PJEF 3EYUL 1OARL 4WFFE 5DK2A 5LGHL 4ZFGL 1S9VB 3QNZA 2QSCL 4Z9KB 1PX4A 2O5YL 5JIHA 3T0BA 2P1YA 3HI1B 5C0ND 3MCLL 4H0GA 1HSBA 5CD5C 2BFVH 4OUUB 1K9TA 4YR6B 4H5SA 4N9GA 3I2CH 3OJ2C 4NN7B 1NMBH 4XZUA 4ELMB 3DRQA 5ILTH 3GSXB 1UG9A 3O2DA 2A6JA 3GRWL 3FRUB 2EDBA 3MV8E 5CEZH 3QXWA 3GBNL 3QB7C 3ZLQC 1WFUA 3I6GA 4GBXC 4YHNB 4WWID 4G8EA 4DZ8B 4Y5VA 4F58H 2CDFB 2PR4H 1YC7A 3O4OC 3R0MA 4O58L 3C6LC 1HHGB 4QRUA 3P11L 4H8WL 5I1HL 1Q38A 2QSQA 3QULB 4XT1C 4ZUTB 2UZIH 3BD5A 4RQQA 6FABH 2ARJQ 3L9RB 1X5XA 1XF5B 5DZLA 1EEZA 3QQ4A 1ZT4A 1IGML 4RSVA 5IR1A 5E70A 3WIHA 3QO0B 3WFCH 3A6OA 3QAZB 4X99B 5AG9A 3PV7A 1FFRA 5DHVB 1DBAH 3DMMA 2F8OA 2A74B 3VRLE 4XTRD 4QRPD 4ZDHA 5IVOA 1ZHBA 3WJLA 5F88B 2X89D 3F62A 3TWCH 3IVKB 3N1QC 2OQJB 2K3TA 4G8IA 3LIZH 3QIUB 4I48A 4M48L 5DTFA 3CU7A 4O2EA 3HE6B 1YY9C 3E6HA 4NBYB 3IETB 5EOTA 3MV7D 4NFDA 2OMBA 1JZ5A 3CH8A 4UIMB 1S9VA 4XVTH 1KTKE 3HI1A 1IT9L 1C08B 1SMOA 1QFPA 2XY1A 4OUUA 4PGDB 4H20L 4JO2H 3PP3H 5CLWA 4MVBC 2VYRE 3B5HA 4ELMA 3GUTA 3GSXA 1ZVYA 5L8KB 1FZKA 1I1RA 3FRUA 3ARWA 2DQCL 4J3TA 1T89C 1G9ML 2W9EL 4NJAH 4YHNA 3CFBB 5GRUH 4L8SC 2APVA 4DZ8A 4NYLB 2EDRA 4AMKH 3ZHLA 2CDFA 1J0JA 1DVFC 1UEMA 4U7SA 3WKMH 3UBXB 3BDYL 3U30C 5F7DB 4KI1A 1I1FB 3QULA 4R4NC 5BZWB 5FEBA 3LRGA 3IKKA 4ODVL 3HC4L 3WFBL 2O61B 3L9RA 5CZXC 4KWUA 4XBGA 3UTSD 4GFTB 2NY2C 2ITCA 5EN2A 3HI5H 1KCUH 2IADA 4NQCD 5FYJU 4R8WL 3QO0A 2X7LB 4JRYA 1D5ZB 4X99A 3A6BL 1PW3A 3OBAA 2AJUH 2ZSWA 5DHVA 5JDSB 1YNLL 2P8MB 5I71B 4XNZB 4OD1L 2F5BH 3DHJA 4FQHA 2EKSB 5F88A 4PBWD 3CDFA 3CVHA 3E6FA 2R0LL 3DROB 1R24B 4QHUB 5C6PB 2D0HA 3IVKA 2UWEF 4YUEL 3T2PA 4QOKD 1KXQE 4OLXL 4OTXL 3QIUA 1FZOB 4PP2A 3G9AB 4JFFA 1I4FB 5MERB 3RA7H 5EFIB 2R9HC 4FG6C 3HE6A 1RZGB 2YA0A 5FXCH 3AGVA 2BVTA 1NANI 4WFHE 2Y72A 4UIMA 2CR6A 2MNUA 4NRZB 5DJDB 4G8GA 1C08A 3SBWA 3DUSB 4F2MB 4V1DE 3K80A 4PGDA 3DNKA 4YIQB 2VOTA 4RA0C 1BPVA 1ZT7B 4ZFOL 1U6AH 2ZKHL 5LKNA 3SJVB 2IPKB 4N1HB 1MIEL 4MJIB 3RDTC 2AV7B 1G6RH 1K8DB 1PKQE 1LNUB 4MD0B 4XPFH 4OCSL 4HXBH 1RJCA 4C54A 5GRYA 4DQOL 2PETA 1HHKA 4NO2B 1HHJB 3PNWB 1PYWB 3ZTNH 4RMSA 4IRSD 1HIML 5GRZA 1FO0L 4NYLA 4K94L 1ZSDA 4CGTA 4LSRH 3ARBB 3UBXA 4WI3A 1I1FA 5E6IC 5T5NG 1YEIL 1A7QL 3CK0H 2WUBH 3QDJB 5JOEA 2Q8AH 5IFAH 1SQ2N 4JFOB 2O61A 5EORL 4FQXC 2Q7NA 4PJFF 2DMCA 4P2QD 4I13B 3DHMA 5FDWA 2QQKH 4GAGL 3OG6B 5HHME 2X7LA 4JQXA 3LS4H 1D5ZA 5FCUH 3VWJB 3MROB 2VH5H 5I1KH 3QRGH 1WK0A 3BUTA 4OZGE 3V0AC 2GSGB 3MRRB 4PRDB 3J7HA 4XVSL 5DMGD 2ATPA 2EKSA 2JB6B 1GOGA 1VFAB 4M1DH 4XNXL 3DTXA 3DROA 4LEOB 1R24A 2J2ZA 1NCTA 4XRCB 4X7TB 3VXPB 4PV9B 1NKOA 1FZOA 3U6RA 3FQNB 4HJGB 5MERA 2NY4D 5EFIA 3RWCB 1XEDA 5GRXG 5IESL 4ZTOH 1N64L 4G6ML 3D6GA 1K6QH 1AI1L 2HT3D 4KVCH 4M8VA 2RFXB 5HVWA 1K4DB 1MY7A 2FECI 2AERT 3O8XD 2ZUUA 2IH1A 2PYED 1WT5C 3WBDA 1BVLB 1U9KA 3BT2H 4GW1B 3TH4T 3PXHA 5DEFB 2D7TL 3ZYZA 4AIXA 3C60B 2C9AA 3NGBC 4HKXB 3SJVA 4HWBA 4MJIA 1FFPB 4OFKA 5IMOB 1LNUA 4MD0A 4I3SH 4OFPA 2YD2A 2IJ0C 1FSKB 3UJTL 5DZNA 4NO2A 1HHJA 1PYWA 3PE9A 3MLRL 1BD2D 3HR6A 5HYFA 4F57L 1F4HA 3ZE1F 4XPBH 4UZGA 3ARBA 3BXNB 2G60L 3KLSA 1I3RB 1FNGB 1G1YA 1MCQA 2HTLD 3KWWA 4XP1H 3W9DA 1WWBX 3O2VL 3VDBA 2AK1L 4HUUB 5HI3C 1UJ3B 3OB0H 3QDJA 2XQBL 1MJUH 3MREA 2CDEB 3VGBA 1SJHB 4HC1L 5T3XD 1V8HA 1KJ3L 5FUZH 1DN0B 3AROA 4QRSB 3FQXB 3T0AA 4J3OC 4PRIB 4PJIE 4Y16C 4H8WC 1SYSB 1CXEA 1U8QB 3ET9F 2L0DA 5L2JA 1CU4L 4XP4H 3AMLA 3DO3A 5L0QB 3O6MH 1TMCB 5GIRA 2GSGA 3MRRA 4PRDA 3LOWA 3ZT7A 4FQ1H 5DJ6A 4G43B 2R29L 1OGTB 4K23H 4U6TA 2KZWA 1HH9B 5F7NC 5FGBA 4PY7A 1CD0A 1OPGL 3VXPA 3G6JE 3HS0B 4FNLH 4P5TA 5D9SB 4HXAH 3U79A 3FQNA 2DQFA 4HJGA 1D3CA 1ITBB 3RWCA 4JFDA 3BPLC 1IL1B 4IRJB 4JDZB 4K2UL 1AXSB 4P23C 2BJMH 3ZTJH 4U0RB 4WI9A 4MSWB 1MVFA 1K4DA 1KFAL 4M4RA 4BZYA 3PHQB 4XHJC 1FNSH 3RWGB 3EFFB 3LN5B 5HI5C 1MWAH 5BW7C 4GW1A 5IOPB 5DEFA 5EO1B 5EZJB 3C60A 2NX5B 3UCRA 4HKXA 1FFPA 3MLSL 3SGKA 4P2RE 2P48B 2ENSA 4Q0XL 1ZA3A 4NM8H 5D2LF 4OV5B 1XGQB 3MZTA 4IJ3C 2VKWA 2BERA 1SBSH 2C3VB 5JZ7D 5IJKA 1CFSB 2DN7A 3DX9B 1FNGA 4HUUA 1IAIL 3QUML 5T1LB 4KMQA 5C7XL 1HKLL 3VG0L 3RI5K 1CDCA 1SJHA 1DN0A 4QRSA 1IQWL 3RWJA 3I85A 3QI9B 3B2VL 4ZODA 4PRIA 3HCVB 1SM3L 5IW6B 1U8QA 3PABB 4G9FB 1A9EA 2I07B 2XV6B 5JO5B 1QFWM 1PD6A 1AXTL 4YNYB 4DGIL 2HJFA 3DIFA 3SCMD 4EDXB 1OGTA 1Z3GH 3X17A 2JELH 1A7BA 3UC0H 7FABH 3ULUH 2J4WL 2VUYA 5EC2B 1A4KA 3HS0A 5DFVC 1IGCH 2VDQH 1BP3B 3GMRB 5T1KB 3OJMB 5DVMA 1IL1A 4LCYA 3SKNB 4IRJA 3I2CL 4JDZA 4X9BA 3VA2C 1AXSA 2YSSB 1EZVX 3KPRD 4JAMA 1HXYB 4MYWB 4I8DA 4X6CB 3PHQA 1A6ZA 1P1ZB 4KH2A 2R1YB 2YD9A 1GGCL 1X9QA 3EFFA 3LN5A 5JNYB 5FECB 3ORJA 2P4AB 2VIRB 1NGXA 5EO1A 2NX5A 2FB4H 2M26A 1I9IH 4F58L 1IEAB 4JM2C 1H3UA 1FCGA 1A02N 4U6HB 5D7KE 4LQFL 1T2QH 1A3RH 1EHAA 1TJIH 1KN2L 1MAJA 4HIIA 4OV5A 1XGQA 2E7LC 2A6IB 2XZQL 4UI2A 4Y4KB 5D7SH 1IM9B 1KB5L 3GSRB 1ED3B 3MV01 5KTEL 4WO4B 1W72L 3OAYH 1T7WA 2J5LB 3HC3H 2XN9D 3RNKA 1MH5A 3DX9A 2B39A 1OP5K 4D8PB 4EZMA 2D03L 4PLOB 2DD8H 5BV7H 3WFCL 2P5ED 3U4BH 1CGXA 4I0PC 4BH7B 2VMFA 2OZ4A 1QSEE 1DBAL 3GSUA 5E8OA 3QI9A 3EJZD 5KBNC 1JPGA 1QVOB 1KLGA 5IW6A 3QPQD 3ROOA 4Z6AT 5CEXB 1QFWH 5C0AB 4G8FB 1RZIA 4YXKL 2I07A 5CIPB 4P4KB 5JO5A 3TWCL 1TFHA 5CKAA 4YAQB 4HUKB 2YXFA 5ETUA 4NQDB 4J6RH 3BMWA 3UPAA 2W60B 1P84J 2EZ0D 3IFOB 4EDXA 1DDHA 4P5MA 1LO4L 2X4RB 3SN6N 3ES6B 3T0XA 1GH7A 3MBEA 5E5UB 4MS8D 3GMRA 4JO2L 4L3ED 1ACYL 3SKNA 3VRIA 1P6AB 2VN7A 4EI5A 4WHYH 5B38B 4Z7UF 1HXYA 2XKNA 3N85L 4WUUD 1S5IL 2OCFD 1P1ZA 3FFCB 2R1YA 4NQSB 4HD9A 3LKOB 1E28B 4DUXA 1OW0C 5FECA 2VIRA 1YA5A 2C3XA 4JG0H 1F11B 1K4CB 1A1MA 2NY1C 3BISA 3P4NB 3VE0A 4WI5A 1KPRA 3REWB 2IQAA 3L5HA 1MREL 3VCLB 2DDQH 1IEAA 1MHCB 4U49A 3WKML 1NQBA 1A7PL 5ICXB 2X05A 3JUYA 2LVEA 1F3DH 1ORQB 2EDNA 4KQ4H 5BXFB 3CFEB 3BX7C 2DM4A 4Y4KA 1RHHB 5CGMA 3GSRA 5K59F 2CMRH 4HKJA 2FHCA 4X4XB 4IRZH 4NUJB 4NN6B 5CJBA 2ZOLA 3EHBC 5EUOF 2OXHA 4EQ3A 2ZSVB 3W2DL 4P4RB 3VFWB 4Y8AA 2AJUL 5DFWH 5CKGA 2O93L 3GNML 1UA6H 1I85A 5HD8D 3L3GB 3SO3C 4RA3A 2OX5A 4R7DA 1QVOA 4F33B 4WV1C 1D5BA 5DYOB 5CEXA 5C0AA 3RVTC 4G8FA 2UVEA 4RGMB 1T04A 4P4KA 5TE6L 2AK4A 4YAQA 1ZLWH 1UZ8B 4PJ5A 1SJXA 3QUYC 5GGRA 4PJ7F 3RA7L 4AK1A 4P3CH 4YBQC 3BP7B 1HKFA 2X4RA 5L6YL 2F5AL 1GC1H 1N6QH 3OKLB 4NQXB 2ZOKB 3UBXG 2FCBA 3LB6D 4JRXA 3VXMB 3VG9C 4HK3N 4QRRD 4KUZL 1YEKH 2HKHL 3VXUB 1INDH 4P2OD 1U0QA 4M6NL 5I17B 2FR4B 2EEAA 1TQBC 4HIXH 3FFCA 4WFFD 1AO7B 4NQSA 4XPFL 4OJFL 4L9DA 4KHXL 5GS0L 4CNIB 2Z93B 3LKOA 4OZFH 2Z9TA 3LQMA 3V4PL 1IGYB 1YN7B 2FL5A 2H3NA 3QEQB 4F7CB 1F11A 1U91B 3P4NA 1QO3B 5CP3A 2A9NL 2GTZA 3VCLA 5CD5D 1AFVH 2NXYB 1TZIB 1MHCA 1AQKL 1JRHL 2V2XB 2FH8A 4C57C 4OCMC 5ICXA 2M2DA 1ORQA 5A2FA 1E4JA 1X5IA 2DM2A 3MV8D 5J6GA 3NAAL 4X5LA 3CFEA 1NLBH 2GCYB 2JK5B 4U31A 5GSVA 3GZKA 3QRFM 1MQKH 4R3SB 2VXQH 3UJIH 4LLDA 4K3DL 3OKKA 4ZTPL 5EU6E 1QSFE 4GBXD 4X4XA 3X3FL 4NUJA 2Q1EA 1U3HC 4NBZB 1A6VL 2ZPKH 1RZKH 1IBGL 3WDJA 4ODSH 3T1FB 3MLUL 1F2QA 2ZSVA 3LS4L 2AEWA 1G7IA 2LV4A 3C6LD 4Y5YC 4P4RA 3VFWA 5F6HI 2AEPH 3BSZL 4HUNB 2VH5L 3V7MA 3T0EC 4APQD 4QXUL 3L3GA 1RV6X 4F33A 2VXTL 5C3TA 1F00I 3TCXA 2J8UA 3T0EE 1A8JH 4RNRB 4KK5C 5F97E 3SKJL 1UZ8A 4LVHC 3GSNL 2HFTA 4XMLH 4U1JB 3MJ7B 3B5TA 3CSBA 2Q86B 1C7TA 1A5FL 3BP7A 4OLVL 4QHMA 4NCC1 5C92A 4JPWH 3BDXA 4NQXA 3JTSA 2ZOKA 4P5KB 5JMRA 1MF2H 2CJUH 2Y6SC 1BF8A 3VXUA 3JWOH 1H9VA 3EO0B 4RMQA 1KBGL 3IU4L 3MTRA 5EULV 1H0DA 4M7ZC 5HYSB 2DLFH 1CG9B 25C8H 1YY9D 4HGWA 3UAJC 4ZO7A 4CNIA 4WHCA 1ZGLB 4P0DA 4C59B 5E99H 1A7RL 1YN7A 3QEQA 5GGTH 4F7CA 4UTAL 3DVNB 4FQLL 1G7QA 4K3JH 2A83B 4PJGE 5GPRA 1HCFX 4QRTA 2V2XA 3F12B 4MVBD 1NC2D 4J1UB 3R8QA 2PO6C 2JK5A 5EIQA 4GKOA 4W81A 5CEZE 5GRVL 4R3SA 4LLUB 3IAPA 4K3EH 1S7RB 3K2UH 4ZD3L 3CFCL 4XVJL 3CLEH 2HG5A 2HJKB 3CFIC 3T1FA 4R9HA 1GGBL 4XC3H 2PTUA 1GXEA 2B1AH 4NZUL 3F7QA 3HAEH 2WIMA 5I8CB 5GJSL 3RHWF 3OJDB 2BSTA 4OF8A 5E8NA 4OLWH 3RX7A 1F6AA 4MA1C 3MODH 3GHEL 1H8SA 4J4PD 3WV0A 5CZXD 5FK9A 2FJGB 1NFIB 2NY2D 3MV7B 5ESAB 1CR9H 1MHPH 4U1JA 2MPAH 2Q86A 4HV8B 5H94B 2OTPA 3OSKA 5J12B 3S36X 3NZHH 1NUDA 3FB7B 1EXUB 1JIBA 3SGJA 3BIAX 3KJ4B 2BHUA 4LSQH 1FNSL 5DRWA 3FQUB 4PJEA 2VE6B 3HC0A 1JF1B 3MOQA 5B22A 2X10A 3SGDH 4PTTB 4QYOB 2VDMH 3VFOB 5DVKA 4WW1A 4JFXB 5KW9L 1OY3B 3VXNB 4YHLL 4WFHD 1IAKB 4WJ5B 1CG9A 2R9HD 4FG6D 3FHQA 4KGJA 4G9DB 1OF2A 4TUJB 3KYNA 5F7FA 1ZGLA 4LLQB 5FO7B 4V1DD 3JTTB 3DVNA 4W4OC 2VQ1B 3JWNC 1DFBH 1L4IA 4N68A 1SBSL 5I6XC 1KCSH 3HUJE 3F12A 3PGCB 3DBXA 4J1UA 4TNVF 4KRNA 3CDYA 3RDTD 4NQCB 2XZAL 3HE7C 4LK4A 3DURA 3D85D 4Y0GA 3R06B 5C07E 3RWEB 1UCBL 2G9HB 2BZDA 5HJ3A 1S7RA 2M8XA 3I6LE 2ZCLL 4Y2DA 1A7NL 1VCAA 2VZ3A 4XMKL 5IMLB 1HN1A 2FJHB 3UZEA 4QRPA 2RCSL 2B4CL 5AAWA 2X89A 4X5WB 1KEGL 4L5FL 4NKQB 2VAAA 5I8CA 3L5XL 4OZGF 1HNFA 3UYPA 4QOKB 4DFHA 4N8VB 4I4WA 4XXCC 2FJGA 3DX7B 3EYSH 3MUHL 4FQXD 1NFIA 1SJVA 3QUXB 3RIAK 3UC0L 3MV7A 5CAYB 5I15H 5ESAA 4PJDE 5GGUA 1HZHH 4HMDA 4UIKH 5TE4H 2J8OA 2GSIB 2VLRA 4HV8A 4L9LA 5JHDE 3DI2B 3ARFD 2DQTH 4Q9CA 3PL6C 4D0BB 2P8PB 2YEZB 3AS2A 1P7KB 3FQUA 4EXKA 2VE6A 1YQVH 1FAKT 2DTSA 3O9WC 1QBLH 5KAQG 4FXKB 3VFOA 2FX9H 4IRSB 5DGRA 4JFXA 3S7GA 1I9IL 3RAJH 1HK6A 2AP2A 3VXNA 5AG8A 1JHTB 1IAKA 4LNRA 4PRBB 2V5TA 5KVMC 5T3ZL 1BJ8A 2C5DC 2XYCA 4G9DA 4HCRH 1WZ1H 1A3RL 1E4KA 1TJIL 4LHUD 4LLQA 5FO7A 3CLFH 4NOFA 3JTTA 1QRNE 1MUJB 2VQ1A 3MLXH 4MJ5B 3QFDB 1A47A 1OTUC 4LF3B 4EDWL 3PGCA 3V0VA 1UADC 3UTSA 3V6OA 2FHFA 4NQCA 3QO1B 4LSTL 1E4WL 4JHAH 1BEYH 4M7KL 4P2QB 1JNHA 3NFNA 1CGWA 4U1KB 5GISL 3U4BL 4XPTL 3RWEA 2G9HA 3GMLA 5I75C 1I9EA 1JPFB 4RMVA 1C5DB 2YKLL 4PJIF 2FZ3B 3BZDA 3GSVB 5GZOD 2X4NB 1QFWL 4NN5B 4PLKC 2C4FU 3QG6B 3FO1B 4OQTA 1IKNC 3KNBA 5I8EB 4LRNH 4PJFB 4H1LB 5GS1B 1RAMA 1CK0H 3KS0H 4Z7VE 5C0FB 3WXVH 2BVOA 3EGSA 3I9GL 4JY5L 4KPHL 4POZC 1MELA 4R6UA 4N8VA 1BWMA 3VFVB 4WRLA 5IFHL 5DUPH 1QBAA 2YWYA 2NY4B 3DX7A 3Q6GH 4KVNH 3RUGE 1EAJA 4NKMB 4NRYB 1KENH 3G6JF 3AU1B 4Y16D 2KH2B 1H3XA 4ZNEA 1H15A 3O8XB 4WI6A 2GSIA 1RZFL 3KPOB 4JZNB 1FC2D 3V0WH 3GJFK 3KLDA 5CGYC 1XZ0B 4D0BA 2A77H 4UDTB 2EDKA 2P8PA 1WF5A 1P7KA 3LRHA 3RWIB 1DEDA 4LBEB 4FXKA 3QCUH 4X6FA 4IEFB 5ESQB 4IRSA 1NCAL 5D7LE 5I66B 2GIYA 1JHTA 1KSRA 2VERN 4XNQB 1INQA 3OXSB 3WNLA 3SE8H 4P23D 4UOW0 5ACLA 2QKIA 3LQAH 1RUKL 1MUJA 3B8SA 3GDBA 35C8H 1J10A 3QFDA 4JJ5A 2AJ3B 5BJTA 1WFTA 3REVB 5HI5D 1LMKA 3S9DB 4LF3A 3CXDL 5I1GH 1FZJB 2E6JA 5CIPH 3CD4A 2EDWA 3EYVA 3PUCA 3HPJB 2IPUG 1FVCA 4DGYL 1YN6A 4P2QA 2BX5A 1U3ZA 4UTBL 1KT2B 4ORZC 5IW3A 1JPFA 3C09B 1JZ4A 1C5DA 1L0YA 4OZ4B 4UILL 2X4NA 3BPNC 3GO1H 2BCKA 3QG6A 3FO1A 1U8OB 4OI9A 5I8EA 4PJFA 5GS1A 4FFVC 5C0FA 2X9WA 2WSKA 3DUHA 4MCYB 1ACZA 1YEGH 1EVUA 1RJLB 4MA7H 3L95A 3EOTH 3CJJA 1UKTA 3W5NA 1BBJB 3ALPA 4MNGB 4NKMA 2ZUTA 3IYLW 1VPOL 2LFGA 2VLKA 3O8XA 4U1HA 2PYEA 1NC4D 3KPOA 1OP3K 2V5YA 4Y7MA 5ALCH 2EDFA 2NY6C 3VJ6B 5J1AB 3O6KH 4UDTA 4HUVA 4S0TD 1S9WB 1H5BB 3WUWB 4OT1L 4NPYB 2NY5H 2D2OA 3RKPA 3PP3K 4JEGB 4OZIE 4BKLB 3TNNA 4PRPE 1HOCA 5ESQA 5FOJA 5DFVD 5I66A 1MHEB 1G0DA 1ZEAL 2PN5A 4WEUD 5IBUB 1BD2A 4BFEA 3ZYOA 1A1NB 1JWUA 1DANU 4JM2F 4ODWB 3BKYL 4AH2A 4ERSH 2CXKA 3U9PL 1NEZB 1N7MH 2AJ3A 1S7UB 1A6TA 1I7RB 2XTJC 1BLNB 3UJIL 4NQVA 5C2UB 5IT2L 3B3IB 1YY8B 4LPVA 5AWNL 5F70A 1FBIH 3F7YB 4MA3B 4Y4HC 2Q76B 4YHPB 1RULL 4JM2D 1EEQA 1TCMA 5CZVH 2DWEA 4FQCH 3N1PC 4JG1H 3FOLA 1NCUA 4UAOB 4YLQT 2EDLA 1GGYA 3NPZB 4HFUL 3SCMB 1MCLA 1U8OA 5KVGH 4MXVE 3IDUA 4X7SL 2DKMA 1D6VH 1MCWM 1QFOA 5J56B 4MCYA 5CUSH 3G6DH 1QSED 1RJLA 4YK4B 5EO0A 3HFMH 2BDNH 1IAII 5D7IB 3TT3H 1M7DB 4BELD 1BBJA 3ESUF 4I0PD 3VXOB 4MNGA 2ZUQB 1O0VA 1XH3B 3LRSA 5F6IC 3MUJA 4KZEH 1HQRB 3KPRB 4PUBL 3GHBH 2W1NA 3JV5A 3WLWD 4BZ2H 4TUKL 1Q9WB 1P5VA 4QWWC 3MRBB 3HNTH 3VJ6A 2BRRH 5DJYA 1S9WA 1VFBB 4HK0A 3ULUC 1H5BA 3WUWA 4DEPB 4RMRA 4NPYA 25C8L 1FFOA 4POYA 2MTPA 3E3QC 5E99L 3ULUE 4JDTH 4WCYH 4LSUH 1ZK9A 3ZT6A 1AGDB 1SY6A 4DAGH 2IALB 3C5ZC 1TVBB 5AD0B 1A1NA 4Y1AE 1TZHB 5FYLH 1MFAL 2XN9B 5F6HJ 3T1WA 2NNAA 1NEZA 1S7UA 1U8KB 3BIKB 1BJMA 2ZCHL 3ARSA 1I7RA 5ANME 5KJRH 4PB0L 1MHHB 5D2LA 2VDOL 4BZ1H 1LO2H 3BMVA 2FNBA 4M3KB 2NY1D 4MA3A 3U82B 4CADA 2Q76A 5DEGB 2QHRH 3ULVH 4LLAA 4X7FC 3TN0D 4OIAA 4YHPA 1IGTB 1DBML 3CXHJ 5L9DH 1YQ2A 3LCYA 3W39B 1QBMH 1RUAL 4OLWL 5C09E 4IMKA 3D0VA 1HYRC 3QWQB 5GS2D 5C0CE 3SCMA 1MFNA 5HVHB 3BKJL 4LNVA 5DURD 5BV7C 4NDMB 4N0FB 4KJWC 1U8PA 3WL9B 1WBZB 1HILA 3LVEA 3WUZA 3F6IA 3BWUC 1CD8A 3EHBD 2VR4A 5GGQH 5D7IA 1M7DA 2E27L 3VFNA 1X6LA 3VXOA 4X7EC 4PYHA 5D1ZC 3KPRA 5DJ8B 4IDLA 4O4YL 2F8XC 5FA3A 4WUUB 4JFPB 1XIWC 4M7JH 3IFPB 3RVTD 1Q9WA 1B0RB 2YMXH 3FB5B 4JHZA 5HGBB 4NM4L 4Y4FC 4OLUL 3GSQA 3BN9C 3FO2A 5F89B 2CLZB 3QUYD 1DBKH 4L4TD 1VFBA 4U0QB 4Z7UB 1NAMB 1AKJD 3HMXA 4Z18A 5TDNB 4DGVL 3VI4E 2P49B 2YWZA 1AGDA 4TN9A 4LLMB 1BAFH 2XWBB 1I7TA 2IALA 3IXAB 1TVBA 4PJ9C 3OKYA 5AD0A 1TZHA 4TTDD 5KSBB 3AVEA 3WEXA 1FGVL 4ONHB 2XN9A 1R3HA 2DMBA 1BECA 2Z4QB 1RIUH 2G5BB 1SEQH 3KJ6L 4AEHH 1U8KA 3BIKA 4G3YL 1IGFL 3UTTE 5C0GA 1MHHA 2P5EA 4G42B 1FVEB 1I7UA 3QXVA 1F97A 3H42H 3QXAB 4ZG1A 2OL3L 1C5BH 5I1CH 1CDIA 1OGAD 1OAYH 5HGAB 1WCBB 2R56H 2B5IB 3OB0K 4MAYC 2FDBP 4NHUB 5GRVK 5KOVC 4HPOH 4B5EA 2BY2A 3C6SB 2YK1H 5KSVA 2AXJA 4DVBB 4YHYB 1UWEH 3V5DA 4NQUA 3LKPB 4AG4H 1ZE3C 1RZ8B 2FX7H 5EU6D 3OX8B 3VGFA 3EZJB 4PG2C 3EYSL 3M07A 4TUOB 2WBKA 3TVMC 4NDMA 4N0FA 4DKEH 1WBZA 1U3HD 4RMTA 4UIKL 3CMOL 3NTCL 1Y18A 15C8H 5BO1H 3SKOA 4JCLA 3PDGA 1KJ2H 2R0KH 4XH2B 1CLYH 1W0YT 1VGKB 2P24B 4L3EA 2H1PL 5FYKH 3UP1A 3C8KB 5D8JL 1ZLUK 4QRRB 5EU5A 1J9CT 3T0ED 2ICEB 4P2OB 1WFOA 4WUUA 4JFPA 4LEXL 1WIOA 3ZE2E 2X4QB 3QUZC 4YO0B 3FB5A 3S4SA 4KK5D 3F7RA 1AY1L 3OF6D 4RWHA 4QRQB 4PG9B 4DN3L 5EUKB 2FX9L 3WXWH 5SX5K 2CLZA 3RAJL 1NBZB 2OMNA 1GC1C 1FH5L 3RVWC 1MAML 4U3CA 1L6XA 1F58H 4Z7UA 1NAMA 1ONQB 2O5ZL 3CLFL 3WIFB 3V4VH 1LEIB 3MV8B 3GMQB 3SDXB 4LLMA 2XWBA 4PJGF 1MCPL 2XG4A 3SE4A 5KSBA 2Y6SD 4Q9QH 3OAUL 4GBXB 4N8VG 2G5BA 1IGJB 1BEYL 1T03H 4BSJA 3S34L 1T80A 3BAEH 3O4OB 3C6LB 1FVEA 4M6OH 4RAHA 3T8XB 5F1SA 4RDQF 2YBRB 3QXAA 2M1KA 3V2AR 1EEYA 1IKFH 3PJSB 1F5WA 1WCBA 4B50A 1DLFL 5A40E 4NHUA 4P3WA 3V4UL 3DECA 5CEZD 4G7VH 1JRHI 1O7SA 4QF1B 1I8LA 2F53E 2PO6D 3LKPA 2YD4A 1RZ8A 3OX8A 3MRQB 4WTXA 1RZKC 2VLLB 3CFDB 1YEHH 4TUOA 1OSZA 3JWDL 3MUGB 2VZUA 5DD5H 3ZO0A 1E27A 3VI3E 4PB9H 2DQUL 3HRZB 4GXVH 4XH2A 1FFQA 2P24A 1ES0B 4GO6B 3TBYA 3C8KA 5HYQB 7CGTA 1F4XH 3MYJA 4TVPL 5C0RH 4PJ7A 2ICEA 4P2OA 1P9MC 1EMTH 3S37H 4EOWH 4ONFH 4YO0A 3P9LB 1NL0L 2GFBB 3WSQL 1JNNH 1F90L 5KVEL 1JYVA 2YPVH 3N1MC 5CGTA 5E95B 1A6WL 4WI7A 5HPMA 1ONQA 3TJHD 1NC2B 1WBXB 3WIFA 5IB2B 1JVKA 2CGRL 1LEIA 35C8L 3MV8A 5JDJA 4UT7L 2R8SH 3O2DH 3GMQA 1R5WA 3JWOC 4H1LG 5C0IA 3HUJF 4LFHD 4YHKL 3BO8A 3G5ZA 1ITCA 1RFDL 4LPUA 5IKCA 3KLHC 2Y5TB 1U8MB 3LPGA 1UH3A 4GBXA 4GQ9H 4L8SB 3MJ6A 1QLEH 3PWVB 5D7JA 5HHNA 2I24N 1JGVL 1DVFB 5HHVL 4G6KH 3C6LA 3T8XA 2OK0H 3U30B 4APQA 3C2AL 4JO3L 5F3BA 3PJSA 1ZKAA 3T4AB 3GO1L 4QO1A 3WIIH 4UV7L 1YUHB 1CT8A 4H88L 2NY2B 3QA3B 1MCOL 4HG4J 4QF1A 5MEPA 2ADGA 5DDHB 3ESVF 1FRGL 4FFYL 2AEQH 3QHFL 3HE7D 3I6LD 5F44A 1R3IH 5GGSA 3DUUA 2VLLA 4PTUB 1UM6L 2EYTB 1BFOB 4QXGH 3MUGA 3EKCA 4PJDF 1C1EH 4LCCA 1DL7L 3O2WH 4E42A 4WWKC 4TYUA 4RAVA 3HRZA 3KPLA 4KJPC 5BZDB 3FZUC 1ES0A 2VDPL 5HYQA 1I7ZA 4GKSB 3BVNB 1YC8A 4AYFA 3OAZH 3KYOA 4LKXB 4NGHH 3VGEA 1NDGB 1WUNT 1ZXQA 1OT2A 3V95A 4GRWF 3P9LA 4FZ8H 2E8ZA 1CE1L 1LVEA 4ESKA 4PREA 3TA3D 2BHYA 3STZA 4V1DB 3IFNH 1GZQA 2XKSA 1CGVA 1SJEB 1XGTB 1MRFH 3UX9B 1MFEL 3VD9A 2XWJA 3I02B 3PL6D 1U8JB 2YPLB 4M93C 4ERSL 3V52H 3GEWB 4GKZB 3QIWC 4YXHH 32C2B 4A6YH 1N5YL 2VN4A 3RDTB 2F58H 3O41B 5DWUL 4J3SA 4ODXB 3BN3B 5B39B 3D85B 4NJ9L 2VR9A 1QBBA 3NH7H 3ZL4L 1L7TH 1FBIL 1FNFA 1U8MA 4ZUUB 4L8SA 5JUEH 3PWVA 1CBVL 3S8WA 5SWZE 1C12A 3IDXH 5CZVL 4JG1L 1CVRA 3KYAA 3MNVB 2R23B 2AW2A 2FIKB 3JVGA 3QXTA 5CINL 1UM4H 4LU5H 5E6IB 3SDYH 3T4AA 4R0LC 3FT3A 4YDKH 1OTUD 1YUHA 2VTFA 4J4PA 3ZT5A 1FGNH 4FQXB 4KKCC 2DQDL 3QA3A 3WUWG 3MFFA 1NANH 1TTFA 4BJLA 1LP9B 5I8OH 1CFQA 1QQDA 1DLHB 4BK5A 4G6FD 3RUGF 3RWHB 1BFOA 4KTEH 3WDHA 3HNSH 3ECBA 3MXWH 1DQTA 4MNQE 2RJMA 5CWSB 5HHPB 5IBUG 1IGIH 4PR5B 5IQ7L 1HHIB 4BSWB 3H2WA 4ZPVA 4PLKD 5DMYA 3HZVB 2PXYA 4DW2H 1II4E 5BZDA 5E6YA 1QYGH 2A0LC 3OKNB 2ZG2A 2C1OB 1NEZG 3HNTL 1I3UA 4GKSA 3BVNA 1KTLA 4POZD 4LKXA 3EFDL 2CLVB 2ESVB 3MRFB 1QPXA 1UJTA 1UKQA 2W9DH 4LHUB 1EJOH 4HUXB 4LSUL 2D0FA 4V1DA 1BVKB 4WUKH 1T1ZB 4NP4L 4ZUWB 4MQ7B 1HINL 1SJEA 2HVJB 3EAKA 1XGTA 4ORGA 4S2SA 2LU7A 5CP7B 5FYJL 1LK2A 1PKQA 12E8H 3MV11 3DV4A 2EC9T 3NGBB 4NWUL 3RDTA 4JZOB 2NY0C 2XPGA 2P47B 1PVHA 2YR3A 4MHHI 2H32H 2JTDA 3D85A 4L8DB 3HMWL 5D7LD 1HE7A 4YQXL 2N7BA 1NSNL 4ZUUA 3TESA 2V17L 3L3IB 5AZEL 2WLYA 1RUMH 2PW1A 4PYGA 2D31B 3GSOA 5L9DL 3SGEI 4GS7C 1QBML 3MNVA 2HFFB 2R23A 5KG9B 2OTWA 2FIKA 1KLUB 5HHOE 2RGSA 5E1AA 4X98B 4HIEA 4G9FE 1H8OA 1WC7A 5D2NC 2YD5A 3WHE0 1EGJA 4C4KO 4FZEH 5EPMB 4TSBL 5DJCA 2XACC 5D2NE 3U46B 3WFEL 4JQIL 2WW8A 4Y16B 3U48A 2HH0L 1DLHA 5GGQL 3X13B 3L5JA 3QCTH 4OZGA 3BKCH 1ADQA 1RUPH 3ARFA 1EHNA 4M5ZL 3QEHA 4LMQE 4MD4B 3GIVB 4U6XB 5CWSA 4PR5A 1HHIA 4BSWA 2CR3A 5BRZD 3V6FB 1TVHA 4M7JL 4AEEA 1VGEH 3HZVA 4KK9C 2YN3A 3O3BB 3OKNA 3MLVL 1DSFL 4OLZH 5I1DB 1T5WB 2C1OA 4PRAA 1BIIA 4EUPA 3JWDC 4F9PC 4PRHE 2DTML 5ECJE 4LSSL 4X0KA 1C7SA 3MRFA 3BPLB 4KRPD 1MNUL 2GJJA 1CGTA 4P23B 2UYLB 4HUXA 1CLOH 2Z8WC 2ZP0T 1BVKA 3IF1B 4NNXB 3QH3A 1BAFL 4ZUWA 3U36B 2CKBB 5IF0A 4O2FB 1WT5A 2Q87A 5CJXA 3V6ZB 5J11B 3L5WB 1YEJL 3PGFH 4E5XB 5ITBL 4P59L 5CP7A 4HS3B 3MJ9A 2NY6D 1QHPA 1FNHA 4BQBA 4UT9H 4JZOA 2AABL 2Z92A 5ICYB 4PRPD 1YEDB 5HSFA 4HF5H 5D4QA 4AY0A 4OQ1A 3FJTA 4IMLB 5D70H 3L3IA 4IJ3B 2H41A 2GITB 2A73B 2IMMA 2JF1A 2D31A 4LAQH 3T3ME 5IV2B 2AJXL 4PY8I 4HPOL 3UROR 2HFFA 1E6JH 3WS3B 4JREC 3GK8H 5IK3A 4AG4L 1NFDF 4HAFA 4JJHA 1KLUA 5F9OH 3UPRA 2XTJD 1N59B 1CE6A 3DGGB 4OFVA 1RURH 4MXVF 2XQYK 4MAUL 4PJIA 3GJEB 4K71C 3ARGC 4Y4HD 4DKEL 1DE4A 3V79C 4Q58C 3TNMB 3K1KC 3U46A 4NQDE 4AQOA 5IQ9B 4JN1L 5DQDL 1KJ2L 3T3PF 5CBEB 4MQSB 1AIFB 2P42B 4OSUH 1NC4B 2Z31D 3KPNB 1Q72H 3BWAB 4MD4A 3RIFK 4UUJB 3GIVA 4U6XA 3NA9L 4HLZH 4WFED 4AT6B 1QOKA 4U7KA 5AZ2H 3IGAB 3MRDA 4H25B 1T20B 3G6JA 3MV9E 3GIZH 1ZHKB 3S35X 1UFUA 1T5WA 2HJLA 2VDKL 4NCC2 4YGAB 3TF7C 1HNGA 4WY7H 1BBDL 3F58H 5TDPA 2APBA 43CAA 2CIIB 4QKXB 4MA8L 2IEPA 3V4VL 2UYLA 1OAQL 5LQBH 5D96C 5DVNA 4X6BA 2CKBA 4GLRI 4O2FA 3B9KC 3V6ZA 4QWWD 5DQ9B 4UU9A 4E5XA 5BW7A 2NY5C 3O4LB 1V7NH 4HS3A 3GMOB 3RL2B 4P2RA 3P40A 5HDOA 3ULUD 2DIBA 3FN9A 2IBBA 5ICYA 5T1DH 3P73B 4JM2B 5A2LH 5KSAC 3VW3H 2YA1A 3Q48A 5ALBL 3VFSB 1U58B 4PFEA 4IMLA 1EHLL 2MQ3A 2VXUH 4Y1AD 1IKFL 2SEBB 2GITA 2LABA 3C5ZD 2A73A 1S7SB 3EBAA 3PWLB 5TJWK 1J12A 4WGVB 5IV2A 1YNKH 4I77H 2KKQA 5SWQA 2UVFA 2P7TB 4O02H 2GK2A 3WS3A 5DD0H 1U2CA 1DTUA 5EBWB 4RFOH 1QSEB 1JPTL 1JZ2A 1FO0B 4YXLH 4I0PB 5EOCH 3L7EB 3OL2A 1UC6A 2GW5A 1L9NA 4AEIL 2AGJL 3TNMA 5IG7B 2L4OA 3CFJB 1JZ6A 5IQ9A 4PB9L 5CBEA 2H26B 1IQDB 3HZMA 1PSKL 1AIFA 2NW2A 3AM8A 5C09D 3I84A 1VADA 4HBCL 1A6UH 1ZTXH 2IFFH 5C0CD 4IDJL 4UUJA 5C0RL 4WEMB 4AT6A 4KTYA 4LVEA 1NCWH 3S37L 1L7IH 4XWGH 4H25A 2DWDB 4YHMH 5EU7C 2IG2H 2X1QA 4KV5E 3SQOH 1B3JA 2W0FB 1T20A 1WIUA 3VXME 2A2QT 4KJWD 5DLMH 2GUOB 5EU7E 3C5SA 4YBLC 4U3HA 3MPCA 4ELMF 1QLRB 1JE6A 3DX6B 2J88H 3MUY1 4RGNC 2KPNA 1AO7E 4CDHA 4G6AD 1K5NB 5F1IB 5GZNC 3NCFB 3MACL 5ID0B 4RGNE 2ICWB 5D1ZD 3IDJB 4K7PX 1T5XB 3JV6B 3PIQB 2R8SL 3O2DL 1LO0H 1XIWD 5B21A 2W07A 5ACMA 1NUGA 1S9YB 1IZJA 4PGBB 5DQ9A 4Y4FD 4D2NA 3OHXB 1AXIB 5DJXB 1J87A 3BKML 4I3RL 3FCTB 3GMOA 3PP4H 3RL2A 4QGTA 4AIZB 2NY1B 4LPXA 5IWLC 4IHOA 4GAYA 4QLRA 4JM2A 1GPOH 3PV6B 4Y2OA 5I16A 1KV3A 4MXWL 1WWWX 4PGJA 5DD3H 1U58A 8CGTA 4Z7NE 4HFWA 2SEBA 4AIOA 3VGGA 1S7SA 3PWLA 4PJ9D 5FYLE 1KELL 1C16B 5DURB 1I75A 1F6FB 3KDMB 4OGYH 3VFUA 5JXEC 3UTTD 2Z8VC 3WIHL 4LIQL 3ALXA 1QSEA 4P9MH 5A16B 3ULVC 2B2XH 2B8OT 3LDBC 4JKPH 1JBJA 4NCDA 1OAKH 3HZYB 4QXGL 3OPZH 3QNXB 3ULVE 3NIDF 3SO3B 4O5LH 2FH6A 3CFJA 1EH9A 3W0WD 4WV1B 4MAYD 4OCNC 4TNWK 1JTPA 2H26A 1IQDA 4JB9L 5J89A 1JF5A 1MCWW 3Q1SL 4D9LL 1KIPA 3MZGB 2AJZA 1Q9OB 4ZPTA 1FORL 3H3PL 1EAPA 3QUYB 3ZE2F 4L4TB 1RK0A 1DEEA 2R15A 1CZ8L 2R2EA 4ACPA 5F3HB 3TVMD 4B7IA 3E8UH 1AKJB 2GUOA 5CHNA 4U1GC 1KF9B 4J3UA 1MJ7H 2Q8BH 4ETQB 4Z78B 3DX6A 5FUOH 1MRFL 4HJJH 3MOBH 2MSPA 3H9ZA 1TPXC 1K5NA 5C0BB 3VG9B 5F1IA 4LCWE 4WTWA 4XC1H 2ICWA 4RFEB 3JV6A 4RFNC 1EO8L 4XPGL 1TQBB 2UUDK 3QUZD 5D6DC 2FSEB 1FHGA 3OHXA 3LN4B 1BQHB 1OW0A 4HS8H 4NZDA 2X4PB 3HN3A 1BJ1H 1W0VB 3DRTA 4AIZA 1OGAB 3VU2A 4V2CB 1BZ7A 1KJMA 1XGYL 3TN0A 1W0WB 3ZE0E 3RVWD 4BSVB 3C08H 1KEML 4LRIC 1NDMB 5MP6L 2Y9RT 5EB9A 1NJ9A 4MQXC 4LU5L 1U8IB 3MFGB 1U8LB 3RVVC 5EU6B 3F65A 4MHHG 2JJSC 3NIFE 4JO1H 2ZG1A 1UT9A 2YOCA 3GBML 1U3HB 4L8BB 1NUNB 5I8OL 3QFJD 2EDQA 2VL5B 4RGOH 5A16A 5BVJA 5DSCA 4Y5YB 5T33L 4KTEL 1IGIL 4RCAA 3T0EB 4O9HL 4WVRA 1X3DA 3VI3F 4WI2A 4WV1A 1KACB 1I8KA 4DW2L 2F53D 3CVHL 2LAGB 5K9JL 2E3VA 1EBAA 1DQDL 2H9GB 4ZAKC 5H2BB 4LVHB 1Q9OA 5B39G 2AKRB 4X7CC 4CMMB 3BQUA 1N6VA 3LKNA 4I5BB 2MFNA 3DO7A 1HSAB 5F3HA 3VFPB 4OV6F 5HTSA 1AKJA 1XF4A 3LZFL 4WUKL 4CJ0A 4QT5A 4ETQA 4PJ8A 4Z78A 1S78C 2AS5M 5FYKE 5KOMC 3RBGA 4R26L 4UT6H 2XZZA 4IIQC 1PDKA 1MRDL 4RFEA 2V6HA 4GG8A 3NIGE 4XGZB 5IB3B 4DOHB 3BJLA 3KR3H 4M7ZB 1I3GH 4PJCE 4YWGL 2FSEA 4CU7A 3DVGB 3NMEA 2XI9A 1F4YH 4X8XA 3TIDB 4PS4L 1ZAGA 2X4PA 4PJGB 2Y36H 5CP3H 4OCXH 3M1BB 4KK8C 1OP5H 4UB0L 1ULVA 1LK3H 4NSKB 4UINH 2GK0B 1NDMA 4JVUA 4DFIA 2PO6B 4KDTA 1U8LA 3P3YA 4X7DC 1QSFA 1P6FA 5EU6A 2AJYH 5ERWB 4U4BA 3KLHD 2NPLX 4FZEL 1UM5H 4BH8A 5HYJB 1CICC 2R69H 2I5YH 1OLZA 1U3HA 1A3LH 3TBWA 4QOKE 5J9PB 4OB5L 2FECL 4LHUG 1IEHA 4I1NB 1V3LA 1UWGL 4M43L 2XNAB 1W72B 1G9NL 2C1PB 3G5VB 3T0EA 3IDYC 3O11B 1T83C 4MA1B 3VWJD 4F7MB 1FVDB 4R4FL 2CK2A 4MB5A 2QQLH 2IAMC 3OF6A 2HTKC 1JV5A 5H2BA 3Q6FB 1T1YA 5HVGB 5IIEA 2AKRA 2VXVH 4CMMA 4WFGE 4MCZB 1LWRA 3BIBX 3EYUH 1QNZL 1OARH 4Z0BL 1HSAA 2QSCH 3VFPA 2O5YH 1X7QB 5FO8B 3FQRA 3MCLH 1AHWC 4WWKD 4GMSL 1A64A 5CJ5A 2XICA 4KJPD 3FZUD 3VXSB 4OCLC 2QEJA 4HWZB 1BF2A 3BDBA 1FYTD 2AI0H 4GSDH 1QR1B 2FATL 4HWBL 1R3JB 1YMMB 3GRWH 4XGZA 4WNQB 3VGAC 4KFZC 4LSPL 3GBNH 2CRIA 3THML 3DVGA 4HF5L 5JA9A 5B4MC 1YMHB 1ZGLM 4PJGA 4F7TA 2YRLA 3X3GL 3HUJB 5EZLB 4O58H 2PNDA 1EIBA 1KPVB 3AXLA 4LAQL 5I6XB 3T0DA 5HYEA 4KI5C 4XNUL 3P11H 1VHPA 5H37H 5I1HH 5LGJB 2NR6C 2GK0A 3MRNB 4JHWH 4LVNC 1EA9C 4ISVA 5IM7B 3QIWD 4LAJH 5ENWB 4MXQC 2H8PB 2PO6A 3N1GC 3HE7B 1G7JB 2V7HB 1H3TA 1RURL 2X1XR 1IGMH 5ERWA 3PXJA 1X5LA 5SWZD 1RZJL 4I3GA 2EDTA 1AC0A 1PG7X 4D9QE 4R7NB 5J9PA 1IM3A 1AR1C 5CJOL 1S5HA 2UV3A 1NGQL 1QLFB 5AZ2L 4K8RH 1N26A 4LARL 5I2IB 1CXIA 2OJZL 4F7MA 1FVDA 5TGBB 3WMSA 4PJDB 4PRNB 4IM8A 3UO1L 4PJBE 4IS6B 4M48H 4Q9BA 2IBZY 1N5AA 3V5KB 3DMMC 4WY7L 3F58L 1DQLH 4I18A 4J8RB 4MNQD 3TCLA 3MJ8A 1MCFA 2EO1A 1M05B 3WJLC 1KIQA 2OR7A 4PP1D 1X7QA 1IT9H 3CC5B 3PL6B 3LS5H 1M71B 4U3XA 1MFDL 3O6LH 2BSSB 1OAXL 2DMKA 3K3QA 4F7PA 2A0LD 1TNMA 2ZNXA 3O9WB 3CIQA 1Q94B 1QR1A 1R3JA 2V9TA 1XF3B 4WNQA 4NOBA 2NTFA 2YHGA 3VFMB 3WFHB 1G9MH 2W9EH 4D0CB 5I76B 4WEBH 2AV1B 5EC1A 4FFZL 1UXWB 4GJTB 1SBBA 4RAUB 1YMHA 1OAUL 1PQZB 4WDIB 2VXUL 1AGBB 3DYMA 3MRIA 2FBJL 4W4OA 4Z7WB 5KAQF 3HUJA 5EZLA 1KPVA 1G6RB 3MRPB 1B0GA 1FL3A 5ESVA 1A1OB 5IM7A 4ODVH 3HC4H 1NMCC 5ENWA 3RWDB 5C07A 1FPTL 5L7XH 1G7JA 1NGWB 2VDRL 1XR9A 4OI8A 4YXLL 3MBXH 4GRLA 4G6FB 4FFWC 5EOCL 2R1XA 3IAGC 1URLA 5I75B 4WHDA 4ALAL 5FKAB 5T1LD 4R8WH 4YGVB 3LH2L 5DHXB 3CZJA 5E1HB 4Z95L 2YD8A 5I0ZA 3MA7B 4R7NA 3A6BH 4NFBA 4Z7VB 1QSZA 3TBTB 5HHOD 2Q7YB 5TDOB 1YNLH 2IFFL 2F74A 5K9QI 4G9FD 2B1HL 5DK0A 3TYFA 4OD1H 1NCWL 5IJVB 5I2IA 4XWGL 2IF7A 2R0LH 2Y25A 5DK3A 4CW1B 5TGBA 4IOFC 4PJDA 4XXCA 2W91A 4YUEH 4IS6A 4OTXH 3TA3A 2K7PA 3RZCC 4X6CF 5D5ME 5JHDA 3JBG7 4J8RA 1TETL 4KKLC 2BVYA 5K9KB 4PGCA 1JFQL 4YPJA 1J05B 3CC5A 4WU5B 4CVXA 1M71A 4HPYL 4XAWL 2BSSA 4KK9D 4DN4L 2ZKHH 4PRHD 4HWUA 3X12B 1CWVA 1MIEH 4JZJC 6CGTA 3PP4L 4XXDB 3CSYB 43C9B 3RX8A 1F2XK 5TQ2H 1XF3A 4RIRA 4L1DA 4Y5XC 1CTOA 4OCSH 4RISL 4X83A 3VFMA 4DQOH 4GG6E 3SBWC 1QRNA 2HMIC 5J1TC 1HIMH 1UXWA 4K7PL 3LKQB 4ZS7L 1PQZA 4K94H 1AGBA 4P49A 4GW5B 3OZ9H 4ZS6C 1KG0A 1G6RA 4ZFFB 3FL7A 1HYSC 4OGYL 1YEIH 5MI0C 3D87B 2WINB 1LEKA 4MJ4A 1NGWA 4P9ML 5EORH 2AXFA 3E1F1 2OZ4L 1K2DA 1IC4L 4Q2ZA 5CS7A 4GAGH 4O5LL 2GHWB 3RY4A 3MA7A 5BRZB 1FL6B 3BPNB 3TBVB 4OQTH 3TBTA 1EFQA 2ORBL 3WYRA 1RQ5A 2AEIT 5TDOA 5IMKB 5IJVA 3RUGA 4XNXH 5BVPL 2DI7A 4NQDD 3PWNA 5DFTA 3E8UL 3OKMA 2ADJA 1GGTA 3EOBB 5FCSH 3BP6A 3ARXA 3KYKL 2Y23A 4OI7A 4OKDA 1PLGL 1MLBB 5FUOL 5IESH 3I75B 1N64H 3ROLA 5LWYL 4G6MH 4TTGA 1AI1H 3L6FB 4WU5A 1UXSB 2NY6B 4FQIL 2EDJA 2ADFH 3MV9D 5D1QC 1P7QD 4OZIB 5GJTL 1OVZA 3OKDB 1UACL 2D7TH 3QZWB 4PRPB 5D7LA 3LKRA 1PJ9A 4CVZB 4KROC 1MCIA 1B90A 3SDCC 3O3UN 2FWOB 5FF6B 3UJTH 2DLIA 3C08L 5CBAB 1KN4L 3LKQA 1Z0MA 5CD3A 1MWAB 3MLRH 5F7UA 5C0DA 1J18A 4J3XA 3RY6A 5TF1L 2XTJB 3B9KD 3PGDB 2G60H 4RZCB 3W9EA 2YUZA 4ZFFA 4NC0B 3O2VH 2AK1H 1J8HD 3OKOB 4Y4HB 2XQBH 2WINA 1AGFB 4RGOL 1DUYA 4OF3A 4OF0A 5KSAD 4H26A 1A2YB 4PJAE 1KJ3H 4WHTB 3HG1E 5GHWL 5TH2B 4JDVB 4NRXA 3GMNB 1CU4H 4MZ3A 1FL6A 3TBVA 3O6FC 4JGUA 5DJZA 3X14A 3U4AA 2H2PD 1T7XA 3NZ8B 2IWGA 4HS6B 5CJQL 2PCPA 3V6BR 1MJJA 1YEFL 2EECA 2R29H 5IMKA 4LCUB 1DQML 3LHPL 4EKXA 1BQHG 1KNOB 3BEWB 1OPGH 4R97C 4Z77A 5F6IB 1EFXD 5BQ7B 3NACL 1MLBA 1HWGB 3I75A 4K2UH 1ZHLB 4TPRL 1XGUB 1QACA 3GMPB 3JUZA 1J8KA 3KR3L 3DVIA 4P5TC 1X4YA 2Q6WA 4OZIA 3OKDA 3LEXB 4PRPA 2ICWJ 5IEHA 2VO5A 1AO7D 3G04A 3MLSH 4FQPA 2NYYC 4HW6A 3L7FB 5JXAH 4OIIH 2FWOA 2CUMA 4RGND 5FF6A 3C5ZB 1AE6L 3TV3L 4Y19E 1TQCC 4UINL 1EUUA 5GZND 5CBAA 2D7PA 4QXTB 4Z5RB 4Z7NF 1MWAA 2VUOA 5ANMB 3JXAA 5C8JB 1YZZA 1RZ7L 3SE9L 3MGAA 1AD9B 4XBEL 4F9LC 1Q0XH 1IAIH 2UY7A 3QUMH 2R69L 1DUZB 4OFIA 4UDUB 4LPWA 1A3LL 5C7XH 1HKLH 3VG0H 1AGFA 3WHXA 5C1MB 1XCTB 4UQ2B 4WHTA 1IQWH 1JGDB 5C09B 3B2VH 4OLYL 3CCHB 2C26A 4HKBA 2Z31A 5IJKC 5FYLD 5C0CB 1SM3H 5F72S 3ULVF 5TH2A 1CVSC 4JDVA 1JWSB 2X4SB 3HI6L 3PWUB 3FOMB 1CS6A 1ORSB 4W68A 1WZKA 1AXTH 1PY9A 5BV7B 5ADOL 4QRRE 3NZ8A 4HS6A 2FHBA 4I0CC 4LCUA 2LTQB 2KZ1B 3GJFH 3ULVD 1KNOA 4Y88A 1Z9OA 4LOUC 5JHLL 2J4WH 4NHCL 4MJ6B 4MD5B 5D1ZB 5BQ7A 4YHIB 4KK6C 4XAKE 3QISA 1XIWB 4DZBB 2DQGL 5GSRB 3GMPA 4HBQA 5E5MA 5AYUL 4Y4FB 2AI0L 4GSDL 5JW4N 4X9FA 3L1OL 2NY7H 1GGCH 4RDQG 3SDXE 4Z0XB 4XNMA 3WN5A 3LEXA 1HEZB 1S9KC 3RVUC 3BP4B 3MOAL 2BNRE 4Y1AA 3BZEB 4LCWD 2CDGA 4RRPA 3ZE0F 5C2BH 3L3OB 4GOSA 4LQFH 3C5ZA 4PJ9B 1KN2H 1G7LB 5FHAH 5A2JH 2NMSA 1KC5H 4JHWL 3EW3B 4ZUVB 5FGCB 2XZQH 4GMTL 5MEQB 4Z5RA 1KB5H 1RMFL 5ANMA 5KTEH 3UTTB 3RBSA 1W72H 5E2UL 4CRPA 5T1MB 5KZCB 1MCSA 3PWJB 5DXWA 3WS6A 1CDGA 2D03H 3M8OL 2R4RL 4UDUA 2BY1A 3LQZB 4YC2C 3W0WB 4L4VD 4MAYB 4MJ2A 2A1WL 1XCTA 4NBXB 4QTIL 4UQ2A 5C09A 1D5MA 1P4BL 1HXMB 5C0CA 2XIDA 4K8RL 4MQXD 1TENA 1BVZA 3N06B 4BQ6A 4YXKH 4LFHG 3RVVD 3SKMB 3PWUA 3RGVA 1ZGLP 3BHBB 3HA0A 3FOMA 2YPKA 2X6MA 1V7ML 3NVQA 2APXA 5GS3A 5LGKA 3TVMB 4QTHA 1PG7L 1PEZA 5LJYH 1BZ9A 4G5ZL 3K74B 1OP3H 3I3BA 1DQLL 5ACZB 2QR0A 1LO4H 1VESA 2GAZB 1TLKA 1RHFA 4MJ6A 1OQOA 3RY5A 5BOZG 2CXGA 3LS5L 4MD5A 5D1ZA 4YHIA 5K9QG 2X1WL 8FABB 3PWPB 3O6LL 1ACYH 4YR6A 1XIWA 5JPNB 4X5XB 4DZBA 3QUZB 5H8DA 1D9KC 3ILQC 1G0XA 3N85H 4Y4FA 1S5IH 3DXAE 3NIGF 5EA0H 3KGRA 3DYPA 3MBEC 3G5XB 4Z0XA 3DJ9A 4WEBL 3HMXH 5FYKD 1XF1A 1MREH 2DL2A 3BP4A 4FMKA 3EUUA 4EI5C 5IHUL 2J8HA 1S78D 4H0IA 3L3OA 1A7PH 4PJ9A 1HHGA 1G7LA 3OTTA 1YYML 2I9LB 5MEQA 4ZUTA 4XVUC 3MXVL 4OZFB 3UTTA 5C6TL 3I6KB 1JN6B 1XF5A 3QFJB 5L7XL 2WLZA 3KAAA 5T1MA 3MBXL 3MRKB 1JYXA 1VEMA 2VLJD 1KCRL 3BOVA 1RU9L 4QHLB 2NTSP 4P2CG 2VC2L 3STBA 2FX8H 3W2DH 4Y4KC 1B4JL 4MAYA 4MX7B 2F53B 4ZFZB 3GNMH 5DVLA 4GAJH 5E5RB 2A74A 3EOYG 2AXGB 1N8ZB 5DGQA 3SKMA 1YYLL 1N4XH 3KXFB 5TE6H 4PG2A 2OQJA 2QSTA 3D39E 3NCJL 1CICD 1I85C 1KXTB 4ODBD 1QP1A 2XG5A 2X09A 3IETA 3LV3B 3QUXD 4KQ3L 5MHSE 2QTEA 5L6YH 2F5AH 2GAZA 3E2HC 4U2YA 1ZANL 3GI9L 3I50H 5A43C 4EI6B 1IRAY 2PTVA 8FABA 4R2GC 1X5ZA 2D9QB 4NT6B 3QDAA 5JPNA 1K8IB 1CD9B 4KUZH 4X5XA 2HKHH 1S7WB 4M6NH 2IAMD 4WFGD 1UEYA 1DQQB 4HX1B 2YPLE 5GS0H 3WFDL 4OJFH 5TQ2L 4KHXH 3P0GB 5HGHB 1AD0B 2UZYB 1N3NB 3G5XA 3V4PH 1AH1A 5EOQL 3CFBA 1ZLVH 5LAXB 1BFVL 2A9NH 3OV6A 5HHQB 1AQKH 3OZ9L 1Z9LA 1JRHH 4G6JH 5F7DA 2KBGA 2W0KA 5LBSL 4N5EC 3NAAH 2I9LA 3P9WB 5BZWA 2GEEA 4OZFA 1UB6B 3I6KA 4K3DH 4ZTPH 5IGXL 3ARPA 5B4MD 5IBLD 3X3FH 1A6VH 2XWTB 4QHLA 1IBGH 3IB4A 3B8YA 3MLUH 5C08B 1LP9E 4OQTL 3VA6A 2VQTA 3BSZH 4MX7A 4NUGL 2F53A 2NR6D 4ZFZA 5JDSA 4QXUH 2P8MA 2WUCL 3UBXI 2VXTH 3L3DB 4MXQD 5IFJB 3ZDZE 2AXGA 5F7HA 2W0PA 4QHUA 3SKJH 4EN3C 2VZ1A 2HFEB 4D9QD 3AY4C 3GSNH 2CUHA 1DBJL 3Q5TA 2Y1VA 3HAEB 1I4FA 4PGEB 1RZGA 4PPTA 4WWKB 3LV3A 2EH8L 5JLZB 1A5FH 1KUMA 2ESVE 4OLVH 1L6ZA 1AR1D 4NRZA 1JTOA 5DJDA 3DUSA