3CXDL

Crystal structure of anti-osteopontin antibody 23c3 in complex with its epitope peptide
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
213
structure length
213
Chain Sequence
YIQMTQSPASLSVSVGETVTITCRASENIYSFLAWYQQKQGKSPQLLVYAATNLADGVPSRFSGSGSGTQFSLKINSLQSEDFGTYYCQHFWGTPFTFGSGTKLEIKRSDAAPTVSIFPPSAAQLSSGGGSVVCFLNNFYPKDINVKWKIDGAERGNGVLNSWTSQDSADSTYSMSSTLTSGGDEYERHNSYTCEATHKTSTSPIVKSFNRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of recognition of human osteopontin by 23C3, a potential therapeutic antibody for treatment of rheumatoid arthritis
pubmed doi rcsb
molecule tags Immune system
molecule keywords Fab fragment of anti-osteopontin antibody 23C3, Light chain
total genus 48
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2008-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cxdL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cxdL01
3QDJA 1NMAL 2FD6H 3OSKA 4QGYA 5J12C 2XG5A 1VDGA 4PRHB 1AR2A 2C1OB 3RHWK 1IGJB 3U36B 4AIZA 1CVSC 1UB5B 4QXUL 3GMRA 4LASL 4IDJL 3MA7A 5D96B 3GI9H 1FQ9C 5B38A 3DX6B 3WJLA 1G84A 1H8SA 2B7DT 43CAB 4L8SB 2BY3A 3D2UB 4Y2DC 1DBML 1SBBA 2CLRA 4XCFH 1N64L 5T1DL 5EO9A 2BVTA 4OT1L 4RFNC 1P4LA 3JV6A 4G6JH 4Z76B 3RHWF 5E03A 3T4AA 4FTVD 3O8XC 5CKAA 1MRDL 4HKXA 5DJDA 4BSVB 2EDJA 4J12A 4X6CB 4I3RH 4A6YB 1A4JB 4OZFA 3WBDA 1SYSB 1B0GB 3I02A 3MCKA 1R3LB 2D31B 1YEFL 4Y5VA 3WLWD 4KVCL 1NFKA 4LVEA 4PJCB 3MCG1 2O5YH 1HI6A 4UIMB 2VL5A 3HI6L 2CXKA 1MHHA 3K80A 3FFDB 3I6KA 3QO1A 4XRCB 1SYVB 5MHSE 2M1KA 2XKNB 3FHAA 5I1CH 1A3QA 1RJCA 5D70H 1QYGL 5IVZB 1FNSL 3KGRA 5HYIA 2Y7QA 5D2LA 3L3OB 5B3NA 1IQWL 4JFPB 4CU6A 1HINL 4MJ5B 1CICC 2IPUG 3VGDA 5C3LD 2CRZA 2XV6B 1C16B 1I3RA 3QI9A 3VWJA 3N9GL 5I30L 5F9DC 1Q94B 5TE6L 3CFDB 4AL8L 5I8OH 2MHAB 5CJOL 1GOFA 3WIFA 3ET9F 1JNHB 1JRHH 2ZKHH 3TO4D 3VXOB 2E9WA 2VDRH 2EKSA 1TCRB 4J4PA 4KJPD 3U48A 4PRPD 4QLRA 4PGBA 4XBGA 1FDLH 1F11A 2Y36L 5CEZL 3DIFB 1RY7B 4NQCD 1SMOA 1YPZF 3MRGA 1E4XI 5A43C 1ZHLA 4X99B 2RFXB 1YY9D 2Z91B 3HZMA 3WKMH 5KANI 1MHHB 2FDBP 2HN7A 1KN2H 1F97A 2D4DA 1DUYA 3E3QC 3P3YA 2DIBA 1UC6A 1OP5H 2CK2A 4YHZL 4ZNCD 1N64H 5T1DH 5BVJB 3OKMA 3L3HA 1II4E 1G0YR 2D7QA 3RY6A 4XC3L 2VH5H 3L3KB 4MB3A 3TFKC 3F7YA 3HN3A 3MJ8A 4PLKD 4Y2OA 2H2SC 4X4YA 2JJUA 5IQ9B 1MFCH 5A2IH 1MHPH 2H2PC 3ARFB 3B9EA 4MJIE 5I18L 4YBQC 3F6LA 4XPTH 5DHYA 1YEHL 1EMTH 4YDLC 4U1SA 3TBVA 1H5BA 4K7PX 2X4QB 3EDJA 4U1HB 3GMLA 5T1LB 2MTPA 5L6YH 1BLNB 4NQUA 3TIDB 2M2DA 3S4SB 3H9SE 1KJ3L 3G6JB 4WTXA 5A16A 2DLIA 1Q9LB 4PTTA 2C1PB 3LQAL 3H9SA 1IC1A 4NNXB 1BEYL 1TVHA 1EFXD 3KJ6H 5JUEH 4LDOB 2CIKB 3D5OF 4LHUG 3D85D 1FO0L 2Z4QB 2YMXH 5E99L 4NQDE 3DRTB 3LDBC 4P4RA 4Y4FC 5GGUA 1ONQA 2V9RA 4OZHA 1FFNB 1DVFB 2GCYB 2VLRA 3BQUC 4YX2L 2JIXA 1JRHL 4YDIL 1XGQA 3QXDB 1P7QA 1FVEB 5HDQL 1FHGA 4KVNL 4LLAA 4M6MH 1MJUH 3W0WA 4KV5E 2ZP0T 4OCYL 4M6NL 2Y36H 4ODBD 5CEZH 4TUJB 4FS0A 5CWSA 2ITDB 3GZKA 1F8TL 3B5HA 3QZWG 3HR5A 5JHDD 2X2YA 2E9JA 3ZHDA 5DR5L 1ZHBA 3UYRL 1EO8H 4MXQD 1YEGH 3DYPA 2I27N 2F8VA 2UV3A 5CLTA 4OLEA 4UQ3B 1KOAA 2OJEA 5LAXB 1U3ZA 5ITFA 4OLZL 3GMNB 1INEL 3T2OA 1DE4B 4ZPTA 3ZDZF 5HDLA 4KQ4H 4NCDA 2CIKA 1KXTB 1GGYA 3DROA 3UBXG 4LLDB 2HG5B 1S7UB 2R29H 4R0LC 2AVGA 3BZFB 1BFVL 5TDOA 1JPST 1U2CA 4IRSD 3EHBC 3KPNA 5EIVA 4PP1C 1EMTL 4YBLC 2QHRL 3C9NB 5GS0H 2DYPB 1A7QH 2ZSVA 3S9DB 5DSCB 3FQRA 4ZS6C 4GOSA 4IOIA 3UC0H 1UM6L 1EEQA 2MMXA 2EIZB 4LSPL 3TZVB 3ALWA 3MODH 3RTQB 4YFLI 3C5ZD 1ZLUK 4RSVA 5E8OA 4FQCH 2XXMB 4AT6B 2ADJB 3BHBB 5C3TA 3KJ6L 3C09B 5CIPH 3L3OA 2R1YB 4KTDH 5DHVB 2CDFA 1T0MB 1DDHA 2NY2D 4H8WC 1JGDA 5JPMB 1HEZB 5L88L 5FYKL 1E6OL 1A6AA 5J6GA 4HWZB 2HWZL 2J8UF 3OX8B 1LNUA 4HV8B 5CZVH 5TE7L 2VWEC 3SDDB 4WFHE 2DLFH 3QZWB 2ZUYA 4PJIE 5J12B 3CFCL 4ZUUB 5LKNA 1F02I 1XGYL 3DTXB 1TJHH 3OR7A 5EIIA 3L95A 4XP6H 1F3JA 3LKRB 5CGMA 3UJIH 2AI0H 3OAYH 2WWMC 2FSEB 2A83B 3RTQD 1JUFA 4U1KB 3UYRH 1WTGT 3RTQA 4UDTB 5KVFH 3HC0B 4PD4K 2EDQA 3IVKA 2X1PA 2FR4A 4OCRH 2ADJA 5JIIA 4C55A 3V0VA 3D39D 2H6PB 1K2DA 4NHUB 4PTUB 3HR6A 2V9TA 1TTUA 4TULL 4G3YL 3JWDC 4XPAL 3IYLW 3TBWB 2R23B 4RFNB 3FT4A 2P24A 5E2WL 1JGDB 4JQIL 4MNHB 1KCUH 5DJYA 1FSKC 4XP4L 3AS2A 3NIDF 5EFIB 3QPQD 2VN7A 4ZAKA 2FHFA 4PYHA 5I1KL 4GAFB 3EJJX 4LVHB 1CGSL 4OCXL 1PBYA 1RZFL 4YXLL 2B1HH 4ZUUA 3SN6N 4I2XB 1X5XA 3MJ7B 5K59F 5TPWH 4XBPA 5JHLH 5BZDA 4J3XA 2Q3AA 3DVGA 4MDJA 4PS4L 3V5DB 1HCVA 3P0VH 1WT5A 5EBGA 4R2GD 3WIHH 2CMRH 1NMBL 2Z35B 2BVEA 1EEYA 3GJEA 4EUPH 5IHUH 1JUFB 1MIMH 4K55A 5F97E 3S37H 2B4CC 1MFAH 1D6EA 4R97C 5HVGB 3IF1A 5FF6B 4M7ZB 5IR1B 2HKFL 4U1IA 2Z92B 1CFNA 4RIRB 1UZ6F 1D5IL 2X4NA 5D5ME 1J1OH 4WU5B 1BWMA 1MCNA 4JZOA 4O2FB 1XF2A 1OGAD 1OHQA 1LEKB 2HWZH 1RURH 2MWCA 3N0PB 2VWEE 2ESVA 4ZSOB 2P8MA 4TVPH 1DANT 1KIQB 3ZKNC 3P2TA 4XNUL 3BUYA 1FVEA 3FT2B 1I1FA 1MSPA 2R2BA 1A6ZB 4IRZL 3VI3E 3TJHD 5BQ7B 5I66B 5BO1H 2M26A 3EYVB 1OCWL 4FTVE 1UVQA 5FM8A 3S98A 5I1DA 3G6AA 3HPJB 4JHWL 5HPMB 1ZA3B 3CD4A 3UTQA 4PJDE 4JVUA 5HYSA 4PP1D 5FDWB 5MENB 2VLJA 3T4AB 1UYWH 1XIWA 2V2TB 5ADPH 1CGWA 1UCBH 4RMSA 2NY0C 4YDLB 2EO9A 1YEEH 5E70A 3VXRB 5C0GB 1WQVT 4XPBH 1G7QA 4NFCA 1DE4A 3MFFA 1B3JA 1G7PB 5J1TC 1FFQA 3QI9D 5JIKA 4C4KO 5GRXG 5I75C 2E8ZA 4L5FH 4KJQC 1IEAA 1WFOA 4HUMB 4Z95H 1IGJA 2JE8A 4JQIH 3DURB 3Q48A 3GMMA 4PRHE 1ZLVK 4PJGB 5IHLB 1HYSC 5CIPA 3HNSH 1GGCL 5FECA 4OFPA 2VAJA 3BP4B 2X4OB 5KS9E 4ONGL 2UWEE 5SV3A 1FG9C 2DQEH 4X7TA 4IOIB 4JFFA 4LIQH 2YRLA 4MMXC 4NQEA 4KJWC 1HXMA 4LCWA 1MRCL 4LP4A 4EUPG 3I3EA 3MRJB 4YDJB 1ZLUH 2NY3B 2BY1A 5E8EB 1OM3H 4YE4L 1MOEA 4G6FD 4S2SA 3SDYL 3RKPA 5H94B 3L3JA 1QSFE 5MENE 4XC1L 3IDNA 4KWUA 4Z7UE 4L9DA 4RGNB 2OR9H 4Y16B 3IKCB 3VD7A 2KZ1B 5IB4B 5EZIL 1LGVA 1TNMA 2UZIL 1F4AA 3G5XB 3HUJB 43C9A 5ANME 3INUL 2NY7L 1HYSD 3DVNB 1T0NA 1FPTL 5E6IB 5FYLE 2NTSP 2P5EA 4FQXC 1N3NA 1CGYA 2BVUA 3OJ2C 5JW5B 3P4OA 2RB8A 4E9LA 3P0YL 1S7WA 2PXYB 3OKNB 3EYOA 1Q1JH 1ZGLP 5E56A 1U2HA 3CVHB 2BSTB 4XCNB 3RDTC 1NC2A 3QEQD 5FV1L 4N5UA 4R0LB 1VFMA 4D0DB 3LQAC 3U0TA 3FB7A 3M1BB 3WJJA 5FYJE 3SE8L 1QLRB 3PHQA 2BSED 4WGWB 2ADIB 3O41A 4KJYA 4ODTL 1CXEA 1S9WB 4NP4H 1VA9A 3TV3H 2QEJA 3AREA 4PGZA 4X9HA 5FYLL 4PGEA 5T5FL 4FQPA 3PE9A 2APVA 5AZEH 3F8UB 4MD0B 1GSMA 2OX5A 3WNKA 2X70B 5SX4H 4NQTA 3QDME 3CMOH 5INCB 1BQUA 4WVRA 4S1DC 1JBJA 3MPCA 3JV4B 2JCCF 3WUZA 5K9QG 4LL9A 3C09C 4WHYG 3RWIB 4XMLL 3O8XD 3QJHA 3FQWB 1U3JA 4PTTB 3P9MB 4HKJB 4HJ0D 1WLHA 2ZCHL 4MCYB 2W60B 4IDJH 2ZJSL 4N8VA 3G9AB 4YZFF 4NQXA 2JF1A 1IBGL 2CXGA 4DQOL 2HH0L 3OG6B 1BF8A 3EO1B 2IEPA 3EZ8A 1KEMH 1AP2A 3T04D 4QHMA 2ZUTA 1WC7A 2AV7A 3O9WB 5DEZA 4PGCA 1EUUA 1MRDH 3RVUD 1DEEA 1NJ9A 5JORB 2E7CA 1G7MA 4G9DB 2GJ6D 1F4WL 2AJZB 4ZUWA 5E2VL 3RA7L 1MCBA 1D9KC 5C0DB 4NN7C 3HPLB 3B4NA 5CSZB 4OCNC 3LQZB 2APWA 5DTFB 2X7LB 3EFFA 4AEEA 1G6VK 4DZBB 5D2NA 1QFOA 1Q9OA 3DRQB 3VGEA 5CEZE 1CL7H 2R2EA 4WWKA 3QDJB 2XNAB 5DQ9B 2QSCL 3WLWC 3QEHB 3LCYA 4QHKI 4PJEB 1NC4A 4H0IA 1AQDB 3TH2T 3T0EC 3VXMA 1KTDA 3HLAA 5IB2A 1RUKL 1YMHA 4NC2B 4P49A 5DO2D 1EZVX 2OBGA 1MQ8A 3H6JA 3RWDB 2R0ZL 1EV2E 4OF0A 4JHAH 1INQA 3KXFE 1DEEB 4KDWA 1WZKA 4LLQA 2XTJD 4Z7OF 2NZ9D 5A3ID 1KC5L 4EI6B 3U83A 2ZKHL 4ENED 1YPZE 5DDHB 5FO9B 3LKPA 2AJXH 5CIPB 5IKCB 4TUJA 1CWVA 2UYLB 3VA6A 4X6DB 1OTSC 1J8HA 1BZ7A 3TNMA 4N8PA 4X6BA 3BDYL 4L4VE 3ARQA 2ICWA 2ZOKB 3VJ6B 1BZQK 1KIUA 3ZSTA 4UT7H 1NCCH 4MNQB 2GSGA 4Y5YA 4GBXA 3B5GA 4BZ2L 2MQ0A 4DK6A 4D9LH 3C5JB 1Z5LA 3JV6B 4N5ED 4XI5C 2B4CH 1X5KA 4M6OH 4EOWH 5E5MB 2XXCB 1KN4L 1KV3A 5D1QC 1T0PB 4Y4HD 1LNUB 3NIGF 3C2AL 4HV8A 1ES0B 5KSVB 12E8L 1OAKL 2HTKD 4TSBH 4PJHB 3PHOA 5C08B 1AGBB 2DM7A 4U6XB 1H3PL 4K8RC 1E4XH 4LLUB 5BS0D 4LNRA 4ODWA 4JFFD 1BJMA 3HUJE 1QFUL 1CXLA 4JZJA 3FQXA 4Z78A 4BYHA 2LU7A 1N8ZA 5ISZE 1UCTA 3LV3B 1T66C 3VXUA 3HE6D 3E2HB 1HHGA 3J8F7 1MY7A 3S36X 4MJ4A 1UZ8B 4PJ8A 2AV1B 3WXVH 3VD3A 2UUDK 3QHZL 3PGCB 3S5LG 4Z7VB 2QSVA 4GBXB 5ECJE 2AJVL 4NSKB 3TT3H 1P84K 5T1KA 4DKFH 2V17H 3W39B 3IU3B 3KYNA 4F8QA 5ACZB 3BWUC 4PRBA 1BD2A 1U6AH 5IGXH 3QEUA 4IM8A 2IH3A 2DJ4A 4ODUB 5GISL 3QEQB 4AY0A 2YMXL 1NFIB 2AQ1A 2NR6C 5CHNB 4XP5L 1PQZA 3RVUC 4OGYL 4Y1AB 4NC0B 1UFUA 5EUOB 5CD3B 4ZS7H 1FFOB 1QVOA 1YECL 5GJSL 5JIHA 2OL3B 3TN0B 4L8CA 4TSCL 3VH8A 1B4JH 2AKRB 4ORGA 4Q9QH 1QBAA 4PJ9A 4IRSA 4M6ML 3T1FB 7FABL 3SO3B 1UWXK 5J9PA 4NQSB 3A67L 5I76A 5FO7B 1MRFH 2IAMD 1RUML 2AV1A 1I3VA 1DUZB 1ZT7A 1D6EB 3LKSA 3DSFL 3QIUB 3IVKB 1YJDC 2OQJA 5T1MA 3GSUB 3GSXA 4QXGH 3L5XH 5HDOA 3G5YA 3HE7B 5INDB 2J88H 3OKKA 1A7PL 3CVHL 3FTGB 4TUOB 1FVDA 4U1HA 4OLZH 5HD8C 4MA7L 5ERWA 1PJ9A 5DJ8A 4G8FB 3S88H 5L2KD 4PGCB 3HE7D 5GGRB 2EDDA 3ZE1F 4JRXB 3ULUF 2R29L 5ICXA 3R8BB 1J7VR 1DQQA 4RGNC 2R8SH 1CD0A 2BNRE 3N06B 1NCDH 2WUBL 4L3EA 5JLZB 2FHCA 1I9JH 1ZLSH 1KPUB 1CGTA 4NM8L 2AKRA 4ORGB 1G7IB 4Q58C 1VESA 2R1WB 5KAQG 4M02A 1CFQA 3TCXA 3WFEH 3DRQA 3MYZA 1ACYH 2Z8SA 1YUHB 2XWTB 3U6RB 1E6JH 3UTPD 5C9JA 5F1OB 4IOFD 1YY9C 3BIKB 4LARH 6CGTA 4JO4H 2OQJB 1NUGA 3IDIB 1MAML 1NL0L 5K9QI 1RZ7H 2DQCH 2VXUL 3RIFF 1CXFA 1LEKA 4K7PL 4U1NA 1QFPA 1XGUA 3LKQB 3O3EB 5ERWB 2HLAA 1Q72L 1WWBX 4XMPL 1E0OB 3BD4A 5FYKH 4XNYL 5DEGA 3VXQB 1Z9OA 2PYEB 4PJBB 5I8EA 1QFWM 2C7UA 1DQQB 3RWHA 5BS0A 4LLVA 5CP3H 1WICA 3LN4A 3RKDD 3WHE1 4X6CF 1G6RB 1T5WB 3NZHH 3MRRB 1CICD 3O9WC 2NYYD 4BKLB 3QUXA 5E08H 5F9AC 4H25B 1A4KB 5DJ6B 3RX8A 2XKSA 5SWSA 1RFDL 1LEIA 5C0EA 2VLKD 5ANMA 2W9DL 4LGRB 3DSFH 4M62H 2C3GA 1ZHNA 1JZ8A 1AI1H 3RWEB 1QUNA 1G7PA 1NAMB 1TVBA 4WNQB 4TQEL 3ECBB 4GMSL 1GHFL 3DOSA 4HWZA 5FA3B 2OI9C 3P11H 3I3BA 3AUVA 1NCAH 4NFBA 4HGWB 3P4OB 4P23D 4WIQA 1MLBA 1GH7A 5BXFB 5KSBB 3BP4A 3EFDH 4U49A 5DSCA 3PWPE 3FN0H 1U91B 4W70A 2EIEA 3CPLA 4PRPA 2EXWD 2EDEA 3G08A 2PCPB 4Q9CA 4D2NA 3LN4B 1T6VN 4YXLH 4FXGA 5EN2B 4PJ8B 4NT6B 1IC4L 5TPWL 3WFEL 4CADB 4OI7A 1VACB 3QUYD 1QSED 4O4YH 4P3DA 2XIDA 4U2ZA 1OWWA 4XHJC 1KJ2A 3OAYK 4JN2A 2ICEA 3QDGE 4J3TA 1T2XA 1YNTA 2QQKH 4P5TB 2X05A 1I75A 4R4FH 3D69A 3TA3A 3ZDYF 2EXWC 5E6IA 4KDTC 2I26N 3QIWA 4YQXH 3H3PH 5ESQB 3FQUA 4XPHH 1OVZA 2E3VA 1XF1A 3T0EB 3QCVH 1Z0NA 3ALPA 3WFBL 3DJ9A 4LLMB 2VDPH 4HUVA 1JZ7A 2KH2B 5FHAH 4XNYH 3QDJD 2X40A 5EB9A 3G6JA 4MD5A 3HI1B 1HK6A 3LHPL 1CFTB 2EDYA 3QG7H 4NPYB 2R2HB 4Q0XL 3CSYB 5J6HA 5IVXA 3QHTC 1OT1A 3WFDL 1P7HL 1LO2H 5E9DE 3FQTB 3FO0H 3RNQB 2JCCE 1AXTL 1MI5A 3HZKA 4JM2C 4QHNB 1I1AD 2DQTH 4G80B 3VE0B 1MQKH 5F8RC 4CAGA 2K7QA 2O5ZH 1YEEL 2JCCA 5C0FB 4O2FA 2E9IA 2EYRB 5F1NB 1KUMA 1ONQB 4XWGH 2EYSA 3O9WD 3DHJA 3QUZB 2Z93B 3GMLB 4OZIE 2NX5B 3FTGA 3KS0J 4TUOA 2VE6A 3ZSSA 4F15B 1MVUB 1YEIL 2Z8WC 1KCRL 4BQCA 3S3JA 3QUMH 3FB5B 2FZ3B 4YDKH 2ATKA 3UZEA 1K8DB 4P59L 3L5HA 3V5KB 1OWRM 3ZTJH 4Q6IC 3CFEB 5IROC 3O45B 4JFEA 4XBPB 5E4IA 2K3TA 4JANB 1HSAB 2A1WH 5ESAA 4HUXB 3FOMB 3RL2B 5JR1L 3GIZH 4Y19E 4I77L 5F93C 1LK3H 4UTBL 2Z35A 4DGIH 1XH3B 4KROD 4UT6L 4X6CA 4KHXH 2CH8A 5C0GA 1R0AH 4FQIH 4KROB 4X8JA 1XCTA 2YPKB 4YK4C 4PBXA 3U46B 3ZMRA 1C1EH 1UQSA 4Z7VF 3BPOC 3CVIL 3JVGC 4NUJB 1RD6A 1LE9A 3MRFA 3QIBA 1RIUL 4NN6C 2AXHA 3SJVD 1TZGH 3K4ZA 3SQOH 3QXDA 1MWAL 2ITCA 3UTTD 5IJVB 2HVJA 4LPXA 5C0FA 5D2NC 1CDHA 2VN4A 3QQ4B 3SCMA 2R9HD 1C12B 4L4VA 1FGNL 3NPSB 4U3CA 2UVEA 3I9GH 2B39A 3O3EA 5DJAB 1KIQA 3LEYH 4UNVA 2E7LA 4F33A 5D7IE 3NIGE 1DBKL 1D9KA 1KJVA 3HE7C 3ABZA 3PV7A 3IS0X 4S1RH 2AQ3A 5FUCC 5E5UB 4F80A 3QEGH 4PLJC 5D7LD 1M7XA 3HNVH 4BZ1L 2XZAH 5B39B 4JANA 4OIIL 3MROA 2FHBA 3QXVA 4ZYKB 2YSSB 2MCG1 5DHVA 4WI8A 5D8JH 2VXSH 3BGAA 1A1NA 3DBXB 4APQB 1JGLL 4GXVH 1WV7T 2L7UA 1GGBL 4L9LB 4F7MB 1MQKL 1Z0MA 4JO1H 1OF2B 2O5ZL 5ISZD 4C56A 4WHCA 5F9JA 5HHNB 4I18C 3BPCB 1BQLL 2Q8BH 5IBTH 2VL4A 1LO0H 4GAGH 2B2XH 1KENL 2R4RL 3NCYP 3OF6D 4ZXBC 1JWUA 5IWLA 3CMOL 1IGML 4OJFH 1Q8MA 3CFBA 2WIIA 5IVZA 3FFCA 4G8IA 3UBXI 3ARFD 1J87A 4XBEH 4NRXB 1BOGA 4ZTPH 1W0VB 1QLEL 3NCFB 3IT8D 4I77H 1IKFL 2GFBB 4UT9H 1LWRA 1CXHA 3HUJF 3T2NL 1IBGH 3PQYB 1QNZL 5DVNA 2D3VA 1RVFH 5FB8B 2DBLL 1CLCA 1RIUH 4WFHD 1F3DH 5DMYA 2LV4A 2BRQA 3JTTA 4JN2B 4OZFH 3S34L 2EO1A 1OLLA 4YXHH 1AIFA 5FM5O 1U3HB 1EFQA 5D6DC 4O2CB 5D71L 3IDJB 3JSSA 5JA8B 2V7NB 4GRWE 3VXRD 1JGUH 1LDSA 5FUCE 4UV7L 1U42A 3QRGH 2EH7H 3BVNA 3RA7H 1NAML 2HFEA 1HHGB 4BSWA 4O9HL 4NHCL 1EGJH 3T77B 3V7MA 4HIIB 4R4BA 5JHDB 3PF2A 1X9QA 2VERN 3KLSA 3WS6A 3OGCB 3NN8A 3FB7B 3M1BA 2VSDA 4MCZB 2P7TB 4WUUA 3HNVL 2VLRE 2X4SA 3OB0H 4OM0H 4KAQL 1U8MA 3L3DB 2E6JA 3R06B 1UJTA 1UXSB 2AK4A 1OTTC 2WBJA 3RDTA 5ETUA 3VXPB 3LH2L 1IAKB 2IPKB 4ERSL 1NJ9B 1LP9E 4QXTA 1NBVH 4LKCA 4I4WB 3EO9H 3M17B 3C2SA 4Y1AA 4RWYH 1UEYA 1HQ4A 1AIFB 2Y06L 3MJ7A 5I15H 1QVOB 4PLKC 4AIOA 1GRWA 4ENEC 4X9BA 3X3FL 5CEYA 4NO3B 3MRKA 4R2GB 2VXTL 4KXZH 3E6HB 5MERA 4BELD 2DICA 1T4KB 2XPGA 3HMXH 3SJVB 4M1DH 3MV9D 5D2NE 1ZT1B 4EDWL 3IFLH 1ZOXA 1X7QA 1U8IA 5H8DA 4R4BB 4P46B 3B2VH 4XAWL 4YGVB 1JNLL 2V6HA 4G6ML 4QF1B 4JFHD 4M7LH 2DMKA 2ADFH 3SGEI 4NQVB 15C8L 2VLMD 2I25N 3L3DA 4LRIA 4JKPH 1OAYL 4AM0B 2Q7YB 5KAQF 2IAND 3Q5TA 1F13A 4M6OL 1P7QB 4F3FB 5C08E 1KN4H 5FYKD 4YHPA 4K94H 3GMMB 1I8LC 3BRDA 2IPUK 5HI3C 2FBJL 4YHOL 1DR9A 4HG4K 3C87A 5KVEH 1ZWIA 3RGVC 1U8NB 4PRIE 5C71A 2EH7L 2ZUQC 5J89A 4OV5B 3P40A 4O9HH 3VFVB 1IT9H 1T22B 1A3RH 3MRQB 1CFQB 2GEEA 3U4EA 5F7FA 1CLOL 4GRLA 3BOVA 3JBG7 1N59A 1OP3H 2A77L 1D5BB 2BHYA 3MLZH 4WCYH 4E0RA 4RISH 1PSKL 3ZT6A 4JFDA 3WL9A 2NY4C 1S7RA 3JWDL 4YHLL 4MB5A 5L8JB 3LKOA 3OV6A 5KZCB 1DQLH 3QISA 1WAAE 3G5XA 3HUJA 2IBZX 2QQQA 4MQ7A 1YC7A 5FHBH 5IKCA 4OKDA 1F11B 1CLZH 4MB4A 1MCRA 3FKUS 3G6DH 2EYTB 4U1GB 2GSIA 4GG6F 5T1LD 3SOBH 4FG6D 3DGGA 4JFPA 5JMOC 5HVFB 3OQ3B 1NUDA 4J3OC 5DD5L 2G75A 5GIRA 4B5EA 3IDXH 3CH8A 4KC3B 4YDJA 3WFCL 3FQNB 3BPOB 3MJGX 3ZL4L 5I1EL 2DKUA 1T1XA 4GW1A 3OKMB 5F1IB 4F57L 2MQ3A 4TSCH 4NWTH 1DQML 4OV5A 1N6VA 1LDPH 2AJYH 1CD9B 4PV8A 3PWJB 4G43A 1CT8B 2QQNL 3K8KA 1S7XB 3HNTL 5EDXA 5HGHB 1MI5D 1EBPA 2F19L 3BKYH 2MPAL 2YD2A 2CD0A 4WI6A 2BRRL 5LBSL 1A7NH 5TQ0L 4CRPA 1CGXA 2Y6SC 5GGTA 4H5SA 1YYLL 3WMSA 5HGAA 2J8HA 3NCJH 1CVRA 2EDNA 5I75B 4PJEF 3H9YA 3REWB 3VH8B 4PJFA 2H32H 4XVSL 4LPVA 2HLFD 3VXUB 4U1LA 5K9KB 3K7UA 5JW4M 1BFOA 3JWOC 5A2LH 5HBBA 4NSKA 4XB8A 5FYJD 1S78D 4WFED 1V7ML 3LD8B 5IF0B 2WUBH 1FV1B 4A2MA 3VRJB 4F9PC 2COQA 2AJSH 1UH3A 1A3RL 4LAQL 2XOTA 4QHNA 4PGEB 2B5IC 4XP1L 4EI5B 4ZTOH 4LCCB 4QY8B 4KQ3L 4MQTB 4PJAA 2ATPB 3C8KA 5EC1B 4LHUA 3LZFH 1FVDB 1PD6A 4WY7L 4HIXL 2AEPH 4JPKL 2PO6A 2NLJB 5KN5A 3ZDXF 2DTMH 1I7ZB 3QXTA 1W0YT 4E41B 2VZVA 3TN0A 5GSRB 3RL1A 2P42B 4GRLC 4PJDA 4PP2A 2WBKA 3GSNH 3WN5C 1MF2L 5C7XL 1CLZL 4HUVB 2ITDA 1EUTA 3B9KB 1NAKL 4L3EB 3GMQB 1HQ4B 1I7TA 3B83A 3ZO0A 3RNKA 3SGJC 1G9MH 2WUCL 3ZL4H 5I1EH 5EU7E 1Q9OB 5B8CC 3VFWA 5TFSL 2CRYA 3MUGB 1XGRB 5D1ZA 2FIKB 5A2JH 4JY4B 1T80A 4JY5H 2DRUA 1LDPL 3NZHL 3STZA 1WTLA 3MXVL 3KPOA 4XVJH 5CJ5A 2YWYA 4JPVL 4EQ2A 2O5YL 3MGOB 2OYPA 3WDHA 3EUUA 4XPFL 4X8XA 2QQNH 3D9AH 1D5MA 4OF5A 3TO4A 5DUBB 2W9DH 3SDAA 3MREA 1R3JB 4M62L 3C9NA 1QHPA 1CDIA 2NXZC 4GLRI 4U3HA 4HS8H 1YDPB 4ODVL 3DECA 2NY6C 5JNYB 1RU9L 1HCFX 3RFZC 1DANU 2A6JA 3P11L 1W0WA 1AC0A 3FONB 1N6QH 1FFPB 1U92A 3GNMH 4OUUA 5EC2A 5I0ZA 4DZBA 3RZCC 3DI2B 5J13B 3OXSB 3VA2C 1FZOB 4HJJL 4JKMA 3MLYL 5D6DA 2Y5TA 1NUNB 3HE6B 1W72B 4BSVA 5F88A 1IC5L 3BQUA 4XZUB 2VITA 4S1QL 1LD9A 5CJOH 3BDXA 4NQCB 3AAZA 4NBXB 3UTZA 2IBBA 3LQMA 1WK0A 4E41E 5IB3B 1KTDB 2HAZA 4FXKA 4C56E 4QCIB 4YUEL 2R69H 4Q6YA 1FDLL 1JN6A 3OX8A 2Z31B 3TH3T 1BIIB 3BZEB 1NLDL 4HS3A 3KXFD 3W5NA 2ADGA 4WY7H 5D1XD 2RQ8A 1ZE3C 4TNWF 1MCLA 2F5BL 2RAMA 1JF1A 4HLJA 5DFVD 5I8KH 1EHXA 3LRGA 2Q1EA 1QFHA 1T5WA 1SVZA 2J8OA 3RRQA 5C70A 3BHBA 2X89A 5D96C 1TJGH 4LLVB 1D9KB 4LVNB 4CVZB 1LO3H 1A21A 5A40E 3QCVL 1LEIB 4FQHA 5F89A 4DZ8A 5DJCB 3JVGA 1IKNA 3V0WL 4BK5A 2FATL 3TVMD 3WFHA 5TF1H 1ETZA 1U8KA 2Y1VA 2I9TB 3NGBB 5TFSH 5FA3A 4KK5D 2W0FA 2HA1A 4KDTA 3P73B 3CH1B 3PWJA 4DKEH 1AKJA 2GUOB 1AXTH 3ARGD 5HGBB 3L95B 5IESH 1QSEA 2FH8A 1B88A 4X99A 5DZOA 2V2WA 5DZNA 1K6QL 4ODVH 2ED9A 1MCPL 4U1KA 1HIML 1UA6H 4TPRL 4K9EH 5FOBB 2BCKA 3O4LA 4ONFH 4RMVA 3PHQB 1QLRA 3DUHA 3CDGA 1I7RB 4K3DL 1IC5H 2ARWA 3MJ9H 4PJXF 2ENSA 2BJML 2KDGA 1GOGA 3EJYC 1P7KB 3C08L 1S8DA 3ZHKA 1B2WH 2VXVL 1S9VA 3QH3B 3ARYA 5I0DA 2R69L 1J0JA 3O2WH 1I4FB 4UBDD 5HYSG 3MV7B 3ES6B 4YHKL 2BK8A 3ARBA 3D69B 4L3CA 2Q76A 5IT2L 4PGBB 1MHCB 1F8TH 2Y4SA 1S78C 2HP4A 1AE6L 2EEDA 1BWWA 5F72S 3JV0A 3MV9E 5ESQA 2NY4B 1DFBH 5I74C 1K8DA 4WFGE 3OBAA 2NZ9C 3WXWH 5A3IC 4U6VL 3EOAA 3T1FA 4CN1A 4Y19A 2AXFA 2DLHA 1DL7L 4ELKA 5JLZA 5F6IC 2PO6D 5MEOA 1XR8B 1F4YL 2V5SA 2J6EA 1S7TB 3QQ3A 1T04A 3PL6C 1XIWB 5DO2C 3RVTC 3WHXB 4DVBB 4KQ4L 1GYAA 1AD0B 1H15B 5EU4A 2HG5A 2UZXB 3HC3L 4HX1B 2R1XB 2FJHA 3D25B 3V0WH 5ICZB 2IALA 3HI5H 3O0RL 5JW4N 1FFNA 2A0LD 3SDAC 3EOTL 3PG2A 1MI5B 3HZKB 5K33A 3SE3C 4RGMB 5IQ7L 4AM0A 1YNLL 3T2PA 3WIHA 2ZSVB 4QGTA 4OFDA 4ZFFA 4G6KH 1JGVL 2DBJA 3DPBA 4H1LB 3WNOA 4L3ED 2C1OA 1XZ0A 3BYYA 3LPWA 1ZKAA 3UC0L 4GBXD 5D1ZC 3KXFA 3PV6A 3K2MC 4FOMA 3MRLA 4G9FD 1F42A 3QIBC 3B43A 2FBOJ 5KW9H 3MRKB 2ZUSA 2B5IB 1AD9A 4EI5C 3CLFH 1MCPH 1OARH 4L8DB 3KYMA 4JFYB 4U2YA 4DEPC 4Y19B 2VXQL 4Y4HA 2CLZB 5DD0H 3S97C 5F7YC 3WDJA 5D7JD 3ESUF 3TN0C 1Y0LA 2LAGB 3V52H 3K1DA 4X7DC 2GJZA 1QQDB 3TH4T 3ZYIA 1XCQB 4QO1A 4RFOH 3BZFA 1NQBA 1LD9B 4Y4KD 4DJMA 5E24E 4NIKB 1KB5A 4P57B 3I3DA 5TE7H 1UWEL 4GKNB 4I0PD 1HOCB 5E95B 43C9B 2XZQH 5EORH 3D3VD 4OZHB 2DJSA 2VZ1A 4RZCB 3UPAA 1FORL 1HSBA 3PJSB 1XGYH 1HHKB 3GMPB 2CJUH 4ZD3L 2VOTA 3HG1D 1IJ9A 1U91A 1P2CA 3DGGB 5KSBA 4PG2C 4LKXB 3DLQR 3LRSB 4ALAL 1NC2D 1HDMA 4HXBL 3C8HA 1NGXA 2PW2B 5E9DB 4LLWB 5KOMC 1IARB 4MQXC 3G6JF 3VFTB 4QEGA 1CE6A 2OJZH 4X80L 3VDBA 5I1IL 4X4ZA 2ZCKH 1I7UB 4QWWC 4PJEE 1A1NB 1JFQL 3DBXA 2XTJB 4MJIB 3GMNA 2BVQB 1CGVA 4OQTA 2VZ3A 3WIIL 4NHCH 4OQ1A 5E5MA 5AAWA 5E7BA 2BZDA 5ILTL 4R8WH 5FYJU 2J6EL 1E4JA 2Z8RA 3ARTA 3FB6A 2BVOB 1CFSA 2VISB 2PTTA 2W0FB 2OTWB 5D93C 3RZCB 5J13C 4HGWA 5DMIL 2VDLH 3F7VA 3LKNA 1W72L 3VFOA 4PV9A 4XH2B 4QRRA 3I6LE 3U0WH 1JI1A 3KJ4B 4IIQC 2JK5B 4TN9A 2QSTA 4J1UA 1C5CL 3BPCA 1X5HA 1LEGA 1NBVL 5SWZB 3I75B 3L6FB 3LSOA 2CMRL 3CSBA 5KZCD 5J4MA 5KW9L 4LOUD 3VFNA 1A6UH 4PJ5E 4LDEB 2Q7NA 4APQD 1A0QH 2D7PA 4DW2H 2DLTA 4L4TA 1CFNB 4NN5B 4J23A 3D85A 3T65B 5LGKA 3DHMA 1Q0XL 1SJHB 5DC9B 4DKAA 3N85L 1BVKB 3HMXL 1YN6A 2PYFA 5DF0A 3K3QA 2M8XA 3RNQA 1R5IA 1FIGH 2NPLX 3U4BH 3EJYD 4RDQF 5DUPH 1UWEH 3DUUB 4Y1AE 2EXYD 4KKBD 1U8JA 4G7YL 5FB8A 4K2UL 5EPMB 3BGFC 2PTTB 1S3KH 1EFXA 4K7PY 4FNLL 3QFDB 3MR9B 1PEZA 3O6FC 5AD0B 1VGEL 1UXWB 4JKPL 2HFTA 3A6BL 4CU8A 1KSRA 4HQQH 3LQZA 2CDEA 3WO4C 1WBYA 5D7SH 4UILL 5ADPL 3GHEH 2OK0H 1U8PB 2XQYG 4WTZA 3QNYB 4GW5B 4DTGH 4LVOB 5FO7A 3H42L 1T7ZA 3SDAD 1P84J 4UZGA 5GS2H 3GSUA 3ARWA 3KPOB 2NXYB 3MUJA 4Z95L 3U46A 1L6ZA 3LS5L 2KUTA 1XGUB 1F58H 1WAAF 3NGBC 1MJ8H 4I9WE 1DBAH 4MZ2A 5HDBE 4B7IA 5IFAL 2ICWI 4KRLB 1O0VA 4M6AA 4P5TC 3AS1A 1N0LA 4XI5D 4K9EC 5DA4A 3LDBB 4ZXBD 5DLML 3BD3A 1OB1B 1R3HA 2DDQH 2ZOLA 1DN2A 1Z9MA 1SJVA 2D7OA 3VWKC 1N5YH 3BQUB 4RGNE 5IJKA 2R1WA 5F44A 2B1AL 3KYMB 1AC6A 4BUGA 2A6DA 1JHTB 4YIQB 4Z7NF 1AGDA 5ITFB 4M43H 5FKAB 2FX8L 3BKMH 4LSRL 5DRNA 3NTCL 3UX9B 2CKNA 5IMMA 4Y8DC 3PWVA 2K7PA 4ETQA 4NO5A 5EU6D 1ZT4A 5EBLB 2GAZB 4QRSA 1MJ7H 1T7YA 5I74B 2AW2A 2FL5B 4HIJB 1RAMA 1ES0A 5KSVA 1OW0A 1YEFH 4BM7A 3LN5B 4JFDE 5DUBA 3SQBA 4RMRA 1HNFA 1HSBB 3V6ZB 1L9NA 2BSTA 1YDPA 3OKOA 3BP5B 3KPLB 2WMPA 2MPAH 2Q20A 1VCAA 5LBSH 2P44B 4CN6A 1IZKA 4DKDC 3DSNA 1YN7B 4LRIC 4HQQL 1ED3B 2HT2C 3NFSL 1FNSH 2XFXA 1QSVA 4NP4L 2GITB 3TWCL 3GBNH 3TV3L 1A4KA 2J8UA 1WCBA 2A9MH 3QDGA 1U95A 1I9RH 3OKLB 2OR8A 3B9DA 1C08B 3O6FD 2ICEB 1DBBL 4JM2F 4MNGE 2EE9A 1T0NB 1P4IL 4WI3A 1QLFB 4LAQH 1Z9LA 5CP7A 5C6PB 3VFGL 1IGCL 5HHXH 3ZDXE 1UWGH 3EYSH 4M3KB 3MNWB 5DRXB 2FJFB 4P23B 1DBAL 3AM8A 2IBGA 1DQTA 3HAEG 4HPOH 4X98A 4LQFL 2OSLB 1KJ2H 3VFSA 4ZOEA 5J6HB 3NA4A 4N0CD 2O61A 1AP2B 3W82A 25C8H 5FOJA 2JJWA 4ZFGL 3SDDC 4PJCF 5HYJA 5KTEL 4QHMB 5H2BB 1IQDB 1FRGL 2HT4C 4XNXH 3O2VH 1J1XL 5KSUB 2DKMA 4HEPG 3PQYA 4XMKL 2VH5L 5KJRL 5D4QA 1RULH 2WK2A 4RFEA 5D6CA 3MA9L 1NGPL 4CMMB 5E8NA 1WCBB 4FZ8L 4FMKA 2AJZA 4JAMA 1NCTA 2VIRA 3QWRA 4QTIL 1F4WH 4PRDA 5EC1A 2YD1A 4HWEL 3T2QA 1ZEAL 1H0DB 1DLFL 1YEHH 4OLWL 4HEME 3CFIC 4MA3B 1A5FL 5HHVH 4JY5L 3AXLA 1PY9A 2PYED 1IGFH 4PGJA 3PGDA 5KVGH 3SKMB 5DD3L 2E6QA 4KTEL 1KJ3H 3EOAB 5CMAA 5D1QA 4NC1E 2UZYB 2O5XH 3TC9A 3GUTB 1I1CA 3BW9A 5TDNB 3LQAH 3QEHA 1LHZA 1ADQA 4I18B 3ALXA 4Y5XB 2X4TB 5JUEL 4EVNA 4RBPK 2RJMA 1MIEL 1M4KA 4J2XA 1BOYA 2AK4D 3GNML 3RDTD 4KU1A 3GBNL 4ZO9A 1VEMA 2DIAA 1KPRB 2BMKA 4HS6A 3I50L 4X7EC 2Z92A 1H9VA 2DI8A 3FZUC 4RQQB 1QSZA 4NGHH 5H37H 5DR5H 4Z18A 3HB3D 4EZMA 4ZDHA 3VDAA 4OF3A 2XTJC 1J0ZA 1LE5A 4Y7MA 5EU3B 3NH7H 1GGUA 1IAIM 3HPLA 3PGFL 3GHBH 3WKNA 3WUWA 5CJ8A 1A7BA 1MJUL 5EIQA 4JO2L 4MAYC 3E6HA 3QJHB 5MERB 3VGAC 2W0KA 1AY1L 1L0YA 2H8PA 4FG6C 3PP4L 3OJDA 4CDGC 4R96A 4W6YB 3KJ4C 2XWTA 2Y72A 1UM5L 3HE6A 1WFNA 4XWOD 2BOBB 4P4KC 5E8PA 4KJWD 1J1PL 5HSFA 4H8WL 3BIAX 4PREA 1IM9A 4ZFGH 4ZYKA 3ROLB 3FO1B 4JPWL 1IRAY 3EO1A 4JFHE 5DXWA 2I24N 4BQBA 5DD1H 4E42B 1QSFA 3MACL 4KI1A 2P5EE 5KVMC 1JZ5A 3SCMC 4FXKB 5IP4A 3MREB 2WIMA 3SDCC 4M61B 3DMMB 4G9DA 5I1GH 2R4SH 5D72H 3JUYA 4X5LA 4AQ1B 3UPRA 3T0DA 1A7QL 1BJ8A 5C0BA 5FECB 3Q3GB 4KTDL 3ARGB 4DKEL 4CNIA 2GY5A 3OKEA 3CNKA 5E2TL 1D6VL 4LSPH 1FL5A 1JIBA 1U92B 3BXNB 3BGMB 4NQEB 5F1KC 5EO9B 2OJEB 4MJ2A 1YN7A 4YBQD 4PJ9D 1V3LA 2YD7A 4DKFL 4LPWA 3I84A 1P5UA 3W39A 2KQNA 1KLGA 1I1YB 4MJIA 5F88B 3C6LA 5F3BB 1OGTB 2YN3A 5ALCL 3CFCH 3O6ML 3KLDA 1WIUA 1BD2B 3DX7A 2JJVA 4LASH 2MCPH 4QRRE 3VGFA 2ADGB 3BEWB 1E27B 3CUPB 5DMGD 4WDIB 2NXYD 2BY2A 1E6OH 1R3LA 2YPLE 4AEIH 4PYGA 1SM3H 3MJ9L 4OZHF 1RJLA 5GRUH 2HT3C 2ZPKL 3E0GA 4KKAC 1MFDH 3N1QC 2KZWA 5B4MC 4KMQA 4JREC 2V9QA 4X5WA 2HTLC 4MLSA 1ZLWH 4PJ5D 3W5MA 1EJOL 4N0UA 1XIWD 4Y0GA 3CXDL 3G08B 1CD8A 1FNHA 2NY1C 3MNVB 1OLZA 3TBSB 5CGTA 3ZKMD 1QR1A 4ZFOB 5IBLD 1J0IA 1IGTB 1X5FA 2AI0L 4WI5A 1JE6A 1VACA 1RZIA 5GS0D 3WXWL 3FQTA 2QR0A 4WU7A 4PR5B 4H8WH 4YWGH 4OD1H 4U7KA 5F3BA 4NQCE 2EDFA 4KTYA 2FWOA 3H0TB 1JWMB 3D0VA 1IAKA 2IPKA 4PIRF 1A3LH 2FO4B 1MI5E 3BJLA 3O3DB 3OG4B 1E4WL 4PRNA 4JCLA 4YO0A 3UTSA 1ULVA 3ARDD 4NZDA 4LLMA 3D87B 5F7EH 1TZIB 3NFPB 2V7NA 1JK8A 1OAZL 4HSQA 5HI3D 4CJ1A 4NO3A 1MIML 4R9HA 1KXQE 3W2DL 5GHWL 4DUVA 5GGQH 3MJ9A 5IEHA 3F58L 1MCCA 4WFEE 2OZ4A 4LCUA 4PS4H 3BISA 4AL8H 1F2QA 5CFHA 3BESR 1FCCA 4L4TB 4P9ML 4OZGB 2R1XA 4WO4D 5J1AA 5JXAH 3TCLB 4PJAB 5IFHL 1NFDA 3MRBB 4RRPG 3ULVD 1TXKA 2EDBA 3VG0H 3RUGA 1Q9KB 3BKJL 2PO6B 3DVIA 3ES6A 5DJYB 2RIKA 3KWWA 4QHLB 4JHWH 3GSQA 4RBPH 1GC1H 5HHPB 4DFIA 4GAJH 5C6WH 4LMQI 4Y2DD 3DYOA 2IMMA 5IIEA 1YMME 4O5LH 4JDVB 2DQJH 4JN1L 3MV7A 4DUXA 1IFHH 2XZQL 5EORL 5C0DA 3KLHD 1BPVA 3ARDB 2GTWB 1DBJH 1I7TB 1IC7L 4LPCA 2DF3A 2OL3A 2C26A 2YZ1A 4I0KA 3VRIB 3MLUL 3KYKL 4HGMA 4NRYA 4NQDD 4IMKA 3EYQC 3KPPB 2AJ3A 3JWNC 2ZCLH 3GKZA 4ZOBA 1CF8H 3WFZA 3QIUD 5J3HD 1ZT7B 3BP6A 3GIVB 1R5VA 3TVMA 1MREL 5I1LA 1ZSDA 1S7RB 2FL5A 4HIJA 1T7WA 4JZOB 2VLRD 4F2MA 1EZVY 2Q7YA 3OR6B 1P4BL 4L5FL 1MRCH 5CLWA 1QZ1A 4EUPA 4JG1H 5IBUG 2BVPA 3O8XB 4OI9A 4R8WL 4JFZH 3VWKA 4QOKE 2UWEF 2GSIB 3HNSL 3SDYH 1O5DT 4HMDA 4OT1H 5DMIH 3IB4A 3U0WL 3IJYB 1IM3A 3GDBA 5FM5M 5FDYA 4OLUH 4WUUD 4XZUA 1PYWA 1MVFA 3CX5J 4N8CL 2XWJB 2W9EH 4QRPE 3MRQA 5AUMA 1KCSH 4Z7UF 4O4YL 3KPRD 2CLZA 1U93A 1GGTA 5EZOL 3X14B 1EXUA 5FYJL 1EO5A 1XAUA 1YUHA 3U6RA 2X6MA 1YNTB 2FEEI 4LRNL 4E0RB 2X9WA 3BN3B 3IS1X 4NWUH 3CK0H 3MBEB 4YPJA 1FJ1B 3EJZC 5HGBA 1CFSB 3BKJH 3NCBB 4NRZB 1Q0XH 1BD2E 3BDBA 4PG2A 3KPNB 4U1NB 3FN3A 3V0AC 5HYJD 4M7LT 1YNKH 4EUPB 3QPQC 4GUPA 2IFGA 1UJ3C 2P8LA 2P8PA 5C08D 1CN4A 4JJ5A 4Q0XH 2HRPL 5LXGL 3DO3A 1J18A 2PCPA 2C3VB 3KYOA 5FYLH 2NXZB 1C5BL 4LKXA 1PZUB 5IF0A 5JMRA 1KT2B 2YUWA 4Y89A 5I30H 5DRZA 3U1SL 5I8OL 4QRUA 2GITA 4JR9H 3SE8H 4TNVK 5EBMA 4JCMA 2BFVL 3RY4A 1T1WA 1PVHA 4LCYB 5I9QC 3T4YB 3GHEL 4PY8I 4Z7UB 5IB4A 5EU7C 2WBJB 1U8QB 1FH5L 4YLQT 3PIQA 2VDKL 2VDMH 3RX7A 3MLVL 2ZCHH 3S4SA 4HLZG 3H0TA 2BNRA 1PG7W 3HMWL 5C0RH 5KG9B 5T3ZL 4FMFA 1P4BH 4DVRL 4XP9L 2QKIA 3SDXE 5CHNA 1P53A 3SGDH 4P23A 1X5GA 1ZGLA 5CD3A 4GG8B 3GM0A 5CEXB 4KK9D 3E6FA 4OI8A 1FVCB 1H3XA 4JM4H 1X3DA 3NOIA 4LSVH 4WI9A 3OHXA 1ZS8B 3H7BA 1VSCA 3V8CA 1VADB 4NNXA 5L2KE 5BV7H 3FO2A 2P7TA 1V5JA 2P47B 1FNEA 1XCTB 2YPKA 1X5JA 3CDGB 4KHXL 5IEHB 3BH8B 4FQIL 1U36A 2DQHL 2VDNL 2HH0H 2VAAA 4YGVA 4M5ZL 1K85A 1R5WB 3RY6C 4PRHA 5ITBH 4NHUA 3PDOB 1N5YL 2DLFL 4NQVA 3VU2A 1UEMA 1A9BA 3KPQB 5TGBB 2B1AH 4JFOA 3HAEH 1B4RA 2WWKO 4PJ8C 2F54D 3W0WB 2IF7A 1RZGB 3GSWB 1WWAX 4ZFOL 1MLCA 3BKML 3RU8H 2VYRE 3UJTL 2X4UA 2G2RB 5HJ3A 3IXAB 5J7CC 5GSVB 5HI5C 2HVKA 3TA3B 1JPGA 2FLRT 5GSRA 3RL1B 1F4XH 4KRPD 3NABH 3CX2A 4U31A 4HD9A 2AGJL 4B53A 3PV6B 5KVFL 1S7TA 2A73B 5MENA 5F7DA 5BMFH 5TH2A 1AD9B 1N0XH 1U8LB 1RUKH 4Y2DA 2L0DA 4TULH 5I73C 5KSBF 2CUMA 3QP3A 2Z4QA 3DV4A 4G9FA 3EYFA 4AJ0A 2F53D 1RHHB 4TTDC 1N2RA 3EO0B 2E7LC 4PRAA 3NFSH 1OGAA 1K4CA 3SDXB 4Y5YC 4JO1L 5DK2A 4RIRA 4ZFFB 1JV5B 4P57A 3BDYH 1I9IL 4Q7DA 4W4OC 5IVOA 2B1HL 3S3SA 2G9HA 4OTXH 4RRPA 3U7WL 2D03L 5I19L 3FAXA 5C0RL 5HGGS 3O6LL 4G6FB 4PJIA 4D9LL 2WIIB 2HLAB 1IE5A 3LIZL 4LLYA 3LPFA 4C58B 2ZG2A 3ROOB 1R3KB 2D2OA 3MRPB 4L8DA 1IGCH 5HHXL 2H8PB 2ZNXA 4G8GA 5IMKB 2ESVD 1SBSL 1MH5A 3WSQL 1TFHA 4JQVC 5IW1B 5EO1A 4JFEB 3GSNB 1DEDA 4ZQKA 5H35B 3C6LB 4NOBA 4UT9L 4BZ2H 3BT2L 2A9NL 5CKGA 3UTOA 5IB5A 3GRWA 3TPUA 2Q8AL 2B4CL 3PWPD 4OD2A 2LAAA 2R15A 1LO5B 1DQJA 1S5IH 3QI9C 2LABA 3MYJB 5JPMA 3S5LA 2FX7H 1REIA 4QRPB 5FKPA 4AENA 1KF9B 5FO8B 1RJLB 1T20A 2Z31A 4LP5A 3C2AH 4QRSB 1JWSB 1JV5A 1KTLB 1JGUL 4X9IA 3RU8L 1OQXA 3UJTH 1JJUA 3FHQA 2HVJB 1JF5A 2EIZA 2VQTA 3IFNL 1EH9A 4RMTA 2A83A 4OFYA 4HWEH 4FRWA 5C0IB 4UDTA 1I8KA 1F3JB 4HCRL 2BCKB 5BRZD 1S7VB 4OD3H 1IAOA 1HXYA 3B9KD 5EU6B 4MJ5A 5KVGL 4QNPF 2BERA 3V4UH 4JKLA 2E8YA 1BVKA 5LGHH 1N4XL 1WBZA 1G9MC 4FFVD 1NMAH 2FD6L 3N1FC 1DSFL 5SV4A 5B39A 2YS4A 4QRQA 2QJDA 4FQXA 4ZS7L 5CZVL 3QDJE 2I07A 3C5ZA 3LH2H 4JY6A 4QXTB 4XNMB 3MV8E 4ZFZA 2NQCA 1V3KA 4X4XA 3F7VB 3LKNB 4QRRB 4Q9QL 1FG2B 1U6AL 3UO1H 5MP6H 1TJHL 4ISVB 3EDEA 3MOAH 2Y06H 2N7AA 4XP6L 1K3IA 3W81A 4OZIA 1EEZA 3U7YL 2YA1A 3U7WH 1I8MA 5HTSA 3TBTA 1OTUC 1RUMH 3TLRA 3SKMA 1LP9B 4POZD 2PUQT 1S7WB 5E1AB 5CZXC 1MUJB 3QDHA 4PFEA 5E7FA 5H2BA 4QHUA 1A7PH 1RSFA 3U0PA 1FSKB 3NA9H 2JJSC 1D5XA 5FIEA 2AP2A 1RZIB 2RCSL 2IALB 1SEQH 3WN5A 5IOPB 1AJ7L 1JPFA 4NKIL 1RIVH 4HG4J 4KKCC 1YC8A 3HRPA 4KJYB 2W1NA 4U33A 1UM5H 3MNZA 4U6TA 1TPXB 3QIBD 3MCLH 4X7SL 2WP3T 4YHPB 3MGOA 3O3DA 1BVLA 3LB6C 3SGJA 2E5EA 2L7JA 3NFNA 3TJEH 2VC2L 3THMH 3QUYA 5D7JA 3C6SB 1A1MB 1PDKA 4GW4A 2NW2B 1FO0A 2A74B 2R0WL 3FB5A 4DGYL 1ACYL 5C09E 2MKWA 1FFPA 3WIHL 4MGXA 1G9NC 2PETA 3MQIA 3Q6FB 1I9JL 1NLBH 5DMKA 1SQ2N 1PFCA 3MUGA 4HCRH 4JEGB 1NL0H 3IDGB 1CLOH 4DAGH 2E9BA 2EICA 3QUZC 2ZOLB 2VABB 3RVTD 3LKSB 2BNQB 2GJ6E 3V4UL 1NKRA 5DMJB 3MMEB 4TOYH 3RWJB 4YXKH 5TE6H 1Q72H 4RNRB 1UB5A 4X6EA 5KSAC 5C1MB 4F58L 5FK9B 2XN9E 4JRYE 4QOKD 2JIXB 2QLVB 1F6AB 4NN5C 4HKZA 3O2DH 2DI9A 2H32B 2ZSWB 5C0BE 3O6MH 1I1FB 3SE4A 4JO3L 3X12A 4RMWA 1OSPL 3WNNA 1FYTE 2ENYA 1OP9A 3IJSA 2XQBL 3UZQA 3WUWB 4KROC 1H3GA 1UYWL 3FOLB 5T5NF 4AH2B 5KBNC 3RZCD 4K3GA 4QRPD 1OB1A 4XCEB 2X89D 4P3CH 3FT3A 4X6DF 5DGRA 2A6DB 4YIQA 1GHFH 1U95B 4XPBL 4OCSH 3AVEA 3I02B 4RAHA 3VXRE 1QSFB 1B6UA 4HKBA 4H1LG 3TA3C 5AG9A 1RFDH 2NTFA 4BH7B 4PUBL 4U1JB 2BNQA 1OSZA 2JLLA 4NCC1 5F96L 1MHPL 2H45A 3DMMA 4YDVA 5FGBC 1AI1L 1T6WA 4K71C 4D0BB 2OS7A 5F21B 4NRZA 1DQJB 4Z8FH 3MCLL 4X7SH 1SYVA 4JHBA 3UZVB 5DD6B 4YWGL 4HDIA 5HYEA 4ONGH 3ARGA 5F6HI 4UNTA 2DTSA 2EYTA 4HXAL 5I73B 3BAEH 5HHNA 4CL7A 4CVUA 1E4WH 5SWZA 2X42A 4PGDB 4ODSL 4PJBF 4H20H 4LK4A 4M48H 3TZVA 3K8MA 2XY1A 4DN4L 4K7FA 2HN7B 4G6AD 3JTSB 3JWOL 5GRWA 5CBAB 1OTUD 4M8QA 1G6RA 1AHWB 5IBLC 4N90D 1D5ZA 2DMCA 1OAZH 3P4MB 5ADOL 1HHHB 2ED8A 4PJ5A 3BIBX 3P73A 2H41A 3C5JA 3OB0K 1FO0H 1IC4H 1EXUB 4N5EC 2NX5D 4NZUL 4I1NB 4XBGB 2VQ1A 4JPKH 3DVNA 2PN5A 1X5AA 4NQDA 4ZXBB 2APXA 3ZDYE 3C5ZB 4OUOA 5HHOD 4F58H 1KTRL 3LEVH 2VZTA 1JPTH 1FZMB 1QEWA 1V3JA 5DJZB 3VFOB 1CXIA 2DQFB 5DA0B 3T0XA 5JXAL 3VWJD 4YBHA 1S9KC 3GSNL 1QRND 1OTSD 1TQCB 1H0DA 4HZLA 3UTSE 4DCQB 4OCYH 2DD8L 4YNYA 5JO5A 1WZLA 1RJZB 2JELL 5JOFB 1NEUA 4HK3J 1ZLWK 5FOBA 2E6PA 1AH1A 2UY7A 2X4TA 4M1GH 1Y18B 3IAPA 3U0TB 1CK0H 2IANE 3T3MF 1N6UA 2G75B 3LHPH 2DQJL 2YN5A 3AC0A 4HUUB 2OR7A 3MUY1 1IQDA 3RWCB 4PY8J 4XCYA 1KPRA 1ZXQA 1DBJL 1IC7H 2IANA 4FQQA 2FX9L 3SY0A 6FABL 1U3HD 1YEIH 3D0VB 5J06A 3MLUH 5T1KB 4P4RB 3UBXB 1ORSA 3D9AL 3RUGB 1J8HD 4JFXA 1FLRH 5F96H 2YD4A 5FYLD 3EOYG 3L3GB 4QWWD 1QRKA 4HS8L 4I2XE 1GOHA 1RU9H 4YEEA 2F8OA 2NCMA 3MR9A 1NFIA 3ULUL 3HFMH 5CEXA 3DETC 3NBNA 4M48L 5CEYB 2RBLA 3IAQA 3ZYZA 2F53E 4M93B 5E00A 5IVXB 3AAZB 3Q6FA 3QSKB 3UTZB 2JTDA 3DRTA 2HMIC 3D6GA 3G5VA 5C9KA 3QIUA 1N5AB 4P2QD 2X9XA 2ZG3A 2J3SA 4MNGB 1UENA 2P5WA 4GKNA 3CVIH 1FL3B 2C3WA 2VLJD 3TO4B 4ZNEE 1JF1B 2V7HB 1F45A 5FYJH 3PJSA 3VXUE 4C83B 4PRPE 1GZQB 5D2LF 1V7NH 5F7NC 4LLYB 2ATKB 2F58L 4I0PA 4O2EA 1FZOA 4JE4B 1CL7L 4S1DD 3TBYB 3A67H 1MCWM 1BZ9B 3MBED 5ISZA 2VXSL 1MWAB 1KULA 3TZVD 1TPXC 3SDCA 3A6CL 3MUZ1 3RNKB 5IW6A 4HFWB 1JHTA 3STLB 5IVXF 1TCRA 3IDYC 4Q74A 4BZ1H 3TIEB 4PB0H 2FX9H 6FABH 4MD4B 1ZHNB 5IK3A 5LCVL 4ETQB 1D3CA 4XAKE 4WHTA 5B8CB 1KENH 2R4RH 3VH8G 1RIHL 5ID0A 1JGLH 3D39A 3MJ6A 2GTZA 4GXVL 5GPRA 4CVWA 5AWNL 1WFUA 4TVPD 1T83A 1N8ZB 3BSZH 5GRJH 2D0FA 2HJLB 4LU5H 4PJFE 4O51B 3UPRB 1DQDH 3WE6A 1CGSH 3TNMB 1UB6B 1T03H 4OCXH 4RCAA 1NDGB 2VDML 4UT7L 5I16B 3VJ6A 4FTVB 1KELH 3EIFA 5ICYA 4PRPB 5JHLL 2BSSB 4I0PB 2BC4A 5AUMB 1VFBB 3MRDB 3STBA 2MFNA 3QO0A 3TYFB 3CFDA 4OCWH 3U2SB 3ULVF 4MAYB 5DEFA 3S37L 1EIBA 3U9UB 3MV8A 3VGAB 5DJ6A 4H0HB 4MLIA 4UUJA 5DQDH 3QH3A 3WD5H 5BOZG 4TSBL 4LF3A 1R5IB 1WZMA 3T2NH 5EUOA 5DJ0A 3LEXB 3F7RA 5FKPB 3ZDZE 1WITA 4M5ZH 1NAMH 2BHUA 4PJGE 4X7CC 3FB8B 2WINB 5CILH 3V7AE 1Q9LA 5EUOE 3PXHA 1DFBL 1IEBA 4P2RE 4P2OB 3KPSB 4GBXC 1ND0A 5AD0A 2UWEB 3WE6B 1RK0A 4JFDD 2Z31C 35C8H 2ORBL 3QHFL 1H8NA 4MDJB 5DHXB 4G8IB 3QRGL 2FR4B 5J8OA 1HQRB 1KBGH 4HAFA 5E8DL 1NBZA 4U0RC 4CMHC 1JZ3A 2WZPD 1EEYB 3OPZL 4P4KD 5IMOB 3HI5L 3TBWA 4PRIB 1WC7B 2AV7B 3H3BC 3KLAB 5F7UA 4U1IB 4S10A 5IGXL 4QRQB 3RPKA 4FFZL 5T1MB 5EPMA 2PTVA 3PL6D 1EGJA 5ICXB 4DGVH 3IJHA 1XZ0B 4R26L 2YRPA 4ZDHB 5E94A 5EBWB 5DJXB 5IROA 5DJ8B 1NC4D 3O6KL 5GJSH 5BS0E 3PNWA 2GUOA 5GSVA 4IJ3B 4JFFE 3EO9L 3BUYB 1NEZG 1QA9B 3BSZL 4PJ8D 4E41D 4LU5L 2A38A 2Y23A 5CUSL 2SEBA 4KZEH 1I9IH 3L5WB 3OWEA 3JXAA 5DYOA 1NH6A 4FXLA 2UWEA 3O45A 4R6UA 5TH2B 4KY1H 2OTUA 1GZPB 4I18A 2VAAB 3O6LH 4NPYA 3VMNA 3V8OA 3KLHC 3GO1L 4N0FA 3EYFB 4EDWH 4X4ME 1K8IA 2VLRB 3D3VB 4I5BB 3S88L 2KKQA 1A2YA 4ODHH 2UZIH 2G2RA 3BZ4A 4MDIA 1HI6B 15C8H 4UIMA 1QBBA 3C5SB 5JTWA 4WWKD 1FLTX 3WS3A 3WFBH 1LILA 1T89A 1S9VB 2D4FA 1X4XA 5D7JB 3MRLB 1U0QA 1GIGL 3N1PC 3QG7L 4M03A 4Y19D 1BGXH 4Q2ZB 1GZQA 3BP5A 3KPLA 3DX6A 5HHME 3C5ZC 1VENA 3VFTA 4IRJD 1ZTXL 2ORBH 2GY7B 3WNLA 2CDFB 4MA1C 3GM8A 5I1IH 4ZS6D 3IFNH 3IDGA 1Y0LB 2AXGA 1JFQH 3SJVE 5IFJA 4ZOAA 4YBLB 3TA3D 5DRWB 3KNBB 5FHBL 2EC9T 3TVMB 3ME0A 5DK2B 2BVOA 3V6OA 5F6IB 3RWJA 2FJHB 3D25A 3DV4B 4FN0A 4N0FB 2CDGB 3PL6B 5T5FH 4RMQA 5AZEL 1PSKH 3MRFB 3SOBL 3RTQC 4OIAA 1N4XH 3IDXL 4HJGA 2DIJA 1Q0YH 4X6DE 4TRPL 5E6ZA 3GBML 4X7TB 2BNRD 3P9LB 5DFVC 4RGMC 3VXSA 5IB1B 2FGZA 3BE1H 4D8PA 5E08L 2VUOA 4OB5L 3TP4A 5MP6L 1R6VA 4ZFOA 4YPGA 3M45A 3EDKA 4GKZB 4TYUA 3CPLB 4EDXB 2OI9B 4YR6A 5ALBH 4P2QB 1C5DB 4CVZA 3QUMA 3DUSA 4YGAB 1BBDH 3T4YA 1FZJB 1YEDB 3ARDC 1QBLL 1KEML 1E4KA 4IRJC 4MSWB 1DQMH 1S5HB 4GJTB 4J4PD 4F7TA 2DQDL 3ECBA 4OCLC 1U8JB 4G8EB 2NY3D 3NA9L 1HILA 3T3ME 1M05B 2NY5L 4LSDA 4XNMA 3EKCA 1G6RH 1KTLA 5HHMB 2EKSB 1BLNA 1HNGA 3TIDA 3V4VH 4BQ9A 3PHOB 2IPTH 1RIVL 5INCA 4V1DE 2ARJQ 4AENB 1PY4A 3IDJA 1A7NL 5TQ0H 1PG7H 4HLZH 4EBQL 2X10A 2NY6D 2P8LB 2P8PB 1FVCA 1XFPA 4XX1E 3CSYA 4UILH 5D1QD 1IEBB 2Z91A 5IM7A 3FO2B 1MJJB 4NO0A 3MNVA 4MQXD 1M7IB 3WEXB 5C0IA 1I1AA 2ED7A 5FF6A 2YOCA 4P2RB 3KPSE 2R0WH 1U58B 3DX8A 1QG3A 4EDXA 4JY6B 4NRXA 5GZND 3L3KA 3VI3F 4Q97A 2YD6A 1WBZB 4UIKL 1FL6B 5HHQA 3TYGL 4ZSOA 1FNFA 1AO7D 3ARFA 1JYWA 3QJFB 3KHQA 1GXEA 4TOYL 4I0PC 4GAGL 2VDPL 2XWBA 3ELAT 4OQTL 2B2XL 4OLVL 4BQ8A 4KPHH 1NGQH 5FDWA 2Q76B 3TF7C 5TDNA 3S35X 3ZT7A 2HFFA 2YPLB 3K4AA 3ULUC 3ULVC 1PAMA 5C8JA 3O2DL 4NDMB 2MJWA 4IHOA 4KI5C 1TLKA 3EFFB 1G7IA 4ZO8A 3KPPA 4GW5A 1G7HA 1OD7A 1JHKL 4ONHB 5F3HB 1NFDF 4HUUA 4HWBH 5D2LE 4EI5D 4DOHB 1UJ3B 4MAYD 5ALBL 2PR4L 5IR1A 1S9XA 1IM9B 2DM2A 3D48R 4PJHF 4ODXB 3NIFF 3IGAA 4XWGL 1RK1A 3OKKB 4NYLA 3S6CA 2Z0BA 1J11A 4GXUN 3H9HB 2G5RA 3FZUD 3Q0HA 4Q6IB 5HHQB 3C8DA 5HJ3B 2NLJA 5KN5B 5GGVH 1H3UA 2BVPB 5DJAA 2BX5A 4JRXA 1VKXA 1X4YA 2NY0B 4GS7C 4OFIA 3U7AA 3FFCE 1CDJA 5IIEB 4HGKC 3MRNA 2WBJC 4YHMH 1C12A 4L4VB 4CW1B 5C0BB 3C6SA 3PABA 2DN7A 3REVA 2G60L 3B9AA 1ZWIB 4C54A 1XT5A 5CCKH 2C3HA 4QTHB 3SE4C 3GSVB 3O6FB 4YUEH 2OXGA 4PJCE 1B0WA 2A9ML 5IEKA 2BNQE 1I9RL 4XAKD 4X6EB 3GSNA 3ZKMC 4S1QH 2YK1L 5TQ2L 5J6GB 3I6GA 4WUKH 4J3SA 4QRPA 5FA4A 1S9XB 2LTQB 3IXTA 4U1JA 3QYCA 2ZSWA 1MCEA 5JW5A 4OD2B 4OLXH 4YDVB 5J11C 5T1KD 3MNWA 3AB0B 3VFMA 1UM4L 1FGNH 3MLSL 4NKDB 2NY3C 3ULVE 3RGHA 3LEYL 3HZYB 4AIXA 4PRID 4WO4A 5SWSD 3BMVA 4IRJA 3O4OB 1NDGA 4OQTH 5DMGC 3VFSB 5I16A 4HUWA 2FATH 4WJ5B 1T3FA 1FFRA 3M8OH 2HT4D 4J8RA 3QWQB 2BVYA 1B4JL 4GAYA 2DAVA 5EWIL 1UZ8A 3QUYC 5D5MB 1QFWL 2QBWA 3BKCH 4KMLB 4G6MH 1EO7A 2DD8H 4OIIH 5EUKA 2MHAA 4HKXB 1G7JA 4PJ9C 4M7LL 4A2LA 1JHLH 4FQXB 4LSSH 4HWBL 4ZUSA 4WU7B 1UH2A 5TF1L 5ID1A 5D7LB 4A6YA 4QTIH 4G42B 3MRMA 2NY5C 2OCFD 2GFBA 2FWOB 1OPGL 1BQHA 2YUVA 3QEUB 2OTPA 1CG9A 1HIMH 1UA6L 3BRFA 3MLWH 2BP3A 1OSZB 1UG9A 5HI4C 1IGFL 2Q8BL 3GB7A 1LO0L 4N0UB 1LP9A 5E1AA 1YQVH 1NGZA 1MUJA 3RIFK 1FNGA 2DYPD 1JK8B 5L2KA 1EEZB 2YD8A 3HTLX 3TVMC 3RPIA 1K6QH 4IRSB 4L29A 5JXED 1PX3A 5FGBA 3G9VA 4K9EL 4WEBL 5GS1A 1HYRC 5D7JC 3W9EB 3ULUH 1XR9B 5FCUL 1RI8A 1DN0A 3FO9A 2AK4B 3RDTB 1U3HC 4ONFL 3P4NA 5JW4Q 4M00A 1CTOA 5EUOF 3MSPA 4WU5A 4XX1G 4LCYA 3TBVB 3DV6B 1DQLL 3A6OA 4XTRC 4P9HL 2AABL 3U79A 2GYSA 2WBWB 3Q1SH 4K94C 2P8MB 5BCAA 4LPTA 1PKOA 2F74A 1K5NA 3G6DL 4I13B 3ZLQC 1RJZA 5J1SC 1BVLB 1IAIH 5HGDA 3OAUH 1BJ1H 3M17A 4PP2B 3PP3H 1ZHLB 3L5WA 2AXJA 1AY1H 1AGFB 4CN4A 5GZOD 2XNAA 1A14H 1RZ8B 2ZG1A 4ACPA 4O02H 3QUZD 1FNGB 3E6FB 1U8OA 1JMXA 3AU1B 3SGKA 4U6VH 1DVFD 1DL7H 5F9WB 4F7CB 1D5XB 3GBLA 4XXCA 3V4PH 4NC1C 4JPWH 2FEDD 8CGTA 2P49B 1CDUA 2P5WE 5EOTA 4G7VL 3VRJA 3HC3H 32C2A 1A6WL 2JIXD 4D9RD 3A6CH 1H3VA 5E5RB 2JB5H 5EOCL 4TQEH 3EOTH 3O3AA 2XQYK 4U1SB 1F90L 3QXAB 2OZ4H 4RGND 4MS8C 3OR6A 5CD5C 2X1OA 3ARBB 4PLJD 3BZDA 4Z77A 3ZE2F 3VGGA 3VXQA 1YY8A 4YFLF 1IAMA 5C09D 4KUCF 4HFUL 5DTFA 1TIUA 3V52L 4IBLT 1X5YA 4J4PC 4P5TD 3SE3A 2R2EB 1GAFH 5E4EB 2J5LB 3BW9B 5CJQL 5ESAB 2OTUB 2LFGA 4H25A 4XP1H 3VFVA 1ZSDB 1RHHA 2CJUL 5IB3A 1XF3B 1HZHH 3MYJA 5DRNB 1OAYH 5EOTB 1AXIB 1AFVL 2B0SH 5C07D 4Y5VB 4AEIL 2XN9D 4JRYD 4KGJA 5F9OH 4WHTB 2C4FT 4KKBC 2EXYC 4JPIB 4P9HH 2EZ0C 5C0BD 4K07A 2X1XR 4PJGF 2NR6D 3N50A 5DQDL 3UP1A 4TUKL 3HG1B 3VW3L 1FYTD 5T33H 1F5WA 2E27L 3O11A 5JXEA 5GRZA 4JQVA 5B21A 4BH8B 3OKEB 3B8YA 1VB9A 1KIPB 2X9YA 3T3PE 1WIPA 2R1YA 2BSSA 3TBYA 4LEOA 4ALAH 4F37K 3VXTA 2DWDB 1VFBA 3MRDA 3X17A 4F37F 5D5MA 2F53B 2A77H 3SPVA 1T1XB 3WFHB 1NCWH 2R0LH 1N59B 1LO2L 4UOW1 5DJDB 2XFXB 3P4MA 3U2SA 3RVVC 2F5AL 1J88A 4IMLA 1T1WB 1A1OA 1YA5A 4GKSA 1JZ6A 1F2XK 1B9ZA 4Q9BA 1HILB 4V1DD 1JNHA 4YO0B 3VXOA 1KIRA 1A4JA 2DS4A 2J1KA 2Y6SD 3OKDA 4OZFB 4LF3B 3IKCA 3IETB 2HKHH 3L3IB 5LJYH 3K81A 1UB6A 2VUYA 2CSPA 4KUZL 3FQRB 3QUML 1SMAA 2DWEA 3LV3A 1TQBC 2JB6B 4R26H 3W2DH 3T8XA 2HFEB 2NY1D 1YPZB 5ENWA 1YZZA 2LU4A 4PBVC 4X98B 4N90E 2QSQA 5EBMB 5D9SB 1G9NL 3NN8B 1M71A 4P2QA 3ZE1E 4P3DB 3BGMA 5I1JH 3GIZL 3AB0C 1CDGA 1DZBA 3TT1H 3ULUE 2GIYA 4UTBH 4UB0H 3R06A 3C8KB 1S3KL 3O2DA 5IMLA 5CAYB 4I0CC 2WNGA 1A7OL 1LQSR 4MAYA 4X6CE 5DEFB 1CBVL 3SO5A 4J7RA 2XN9B 4JRYB 2W59A 4K3JL 2BRRH 5DT1H 5AYUH 1UT9A 1HZHL 5MHSD 3DV6A 4I4WA 3RAJL 1TZGL 4PRDB 5D7IB 1S9YA 1MHEA 5JDJA 3RZWA 3QUYB 3VRLF 1U3HA 4FZEH 2EE2A 1SY6A 2WLYA 5K9OA 2W0PA 3ARUA 4U6YA 4WV1A 4J1UB 2EE6A 5HY9A 5HGDB 1CDYA 4KFZC 1OAXL 2XZZA 2YBRA 5J9PB 1OW0C 3A6BH 3BFOA 3GMQA 5MEOB 2A73A 3T77A 1RJYA 1DUYB 2DQIH 4LCUB 5F3HA 1LVEA 2ZCLL 4HULB 1BGXL 4JM2D 1L7IH 3UTTA 3MMEA 5BRZE 2F15A 4KGLA 4MCZA 1MJ8L 3SDCD 5TE4L 2YWZA 1NGWA 4N9OB 1P69B 4HIXH 4POZC 1KLFA 3B9KC 4Y88A 4PJ7A 2E7HA 5DJXA 2B8OT 3RGVA 2R56L 4RAVB 1P7KA 2MOVA 2Y07L 2CUHA 2OP4L 5I17B 4PRNB 1MF2H 2C7UB 5DDHA 2SEBB 2UYLA 3S3PA 2A6KB 4JDTL 5HYSB 4KUZH 1SJEB 2FECL 5CSZA 4LPYA 3GKWL 5BZDB 3NIFE 4BK4A 2YPLD 4ZAKC 1KCKA 2VJXA 2DKSA 3GBMH 4Z7NE 5AEAA 1G7HB 3GJEB 5C9JB 4NUJA 4NZRL 1GZPA 3RWGB 3C6LD 5DRWA 5I1JL 2HLFC 2RR3A 2FNBA 1RUPH 5LWYH 1FYHB 3BN9C 1BMGA 4FFYH 3X13B 3WS3B 1A7RL 1LO5A 4ZUVA 1QSEE 3TNNB 3QCUL 4WW2C 4FQJL 3IRPX 1KG0B 4AG4H 1GC1C 4GQ9H 1IAII 4UV4H 2GQHA 1YNKL 1I85A 3QDGD 2X4PA 4MAUH 4CUCA 1VKXB 4MJ6A 3DX9B 4ZO7A 5BS0B 1MEXH 3PP3K 9CGTA 4V2BA 4HJJH 1F4YH 4YHIA 3O4LE 2PO6C 5IMKA 2Y5EA 3KXFB 1XGTB 3O11B 3FOLA 2IPTL 1P4LB 4Z76A 3REVB 4M8QB 4LCWD 2CIIA 2X4RA 4F8TA 1U8KB 1PG7L 1EGJL 1KIPA 4KV5F 2XWJA 2VZSA 4XNZB 3IFOB 2BOCA 2BFVH 5C0EB 4TTGA 3HS0B 4YC2C 3TZVC 1RZJH 4Y4KA 1DDHB 3KVQA 3VFGH 2EECA 3MCKB 1CZ8H 1HHJA 3MO1B 5HD8D 1NDMB 2H3NB 4NJ9L 4GRWH 1NLDH 4JQXC 4M93C 3MLVH 3ARGC 4NQDB 3BP6B 4MNQD 1WSST 1JWSA 1R5VB 2KQMA 3HG1E 3DNKA 4CVXB 4K3EL 2CLVA 1M6OB 5JIPA 1PQZB 2DQFA 5F7HA 3FRPG 4PBWD 3RVWD 3QFJE 4XP9H 3UXFA 2AEQL 4CDHA 4XRCA 2FIRT 4F2MB 2XKNA 3Q2CA 2J5LC 1A9EA 5JZ7C 2VQUA 4UTAL 1NSNL 4KJPC 3GK8H 3RX5A 4D9QD 1CQYA 1FRGH 1J5OH 5KS9B 5ICYB 1LO3L 4JQXA 4GSDH 4G6JL 4OZ4A 3KPSA 2F54B 3W0WD 3CLEH 1CL7I 4KRMB 4J6RL 1WISA 3GKWH 2CQVA 4FZ8H 1RUQL 4KPHL 3WEXA 3TN0D 3CC5B 2DQHH 4RFOL 3TYFA 1GGIH 3AS0A 3VXME 1V3MA 1G7JB 2W92A 4NKOA 4X6FA 3P4NB 5KTEH 1A5FH 5HHVL 1JNLH 4NZRH 3RGVD 3I6LD 2X70A 4D0CA 2PYFB 3JTTB 1KACB 5E4EC 3IFPA 1EAPB 5KJRH 1J10A 4NJAL 1LP9F 4R7DB 1YMMA 5IWLC 3QWOA 5L0QB 3DGCR 3GGWA 5HI5D 4ZSOE 1M05A 5CP7B 1F4XL 4U6HA 4Y4FA 3VXNB 4EN3D 3V5KA 2VR5A 1J05B 4GQ9L 1S7QA 1S9YB 2GK0B 3QXWA 2HT2D 3MV7D 3DXAD 4MD5B 5A2KH 5FUOL 4QHUB 1NC2B 3SE9H 5DD3H 2FB4L 3RPIB 4PJIF 3MX0A 1ZVYA 3VCLB 1MCOL 2MSPA 3QT2A 3TGXA 3QG6A 3ZE2E 1U8MB 3WIIH 3LS4L 4BJLA 3QQ9D 2EDWA 1TMCB 4FABL 4N0YL 5JDSB 2VB5A 4MWFB 5C0CB 1R5WA 1MIEH 2CK0H 4QF1A 1B2WL 1TJIL 2P5WB 4Y4HC 5LGJB 4JAMB 5GGUB 4LHUB 4NJ9H 4OLYL 3I50H 1MCFA 4I5BA 3D3VA 2GCYA 3JUZA 1Q9KA 4OSUH 4HIEB 2YK1H 3ZKND 4C83A 2WSKA 1JPGB 1FO0B 2A74A 2DQGH 3KPRE 3K8LA 3LIZH 1RMFL 5CS7A 1YEJH 2AEQH 3VWKD 4GLRH 2LVEA 3VXNA 4O2EB 4JFYA 4S1SH 5DMKB 2QKIB 3B9KA 1TVHB 3NIDE 4YHZH 4QOKA 1A0QL 1B0RB 4M4RA 4ZPVB 3GK8L 3T0EE 3WSQH 1RZ8A 5DD5H 3ILPA 3UTSD 4PJEA 2VABA 1RV6X 1J0KA 3IDMB 1BD2D 2ZUWA 3BT2H 3GSRA 2H1PL 3N85H 1TQBB 1A02N 4N0RA 5A1AA 4NWTL 1XGRA 4K23L 5I1HL 1JCKA 1HOCA 5I1GL 1NAMA 1TVBB 3R0MA 2CRMA 4NZJA 4M5YL 3BKCL 1WIOA 4MWFA 3ZYJA 5C0CA 4G7YH 5JW3H 1T20B 4GO6B 3KDMB 1QKZL 4K8RL 5C0AD 5FGRA 1I1RA 1IEHA 3HNTH 3O3BB 4TNWK 3FFDA 3I6KB 3QO1B 4RA3A 3MRNB 1P1ZB 1ZHKA 5GJTH 2LVCA 3LKQA 3IDUA 2D9CA 2IQAB 3BP7B 1HDMB 4V2CB 3FT2A 1BEYH 1T3FB 2OK0L 1IGIH 3DX9A 4KK5C 4G8GB 4Y16C 1MCDA 5T3XD 1Z5LB 3HPJA 5D2NB 5HPMA 3FQNA 5EOQH 3K2UL 4R96B 4TSAL 1VHPA 1J8KA 4GRLD 5GRVK 3BJ91 2OL3H 4C57C 5E99H 1MCJA 2XY2A 1PYWB 1PKQE 1QO3A 3LS4H 4WRLA 4F9LC 5I2IB 2ZPKH 2EC9U 2BOCB 2FEDC 1GPOL 4MX7B 3ZTJG 1T7XA 1U93B 3LS5H 4NOFA 4E42A 3VFMB 1F58L 3EYQD 5DD6A 5CINL 1MCQA 4M1CD 4LCIL 5HGHA 5T3XH 1Q9WB 2MCPL 3SDXA 4PJAE 4ZD3H 4L3EE 2Z9TA 4LSTH 3BN9D 4JLRA 2CLVB 1CS6A 4G5ZL 4JB9L 1SM3L 4EI6A 5TDPA 4BFEA 5GRUL 2IAMB 4QT5A 2VLJE 4OGZA 3SKOA 1RK0B 1YEGL 1P7QD 3ILQD 2DDQL 4XPGH 3OR7B 5I1AA 1A9EB 3VXUD 4PJXB 5D5MF 2IG2L 4J3UA 4P2RA 4HJ0C 2Y7QB 5D2LB 1FL5B 1NBZB 5GGTL 1IAIL 1NCNA 3LVEA 1FC2D 2NNAA 4PJ5B 4NO0B 4LHJB 3NTCH 1JPFB 3B8SA 2DWDA 5KANG 3RI5F 5HYJB 1ETZB 1WWCA 2BVQA 4EIGB 5FFLA 1XMWA 2H1PH 3DX8B 3VE0A 3EAKA 3MLXH 4EI5A 4YFDB 4I3GA 1SJHA 2VZUA 2YC1B 1W72H 4PJDF 1CE1H 3MXVH 4MD0A 4XVJL 4M7KL 1KJ2B 1FL6A 5JXEC 5F1SA 2R9HC 4HH9A 3THML 2GT9B 4G7VH 4R7DA 1NGZB 3DTXA 1J9CT 2VLME 1C7TA 5FO8A 2WINA 4JKWA 2P4AB 1EHNA 2FECI 1Y18A 3FQXB 5CJXC 4YC2B 3PHSA 2XPGB 3P9MA 5F7EL 2FJFA 5IM7B 1PGRB 1D9KD 2W9LA 1INDH 4FQCL 5I76B 1NEZB 3QQNA 3RY5A 5HVWA 1FN4A 2F54E 5C2BL 4XCNA 5IFHH 3RL2A 1U8IB 4XT1C 4NDMA 3AU1A 4EN3A 2R2HA 2EKJA 4HFUH 3GSXB 3IKKA 3BPLC 3KPMA 5L7XL 1OAQH 4GAJL 5DJ2B 3CXHK 2IH1B 1GAFL 2VLLA 3KLAA 1WVZA 1L4IA 3CZJA 3FO9B 5IMLB 5DUPL 4JZNB 4PJ7B 2VR4A 4G80A 1AQKH 3VG0L 2VIRB 1A9BB 3KPQA 3ARED 1MCSA 4ZUWB 2XA8L 3W9DB 1OSPH 3RVWC 4KI5E 2EDLA 3QEQE 3SBWA 4HIEA 4NBZB 1MVUA 2HTLD 1K5NB 2F5BH 4N1HB 5JNYA 2HJKB 3ZE0E 1G7LB 4MZ3A 2WLZA 4LFHD 4KZDL 4BFIB 1TDQA 2A6IA 3EYVA 4XPGL 3SJVA 4M8VA 1KLUA 4XCFL 2NXYC 3EDFA 1MREH 5J56B 1EVUA 4ZPVA 5FKAA 3BH9A 4OCSL 1W8NA 2FIKA 1OL0A 3NVQA 3OGOE 4XMKH 4KK9C 4F7EB 1NGPH 3STZB 4HFWA 3KNBA 4NO5B 3MLTB 3STLA 1KCVL 4MNGA 2XICA 4JG1L 3SKUD 2CR3A 1XH3A 1LK2B 3I2CL 2YRZA 3FRPA 5DJ2A 1ZEAH 5IMMB 3MLXL 3LN5A 4YFEA 3NZ8B 2X44D 2C4FU 3F6IA 5DC4B 4Z7WA 3B3IB 1JN6B 3UDWA 1PX4A 3W11D 1XGQB 2YR3A 2GTZB 3OZ9L 4WO4B 3KR3H 3VXSE 4HXAH 3BPNB 1RZFH 2OLDA 1FBIL 4Z7WE 5EULV 1AR1D 1ODAA 3MV9B 5ISZB 4X6BB 4LSUL 2VLJB 4GW4B 1ZHBB 2NW2A 4UAOB 4TPRH 4XGZB 4MNQA 1E28B 1KJMB 2J8UB 3CDCA 4Y5YB 1T1ZA 3ZKSD 3UAJC 4LQ1A 4LEOB 3MRJA 3F65A 5IEKB 2I5YL 4GKOA 5D7LA 2BNQD 1UACL 4MNQE 4N68A 3BH9B 3VWJB 5EUKB 4S2SB 4N8CH 4LHQB 3P77B 3SKJH 4HWUA 1KCSL 5EBLA 2X1QA 3QFJD 4U1GC 5C86A