3CXDL

Crystal structure of anti-osteopontin antibody 23c3 in complex with its epitope peptide
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
213
structure length
213
Chain Sequence
b'YIQMTQSPASLSVSVGETVTITCRASENIYSFLAWYQQKQGKSPQLLVYAATNLADGVPSRFSGSGSGTQFSLKINSLQSEDFGTYYCQHFWGTPFTFGSGTKLEIKRSDAAPTVSIFPPSAAQLSSGGGSVVCFLNNFYPKDINVKWKIDGAERGNGVLNSWTSQDSADSTYSMSSTLTSGGDEYERHNSYTCEATHKTSTSPIVKSFNRAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of recognition of human osteopontin by 23C3, a potential therapeutic antibody for treatment of rheumatoid arthritis
pubmed doi rcsb
molecule keywords Fab fragment of anti-osteopontin antibody 23C3, Light chain
molecule tags Immune system
total genus 48
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2008-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cxdL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cxdL01
4ZO7A 1VPOH 5EOTB 1FJ1A 5GHWH 5GGQH 1G9MC 5HGHA 3DETD 1A6UH 3T3PE 4YBQC 1FL6B 4X9BA 3O4LE 2EC8A 2Q7YB 2VRAA 4CL7A 5DHYA 3SJVA 3PQYE 3VXOB 2C3VB 4DKFL 1P4IL 3SKNB 2VQUA 1ZT4A 4JRXA 4JZNA 4UT6H 4QRPB 1EO8L 3OPZL 1NGQH 1BVKB 4XVSL 4I3SL 4LLDB 3QNZA 3HRZB 1S7UA 4NKDA 3IAPA 4PTUA 3STLB 1FRGL 3AXLA 1UJ3B 5I1KL 4YFLF 5DK3A 1ZHKA 5DFVD 3GSWB 2VYRE 3QFJE 2HH0L 4HKXB 3DX8B 3QDJB 3SBWA 1CFTA 3VFMB 4MXVE 3TBTB 3T3ME 1CN4A 3SE4C 3V6BR 4QOKD 3ZT6A 2A6DA 4FQ2L 5KG9B 3WJLA 3PV6B 2AXHA 5ALBL 3FFCB 5L2KD 5DMJB 4U0QB 5IKCA 2APXA 4HIIB 5IR1A 5CSZB 4U1HB 2MJWA 3OGCB 1QFPA 5HHPA 4EUPA 1RUQH 4HIXH 3NZHL 2YBRB 1FNEB 2FEEI 3G5VA 4OSUH 4PV9A 1D7FA 3CFJB 1FZKA 3E0GA 2X9WA 3PDOA 3GIZL 4XP6L 2OTUA 4QXTA 4DJMA 1J0JA 3ROLB 3VGAB 4JR9L 4XTRC 1NMAL 4JFED 4RGNE 4YPGA 2XZAL 1IC5L 3STZA 4UDTB 3QNYA 3F7PC 4PRDA 2XXCB 1RHHA 2A0LC 1GGBH 2P7TA 4NRXA 1BZ7B 3QISA 5E9DB 3DX7B 4GKSA 4OGZA 1UXSA 3LDBC 4IOFC 2CIKB 4M62L 3FAWA 1S7WB 2HVKB 2PO6D 3ARGA 3DARA 1AGFA 1LO0H 1CL7L 3HI6L 5AAMA 1NAKH 4G3YL 4HK0A 4DK6A 4FMFA 3RHWK 4I0PC 1RZJH 4L4VA 1X5JA 1VGKB 4FZEH 4Y5XB 3WFDH 3O3DA 3K74B 3RUGB 3ULUL 4UAOB 4PR5A 1B88A 1QPXA 2XN9A 3PABA 4IOSD 5BZDB 4KC3B 1AC6A 2WBJC 3DPBA 4BK5A 4PJAE 2E7HA 2O93L 4Y2DC 3ARFC 3Q6FA 1ZKAA 1T5XA 4YHLH 1EZVY 2VDLL 4FZ8L 4J3OC 3AS2A 4ZAKB 3QUZD 3QUYB 3I6LD 1HEZB 4LLYA 3U36A 5DEFB 1FYHB 3UAJC 1MFBH 1YMMD 1QFWH 2PTUA 3FO9A 3RWFB 5J6HA 1CIDA 5JW4Q 2DBLL 3QDGD 2FIRT 4X6CB 4HHAA 3HI1A 4PJBE 3JV6A 4MA8H 5BQ7A 5D1XA 3U9PL 4WUKL 1FNHA 1KCSL 1PKQB 4M48L 4S0TD 3JXAA 2CJUL 3OXRB 4G43B 4Y5VA 2OM5A 4OGAD 5D6CA 2YK1H 4FA8A 3EO1B 4EDWH 4PJXE 2DD8L 5HYJA 1FL5B 4GKNB 1ACYH 2Z92A 3MZTA 4N5UA 1K4DA 5INCA 4NQEB 2VC2L 1D5IH 3GJFA 2X1WL 5C9JB 4TUKL 1JPFA 3INUH 4HUMB 1BHGA 4XCYA 3VFOB 4RGMB 3VXTB 4MDIB 5IB3A 5CWSA 2VLRD 2VISB 5D70L 3QRGL 5FKPB 1S3KH 3CLEL 5DVOA 3BP7B 1LMKA 5F7DA 2Y7QB 2UVEA 1NBYA 3PL6B 2HRPH 1QKZL 1L7IH 2JTDA 4OCWL 4NQSA 3D0LA 3M07A 5M7QA 1OAXL 3H0TA 1NCBH 4LQFH 4Y4FC 2WAHA 2VWEC 5IIEB 3B9AA 1UT9A 5BRZE 4E41D 3VMPA 4BSWB 1SEBB 4MA7H 4POZC 3G5ZA 3EOYG 3DO3A 5E2TH 3U7WH 4AZ8A 5T3ZE 2X4SA 3O3EB 5JOPE 4MJ5A 1KYOK 1UADC 5IG7B 3T2OA 1CXIA 3QQ9D 4UT7H 3X11A 5DJAB 3BXNA 1PVHA 2Y9RT 5C0EA 3CZJA 2OL3A 1M71B 2FEEL 5HHME 1MVUA 1JYVA 3EYOA 3IKCB 5JA8B 4RFNC 4DCQB 1S7QA 3HNSH 4IRZH 1DJSA 2D31B 3QB7C 1MHCA 4FFVC 3DROA 2Y36H 2YXMA 4U7MA 4G6KL 4UUJB 2P45B 4RGOL 4XVJH 3ORJA 1CT8B 5DRZB 1HILA 3I2CH 1T0MA 5GJSL 1MCOL 3IFLH 5HGBA 4OZFA 2NR6C 5KVMC 1NANI 4HWZB 1QLFB 2VO5A 2ERJC 4R7NA 5GRVL 5C92A 2J3SA 4MMZC 4PJHF 1LO4L 2JJTC 4U1IB 4WRLA 4AYFA 25C8H 1UWGH 4QT5A 1ULVA 3DVNB 3K2UH 4BZ2H 4GW1B 3JUYA 3PP4L 5GSRA 5JDSB 2FR4A 3ZE0F 1DANT 1DQMH 1YEIH 2VXVL 3IXAA 4DW2H 4TQEH 1P69B 1ZXQA 4BH7B 1QSFB 4JHWH 1IEHA 4WW2B 4GRMA 3QQ4B 4U6YA 3DNKA 3O4OC 4J4PD 3L5WA 1OP3H 3TNNA 3FJTA 4PRNA 1T3FA 2BJML 1FGNH 1GPOH 1OD7A 1EDQA 2IANB 2E9WA 2NY1B 1FPTL 1HHGB 5D7JB 3K2MC 1MFCL 3VU2A 2CLVA 2D9CA 1HHKB 1UC6A 5F1KC 2A9MH 3ZTJG 5F3BB 4RSVA 4R97B 2GI7A 3U1SH 2YD8A 1A1MA 3EKCA 3O0RL 5E2VH 3BWAA 3KPSB 5ENWA 1VFUA 2QR0B 4HS8L 3DVFA 4P5KA 3STBA 2AXFB 1GGTA 3TLRA 4LPUA 4NO0B 4Q0XH 3MXWH 2X4PB 2VUYA 4XT1C 2EEBA 1T7VA 3D3VD 4QRSB 1TZIA 5DR5H 1KXVC 1ZHNB 4OCNC 3MRHB 4O2CB 2W0FB 1UM4H 1CE6A 4ZTOL 4NZTL 1Q72L 4OM0L 1N4XL 3TA3C 5KSBB 1PAMA 5DSCB 2JK5A 5HSFA 3TT3H 3ULVD 4WVRA 3GKWH 5JIHA 1LP9E 2VZSA 3ES6A 5FB8B 1J1XL 1YPZA 1RZFH 4WJ5B 2K7QA 4YDJB 1QRNA 4NQCB 1H3UA 5AUMA 5FM5O 2CR6A 4PJHA 1EJOL 4JFEE 5I19L 4AIOA 5C0FA 1DQLL 1BQSA 1XEDA 1AKJD 2YSSA 4JFYA 2UV3A 3TBWB 5J3HD 3L3JA 1RVFH 3DGCR 3GMOA 4ODUB 1NCWH 4XRCA 4PJGE 4YEFA 4JEGB 3RKDD 3SE4A 5F9JA 3VXPA 1BVZA 3IJSB 3T4YA 3VE0B 4QXUH 4KVCL 2YD4A 1NEZG 5ID0A 2FEDD 4KZDH 3OAYH 4TTDD 1BBJA 1NCDH 4PGJA 3MGOB 1FIGL 3K81A 3IFOA 4I48B 4JY5H 4JJHA 4OGYH 1J1OL 2AKRB 4JO2H 1C5CH 5D2LE 5C0RH 4XC1H 3IF1B 4MXQC 3ZZ1A 4LGSB 4IIQB 1RIUL 3ZT7A 3R0NA 2AJ3B 1HDMB 3QA3A 2LAGB 4I4WA 4U1MA 5CIPB 3U0PB 1KJ3L 3EOTL 1NC2B 1PW3A 4OLWH 4ZUWA 3I6LE 1YMME 2XZQL 1S9WB 1R3IH 8FABB 4P2OB 5J13B 3EHBC 2YR3A 3QDGE 4HXBL 1A02N 4ZPTA 2VNCA 5LAXB 1DQJA 3EIFA 3O6LH 1L7TL 1CDBA 1CE1L 3V4VL 5I18H 2A38A 3HE6C 3NZ8B 4TPRH 4TN9A 4WI2A 1DQQB 3WMSA 1UZ6E 1MCJA 7CGTA 5GS1B 2YUXA 1NFIA 5FO8A 1EEZA 4G9DB 2A83B 2W9DL 3KVQA 3ETBF 4ELMF 2GIYA 2NZ9D 4ODWA 1QACA 3V0AC 1ROWA 4I0PA 4EDXA 3QFDB 1MJ7H 1EH9A 2H2SD 4A6YH 1XGTA 1N8ZB 4XP4H 2WBJA 3P4MA 2VLRE 4Y2DA 3ARFA 1NFDE 4HK3N 4OM1L 3OKOB 3TNMB 1FN4A 1TTFA 5ID1B 3BD5A 3JV4A 2E6JA 5TQ2H 3SE9L 3SO3C 5GRXG 4CN1A 1QSZA 5T5FL 1FZMB 2DQTL 3LY6A 4XBPA 1C1EL 2O5XL 3ZDYE 1X44A 2VLKB 1MI5D 1S9YB 4UIMA 4XCEA 2EE2A 3NACL 1A0QL 5DMIL 1A7NL 4XXCC 1OM3L 1P7QB 4U49A 4CAGA 1JNHB 5TF1H 4C57C 3VJ6A 3TBYA 4IRSD 4DAGL 4EVNA 4HZLB 4PRBB 4E41E 1KULA 2XV6B 4HPOL 2IADB 3AAZA 4PRID 1BLNB 1DBKL 3ZTJH 2OYPA 3ESVF 1MCWM 4K55A 4YHZH 4DGVL 2B1AL 5GPRA 5EULV 4U1GB 1TVHB 3BESR 1TQBB 3DXAA 5LGJB 4KY1H 3BVNB 1ZT4B 3GJEB 1R6VA 4P4RA 4JZNB 4I77H 4LU5L 1I3GL 4LLAA 2BVPA 4Z7VB 5KVDH 5I1GL 3QUXD 1RULH 3PV7A 5A2IH 2HTKC 2P24B 5CJOL 4J3VA 1HHIA 3EYVB 1D6VL 1XGPB 4M1GH 2NYYC 5C2BH 3IDGA 3K4AA 1A2YA 1YEGH 3OKNA 2B39A 2NY5H 4X4MA 1RIVH 4JJ5A 3UTTD 5J7CC 4L3AA 5IVXB 1N64L 2QL1A 4OLYL 4OZIA 4ELMA 4ORZC 2GAZA 4FXLA 3UYPA 4KJPD 5E95B 2O5YH 4Y4FA 2CLZB 3U7YH 1LE5A 1KIUA 3F58L 4LVOC 4N90D 4KKLD 2HA1A 1VENA 4Y1AB 1CTOA 3ZYIA 3QJHA 4MAYD 1W72B 1Z5LB 3QQ3B 1J11A 3LKNB 1P6FA 3QDAA 2HVJB 2CLRB 1F4YH 4PV9B 1KLUB 3UCRA 5F96L 1I8IB 3FHAA 4Q9QL 3T0BA 2W65A 2HTLD 1BF2A 4KJYA 3BKMH 2NY2D 2FBJH 3BPOB 1VCAA 4N0FA 5DQDH 3LN5B 2N1KA 2CIIB 1F4WH 1MFEH 5I1AA 1N2RA 2VDML 3B8YA 3DUSA 4GAFB 4WTWA 3RKPA 2P7TB 3VWJD 1QRKA 1CLZL 3TZVD 3DGGA 5B4MC 1UXSB 1SJVA 1ADQL 5E6ZA 1CICB 4HS6A 5L9DH 4JFOA 5DK2B 3VXRE 5GGRB 3B2UD 4AIXA 4DKEH 1B6UA 1FIEA 5MEPA 3WYRA 3GMLA 1ZA3B 2EDHA 2Q86A 3MUGB 3SHSA 3OR6A 3LD8B 1CBVH 2JJTA 4UBDD 1OGAB 2FJHB 3S97C 2CDGA 3D3VE 3K4ZA 1IC7H 4MD0B 1FFPB 1JZ8A 1RUKL 4JFDD 3RWCA 4JO3L 1HZHL 3BHBB 3S36X 4P2RA 4WW1A 5JIPA 4PJDF 3GNML 1U9KA 4QTHB 4YC2B 3ULVE 4WI6A 4UB0L 1RZIB 1YY8B 4WI8A 4AJ0A 3T65A 2EC9T 1BAFH 4PY8J 3RRQA 1F11A 1ZEAH 4LVNC 3BIAX 2AGJL 3ARED 4RNRA 3S4SA 5HI5C 1FZJB 2FX8L 3LRGA 1XCQA 1RJZA 5J9PB 2H9GB 1UYWH 2NXYD 4O9HL 5FK9A 1HSAB 2GTWB 4DK3A 5BZWB 1YYMH 1WWWX 5IV2B 3W11D 5I1EL 3BGAA 3CXHJ 4FHBD 4Z8FH 3B43A 2IFFL 5IMOA 1KEGL 2QQKL 3CX2A 3FO1A 5KSVB 5E08H 3D69B 4JM2B 3MJ8B 2Q8BH 4HC1L 5A2FA 3HMXA 1UJTA 4ORGB 5ICZA 2EH7L 5I8CA 5IOPB 4MJID 1YEHH 5AZEH 4PLJD 1DN0B 5CEYB 2X89A 2AV7B 2D7TL 2GSGB 3TA3A 4APQB 4CJ1A 2CRMA 2R1XB 3OSKA 3MA7B 4NRYB 5F44A 1I3VA 3BIBX 3VGEA 3TIDB 4P5TD 4U1KB 1AI1H 4LGPB 3T8XB 1T1XB 4OCXH 4FQIH 5A40E 2P8PA 1J5OH 4G42B 3RWIA 3R1GH 4K71C 1VKXB 4JFFA 1MEXL 1I7RA 1UWXH 3RHWF 5KJRH 3GHBL 4JRYB 5HI4D 5C09D 3IDYB 3RA7H 3W5MA 1GOFA 1QVOB 3OKEB 5GISH 4GAYA 5JQ6L 2FIKA 3TH4T 2EH8L 2AERT 3BZEA 3T08A 2AEPH 1LDSA 3F7VB 4HXAL 1U3ZA 1KV3A 3QO0B 2BVQA 1NDMB 4XNQB 3W2DL 1GGUA 2OTPA 3NCJL 4KI5C 2ADJA 1Y18B 4FQXB 4NHCL 1A7RH 1I1AD 3P0VL 4MSWA 2JELH 4OD2B 4XPFH 2CDFA 5BMFL 1IC4L 1BZ9A 4U6XA 3DX9B 4JKWA 4U1LA 1YNTB 2VB5A 4RFEA 2EDOA 4UV7H 4GBXD 2Z4QB 3NPZB 2VABB 4F33A 4LSRH 5IB5A 4S2SA 4L4VE 2X7LB 1JGLH 4WI7A 4JCMA 3ARQA 4PJ9B 1ETZA 1VERA 2I07A 2XN9E 3E8UH 4N0YL 1PZ5B 3U48A 5MEQB 1CF8L 5CBEA 3T1FA 2DDQL 3IDMA 5CP7B 4C56B 1AXSA 3P4NB 5KSAB 1UGNA 1ITBB 2HFFB 2XY1A 3EFFB 5IQ9A 1PYWB 3HE6A 4UOW1 5IHUH 3WS3B 4N8VA 4NKQB 5E2WL 1NAMA 4MVBC 4OI7A 1IKFL 2V6HA 3REVA 5I6XB 4PRIE 3ELAT 3DSNA 2W38A 2ZOLA 3P9LA 4OQ1A 5BVPH 1HE7A 5DO2D 5HI3C 5FF6B 1NSNH 2EYTB 4RMVA 3O6MH 4R2GB 1BX2B 3JWOL 2B2XH 3BKYL 3ZHDA 4A2MA 1UB6A 1WZ1H 4IOFD 4IEFB 3ZMRA 4YDKH 3C5JB 2X40A 1YN7B 3UP1A 3FT3A 4L1HA 2B20A 3SOBH 4CW1A 3OJ2C 4GO6B 1AGDA 4MA1C 1AXTL 1TZHB 5TDNB 1F4XH 2AV1B 4JE4B 4I0PD 4Z78B 1HYSD 1QSEA 5EUKB 1N6UA 3IKKA 4S1DD 4G80B 3JBG7 3UTTE 5HGGS 4HJGB 1J12A 3DMMC 3HUJE 3OKLA 3VWKB 2FYYA 4GQ9L 3FZUC 1Z0MA 4XXCA 4JN1L 5FA4A 2DQEH 3GSNA 4N90E 3UTZB 1CFNB 3F6LA 1CLCA 3JWOC 2AP2A 1I9RL 4M8QB 5T1KD 4XCCL 2OR7A 4LRNL 4PJ8C 3O3BA 1CFSB 3V7MA 1FVEB 3S98A 3QIWB 4JAMB 1ZGLM 2NCMA 3QH3A 1KIQB 3NIFE 1HCVA 3QDHA 1LEIB 1ZLUK 2YD1A 3UJIL 1R3HA 4XMPL 4OV5A 1S9VA 2C3GA 1T21A 2GFBB 3G04A 5IEKA 3ULUD 5D7IB 5MERA 5C2UB 1LNUA 3K0WA 4XNUH 3AUVA 4M3JA 3VI3E 3OKDB 4H1LB 5SWQB 15C8H 5C0FB 2F8VA 1J0KA 1OQXA 4JN2A 5EIVA 2D3VA 3HLAB 1ITCA 4R26L 1IGML 3VG9C 3DXAD 4JZOA 3W0WB 4LP4A 3RX5A 3BP5B 1ND0B 1CD1A 1BQLL 4P2QA 3GSRA 4LAQH 5IFJB 5LCVL 2DLFL 1YEJH 1KELH 5LKNA 2O5ZH 2HWZH 5DVLA 2C3WA 3CDGA 3WIHL 4G8GB 2CO7B 4ZO6A 4G6AD 5F71A 3HR5B 2HJFA 3QXTA 5F7YC 1EERB 3MV7B 2ARWA 3MV8A 4Z95H 5FYJL 3AU1A 3SDXA 1MWAA 4M7ZB 4LMQE 2QBWA 3OV6A 4HZAA 1U6AH 1UWEH 2QADC 4X4XB 3CZFA 2NLJB 1XH3B 2NY4C 4JG0H 4RA3A 3WXWL 4JZJC 5FO7A 5EU3B 3RGVB 4S10A 4POZD 5ACZA 3U30B 3LKPB 2CUIA 2YWZA 1ZT7B 5DHVH 1T4KA 5IW1B 1T03H 4LPCA 4JHBA 5SX5K 2HG5B 4WFGE 2EDJA 3WO4C 1RHFA 1W8OA 4Q9BA 2LTQB 4P3DA 1XF4A 3NFNB 3QDJD 1LE9B 4S1QH 2E6QA 1T22A 3L7EB 5D5MB 1C5DB 1KIPA 2ZCHL 3S6CA 4JPWL 2HKFL 4KUCF 4PG9B 2P5WA 2H6PA 2CKBH 3BMVA 5I71C 3A67L 2A1WH 4Z18A 3FFCD 2YA2A 4FFVD 1CR9H 5TF0A 1F6AA 1VA9A 1ZMYA 5F7EH 1Q9KA 3DTXB 5GXBB 3VG0H 4KQ4H 5IBLC 4GLRH 2F8XC 4YJZL 1OAYL 2AJZA 2BMKB 2NR6D 3EGSA 3FFDA 4ZO8A 5DMGC 4MCYB 2X4OB 4MJIE 5DI8B 3BJ91 4LBEB 2H26A 5H8DA 1AO7B 4O02L 3BDXA 2VXTH 5FHBL 5JIKA 4XWOC 3BMWA 4K9EH 4N5EC 1R3KB 4Z0XA 1IM3B 1ADQA 4LNRA 1ZLSL 3FONA 5EN2B 3SCMB 4HD9A 2AJXL 4ZYKB 4XAWH 5FECB 1R3LA 5DJ2A 1WLHA 1GZPB 4MQSB 4M8VA 4LLQA 1RZGA 4XZUA 4BSVA 4G7VL 2A2QT 5C09E 5MEOA 2J6EH 1UM5H 3IETA 1YPZE 2QHRL 3W5NA 2BP3A 3HC3L 4Z7WE 1A6AB 2XPGB 3KNBA 1SVZA 5HPMA 2WUBH 1WIUA 4YNYB 4F2MB 2HT4C 1L6ZA 1AR2A 2DS4A 4LIQH 5E00B 3MXVL 5ANMA 4K7PX 4PB0H 3KWWB 5EBLB 3T2NH 3SDDB 1BWWA 3WD5L 2ZCKH 4PRPB 5I30L 1NCCL 4U1SB 3ULSA 4FQQA 2B1HH 3WIFB 2EXWD 2KPNA 4LSVH 4EIZC 1MUJB 4PP2B 3E6FA 4NDMA 4WU7A 3T04D 3WNKA 3DI2B 4ZAKD 3QUYD 2G9HB 5FYKL 2V7HB 4CVZA 4QRRA 5KTEL 3OAZH 4B0MM 2BSTB 1XGRB 1AGEB 2X89D 5FHAH 4U1NA 3TA3D 5FGBC 4X8XA 3ARSA 1VESA 3QO1A 1N3NA 3MA9H 2HJLB 5DEGB 3U0TA 3LRHA 1HWHB 4OD1H 1EPFA 2C4XA 3MYJA 4HC1A 5CJ8A 1Q9LA 4IMKC 1RIHH 4JFFD 5DA0B 1MQKL 1FFOB 3L9RA 3BSZL 4RQQA 4U2ZA 4BFIA 1N26A 4C58B 2VTFA 1P4BL 4LSPL 3LS4H 4U3XA 1FG9C 3CFEA 2XG4A 2ADFL 2CRZA 3HG1B 1E4XI 3BO8A 4M1CC 1A9EB 3UTQB 4Z77B 3KYKL 5DD5H 1QG3A 4ONFH 1MJUL 3MUZ1 2HLFC 4X6FA 3WFHA 5FOJA 1MIEL 3IJYB 1WTLA 4WHTB 4KTYA 3IDXH 1BF8A 3V95A 3PL6D 5DK0B 1CD8A 2L7JA 4G8EA 4EUPG 4XCNA 1ORSB 4OLZL 2QQQA 2Y5EA 3E6HA 3TC9A 4XVTL 1P1ZA 3QXDB 5KOMC 5TDPA 1Q0YH 2A6IA 2VDRH 4LLWA 2BVOB 2J2ZA 4JPVL 2EDYA 4MXQD 5E5MB 2DQFA 5HVFB 5JQHC 4IMLA 3FCTA 3N0PB 4MHHG 3WUWB 2BCKA 4X9GA 2XFXA 1W8NA 2B0SL 2D03H 5TFSH 1R24A 1DUZA 1FH5H 4WDIB 4DEPB 2C1PB 2WZPD 1QZ1A 2I27N 4Y8AA 2YKLL 3RVTD 3VFRB 5JHLH 3CC5B 4JY4B 4OIBA 3MX0A 4YFEA 2VDQL 4W6YB 1ERNA 2BOBA 5JUEL 1FO0H 3QIBC 5A16B 4DQOL 5AG9A 1I1FB 1ZS8A 4NQDA 1I3RA 3S96B 5A2JH 2AI0L 1KTRL 1SMOA 1RJCA 2OLDA 3GM0A 2GJ6B 1PG7W 4QHNA 1FAKT 3NN8B 3ULUE 3NTCL 3BZFA 4N8CH 3ALWA 4UDUB 3GI9H 4NC1C 5JPMB 3V5DA 5C3TA 4AG4H 1A47A 1T5WB 1U8JA 5CSBA 5IVZB 4J6RH 2E7CA 5EO0A 5DWUL 1P2CA 1I8LC 2WUCH 1I8KB 5CBAA 1YMHA 4HWUA 3FTGA 3DXAE 3P73B 1MAML 1BJ1J 2X4NA 1A6VL 3MOQA 5E7BA 5GRWA 1E6OH 4XP5H 2V5RA 4ONGL 4L3CA 4ODXA 2EIZA 2ESVB 1S78C 2ZUSA 4P9ML 3DMMA 5HHOA 4ESKA 2YPKA 3S37H 2W91A 1N59B 3OKKA 3QXUA 5CLWA 2Z31C 4HJJL 43C9B 1HOCA 5DJXB 4P57B 2Q6WA 3IS0X 1DBAH 4ZNCD 4X4ME 3GBLA 4ZPVA 4L9LB 4PJ8A 4OZIE 1OP9A 3PXHA 3KLAA 1KN2H 4Y4HB 3ZDXE 2CDEA 4NKOA 2NW2A 5L8LB 4LL9A 3OXSA 2P44B 2ZJSH 3ECBA 3W9EB 1A7PL 5F7FA 2MTPA 5DRXA 4KZEL 2IAND 2FL5A 3MMEB 4F58L 2NY1D 1X4YA 1U2HA 4JDTH 3PWPB 5TE6H 3VFNA 4EI6A 5D7JD 3HMWH 3LQZA 2V2XA 1K8IA 4KHTH 1C7SA 4MJ6B 2HFGH 3U4BL 2WP3T 4TUJB 4C4KO 1QEWB 4G5ZL 4QHUB 4MWFB 2C7UB 4X6BB 5EBMA 3S34H 4K3HA 2QQLH 4XNZC 1NUFA 3ZDZF 3ZE2E 4MA3B 4MNQB 2GK2A 3KPSD 3MRKA 1WSST 5E8EA 5I9QB 3QDJE 1V3MA 4PJDB 5I2IA 1PY4A 5HDBE 4MYWB 4KKAD 4YWGL 1I7TB 2YN3A 1U8IA 3I9GL 1FVCB 3HC4H 2EYRA 4UI2A 5GGVL 4NO0D 3FFCE 1CGWA 1KPUA 4RMWA 2CO6B 3FQRA 1MLBB 1SBSL 2P8MB 4FMKA 1XGYH 4K3DL 3MRIA 4TSBL 1ZAGA 4GRLC 4WUUA 3MOAL 3NA9H 2VAJA 5DDHA 1QYGL 3MACL 5EZOL 2DQIL 4CNIA 1HHHA 3EFDL 3QNXB 1SY6H 3FB5B 4O58L 1E4XL 4LHUA 4NQVA 4O51A 4ETYA 5JLZB 4K7PY 4TRPL 4LKXA 1DEEA 1JFQL 4JZJA 5K9OA 4NSKB 2DKMA 4PJIF 3QRFM 1IGJB 1TZGH 4NQCD 1W0VA 2DL2A 3IU3A 3MV8D 4AT6A 1U93A 1O5DT 3WNNA 4GAJH 5HVGB 2F58H 5DC4B 3UX9B 4NWUH 5I66B 5HDQH 3CLFL 5C8JA 1PLGH 2V2TB 1FZOA 3QUMB 3C08H 4H88L 3GRWL 5JXAH 1LK2B 3REVB 3TJHC 2VR4A 1WGOA 1A4JA 4HKZA 3KPPB 4FQPA 4EUPH 2R8SH 3MRJA 2BSRA 4AEIH 4WTXA 1MFAL 3VMOA 5MENA 5DD0L 5FCUH 1TPXB 4DVRH 1DZBA 4OZFG 4L8DB 2EDLA 1A9BA 2OP4L 1LO3H 4M1DL 3RDTB 5C0AA 4JDVA 3LQAH 2RCSL 1BREA 4FFWD 4Z5RA 4YBLC 3GIVA 2V17L 4FOMA 3KR3H 5GS0C 1MPAH 1MHHB 2F19H 5DD3L 1INQB 1XMWA 1MCKA 2IWGA 1NC2D 3N50A 5J57B 4QYOA 5HTSA 3VXMA 2JJSC 1WV7T 4P2OD 5GZOC 4JHAH 3EYSL 3RWJA 3RZCC 4JANA 4D0CA 3T0EC 2CXKA 1XZ0A 4NN6C 3X17A 1N7ML 4LSSH 4X8JA 3B6SB 3VXUB 1IQDA 1SM3H 1PKQE 5I1LB 5FM4A 4HJ0D 4M5ZH 5JR1H 3I6GA 3TBSB 3O3BB 4IOIB 3V4PL 5T3XL 1T04A 4QXGH 1Z3GL 1EMTL 2ZUUA 5F7WC 4JFFE 4OQTL 4PJIA 5C3LD 3PGFL 1A6TB 1BEYL 2X42A 3VH8B 2AABH 1KLFA 3A6CH 3MV01 4FQJH 1AIFB 1JHKL 1ZA6B 4KK5C 4U0RC 3NCCB 3QEQA 4NJ9L 4NQUA 3IFPA 3HAEA 4AENA 4P2CG 2A74B 2HKHH 4NUGL 5D96C 2M26A 3AY4C 5IFHL 1R0AH 2XWBB 4HUVA 4P2QB 2WM0A 3GSRB 5ETUB 5HHNB 1D6EB 1CZ8L 2ZOKB 3MR9B 1D9KC 5EU6A 1FNFA 1YNKL 1T6WA 2XACC 1CG9B 1P7QD 5FGBA 4S1SL 2Z9TA 4XH2B 2DIJA 4J3UA 2EYSA 2H2PC 3OHXB 3CVIL 1S5HB 1K85A 4JGUA 3F7YA 3GJFH 4JFQA 4QHLB 1DL7L 1OTUD 3T09A 5K9KA 2LVCA 3AU1B 4IMKA 1T7ZA 5IJVB 3FB8A 4X80H 1RK1A 2EICA 1NBQA 1L4IA 1ZHLB 2HJKB 5E8DH 4EQ3A 4FS0A 2W0KA 3LSOB 4ZUTB 1ES0A 4LVHB 2GUOA 1B4RA 1XF3A 5HYSB 1HWGB 3BPLB 5D7KE 2CRIA 2JIXB 2DQGH 1U8OB 2J88L 1WC7B 3FQWA 1Z6JT 1AH1A 1U8LB 3LH2L 4M5YL 4OFDA 5KSUA 3SEPA 3VFVA 2OQJB 3MLYL 2A6KA 3NVQA 4WI9A 2IMNA 1KPRA 1JGUL 1G7IB 1VACA 2KDGA 4OCSH 4ZS7L 4AEHL 3AGVA 5B38A 2NY6C 4RAVA 1NJ9A 2VL5B 2P5WB 4DGIL 3GSUA 3CH1B 4EI5B 1VFMA 2E7BA 1I9IL 4OT1H 4PGEB 35C8H 1X9QA 4Y1AD 5DJ0B 5DJZB 3RWDA 2OL3H 1PGRB 2E8ZA 3JWDL 5DRWA 2VXQL 3O3AB 3C6SA 3S35H 1YEDA 3EGSB 1G1CA 2K7PA 1EXUB 2DQUL 3PHOB 3G6JA 4CMHB 1BJ1H 2Z8SA 4HAGA 1EAPB 3QIBA 2I26N 4R4BA 4TUOA 3D39A 4HEPG 2IANE 4YHYB 4L4TA 3MROB 2AJYL 5BO1H 4DGYH 4DFIA 4OZFH 4TULH 4F9LC 3UXFA 3WEXB 1AQDB 4LCUA 4L3EA 1I8LA 1NFKA 3WKNA 4OLXH 1UCBH 3EOAA 5IW3A 4WEBL 2YD2A 3CAFA 2DWDA 1CICD 3JWDC 3F65A 1UB5B 3KPSE 3HB3C 3H7BA 3H2WA 5I8OL 1E0OB 4BKLB 4Y7MA 3BE1H 1MHPL 4NN7B 2Z31A 2IAMB 1FE8H 4N8PA 3H3BC 5BVJA 1A7OH 1OGAD 2JE8A 3JV0A 3CFKB 4E5XB 4GG6B 3V0VA 1BBDH 2AJUL 1F97A 3F5WA 4HH9A 2NNAA 1U8PA 1CDYA 2W0PA 3TN0B 4PRHB 4WO4B 2ED8A 4GW5A 2X70A 4HBCL 2FX9L 1X5GA 5KSBE 2H1PH 2PTTA 4MCZA 3KDMB 4J3XA 2YRLA 1EEYA 2R0KL 3ZE1F 1YEEL 1XCTB 3LIZL 3DURB 4PJ8D 5FOBA 5K9QG 2WSKA 4M43L 3S8WA 1IFHL 4NQCE 2Y07H 3CXDH 4X0KB 3MV8E 3MLSL 3SDXE 3UJJL 1KIRB 4KJQD 3P11H 1EO5A 2XRAL 5AG8A 4WFEE 4OFIA 4W4NA 1BFVH 1QFUH 2ZG1A 3D18B 4YHML 4U6VH 4HULB 4HIJB 4O5LL 1N3NB 3KJ6L 2WWKO 4GRWB 4LEOA 4MNGB 3LN4A 3GI8H 2J4WH 3VRJB 4UTBL 4QXWA 1G9MH 4EOWL 4BFIB 5JZ7C 5ADPL 3D9AH 3RU8H 3WDJA 4JM2D 4AM0B 1RFDL 2X09A 1IGYB 4AIZA 4GRLA 1JZ2A 2F53A 1T20A 3BH8A 1Z9OA 2IH3A 5E6IB 4HT1H 1IKNC 2XKNB 5ISZB 1FNGA 1KB5A 3L95A 1GHFL 2J8HA 1T89C 3TESA 4FN0A 2NMSA 2AEIT 5C0JA 3L1OH 3MBEB 4KKCD 4EZMA 3O2DL 5F1NB 1A1OB 4HWBL 1GXEA 2Q76B 4WUUD 4K94L 4LPXA 1S7VB 4ELKA 5TDPB 4NUJB 1NCAL 1JPGA 4OZ4B 1K8DB 2OTWA 1NDGA 3C2SA 4JRYD 4ZOAA 2BNQB 1Q9WA 4X7FC 2XTJB 3HPJA 4N68A 3QWRD 1EGJL 2W07A 3EO0A 4DKFH 3HE7B 4WU5A 4ZUUA 5FUZL 2AS5M 4PBVC 5F88B 3C6LB 2ICWB 4LHQB 3LEVL 1EO8H 4P23C 1NGXB 1RUAL 3OPZH 5J89A 5L7XL 2ITCA 2FWOB 1L0XA 2DM3A 4FQXD 3L3GA 1IARB 1DBBH 4BFEA 1KCUL 4KAQL 3MRNA 5FUCC 1CDUA 3QR2A 5MI0B 3WHXB 3ZKMC 4X9FA 5ITFB 1BM3L 4G6ML 1L0QA 4K94C 5T33H 4PJFF 3HZVA 3H6JA 5E2UH 3VGBA 4OBSA 2LU3A 3LKQB 4N9OB 4LSUL 5EFIB 1OAKH 4BA8A 4EBQL 1BQHA 4OZGF 1IEAA 5ALBH 1OOAA 5ANME 5D9SB 4PJ9D 2APVA 2JJSA 1IGIL 4N0UA 3RZCA 5DMGD 4G6JL 3T0EA 4PIRF 1TETH 5KSAD 4C56D 2P46B 3L3HB 1MRDL 1DP0A 3RI5K 3NZHH 5CGYC 5DVMA 4RCAA 2PW2B 1JK8B 1HXYB 4F7TB 5INDA 1H9VA 4M93B 4XP6H 3NGBC 5DGRA 2X4RA 3L3OB 4JR9H 4QRRE 3QHTC 5LJYH 2HLAA 1NMAH 3DBXB 3HFML 1J9CT 1S7TA 1M7DB 1ZVSB 2G5BB 3NPSB 3VD7A 4R2GD 5A3IC 1IC5H 4CU7A 1X5XA 3FO0L 1AP2A 4JREC 1HINL 1IAOA 3Q5TA 4PV8B 3MRPA 4Z7VE 4HFWB 2PW1B 4M62H 1OT2A 4YHNA 2GITA 5IBTL 3DUUA 1XFPA 2ICEA 4WWKC 3LQMA 3HI6H 4I5BB 1H3XA 3OKMB 1IM9B 5JPNA 2FECI 2L4OA 4KI5E 3SKJL 2EDFA 3AY4A 4XWGL 5T5NF 3QEHB 2NY7H 5IVNA 4XXDA 5J12B 5J11B 4ZXBC 1YJDL 1IAIM 2VLLA 4HF5L 2E3VA 3VRLF 3VWKD 3O6FB 1D9KA 3UMTA 2R29H 4X5WA 3CSYA 3MNWA 3OG6B 5GGSA 5DQJA 2D0FA 1P4LB 2YMXH 1JMZA 3R06B 4MLIA 4Y1AE 1A7QL 1PJ9A 2Z35B 2VDLH 4FZ8H 4ACPA 4E42A 3D85A 4RZCA 3QIWD 3FRUB 3RWEB 3FOMB 5D71H 4C83A 2KUTA 3MV9A 5B3NA 4QY8B 3DV4B 2DBLH 5TGBA 1GRWA 1MIMH 3KPMB 4OB5L 1QBLH 3DX6A 3N85L 1IAMA 1S8DA 3U9PH 5BV7C 4WUKH 1KCSH 3AMKA 4M48H 3VXQB 3IU3B 2OI9C 3N9GH 1B0GA 3B9KC 3KPNA 1G0XA 2DD8H 3BZ4B 4F7PA 4GXVL 1F8TL 3PHQA 5TE4L 4XX1E 1DVFC 1RJYA 1FLRH 3MRLB 5IFAH 1OSZB 2JCCF 3W0WD 2MSPA 5A2LH 3DRTB 3PP3H 2ZPKL 1EUTA 4NQDE 1OARH 3BAEH 3OAUL 4FTVB 4LLMA 5FYKD 3DLQR 4YZFF 1FG2B 4TUKH 5K33A 2IQAA 1B4JL 4NZUL 3K7UA 3KYMA 1QLRB 3MRJB 5JNYA 1LK3L 2X4QB 5D70H 1Y6MR 3JUZA 2P5EA 5GGTL 5FO9B 4J1UA 3KYOA 1F02I 5IF0A 4DWHA 5SWSD 1CXEA 1OGAE 4OI9A 5EOCJ 1LEGB 3MO1B 3LKRA 3GZKA 4HUNB 4C54A 4NNYA 3MV7D 3JVGC 2EXYD 1QKZH 5C0AB 1WBYA 4OKVB 4JQVC 5HHOE 2BRQA 3HPLB 4N8VG 2E27L 1JUFB 1NC4A 4V1DB 3B5GA 4RISL 2C4FU 2XQYK 5DS8A 2WBWB 1SMAA 4JM4L 1J0IA 3RGVD 1RURL 4TVPL 5I8KH 4X4YB 2F5BL 3LV3A 1KG0A 5EB9A 3DHMA 5E94A 5JHDA 1ZWIA 1FORL 1IQWL 4YFDB 1KYOJ 3PWLB 3MGAA 2BSSA 4LEXL 4F9LA 4WV1C 3ZSSA 4X7TA 3KLHD 2GSIA 4R0LC 1JE6A 3QIBD 2DLGA 5AAWA 2VQTA 3MLRH 4BELD 3GMMA 3H9SB 3I6GB 5JW5A 2P48B 2Y5TB 3VFTA 2D4DA 4J23A 3MFGB 5IW6B 4L8CB 3BN9C 2I5YH 1BD2A 4XPHL 5ALCL 4X9IA 4CN6A 5HVHC 2ZP0T 4ODSH 1F4HA 4WHCA 1FFNB 5EIIA 2BRRH 3MPCA 2BOCA 5AWNL 3GSQA 1A4KA 1UM6H 4RGOH 4HKJA 1DQTA 1G7MA 2ED9A 5GJSH 1LO2H 4JFPA 4YGVA 5J6GA 1VSCA 5E8OB 4LLUB 4ZD3L 4Z76A 2UWEA 1AO7D 4NZJA 5EC1B 5FAAA 5F6HI 1WCQA 4W70A 4KROC 1CDIA 4A6YA 5I76A 1OB1B 4WUUE 4LKCB 2FECL 1U3HB 2VXVH 4P9HL 3I84A 4OGXH 5ESQA 3DVIA 5FA3A 3G5YA 4GMSL 3QEUA 5D7LA 4O2FB 5DXWA 3OX8B 3MRDA 3NFSH 1I7UA 3J7HA 4G8FA 4JFQB 4ZQKB 3EDEA 4UNTA 1MREL 1TVDA 1CTNA 3KXFA 4AH2A 2BJMH 4POUB 1F58L 3HMXH 3RFZC 5FKAB 3OJDB 1CGVA 5AYUL 2D9QB 5ELIA 4HW6A 4I3GA 4OTXL 4R3SB 4NP4H 4Q9RH 3ZKNC 1MFCH 3OZ9L 2DTSA 3ILPA 4J8RB 1V3KA 3T3PF 3L3IB 4LSDA 2ZCLH 4WTZA 2WINB 5I1JL 2GT9A 1E4KC 1ES0B 5KVEH 3C09B 1M6OA 3SDDD 3O11A 2BY3A 3GGWB 4PRPD 2QHLA 1C12A 3O0RH 4G9FA 1IKNA 1TJIL 1V7ML 1E4JA 2FZ3B 5FYJE 1T89A 4F37K 2EIBA 3S88L 3FO2B 1NGZB 1AJ7L 1D3CA 2VLME 3PUCA 2DKUA 5MENE 3PWUA 3RL1B 5C0DB 2EEAA 3VFUA 3BGFB 3U9UB 3UPRB 4PGBB 1AHWB 2F53D 2X05A 2WMPA 3WFEL 1RU9L 6CGTA 4F9PC 3DETC 3NABL 1B0WA 3LEXA 1QTYT 2JB6A 5DJ6A 3ZO0A 4C56E 4XPAH 1QPPA 4MXVF 3NIGE 4NZTH 3T3MF 1N4XH 3MGTB 4PJCA 4Z0BL 4XNXH 4XHQA 2JJUA 3C8HA 1F3JA 3C8KA 1HQRA 3VXME 1LHZA 4R8WH 3B5HA 1J05A 1XF2A 3DIFB 4K8RD 2NY0B 4P23A 4Z7UB 1JF1A 3U2SA 3BPCA 1JYXA 3MREB 1EJOH 2E9JA 1EEUA 3KPRA 1NQBA 1DQLH 1A3LL 3QCUH 3HG1D 1JZ7A 3D0VB 4YR6B 2X4TA 2P8LA 1REIA 1KLGB 4HWBA 5DFVC 3TPUB 2YXFA 5TDOA 1YC8A 2F54D 4HFUH 1M05A 4CVWA 4JB9L 4H0GA 1VEPA 3KPTA 2WK2A 4LCWB 4FXKB 4K3JH 4UU9B 5TH2A 4OAWA 5CEZL 4Y5YB 3QUKB 4KK9D 4RFOL 1I4FB 2BZDA 4KVCH 4WGVB 1NAMH 4JY6B 2IH1B 3ME0A 3RY5A 5DTFA 1K2DB 1UACL 3QEQE 3TO4B 3PDGA 4JKMA 4GKZB 2V9RA 2WBKA 3MRGB 4Q2ZA 3O4LA 4YHIA 3HCVB 3GMQA 3O9WB 4D8PA 3PQYA 3CFDA 4QRTB 3RZWA 1RIUH 1C08B 5I1DA 5ICYA 3QIUB 5DUPL 4NN5B 5D1ZB 4MQ7B 2FJFB 1KJ3H 1S9XB 3HZYA 4N9GB 1RK0B 2QSCH 1P84K 1HSBB 3SPVA 1H0DB 5JO5A 4HXBH 5EU6E 1J1PH 5IMMB 3GK8L 1SJHA 3T2QA 5AD0A 1S7SB 1CE1H 2XWTB 3L6FA 5C0BB 3V4VH 1N6QL 1B0RA 4PJAF 4K2UL 3DSFL 4XP1L 1EEYB 1CLYL 4LCCC 4YXLL 2WNGA 4WNQA 3H9ZA 1NANH 2GJ6D 2VLJB 4MXWL 5D7IE 1MCPL 5EU5A 4NQXA 3VFPA 3GUTA 1NGYA 5DC9B 1A6ZB 2PO6C 5JW3H 2OMNA 1KNOB 1AE6L 2NX5B 5JOFA 4WWKA 3WCYA 4GH7B 2W9DH 1E4WL 3QG6A 2C1OA 4PJBF 2R0ZH 5I73B 4D9QD 3GSNH 4K9EC 4XHJD 3FMGL 4KTEH 5DUBB 3QYCA 1U2CA 2YUVA 5FYKE 1OF2A 3OKYA 4MAUL 2ESVD 1J86A 2FATL 4ZXBA 5T1LA 2V2WA 3Q5OA 4PJXF 3FQUA 4OKDA 1BGXL 1L0YA 4OM1H 5SWSE 1FNAA 2JLLA 4ERSH 5I16A 2QKIA 2F74B 1VADB 1KC5L 5A2KH 5T5FH 3RTQB 5T3XD 1I7ZB 3EO9L 3MCLL 4MX7A 5EUOA 1C1EH 3DV6A 2O5XH 4Y4HD 5GGUB 3OGOE 4KRPB 2UYLA 5CCKH 2MQCA 2NY3B 1A0QH 5HD8D 4WHYH 5DMIH 1A7NH 4CU6A 4IJ3B 4NGHL 2DQHH 1OM3H 2WLZA 2GJJA 3BEVA 4LCYB 4OGAC 4ZFFA 4DAGH 5DRNB 1XR9A 3D85D 3PWPD 4HPOH 4AMKL 4ELKB 3RVXD 5IB2A 5E4EB 3FT2A 3LKOB 3EJYD 1MFNA 3B9KA 1DBKH 1QHPA 3B5TA 3G6JE 5EOCH 3UTSB 1WIPA 1FNSH 1DVFA 1OPGL 3SKMB 3IDIA 4UZGA 3C5SB 4MNQD 3D39E 3S36L 1KJMB 1G7QA 4X98B 2FB4L 4L4TE 4MNHB 4LU5H 1V7NH 5D5ME 1MWAH 5I1GH 4PJAA 3HZMA 4QHMA 2ILLA 2BNRA 4JDZB 1YDPB 4PJ7E 5IHZA 5CJOH 2XWJB 2OSLB 4DOHE 1SYSA 1D6VH 3WFCH 2NW3B 3JVGA 1XGQA 2IALB 4XVUD 5F9DC 2NY6D 4M4PA 4OLYH 1OTSD 5GGRY 4JQVA 5KOVC 2Z93B 4PJBA 4XBGB 4QF1A 4H20L 1IZKA 3ZL4H 3P4OB 1QR1B 3P3YA 3V7AG 1PEZA 4DN3L 3TH3T 2HMID 3IDNA 4NO3B 2VITB 5D2NB 3WLBA 4LNVA 3QQ9C 1IZJA 5BOPA 1KN4H 1TFHA 5IESH 1AD0B 4NT6A 1ZLVK 4R0LA 3MJ9L 3PNWB 4Q9QH 3V0WH 5HY9A 3FAXA 1JI1A 1LO0L 1JTTA 3BEWB 2ENYA 4ODTH 5CEXB 4ISVB 2YS4A 1NAKL 1TXKA 4H0HB 4LDOB 3UBXB 3RL2A 2PTVA 4GS7C 2R1YA 4F7MB 3F6IA 1LD9B 4M3KB 3U4EB 2DBJA 3UYRL 5KVFH 1MFDL 1K4CB 4I9WD 5DD6B 5E6YA 3RDTD 1ADQH 2GITB 1EFXA 1KACB 3H9HA 2H3NB 4ZFOB 2BVUA 2G75B 1NCUA 2ZSVA 1TCRA 2AEWA 2V5MA 3NAAL 1MFBL 4CUCA 3LS5L 2I24N 2F53E 3FQNB 3V5KA 4LARL 3X14A 2R2BB 2AXGB 1Q1JH 5LGHH 3MOBH 2E8YA 1RUKH 1CGSL 4JO3H 1U95B 3CSYB 1U8KA 1UA6H 4PJFB 2VXUL 3GNMH 4I1NB 5I75B 4FABL 2BNUA 4EDWL 3QDMB 4UB0H 4ZOBA 3TVMB 3VFWB 4UQ2A 3FB6A 5CS7A 3ARBB 4R4ND 1YC7A 4OZGB 4XNMB 1UKTA 1D5IL 1GVIA 1KCKA 2X2YA 3QSKB 2FX8H 3RNQA 4YQXL 3TWCL 1JRHH 3INUL 2I9LB 1HH9A 3I6KA 3V6ZB 3CPLA 1E4KA 4X7CC 3KXFD 5E8NB 3L3DB 3WL9A 3B9EA 1CXKA 2R4SL 4NFCA 1HQ4B 3C60B 1LP9F 1D5MB 1S3KL 1NBZB 2F54E 1JMXA 1FV1A 5F6IC 4K07A 5I1EH 3C5ZB 4Y2OA 2VSDA 3OWEA 4PREB 2IFFH 3M8OL 2OMBA 5I0DA 4TVSa 2QQKH 3NCYP 4MDJB 2HRPL 4NYLA 4U7SA 4LLMB 3FQTA 2Q1EA 3BKCL 5DJCB 4CMMA 4LHUG 4HC1H 2AW2A 4G9FD 4MD4B 1NCBL 5D6DC 3GBMH 5C7XL 5EBWA 4F9PA 2EH7H 1J8HD 4GW4A 4MZ3A 4ZTPH 4Q58C 4ZUSB 4PJGF 4OF7A 4MA7L 5IF0B 3BKJH 4P3WA 3ULVC 1UXWA 2QTEA 4XMLH 4NO2A 1ED3A 1FVDB 2MCPL 2DYPB 4NQTA 4HG4K 1X7QB 1CXHA 4UT7L 5CINH 3T0EE 5GRJH 4KV5E 5IT2L 1MEXH 5DS8B 3Q3GA 1G7PB 4EN3B 4OBRA 5D2LF 1JGDB 3REWB 4HDIB 4M7KH 1HNGA 2JIXD 4GG8A 2GJ6E 1INDL 2VH5H 5JQ6H 2GHWB 2IQ9H 5B8CC 5I74B 4DUXA 2EH8H 2Z8VC 5L2JB 1MJ8L 1U92A 2BSSB 3BPNB 4FFYL 1IL1B 4XMKH 5H94B 3OF6D 3RAJH 4HXAH 2X9XA 3KPRD 5IM7A 1X5YA 3RKDC 4QOKA 3NIDE 4NZRL 3W2DH 4XVJL 5L2KA 5LGKA 3KHOA 3I2CL 2FEDC 4D9QE 1WCBA 2IGFL 4TTDC 2PCPA 1IT9H 3P0VH 3IFLL 1KGCD 5BMFH 1UZ6F 5FM5M 4RAUB 3VFSA 1IC4H 2ESVE 1HHJA 4OUUB 1MHEA 4ZODA 4R7DA 2WP3O 3I75A 4EI5D 3K2UL 1GIGL 1LP9A 1YQ2A 3GMPA 1HCFX 1YEIL 1DQML 4YHKH 4DW2L 1RZ8B 3QWOB 5ESVB 4IDJL 2IEPA 5DJYB 1U8QB 4KGJA 5T3XE 2W1NA 5GIRA 5J1AA 2JCCB 4N0YH 5ACMA 4U3HA 3RPIA 5HHQB 2LAAA 2DDQH 1R3JB 5DUML 4UQ3A 5IEHB 1FGNL 3BDYH 1F00I 4LCCA 4YO0B 1NFDF 2E6PA 2PYFA 2GJZB 5E2WH 1WEJL 3B2VL 1OGTA 2DN7A 5J56B 2ITDA 1IKFH 3PWPE 2ATPA 5EU4B 3MV9E 2R2EB 4PJGA 2PO6A 4YIQB 2MHAA 5HYQA 1DLFL 3ZDYF 2A9ML 4YAQA 5JORB 2NZ9C 2BC4A 2SEBB 3U1SL 2DIBA 4PBXA 5IMLB 5E2VL 1I1CA 3HAEG 3JWOH 32C2A 3BKYH 4L4JA 1AXIB 2H2SC 2FDBP 2YPLB 2V7NA 3O2VL 4Y19B 1I85C 1WFNA 5D2LA 1KT2A 4WWKD 4E0RB 2DI7A 3LZFL 4HGWB 2IAMD 4Q0XL 4U3CA 4ZUVA 1DDHA 4LP5A 3H7LA 1FC1A 1CFQB 1G6VK 5ILTL 1R5IA 5DR5L 1S7RA 4F7EA 2GK0B 4KUZH 4FQHA 2I9TB 2D0GA 4U1JA 4X99A 1YMMA 1FL3A 4NC0B 3U79A 3QDGA 4H5SA 1N5YL 1H5BC 4WO4D 3QJFA 3TT3L 1QFOA 3NMEA 1CGXA 2W92A 5EZIH 4DZBA 3BGMB 3UTOA 3RJDA 4P5MA 4H8WL 1RZFL 4IRSC 1D5ZB 5B39A 1T7YA 3KLDA 1I9RH 1NH6A 4XCCH 43CAA 2EO9A 5KZCB 4IS6B 1E28B 3BX7C 1QSVA 3UJIH 1K3IA 1RVFL 1F3JB 4LF3B 3PWVA 3KLSA 5JHDE 1FSKC 1XF2B 3ARDB 3B9KD 3QEGH 3ROOA 2VLRA 1RUMH 3QUXC 1YQVL 3E1F1 1D5BB 5DURB 4I0KA 5F9OL 2R23A 4QXUL 1FP5A 1P7KB 5K93A 5D1QB 3MLTB 1NFDA 4KDVA 2Z91B 3RWGA 3HS0B 5JDJA 4R26H 1IGMH 3H3PL 4H8WC 3VCLA 2R4RH 5B38G 3LKSB 4I9WE 4JY5L 4OGYL 1S7XB 3O45A 5E6ID 4JO2L 1C5CL 4ZS6D 5C0RL 5ISZD 1BD2E 2PYEB 1F3DJ 5LCVH 2DLFH 5E5UB 1JZ5A 5C07B 5BJTA 3MBED 4RBPK 4XCFH 3WIHH 4KKLC 1XIWB 4E41A 1UH2A 1IBGH 5DD1L 3QP3A 1H15A 1MCLA 3PWNA 5C86A 3VDCA 1A3RL 1U8HA 3O6LL 2RIKA 2FLBT 1IAKB 4MAYC 3BIKA 4Y4KB 5FYJH 2H32A 4K7PL 2NTSP 4OJFH 4TPRL 2UWEE 4CN4A 3WE6B 4JFXB 5DQ9B 2BNQD 2XYCA 1HIML 3PQYB 2XTJD 4AQ1B 1JTOA 2DMCA 5E8PA 4PJ5B 5J8OA 4G8IA 1I8MB 1X4ZA 3D25B 2HTLC 3HE7D 3P77B 4KKNA 1LQSR 2DQDL 3C6LD 2FX7H 2NY2C 5J06A 1JTPA 1Y0LB 4F37F 3MLVL 4PJEB 5F89B 3FB7B 4HX1B 2OR8A 3MFFB 1OLLA 3MJ7A 1QBML 5DJDA 2W60A 3GMRA 5D7LE 4L8BA 1MJ7L 4I0CC 3VWJC 1IILE 3G5XA 2DKSA 3HNTH 3TZVC 4L8SB 1HK6A 1Q94A 1C16A 3KXFE 2R1WB 1JHTB 3QFJB 5KVGL 1L6XA 3ULVF 1G7JB 1EZVX 1KXTB 4UINL 2GYSA 3B2UC 3VMNA 2DWEA 1I1YA 2ZCHH 3EYFB 1U91A 2EE6A 3IT8D 4YHPA 1U58B 5TQ2L 1C7TA 4UBDC 3A67H 5DVKA 1RV6X 2HFEB 4TVPD 1SYVA 1GZQA 3HC0A 3MRQB 5FYJU 3VXNA 1U8MB 1AY1H 4G9FE 5CKGA 1F6FB 3BUYB 5CHNA 1XR8B 5HGAA 1DSFH 5TF1L 1J8HE 2N7AA 3C9NB 4KJWC 5GSVA 4KROD 1DR9A 1BMGA 1R5VA 4O02H 1DEDA 1JV5A 3T77B 4QRUB 4YHZL 4RGNB 2FO4A 1EIBA 3HAEH 3AREC 5FIEA 3MRCA 2AJXH 3MLXL 4JLRB 4W4OC 3DO7A 4KY1L 2ADIB 4PJCE 3R0MA 4PGCA 1IGCH 5DZLA 1LEKB 3D2UB 2NXYC 4G7VH 2JJVA 1F13A 5KVDL 1GC1C 4CADB 1RULL 3CDCA 1AR1D 3W11C 3CMOL 5KN5A 1QLEL 4O2EA 3HC3H 4ZFGL 1IM9D 4M1GL 3CFBB 3KPRE 3PWJA 4HGKC 4PY7B 1OW0C 5C2BL 1YEGL 4PTTA 2IBBA 4WFFD 5TE7L 2XT1B 4F3FA 3D3VA 4NNPH 1DCLA 5D6DA 5H2BA 4XGZA 5I30H 3O6FD 4PJAB 1QO3B 1DTUA 4PLJC 2UZIL 1XF5A 5KANI 4NKMA 4ZFZA 1JI2A 5DJ8A 5EPMB 1Q0XL 4P5TC 4IRJB 3ARTA 2Z8WC 5IB4A 1XF1A 5EZJA 1ZHBA 4ONHA 3TBVA 3GSVB 3S5LA 1PQZA 1QOKA 3X13B 1PKOA 4LHJB 5HI4C 3VD5A 3TCLA 1AKJA 2ZG3A 2X4UA 5SV3A 2O61B 4PJXB 5B8CA 1F4WL 1MFEL 4HKBA 1SY6A 1BIIB 1EJ6A 4OZHB 5CUSL 4FXGA 2OZ4L 4TNWK 1MQKH 3B3IB 4PRAA 5E0QA 2VQ1A 1DFBL 3O8XB 4JPIB 4LSPH 4P46B 1U8NB 4PGDB 3TO2A 4FTVD 2CGRL 1I1AC 2EDWA 1QA9B 3MLWH 2Q3ZA 3KPLB 3KYKH 5C0GB 2DI9A 1CBVL 4F7CB 1MJUH 4GBXC 1LGVA 3BP4B 3IU4H 3BH9B 2H8PB 5FYKU 2IF7A 3EJZD 1IC7L 3FT4B 3GMNB 4GG6E 3LMJL 3KYNB 4OLZH 4RIRA 4NJAH 5JXED 1F90L 4ETQA 1EFXB 2VMFA 4FQCH 4V1DD 3M17A 3BRDA 2VDNH 3QZWB 4JPVH 4NNXB 5BXFB 1MNUH 4C4KT 3JZ7A 1G6RB 3NFPA 1N5AA 2RBLA 5BRZB 1G7LA 4NHUA 5C0CA 2DOCA 3QXAA 3DWTA 2B0SH 2R56H 4PLNC 3IJHA 3WKMH 1NCTA 2CQVA 5L0QC 1YUHA 3UTPD 3UBXG 2JB5H 1A22B 5EUOE 2YKLH 3DRQA 5DO2C 1ORQA 2XA8L 3T2PA 2YEZB 4H25B 2ADGA 1UYWL 3HUJF 4PG2C 1HH6B 5CEZD 3H9SD 3ZHLA 1IEBA 2A6JB 1AGCB 4GRWE 4MNGE 4DQOH 1YYML 1W0WA 3BP6B 5HHMB 1JN6A 2OR9L 2AI0H 3CIQA 4CDGC 1I85A 3MNVB 5E08L 2BVEA 1SBBA 3VI4E 2Q8BL 5D93C 1HYSC 5A1AA 3G08A 1LO5A 1RJLB 3QAZC 4S1DC 1MAMH 3SDAB 1ZLUH 1YEHL 1CCZA 4ODHH 1ONQA 4ONGH 1JWSA 1H5BA 1MI5A 2GCYB 3CVHL 1DUYA 1JVKA 2BNRE 3WSQL 1DBML 1AI1L 1NUGA 4I18C 3VI3F 4DUWA 4HJJH 4D0DA 4IRSA 3WV0A 2IG2L 3GSXA 4QCIA 2FGWH 4PRIA 1U3HD 3R1GL 4R90H 3WNLA 4QKXB 5GRZA 5DMKB 4KRLB 5A43C 2FJGA 4I2XA 1KCVH 3MRMB 5ESAA 1T1YA 3QULA 1BOGA 3O3UN 4WEUD 1PDKA 2BNQE 4S0SD 4L29B 2ZSWA 2XTJE 3EDFA 1T0NA 3MBXH 1A64A 1H3TA 3V52L 2AEPL 2G2RB 1F3DH 3ULUC 5C08B 4KZEH 4F58H 2JJWA 2APTA 3VFGL 3ZKXC 3QUXA 4KVNL 1KB5H 1AD9A 4UNVA 1MH5B 1TJGL 5D72H 3VDBA 1A7RL 1R5WA 2CK2A 2JELL 5AZ2H 4G5ZH 1KJ2A 2VAAB 5BS0B 1Q9OA 4HS3A 1K9TA 2NXZC 4GG8B 3UTTA 4K3EH 4UV7L 3ARVA 3HUJA 1ZSDA 5DFWH 2YPVL 4YWGH 4LPVA 2PF6A 5GGVH 1JGLL 4G6AC 4U33A 2RHEA 3E8UL 4TVPE 3WN5B 5MP6H 1OP5K 1SBSH 3K8KA 1S9KC 4GUPA 4K3DH 5T5NG 4TSBH 5SX5H 4MAYA 5DHVB 1QYGH 2J5LB 3MACH 5EZOH 4OLEA 2AK4D 4HIEA 5IHUL 2Y6SD 2R2HB 3CUPA 4V2CB 3CFCL 2LV4A 4KFZC 2VZVA 4ALAH 4PFEA 3EYQD 4Q97A 2DIAA 4KMQA 5BVPL 1UEMA 2NY0D 3PE9A 5CD3B 4HUXA 1NSNL 4MMXC 2BFVH 4NPYB 4PYGA 5GIRB 4JFEB 5HJ3A 3O6ML 2CKBB 2H45A 5F9WB 3MRRB 2B7DT 3VXSA 1G6RL 4Z7QE 3L3KB 4LFHD 1J87A 2B2XL 2EDQA 1PG7X 4NO5B 3QPQD 1UJ3C 4YDKL 1KPVB 2KL6A 3VWJA 5GS0H 3TZVA 4H88H 3BQUB 1CQYA 2MKWA 3M1BA 1E6JH 1F4XL 3JTSA 3F12B 5HYQB 1FDLH 3T4AB 5JOEA 5DEZA 1DQDL 5KS9A 3TIEA 2BXYA 1Q8MA 3AMLA 5DD0H 2RJMA 3TO4D 4QRQA 2A73B 1ZLWK 4HUKB 1T1ZA 1U41A 4ZSOA 1YPZF 3E2HB 4JFDA 1X5ZA 1DDHB 1MJJA 3ZYZA 4OLVH 1UVQB 3O9WD 1JWUB 2RCSH 4Z7WF 2FSEA 2V17H 2EDRA 1NLDH 3QIUD 3L7FA 3W9DA 5DD3H 2MPAL 5D1ZD 3VGAC 3QUZB 3WNOA 1V8HA 4P4KB 1FYTB 1DLHA 1VDGA 3N1QC 3AREA 5EBGA 5I17A 1QQDB 3GBNH 4IBLT 3QHZH 4CKVX 1N7MH 2ICCA 4W4OA 1T83C 3AS1A 4YDVA 3AM8C 5IB1B 4U6HB 1T1WB 2VLJD 1K5NB 3GSOA 4H26B 4XNUL 1Z0NA 1ZGLA 2WIIB 5GRUL 2GTZA 1DE4A 3NA4A 1UQSA 3D48R 15C8L 3V4PH 2NX5D 3FN3A 1Z3GH 1EHLL 3SKOB 4OV6F 5LXGL 1OW0A 3EOBB 1D5XA 4Y16B 1BECA 4HUWB 1YY9D 1SJEB 1C5BH 3A6OA 4Y5XC 1BEYH 2X9YA 4FTVE 4LAQL 4UAOC 4HQQL 2V5TA 1JHKH 1TVBA 1QHOA 3WNPA 1M7IB 4NJ9H 4HIHB 3CU7A 4MJIA 2EXWC 4H0IA 1GJIA 5ICXB 3QCVL 5FXCH 4FFZH 1WBZB 4QOKE 5GS2H 4OIIH 4QLRA 1B90A 1KTLB 5L2KE 3RWHA 5KW9H 3MRBB 3U6RB 3SDCB 4NUGH 3U46B 4P5TA 3C2AH 4ZAKC 3QUYC 1EHXA 5IFHH 2KZ1B 3AB0B 4NM4L 3FOLA 3RTQD 1KB9K 1U6AL 5EC2A 1UWEL 4KRPD 4HV8A 4XC3H 4WENB 2NY3D 3PHSA 1CZ8H 4V1DE 5IMKA 4D0BA 3P4LA 2X41A 5C09A 5C0IB 4PP1D 3NH7L 4DKAA 5DYOB 1IGTA 4Y0GA 1YA5A 1DL7H 1A1NA 4Z7WA 3UTPE 3DYOA 3UTSD 3JTTA 1AGBA 3MRFA 1VGEL 5K9JL 4HWEH 1JGEA 3IDJA 3MCKA 5CEZE 4G8IB 1HI6B 1E27A 3H9SE 5EZLA 1I1AA 2F15A 4RGMC 5HGDB 3LRSA 5FDWA 4K7FA 1HXMA 5CAYB 1ZGLP 2EDEA 2J88H 4N0RA 2A1WL 4GBXA 1CR9L 2HN7A 1WFTA 1S5IH 3C8DA 3LH2H 4M5YH 4X9HA 2DLIA 4IHOA 3VG0L 4KQ4L 3PL6C 1WBXB 2XNAA 4LLVA 4DVBB 3MLYH 3VD3A 3G6AA 4X5LA 3GDBA 1A5FH 4MD5A 3V6FA 1JGUH 4AEHH 3W81A 3ULUF 1GYAA 1I1YB 5H37G 3QI9B 2OZ4A 2VXTL 4DGIH 1ZT1A 1FO0B 1KJVA 4QNPE 2RB8A 2WWKT 1G7HA 5EA0H 1BVLB 4NM8L 3IVKA 1ZTXH 2BHYA 3H9YA 3JWDH 3U0WL 1JNNH 5EO9A 2VXQH 3PGCB 3RVTC 5E99L 2IPKB 4PUBH 2DQUH 4X6EA 4U6TA 5GSVB 1BFSA 4PG2A 1KEMH 2J6EL 1KTDA 5C0CD 1UM5L 4HWNA 2ATKA 3CSPA 1JWMB 5IJKC 1CFVL 1TQCB 5IBUG 4LCIL 3U4AA 3TJEH 2WUBL 4YK4B 4HUUA 3VRIA 4ZDHB 4OZIF 4JQXC 1A6WL 3DVGA 3PIQA 4LIQL 4X6DB 3TP4A 1UZ8A 3ZDXF 4PB0L 3UZQA 2CMRH 2NPLX 1BWMA 2VE6A 2J8UB 4NFDA 3VXRB 3I02B 3VA2C 3CCHA 1V3LA 1CDGA 4XPBL 4ODBD 4O2EB 5T1MB 5I8OH 5I1HL 5F3HA 2CKNA 2ZUQB 3IXTA 2YC1B 2KQMA 1U0QA 4I18A 1MHPH 4RA0C 2B5IB 3V6OC 2VIRA 4RWHA 1CLOH 2D7QA 2ICES 5T1KA 3T0WA 3ZE2F 5FHAL 2AJUH 3ARZA 1NMCB 1O7VA 5F7LB 1T2QH 3WNMA 1NGPL 1LVEA 3BFOA 2AK4E 4NRZA 4Q6IB 4WW2C 5HDBF 3KPOB 3SGEI 4HBCH 5LBSL 3SY0A 2PXYB 4JFHD 3X12B 3Q1SL 3QDMD 5FUOL 2R0KH 2RFXA 3FRPA 1RIHL 1YEEH 3TVMD 1FJ1B 2NY1C 4RMTA 3LIZH 4EIGB 5HGHB 1QFWM 3ARBD 4JPKH 1IFHH 4OUOA 4Z7UE 3TGXA 5D7JC 1GGCH 1AC0A 3MLSH 3EUUA 3LS4L 3UJJH 1YN6A 3CVHA 5DHYB 6FABL 3SJVB 1TLKA 4MS8D 4YHMH 1XGUA 4JRXB 3KJ6H 4R97C 2EDKA 1BFOA 4ONFL 1CK0H 1HKLL 3MUJA 3RNKA 5J0BA 3QNZB 3MNZA 3O41A 3R4DA 3C5ZD 4KKAC 4XP9H 1S7UB 4UTBH 4EOWH 3GB7A 2MKLC 4NKDB 4PTUB 5ADPH 3AXLB 4M61A 2OJEA 4JFZH 1RFDH 1ZHKB 4X5XA 1Q0YL 5EOTA 2BERA 1CFTB 1FL6A 2YZ1A 2L7UA 1GHFH 2A6DB 2Q7YA 4JO1L 3WHE1 5IKCB 3VXOA 1KUMA 2C3VA 5IR1B 3SKNA 4J7RA 2DYPD 5HHPB 4HWBH 4EUPB 3D5OF 5JHLL 4K94H 1BVKA 4M7JH 3WXVH 3WFBL 4MHHI 3HRZA 3G5VB 2HFTA 1FO0L 3NFPB 4EN3D 3STLA 1UJ3A 4NHUB 1FZKB 3BT2L 3V2AR 3PDOB 2OTUB 4QXTB 3QXAB 3GSWA 2VLJE 4N8CL 1NGWA 2YRPA 3GI9L 4HKXA 3DX8A 3QDJA 3RVVD 3VFMA 2FO1A 1MVFA 4YPGB 5FUZH 3TBTA 2YHGA 1Z9MA 3CK0L 3LEVH 3STZB 5ITBL 3QNYB 3VXSD 1RUAH 4PRDB 4OFYD 1OAZL 1RHHB 5KG9A 3PV6A 3FFCA 4U31A 4NRXB 4M00A 2Q8AL 5H37H 4HIIA 4OD3L 3QPXL 4GKSB 1KCUH 5CSZA 5FYLL 4U1HA 3OGCA 4LK4A 3ZTNL 1G84A 3ARGB 3QZWG 2OCFD 4G6MH 1ZVYA 1AGFB 1WTGT 2YBRA 1FNEA 1MCSA 4FFWC 4HK0B 2VZ3A 4IIQC 4PLOB 4QHKI 2AJSL 4LSUH 4L4VB 3CFJA 3DHJA 2DQJH 4EBQH 3O3DB 4YFLI 3KJ4B 3ROLA 4PR5B 4JO4L 2XN9B 5E5RB 3PABB 4GJTB 4P2OC 4YDLB 4KK8D 5J13C 1IAII 2KZWA 5F72S 1X6NA 5C6TL 4UDTA 4CVUA 3FN9A 4KJWD 1MRDH 3Q6FB 2IPTL 1T83A 1T5XB 4YE4L 4FP8H 1WAAA 5GS1C 3AM8A 5TJWK 1BZ7A 4HJ0C 5CFHA 5E9DA 3DX7A 4LLYB 5SWZD 3U36B 2FHCA 3W39B 3FO9B 5J6HB 1FAIH 2CIKA 1S7WA 3HMWL 2HVKA 1OLZA 4HHAB 3HI1B 3JV6B 5BQ7B 1UCTA 4KI1A 5D1XB 2ZUTA 4NFBA 3S34L 3UTSE 3X3GL 3IFNH 4Y5VB 4FQLH 1VGKA 4Y5XA 5CJBA 3RUGA 2C3HA 3FO0H 5D6CB 2YPLD 4D9RD 4Y19D 5HYJB 2Z92B 5BZDA 3A6BL 3O2WH 2C5DC 5IBTH 5JTWA 4F15B 1K4DB 5INCB 3WLWD 3ZE1E 1RD6A 5IGXL 3HZKA 1NBVH 4CBPA 1XGYL 3GJFB 3PGDA 5BV7H 4HS3B 1JNLH 3SKJH 1JPFB 1AQKH 1NL0H 3F62A 4XCYB 3QUYA 1WISA 4XWGH 1HEZA 4LDLB 4NKIH 4PS4L 5DEFA 4ZAKA 2Q20A 3RWFA 5IB3B 3ARXA 5CWSB 4X6CA 3HUJB 4LDEB 1VEMA 3AS3A 5F7DB 2FRGP 4KHXH 1PKQA 5F6HJ 3OXRA 4G43A 1NBYB 2FH6A 3MYZA 2A77L 4GAJL 2F58L 4LASH 3L5XL 1OTUC 3EO1A 5KZCD 2VN4A 4NQSB 5HDQL 3D0LB 5D2NE 2P47B 1FL5A 4GKNA 2RAMA 3H0TB 1PLGL 1PFCA 4U1GC 4NQEA 1TQBC 4LSQL 5JXAL 5GZND 5C0CE 3G5ZB 5JIIA 1KCLA 3VFOA 5CMAA 3VXTA 4MDIA 1YEFL 2QEJA 1W72L 3ARDD 1UH4A 2R8SL 1CGUA 2X4SB 4MJ5B 2HT2D 2VISA 5DURD 5FKPA 1N0XH 1TCMA 3BP7A 5D1QD 3VD9A 2F5AL 5FCUL 2VDPL 4GXVH 3X11B 3BXNB 5TE4H 2Y7QA 4DVRL 3IS1X 5C0EB 3PL6A 2OL3B 3GEWB 4WW2F 1TNNA 2C3XA 1LO3L 2OK0L 4QWWD 2ZWLT 2ZPKH 3OAUH 1MVUB 3LQAL 2PKDA 3EYOB 1RZKL 4NZUH 3ZHKA 1HNFA 1S7QB 3KR3L 1MPAL 5IIEA 1MHCB 3CMGA 1OL0A 5K59E 2DL9A 3DROB 4BSWA 1SEBA 5BW7C 1HILB 1T0MB 4JHAL 2W0LA 3MJ6A 4QRQB 4I3RL 5HGBB 3O3EA 4OZFB 5IG7A 4Y4KD 1B2WL 1MI5E 4R7NB 1P9MC 4ENED 1SM3L 4YXKH 1LILA 2E27H 5DJAA 5JR1L 4PJ5D 4RWYH 4RISH 4QT5B 2VN7A 3QCTL 4JM4H 1F42A 5GSRB 2FR4B 1RURH 1M71A 4PB9L 3IXAB 4TVPH 5IJKA 3QDME 4DUVA 4XBEL 1BFTA 2F5BH 3BPOC 1NLBL 3B9DA 1T66D 2WLYA 1FORH 3IKCA 4I2XE 1RZKC 4DCQA 1GAFL 3EBAA 4JQXA 4LEXH 4GRMB 2R0LL 2D31A 4U6YB 4HPYH 5HYFA 3L5WB 3TNNB 4PRNB 1IAIL 1T3FB 4XNYH 4UUJA 3H42L 4OFKA 5KSBF 3QFJD 5DRZA 4GXUM 1CICC 3MLPA 5T3ZH 3ARGC 2HT3C 2CLVB 2ZNWA 2HKHL 4HWZA 1QLFA 4XPHH 5ALCH 1OD9A 3LD8C 3SDXF 4U1IA 1R0AL 5L88H 3V6OA 4AK1A 4B41A 1U42A 3DVNA 4GW1A 5JDSA 3LPGA 2CRYA 1A1MB 3ESUF 3CJJA 1MAJA 5AWNH 3BWAB 5ENWB 2V5SA 2WQRA 4P5KB 4BH7A 1MF2L 1QSFA 3W39A 2MMXA 4YX2L 4WW2A 3QQ4A 2DM7A 1SJXA 3N1GC 4YC2C 4Q74A 1TZIB 2IANA 4BK4A 1GGYA 4RGND 2FGZA 4D3CH 1HHGA 1QBBA 5D7JA 3X3FL 1VFBA 1CE6B 4KJQC 4EXKA 5E8DL 1HHKA 2JK5B 3SGDH 3ES6B 3D2UD 5F3BA 1BOYA 2Y72A 1YPZB 1KCRL 4OCRL 1QRNB 5AUMB 4PLKC 3RY6C 1MREH 1AFVH 3NOIA 3KPSA 4R96A 2MWCA 5EORL 4PJHB 2QR0A 1F58H 4HMDA 2AXFA 5ABDE 2VZ1A 3VXSE 3MJGX 4OTXH 2AQ2A 4NO0A 2YSSB 4JM2C 2VOTA 4JFYB 5L6YH 4MQXD 2X4PA 2CUMA 1QP1A 2NXZD 4QRSA 3L3JB 5I1JH 3GMOB 1ZHNA 5ECJE 4ZNEE 4N1CA 4XRCB 1HXMB 4Y88A 1KSRA 1NMBL 1MCCA 3MRHA 4O2CA 2W0FA 3SQOL 1JF6A 1V7MH 3VXPB 5F9JB 1KFAL 1PEWA 3T4YB 4OT1L 4APQC 35C8L 5KSBA 5DSCA 5FGCB 5KS9E 5ID0B 4KKCC 3UPCA 2OL3L 4IRJD 5FB8A 1BBJB 2XQYG 3S35L 3LEYL 1KENL 4L1DA 4WJ5A 4YDJA 4NQCA 5CP3A 4UNUA 3IFOB 4ZSOE 2X1QA 5D8JL 1OWRM 4JFDE 5E56A 1KJVB 4YXHH 3IDYC 3QA3B 4UOJA 4I4WB 4U1MB 4QRPD 2VUOA 3TBWA 4ZUWB 5SWZE 5BO1L 4DGYL 4UTAH 3QG7H 4ODUA 4TULL 4ZPTB 1DQJB 4X4ZA 7FABL 3HN3A 3IJSA 1UCBL 2ARJA 3VE0A 4P46D 2K3TA 4FQXC 1CU4H 3LDBB 1X5HA 3MGOA 3K1DA 4PGZA 4M6NL 2N4IA 4NWTH 1NFIB 4KTDL 2YPLE 4I48A 4D9RE 5FO8B 4JVWA 1T6VN 1EEZB 4P99A 2AKRA 3D6GA 3BYTA 5LWYH 3IF1A 4RMUA 3OQ3B 4ODWB 1YZZA 4IIQA 4I0PB 4EDXB 4HGMA 2AJ3A 1QUNA 3P2TA 1HDMA 1BBDL 4F8TA 5CIPA 3U0PA 2CD0A 3QXVA 4KQ3L 1NC2A 3NCYS 1XGTB 4PJ9C 1S9WA 8FABA 4P2OA 2WBJB 3P4MB 1UACH 1UG9A 3Q6GL 5LAXA 5KSAC 4Y2DB 4Z7VF 3ARFB 2MQ0A 4HCRL 5BRZD 4TSCH 1FN4B 3NZ8A 4Z7OE 3JV4B 3MLZL 4NBZB 1DQQA 5GS1A 4M4RA 2IPUK 3ZT5A 1DBJH 1UKSA 3HNVL 3BWUC 4KI5F 5DUPH 4XBPB 4Q7DA 5I6XC 3I3BA 3WDHA 1BJMA 1P84J 4UIMB 3UZVB 4G9DA 4XCEB 2A83A 3RX7A 1W2KT 1QFUL 5HHVH 5TPWL 4NRZB 1V3JA 3LB6C 4R2GC 3VJ6B 3TBYB 4EVNB 3GI8L 3TFKD 5E9DD 3QFDA 3AAZB 3DSFH 4JG1H 4XP1H 1H3VA 5HHMD 4UOW0 4N0CD 4WCYL 4YXLH 3UJTH 1G9ML 1N8ZA 1OWWA 1MCPH 2ZUWA 5JW4M 5FCSH 1RZ7L 4XB8A 3VW3L 1AE6H 4MJ2A 3OKOA 3TNMA 5ID1A 1E4WH 3DXAB 1UFUA 2WW8A 1BIHA 4P4RB 1BFOB 3SDAD 1H8SA 1FZMA 2BVPB 4NOBA 2VLKA 2FHBA 5LVEA 4MAUH 1S9YA 2FATH 2DJUA 3UC0H 3VWKC 3L1OL 4K23H 4P3CH 1HHIB 1P7QA 1FCGA 1JNHA 2ZZUT 3IDGB 4YEEA 1A2YB 3OKNB 4HZLA 1BGXH 4PRBA 4X5XB 2DLEA 4JJ5B 2IADA 2G60H 1BLNA 3S5LG 4OZIB 4ELMB 1KC5H 2GAZB 3QIWC 4KGLA 5H35A 3EO9H 2K1MA 2UY7A 3MCLH 4Y4FB 1LE5B 3S3JA 1TVHA 4UMGA 5CJXC 2BVYA 4JKPL 3MV11 4PJ5E 5LGJA 3BVNA 3GJEA 4NGHH 5I8EA 2YN5A 5CJQH 5C08D 2EDTA 3QJHB 4Z7VA 4AMKH 4PJEE 1CGTA 5FFLA 2E9BA 4NQED 1DBBL 2P24A 2OX5A 3EYVA 1XGPA 2W65B 1CIUA 1JGVH 1OPGH 5BS0D 4KJYB 3K4DA 5T33L 4LPTA 5E2UL 1NGWB 2AJVH 5IVXA 3RVWD 4N0FB 3S36H 4MLSA 4TTGA 4RFNB 2FB4H 5I1AB 1N2RB 1OAKL 2H32H 2CLZA 3DUSB 5DA4A 2VR9A 4YDIL 4D9LL 5BW7A 3DGGB 5EO1A 4Y1AA 4BH8A 2D7PA 1QFHA 4HS6B 5JW4R 4JFOB 1TETL 2EXYC 1W72A 5MEPB 1Z5LA 3QQ3A 3LKNA 4M7ZC 2COQA 2HVJA 2MCG1 1P9MA 2ERJB 3GMLB 1TJHH 2Q86B 3TYFA 3NBNA 3OR6B 2CLRA 4H20H 1KLUA 1MSPA 1I8IA 3I85A 3RGVC 4YHOL 2CDGB 4DN3H 1YYLL 3EZ8A 4JM2F 3U30C 3LN5A 2BDNL 2CIIA 3RWCB 5DHXB 4P2RB 3QWQB 4WW1B 3MUHL 1CDHA 3KLHC 3UDWC 3O4OB 5GGSY 5IHLB 4JGMA 1G9NL 1MCBA 3BQUD 3T65B 3MJ9H 2LTQC 1IGFL 5FV2A 1CICA 1F11B 5DK2A 3FN0H 4OF0A 5GGRA 3LHPL 2D0HA 4RNRB 3ALPA 4FG6D 4UV4L 3S4SB 1ZA3A 3MUGA 4XPGH 1XCQB 1RJZB 2NY7L 4Z6AT 1OGAA 2FJHA 3T0AA 5FK9B 3UYRH 1MFDH 4MD0A 4U7KA 4CRPA 1FFPA 2X5PA 2R29L 1V5JA 5IMOB 3BHBA 3FO1B 4M6OH 3HZKB 2YMXL 3PGDB 1OAUH 4M9OA 4QTHA 1RZIA 1YY8A 1G9NC 2XICA 3NAAH 5D71L 4P4KD 1FYTD 2APWA 2RR3A 3LS5H 2XZCH 3BDBA 5ICZB 1MIML 5I8CB 1QSFD 3SCMC 1QBLL 4BFBD 1MRFH 4LARH 1EBAA 1FZJA 3TA3B 1OSPL 4GAGL 5J9PA 1CGSH 2H9GA 2EKJA 1WZMA 1HSAA 3N9GL 3U7AA 2VXUH 4FABH 2GTWA 4QRPE 2P8PB 3RY6A 5BZWA 4FQ1L 3RWIB 5IV2A 4JFFB 1JPST 4OZHE 4OF5A 1FLRL 5IFAL 1I7RB 4Y16D 5CILL 5KSVA 3D69A 2MFNA 3CDYA 4JM2A 1OARL 4FRWA 3BAEL 3MJ8A 3ULVH 4YQXH 3TWCH 4GAYB 3B8SA 2FIKB 3NIGF 4LQ1A 5CMAB 3BZEB 3SDDC 1QBAA 1OAQL 3ZKQD 1PX4A 1I9JH 5DT1L 2R4SH 4K8RL 4ORGA 5IOPA 3GHEL 2BVQB 1DN0A 5CEYA 3G9AB 2AV7A 2GSGA 4APQA 5D4QA 2R1XA 4BZYA 2ADJB 3MA7A 4NRYA 3SDCD 3M8OH 3TIDA 4MSWB 4U1KA 3T8XA 2CDFB 5B3JE 1T1XA 1BZ9B 4U6XB 3BKCH 4XI5C 4G42A 4U1LB 4RFEB 5LQBL 3UO1H 1PSKL 4XPTH 1VKXA 3H8NA 5F7KC 5C7XH 3A0OA 4F33B 3I50H 5IB5B 4JRYA 4S2SB 5I8KL 1QVOA 3OKEA 3QWRA 3JV5A 5DLMH 1Z9LA 1FCCA 1ETZB 2I07B 2OJZH 4HG4J 1ACZA 4UIKL 4L5FL 2MCPH 2PR4L 3F7VA 5CBEB 4NIKB 2D7OA 3T1FB 4K8RC 3IDMB 1AXSB 3QO0A 5HYIA 1NDMA 4XNQA 5IQ9B 3MLRL 1MCFA 1JHLH 3HE6B 3WIHA 4N8VB 5IT2H 4TOYL 1WAAE 1Y18A 1NAMB 4FQXA 4OD2A 2R0WH 5E9DE 4NBYB 2I5YL 5I1IH 5SX4H 2ZOLB 3P9LB 4MZ2A 3DX9A 1INDH 1YNTA 4ODSL 2Z4QA 1GGIL 1MJ8H 3ILQC 2BRRL 1QNZH 4HMCA 2VABA 4FFYH 1F2XK 1FBIL 4NZRH 4JQIH 1UM6L 1UB6B 2X7LA 4KK9C 2ENSA 3RUGE 4CJ0A 1OTTD 4OF8A 2IGFH 4LRIC 4PJ9A 1LO2L 4TNVK 2AQ3A 3FT3B 5HDLA 1PZ5A 4I13B 5MEQA 4CW1B 3N1PC 5D7IF 1A14L 1AGDB 5CP7A 3QI9D 4C56A 3P4NA 5KSAA 4GMTH 3V4UH 2HFFA 3EFFA 1SEQL 1PYWA 3WS3A 3N1FC 2R69L 1QSEB 3SO3B 1GIGH 2AEQH 3OG4B 4DEPC 4KMTL 4OGXL 4IDJH 1JPSH 1ZANH 5CGMA 4X6CE 2WWMD 5CZXD 1H3PL 3OKLB 5FF6A 3OB0H 4BM7A 2FYYB 2EYTA 5IVOA 3WO3B 3NFSL 5FA4B 3UROR 3GSNB 1X3DA 5DUMH 2FD6H 5EWIH 1BX2A 1BQUA 3IGAA 3E3QC 3C5JA 3HMXL 5FYLD 5BCAA 3SDYL 1YN7A 5C08E 1WEJH 3B2VH 4UILL 1T2JA 3QQNA 4NP4L 4Q9RL 2WIMA 3QH3B 1VFBB 2Z8RA 1TZHA 1KTKE 2AV1A 5TDNA 1R3HB 2ZCLL 1ODAA 4Z78A 2W9EH 4NQEE 1DLFH 4HCRA 5KVEL 4OV5B 1S9VB 1T21B 3G04B 5EUKA 5BS0E 5IEKB 5MERB 4XHJC 3G6DL 4G80A 3VXRD 1K6QL 4R96B 1J18A 1LNUB 3MSPA 4HJGA 3O2VH 5EOQL 5CZVH 3VWKA 1VFAA 5IQ7H 3PXJA 4JN2B 3LZFH 12E8L 3G6JF 4JZOB 3MLUL 3KG5A 3UTZA 1CFNA 4M8QA 5ILTH 2YD9A 1CD1B 1RY7B 4L9LC 1CFSA 2VLKD 1FVEA 5M94B 3QIWA 4JAMA 2APBA 1U3JA 1KIQA 4XPAL 4Y4HC 4X83A 3VGFA 5GQBA 1N5YH 1LEIA 3CDGB 5ERWA 4LVOB 4XNXL 5CJXA 5D5MF 2R9HD 1TENA 2XG5A 2PXYD 5HD8C 3ARUA 1KJ2H 2ZKHH 2HJFB 4X7SL 2GFBA 4H8WH 4R8WL 5D7IA 4PJ7F 4MGXA 3MV8B 3SDXB 1MWAB 3RVXC 3EJYC 4KPHL 3OKDA 2YA0A 4H1LA 5SWQA 2Z0BA 3RY4A 3SJVD 3CZFB 3HLAA 3QCUL 2DTML 5FO7B 2DQCL 1GH7A 2QSTA 3W0WA 5ACZB 4JRXD 2AK1L 5E4IA 1WITA 1ND0A 3BP5A 4HFUL 5I9QC 2VDOH 5IFJA 3ABZA 4K3JL 1T4KB 2HP4A 3P0YL 1YQVH 5F9OH 3QUML 4G8GA 2ARJB 2DAVA 1JYWA 5F7MC 1NAML 2LFGA 5SWSA 4QGYA 3F7RA 3HR5A 4P3DB 1XF4B 3H3PH 1I1RA 3MV7A 1T22B 1ZLVH 4OCYL 4XVUC 5HHXH 1KIPB 1OTSC 5HPOA 2UUDK 4F57L 2H6PB 4LOUD 2Y06H 4KK6D 3SE8H 4X4XA 2NLJA 1XH3A 1Y6NR 1B3JA 1F6AB 5EU3A 3V6OE