3CXHI

Structure of yeast complex iii with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
55
structure length
55
Chain Sequence
SSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 18
structure length 55
sequence length 55
chains with identical sequence T
ec nomenclature
pdb deposition date 2008-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 3cxhI00
2FYUJ 3CXHI 5KLVJ 1L0NJ 1P84I 4PD4I 3H1HJ 2IBZI 1EZVI 1BE3J 2BCCJ 4D6TJ 3TGUJ 1SQVJ 3CWBJ 3L72J 3H1KJ 3L73J 1SQPJ 1KB9I 3L70J 1NTZJ 1NTKJ 1NU1J 3H1LJ 3BCCJ 3L75J 1PP9J 1L0LJ 1KYOI 1SQQJ 3H1JJ 3L74J 4U3FJ 1SQBJ 3CX5I 3H1IJ 3L71J 1BCCJ 1SQXJ 1NTMJ 1BGYJ
chains in the Genus database with same CATH superfamily
4N6JA 2IBZI 3CXHE 2QEXP 2CK3H 1KQLA 3H1LG 3P8CE 3AE4C 1BCCD 3E7KA 3SWKA 1JY2O 1YHQP 2B87A 1SP4A 1YI2P 3H1LE 3G6EP 4ASWA 1L4AB 3S9OA 2JEEA 2RN0A 2Q3IA 1ZR2A 4H44D 2Q6QA 4TLFA 4OH8B 4WWIA 1K8AQ 5KTBA 3EQ2A 3KQGA 1SQXK 2WMMA 5APUA 3TGUG 1HBWA 3VP9A 1ZRTE 4U3FE 1LTJA 3A0HE 1FDIA 1PP9G 5AW6B 2ZT9D 1GDTA 1RE4A 4YXWH 3CCSP 3F5HA 3CMAP 3S1KA 3TGUE 1SQBK 1HH0A 1JY3N 1KFNA 1VQKP 1T3JA 3L73G 2B87B 2L91A 2MKVA 3A0BE 1EDLA 1SS1A 2QA4P 1E79H 3A0HH 4WBAA 3A7OA 1OMIA 3A5TA 5AVVB 1KILA 3AE3C 1LWUB 2ZJSE 3L73E 4N78D 1YJWP 2NPSD 3II6A 3FX0A 4UB8E 2HODA 3L74D 2HFED 4GDOA 5CCHC 3A0BH 1OIPA 1IFDA 2V7QH 1VQ6P 3ITKA 1OFCX 3VP8A 1Y47A 3MD0A 1UIXA 1XTGB 3M9BA 3KHUA 4UB8H 2KXPB 1L0ND 3P32A 1OW8A 3SSUA 1L2PA 2K1AA 4JQ0D 1ZP0C 4GODA 4I7ZB 2O3JA 5KLVK 1J2JB 1J1DB 2BCCJ 3P8MC 1LTJC 3Q3DA 2HPCA 3H1JG 3U59A 2PAJA 2D2CB 5CCGD 3MHVA 1WT6A 1A02J 1QL2A 2YKPA 3CX5D 3SFEC 3ABVC 3Q2YA 1VQLP 3RK3D 3CPWO 1M57D 4W7ZA 1YJ9P 4ZNCA 1KB9I 1PGPA 4DZOA 3H1LJ 3HUSA 2ZXXA 1G1IA 3CCQP 3WUVA 4I7ZC 1KILC 1GTWA 1FU1A 1LNQA 1J1DC 2WPSA 1NU1E 2WPQA 2OYOA 1JY3P 4M3LA 4U3FJ 2HPCB 1W2BO 3LIDA 5CBNA 1T2KC 4PV1B 3L72G 1KV4A 1GL2A 1N73B 3TGUJ 1BCCE 3GF7A 1RE3A 2WSSH 3GW6A 1LJ2A 3RK2D 1N7SA 1YITP 2J59M 2V7QJ 1Z56A 1H89A 2QE7H 1AV1A 4TT3H 1FZGA 2H43A 1EXIA 3WU2E 3M06A 3L73J 1SQBG 3SWFA 1EZVD 1PGJA 2K9JA 5AW9B 2QJYB 2QJKB 4W80A 4WY4D 1RQVA 3MP7B 3RBXA 4Y28J 3FWNA 3WU2H 1GL2B 2IBZG 2P2UA 4LC1A 4R4LA 3HUSC 2H8PD 2BCCD 1Q2NA 1KQSO 3CWBG 4AUWA 1DX7A 1M90Q 2IBZE 3CXHD 2WZ7A 3MIWA 2QJYC 2JJLA 3M9HA 3H1HD 4N78E 1FBMA 2K9JB 2YKQA 4MN4C 2XDJA 4JYCA 3H1LD 1GL2C 3G3ZA 3KYQA 3H1JJ 1M1KQ 1L0LK 1FJKA 3HTKA 1U57A 2JKVA 1FZFA 1X79B 1IFMA 5C39A 2QM8A 1SFCD 2WWWA 4IL6E 1VQPP 1UIIA 3Q5PA 4XFJA 2N1TB 1L0NE 1URQA 1NGMB 2E43A 3D70A 4U7JA 5EFWB 3GG2A 1SQQK 1CI6A 5AW3B 3TGUD 4GOEA 3FXDA 1HVVA 3VTPC 1PP9D 2DW3A 3S4RA 5BU5A 1N7SD 4IL6H 5M1BA 4OGQD 3FWLA 4GT1A 1GZLA 5AVUB 1WMKA 3CX5E 1VF5D 3E1IA 2KLUA 3RK3E 3L73D 4N3YB 3BRVB 3HTKB 4XE5B 1FZCA 3CCUP 1P84D 1KC8Q 3RL0B 1LTTC 2FXMA 1JCDA 4BRYA 5CBOA 1FDMA 1PL5A 1VQ4P 5APVA 3B4SA 1USDA 2MJZA 3CX5H 4RJTA 1CI6B 2KNCA 1ZR4A 1PV3A 3H1IG 1VQ5P 2M5AA 2WSCH 1EQ7A 1ZW0A 2HYNA 1LT9B 2E74B 2Y0DA 1SQVD 1T3UA 2QG4A 4C7NB 4NPEA 4D6TG 2PP6A 2E5TA 3H1IE 3R4YA 3LIEA 4CPGA 3CLQA 2FXPA 4GKGA 2ZXEB 1LTIC 3M91A 1LTSC 1HGVA 3V6IA 1JTHB 3H32B 2M3BA 4PD4I 2AXCA 3VN0A 3H1JD 1NTKG 2NPSA 5AVWB 2A45H 3Q5RA 1OVVA 2KP8A 2KNCB 3V5BA 2IFMA 2B88A 3GMAA 3IN6A 4I1LA 2QSIA 3R2PA 3AECC 1URQD 1VQ9P 1FZCC 1KFMA 2KS1B 2QM7A 2E76D 2KK7A 2BCCE 3W67A 1ZXGA 4H44C 1L0NJ 3EFGA 1MKMA 4I6MC 2W6AA 2XNDH 5DJTB 4KJMA 5B5EE 5BVZA 3B8EB 1PGQA 5APXA 1L0LG 2O1JA 5CJ4A 2JO1A 1LTAC 3H1HE 2KUBA 2E5YA 2NPSB 3U1AA 1AJYA 2IZ0A 2KI7B 3L72D 1KYOD 2ZYGA 3UIAA 1QGKB 3AE5C 1VDFA 5CCGA 2ZT9C 2FKWB 1S5LX 2SPZA 2OYHA 3L75G 1BSNA 1SQXD 5B5EH 2KZIA 3CXHH 1IO4A 4GOFA 2WSCJ 5AVTB 2JWAA 1BE3G 1FAVA 3L75E 1ZOYC 1LP1A 2C0XA 2FYUK 1AVYA 2IZ1A 3CC7P 3IF4A 3EWKA 1SQBD 3Q1MA 2W6BA 2OQQA 2NPSC 1NTMG 1IFIA 1R5SA 1NOHA 1PP9E 4PJ0E 3BCCD 5AW5B 2GM4A 1WRGA 3W68A 2XZRA 1E5WA 1NTME 2IBZD 1CSBA 2JWDA 1GU4A 1PIXA 3H1IJ 3PRJA 3CWBD 3NFQA 4K35A 2WT7A 3H25A 1YQ3C 1YTZT 3IR9A 1JCCA 2JP3A 1P84E 4PJ0H 1LP1B 1LTJB 5H2FE 3AE8C 1PPJG 1W2EA 2KIKA 1YBKA 1QLED 3HE4A 4HKZH 2OTJP 1Y9BA 3CMEP 1SQVG 1L4AD 2KB7P 5CCGC 3PH0A 4WY4A 1BDCA 1MFTA 2YMKA 2WITA 2WSEH 1NTKJ 1SQPK 2OYHC 2A06G 2R5DA 1NTZK 1P84H 3AEFC 2O01H 3RK3C 1H8AA 1SQVE 1VQ7P 4L73A 1S9KE 3TDKA 1RF1A 5H2FH 4ASVA 3L70D 1DD4A 4LGDE 2A06E 1KILB 5KJ7D 1K73Q 2AEMA 2PGDA 4NPFX 3IFMA 4XA4A 4YXDC 3GHGA 2I1KA 1NJIQ 1FJPA 3T97A 1HGZA 2P7JA 1BGYG 2HODB 2NZ2A 4IFFA 1RE4C 2PRRA 5CCHD 5AVSB 2GUVA 3FGAD 3H1HJ 4IL6X 3H1JE 2K37A 3WMM0 1ZLLA 1M1JA 3HE4B 4H0LB 1BGYE 1S4XA 4H13D 1PZQA 3RK2C 2PFXA 3I5CA 2YO2A 2HR3A 1SFCA 3L75J 3HRNA 5CMZA 1JM0A 2FFDA 2Q1KA 2W90A 2Y9YA 2IYPA 1HTLC 3PTZA 5AVZB 4H0LC 1ZN5A 3H1ID 3BATA 2GA1A 1VQNP 4WY4C 3V2RA 1PP9J 1SQXG 2FYUG 3L72E 4D6TD 1KYOE 1NTMJ 5GTIE 3CL3D 1U7JA 1RF1C 3HUSB 1MUUA 1IK7A 3RGUA 1AQ5A 1SQXE 3QH9A 5TJHA 2B9BA 2WSEJ 3GHGC 2D2CD 2K88A 3V2QA 5APYA 2O01J 1KQFB 1S72P 2FFDB 1KYOH 1NTKD 1X8YA 5GTIH 1SQBE 3TYYA 3BCCG 1QL1A 1J1EB 1FZEA 2O1KA 1JO5A 3HD7D 3L4FA 2VRSA 1R5LA 3BCCE 3O6QA 1N7SB 1Q7YQ 1JY2N 1SQVJ 4OGQB 2HLOA 4IFMA 1KD1Q 1HF9A 2IDBA 1SFCC 1VF5B 3JSVC 3CWBE 2QVAA 3USSA 3G9RA 3B5ND 2FFDC 2M0BA 1IZNB 1RF0A 2ZVNB 1SQPG 1J1EC 1L0LD 4PV1D 1NTZG 1JY3O 3M0DA 1H0TA 3V2NA 2Z5HA 3OA7A 1RE3C 3WUUA 5KLVG 1BGYJ 1N7SC 3PJSK 2FY8A 1LTGC 1N2DC 3OW2O 1EDKA 2FXOA 4OGQC 3L75D 1SQQD 3L70G 2IFNA 1XTCC 1YIJP 1N7LA 1VF5C 3C1LA 2Q5UA 3CCRP 3B71A 3AE1C 1GMJA 1BE3D 4JF7A 5APTA 3L70E 4B86A 1W5CE 1M7LA 2XU6A 3VMXA 4A7PA 1G2CA 3KPEA 1NTMD 2BEQD 2GUSA 2R5BA 3OAKA 3K5BA 3TNUA 2LKMA 2FBWC 3CI9A 3F89A 2WTYA 2Q7CA 1FE6A 1IFJA 3L72J 2WQYC 1DEBA 3AEBC 2WVRA 5CJ0A 2OYIA 3AE9C 1NKNA 3C9IA 5E79E 1NKZB 4AYCA 1SQXJ 3VMAA 2HG5D 3V4QA 2Y9ZA 1URQB 3Q5SA 1RF0C 2JDIH 1RQUA 4JBZA 1HJBA 1FZBA 2QJPC 4GIFA 5AW1B 1PPJD 4DT0A 1G1JA 3M0DC 1G2CB 1SQBJ 3C8VA 4K3AA 1S9KD 5E79H 1IK9A 1U7MA 2A06D 2YNYA 2CPBA 3BCCJ 4L76A 1MFZA 2B89A 1NH4A 2XV5A 2N1TD 1K04A 4D6TE 1FZCB 2OTLP 1URQC 2KYVA 2WPRA 4BXLA 5L8RJ 4H44B 3H1KG 3KDPB 4BRYB 3CWBJ 1FZAA 2E76C 4WVZA 1BGYD 5AW0B 4RKUJ 1KB9E 4HYTB 4YTPC 1JMMA 3H1KE 2C0WA 3O8ZA 1NTKE 4EYYQ 2M5AB 1MV8A 1KQGB 3CCVP 2ZT9B 5APQA 5KLIC 3L71G 1L4AA 4AQRD 3RL0D 3MTUE 1USEA 2OYIC 1KB9H 1Q90D 1PFIA 5KLVJ 1X22A 1EDIA 2N9YB 3L70J 4KT0J 3L35A 5K5GB 1M8OB 1DH3A 1NU1K 5KJ7A 4Y99B 4EI2A 3AEDC 2KSEA 2E74D 2Y0CA 1AQTA 5AVRB 1Q82Q 1R8EA 4WB4A 3AE6C 1L0LE 1S3JA 3MUDA 5CCHA 1Q81Q 1RY3A 4PD4D 3CC2P 1SQQG 4R4MA 2FYUD 3TSIA 3TK1A 1SVFA 3G4SP 4ZMDA 1K9MQ 2R3SA 1GU5A 1AFOA 2E75D 1SQQE 1IFNA 5AW8B 1LWUA 4KHXA 1QVGO 4U3FG 4Y99C 1OWAA 1T8ZA 1BE3E 3N7NA 3D6YA 2ZFCA 1VPCA 5APSA 2LR2A 3V2PA 3P7KA 3EFFK 1HWTC 2K9YA 2AEFA 1JMBA 2W6JH 1L4AC 3HE5A 2OYHB 3CCLP 3RK3B 1PGOA 4D6TJ 5DJUB 1X9VA 1GK4A 1OXZA 3VYIA 2P1JA 3SFDC 5KKZB 3LW5J 1N86A 4H13B 3CX5I 3RL0g 3L36A 3FXEA 5KJ7C 1SQPD 1NTZD 2Q3EA 1LGHB 1FOSF 2W8ZA 3H1KJ 3MUDC 1PPJE 5B66E 1TU3F 5KLVD 2UWJE 2I8DA 2G3AA 4DOJA 3HE5B 1ZV8A 1NAFA 4RO0A 3HD7A 5KKZC 4H13C 3RK2B 3PHLA 4ZKUA 2WT7B 1LWUC 1FOSE 1VL2A 3L71J 3G71P 5B66H 2A45I 4I2LC 3A3YB 3BRTB 4EIJA 3BVHA 2H89C 1DEEG 1L0NK 3B5NA 1OVUA 2O01N 3PLNA 5AW4B 3E1RA 1IC2A 1L0LJ 4JPZB 1K05A 2AXTE 1N73A 4WY4B 3AEEC 2J5UA 3TF5A 1OW6A 3M0AA 1NHLA 1GW3A 1IFPA 1EZVI 1Y8AA 2KLVA 1RF1B 1NU1G 1N8RQ 1YYCA 2RMZA 3CD6P 1SQQJ 1S1CX 1ZMEC 3HD7B 2POHA 1NYHA 3GHGB 2AXTH 3WUTA 2P58A 3ZDMA 3AEAC 3T97B 2C9LY 1BE3J 1S5LE 3V4WA 4RESB 2D2CC 2KZJA 5KAFE 1OX3A 1BCCG 1D7MA 3NTNA 1NO4A 3B5NB 3A2AA 1KMIZ 1M1JB 5APWA 3CXHI 2QIWA 2JR8A 1HUCA 3KXDA 2LXBA 3CC4P 3H6PA 1SLQA 4PD4E 3RBZA 1KILD 3AEGC 1S5LH 2FYUE 1FS0E 3HD7C 2XKMA 4W7YA 1GK6A 5KAFH 1KB9D 2V4HA 1QVFO 1T6AA 2Z4EA 1SFCB 3IAOA 3H1KD 1JOCA 1T2KD 2YXQB 5AVYB 1Q86Q 3B5NC 1HJ0A 4H0LD 3VMYA 5TISE 4PD4H 2N9BA 1KZUB 1M1JC 1VQ8P 2G8YA 4PV1C 1N73C 2WPVB 3D71A 4BWNA 1YTZI 3VMZA 3GLMA 3L71D 3I55P 2W27A 3KZIE 2K3RA 1YQ4C 2LXCB 1NTKK 2R32A 2Z5IA 5TISH 3AE2C 2YMYA 2N1TA 1KN7A 1RH5B 2IYOA 1YJNP 3SWYA 5AW2B 2QJKC 4L75A 2ZAEB 3L74G 3P8CD 4LLHA 2YIUB 4YPCA 4C46A 2ZYDA 1AA0A 1NAYA 3KZIH 1SQPE 1EC5A 3D6ZA 1NTZE 2W83C 3CCEP 4EDFA 1P84I 1AVOA 3L74E 2YKOA 1S2EA 2L5GB 2YXRB 3JC22 2QRXA 2H88C 2P67A 2WSFH 3JCUE 3PP5A 3O6QB 5KLVE 2CPSA 2FYZA 2RKLA 2XNXA 2Y0EA 5AVQB 1L0NG 1CZQA 3MGNA 1GW4A 5GTHE 2BASA 1ZRTD 5CHXA 4IOIH 4U3FD 1EDJA 2YIUC 1NVOA 1NU1J 1JUNA 3MZWB 4JYBA 1FDOA 2QJPB 1GL2D 3JCUH 1VQOP 2R44A 1H0TB 4OWFA 1LT9A 2NRGA 1RHZB 1M56D 2I1JA 2C9NY 5GTHH 1DIPA 1X0TA 2J58A 4C7NA 4Z1MH 3QWOC 4O9BA 2KSJA 3CCMP 4DCKA 1BCCJ 3N4XA 1CW5A 3CCJP 2FYUJ 1NTMK 3NMDA 4OVNF 3M9QA 4L74A 4IFDK 2N1TC 1IJDB 1DD3A 3OJAB 1NWQA 1JTHA 2IX7C 3H32A 1BDDA 1MZ9A 2E76B 1JY2P 2M8RA 5AVXB 3L37A 3BASA 2M3EA 2Q9IA 3TNUB 1QEXA 1KORA 2BEZF 2A45G 4DJGA 3GF3A 2OGUA 5KLIB 1OZHA 1FC2C 1JB0J 2ITAA 4UB6E 1LTBC 2YO3A 3U1CA 4EOTA 2OYIB 1OVRA 2KS1A 1KILE 3RL0C 1JEKA 2OTKE 2ZVOB 4QMAA 1SQVK 5AW7B 1OW7A 4HB1A 2FYNB 5KAIE 1KYOI 1EZVG 2WSFJ 4HH2A 2E75B 2AEJA 4ZKPA 1H88A 4UB6H 1VQMP 2RH0A 2E42A 1EZVE 2ZYAA 1SQPJ 1LT9C 2E74C 1QX8A 3LW5H 1NTZJ 1GD2E 1KTMA 2KOGA 3L74J 1BSHA 4HJGH 5KAIH 5BU8B 4NPDA 1A02F 1JNMA 2BCCG 2IPPA 4C7RA 1LT1A 1NU1D 2R3CA 3I56P 2OARA 3L71E 3AE7C 2FYNC 1EXJA 2P10A 3VOPA 2E75C 3NXSA 2H7HA 3H1HG
chains in the Genus database with same CATH topology
2FYUJ 3CXHI 5KLVJ 1L0NJ 1P84I 4PD4I 3H1HJ 2IBZI 1EZVI 1BE3J 2BCCJ 4D6TJ 3TGUJ 1SQVJ 3CWBJ 3L72J 3H1KJ 3L73J 1SQPJ 1KB9I 3L70J 1NTZJ 1NTKJ 1NU1J 3H1LJ 3BCCJ 3L75J 1PP9J 1L0LJ 1KYOI 1SQQJ 3H1JJ 3L74J 4U3FJ 1SQBJ 3CX5I 3H1IJ 3L71J 1BCCJ 1SQXJ 1NTMJ 1BGYJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FYU J;  3CXH I;  5KLV J;  1L0N J;  1P84 I;  4PD4 I;  3H1H J;  2IBZ I;  1EZV I;  1BE3 J;  2BCC J;  4D6T J;  3TGU J;  1SQV J;  3CWB J;  3L72 J;  3H1K J;  3L73 J;  1SQP J;  1KB9 I;  3L70 J;  1NTZ J;  1NTK J;  1NU1 J;  3H1L J;  3BCC J;  3L75 J;  1PP9 J;  1L0L J;  1KYO I;  1SQQ J;  3H1J J;  3L74 J;  4U3F J;  1SQB J;  3CX5 I;  3H1I J;  3L71 J;  1BCC J;  1SQX J;  1NTM J;  1BGY J; 
#chains in the Genus database with same CATH topology
 4N6J A;  2IBZ I;  3CXH E;  2QEX P;  2CK3 H;  1KQL A;  3H1L G;  3P8C E;  3AE4 C;  1BCC D;  3E7K A;  3SWK A;  1JY2 O;  1YHQ P;  2B87 A;  1SP4 A;  1YI2 P;  3H1L E;  3G6E P;  4ASW A;  1L4A B;  3S9O A;  2JEE A;  2RN0 A;  2Q3I A;  1ZR2 A;  4H44 D;  2Q6Q A;  4TLF A;  4OH8 B;  4WWI A;  1K8A Q;  5KTB A;  3EQ2 A;  3KQG A;  1SQX K;  2WMM A;  5APU A;  3TGU G;  1HBW A;  3VP9 A;  1ZRT E;  4U3F E;  1LTJ A;  3A0H E;  1FDI A;  1PP9 G;  5AW6 B;  2ZT9 D;  1GDT A;  1RE4 A;  4YXW H;  3CCS P;  3F5H A;  3CMA P;  3S1K A;  3TGU E;  1SQB K;  1HH0 A;  1JY3 N;  1KFN A;  1VQK P;  1T3J A;  3L73 G;  2B87 B;  2L91 A;  2MKV A;  3A0B E;  1EDL A;  1SS1 A;  2QA4 P;  1E79 H;  3A0H H;  4WBA A;  3A7O A;  1OMI A;  3A5T A;  5AVV B;  1KIL A;  3AE3 C;  1LWU B;  2ZJS E;  3L73 E;  4N78 D;  1YJW P;  2NPS D;  3II6 A;  3FX0 A;  4UB8 E;  2HOD A;  3L74 D;  2HFE D;  4GDO A;  5CCH C;  3A0B H;  1OIP A;  1IFD A;  2V7Q H;  1VQ6 P;  3ITK A;  1OFC X;  3VP8 A;  1Y47 A;  3MD0 A;  1UIX A;  1XTG B;  3M9B A;  3KHU A;  4UB8 H;  2KXP B;  1L0N D;  3P32 A;  1OW8 A;  3SSU A;  1L2P A;  2K1A A;  4JQ0 D;  1ZP0 C;  4GOD A;  4I7Z B;  2O3J A;  5KLV K;  1J2J B;  1J1D B;  2BCC J;  3P8M C;  1LTJ C;  3Q3D A;  2HPC A;  3H1J G;  3U59 A;  2PAJ A;  2D2C B;  5CCG D;  3MHV A;  1WT6 A;  1A02 J;  1QL2 A;  2YKP A;  3CX5 D;  3SFE C;  3ABV C;  3Q2Y A;  1VQL P;  3RK3 D;  3CPW O;  1M57 D;  4W7Z A;  1YJ9 P;  4ZNC A;  1KB9 I;  1PGP A;  4DZO A;  3H1L J;  3HUS A;  2ZXX A;  1G1I A;  3CCQ P;  3WUV A;  4I7Z C;  1KIL C;  1GTW A;  1FU1 A;  1LNQ A;  1J1D C;  2WPS A;  1NU1 E;  2WPQ A;  2OYO A;  1JY3 P;  4M3L A;  4U3F J;  2HPC B;  1W2B O;  3LID A;  5CBN A;  1T2K C;  4PV1 B;  3L72 G;  1KV4 A;  1GL2 A;  1N73 B;  3TGU J;  1BCC E;  3GF7 A;  1RE3 A;  2WSS H;  3GW6 A;  1LJ2 A;  3RK2 D;  1N7S A;  1YIT P;  2J59 M;  2V7Q J;  1Z56 A;  1H89 A;  2QE7 H;  1AV1 A;  4TT3 H;  1FZG A;  2H43 A;  1EXI A;  3WU2 E;  3M06 A;  3L73 J;  1SQB G;  3SWF A;  1EZV D;  1PGJ A;  2K9J A;  5AW9 B;  2QJY B;  2QJK B;  4W80 A;  4WY4 D;  1RQV A;  3MP7 B;  3RBX A;  4Y28 J;  3FWN A;  3WU2 H;  1GL2 B;  2IBZ G;  2P2U A;  4LC1 A;  4R4L A;  3HUS C;  2H8P D;  2BCC D;  1Q2N A;  1KQS O;  3CWB G;  4AUW A;  1DX7 A;  1M90 Q;  2IBZ E;  3CXH D;  2WZ7 A;  3MIW A;  2QJY C;  2JJL A;  3M9H A;  3H1H D;  4N78 E;  1FBM A;  2K9J B;  2YKQ A;  4MN4 C;  2XDJ A;  4JYC A;  3H1L D;  1GL2 C;  3G3Z A;  3KYQ A;  3H1J J;  1M1K Q;  1L0L K;  1FJK A;  3HTK A;  1U57 A;  2JKV A;  1FZF A;  1X79 B;  1IFM A;  5C39 A;  2QM8 A;  1SFC D;  2WWW A;  4IL6 E;  1VQP P;  1UII A;  3Q5P A;  4XFJ A;  2N1T B;  1L0N E;  1URQ A;  1NGM B;  2E43 A;  3D70 A;  4U7J A;  5EFW B;  3GG2 A;  1SQQ K;  1CI6 A;  5AW3 B;  3TGU D;  4GOE A;  3FXD A;  1HVV A;  3VTP C;  1PP9 D;  2DW3 A;  3S4R A;  5BU5 A;  1N7S D;  4IL6 H;  5M1B A;  4OGQ D;  3FWL A;  4GT1 A;  1GZL A;  5AVU B;  1WMK A;  3CX5 E;  1VF5 D;  3E1I A;  2KLU A;  3RK3 E;  3L73 D;  4N3Y B;  3BRV B;  3HTK B;  4XE5 B;  1FZC A;  3CCU P;  1P84 D;  1KC8 Q;  3RL0 B;  1LTT C;  2FXM A;  1JCD A;  4BRY A;  5CBO A;  1FDM A;  1PL5 A;  1VQ4 P;  5APV A;  3B4S A;  1USD A;  2MJZ A;  3CX5 H;  4RJT A;  1CI6 B;  2KNC A;  1ZR4 A;  1PV3 A;  3H1I G;  1VQ5 P;  2M5A A;  2WSC H;  1EQ7 A;  1ZW0 A;  2HYN A;  1LT9 B;  2E74 B;  2Y0D A;  1SQV D;  1T3U A;  2QG4 A;  4C7N B;  4NPE A;  4D6T G;  2PP6 A;  2E5T A;  3H1I E;  3R4Y A;  3LIE A;  4CPG A;  3CLQ A;  2FXP A;  4GKG A;  2ZXE B;  1LTI C;  3M91 A;  1LTS C;  1HGV A;  3V6I A;  1JTH B;  3H32 B;  2M3B A;  4PD4 I;  2AXC A;  3VN0 A;  3H1J D;  1NTK G;  2NPS A;  5AVW B;  2A45 H;  3Q5R A;  1OVV A;  2KP8 A;  2KNC B;  3V5B A;  2IFM A;  2B88 A;  3GMA A;  3IN6 A;  4I1L A;  2QSI A;  3R2P A;  3AEC C;  1URQ D;  1VQ9 P;  1FZC C;  1KFM A;  2KS1 B;  2QM7 A;  2E76 D;  2KK7 A;  2BCC E;  3W67 A;  1ZXG A;  4H44 C;  1L0N J;  3EFG A;  1MKM A;  4I6M C;  2W6A A;  2XND H;  5DJT B;  4KJM A;  5B5E E;  5BVZ A;  3B8E B;  1PGQ A;  5APX A;  1L0L G;  2O1J A;  5CJ4 A;  2JO1 A;  1LTA C;  3H1H E;  2KUB A;  2E5Y A;  2NPS B;  3U1A A;  1AJY A;  2IZ0 A;  2KI7 B;  3L72 D;  1KYO D;  2ZYG A;  3UIA A;  1QGK B;  3AE5 C;  1VDF A;  5CCG A;  2ZT9 C;  2FKW B;  1S5L X;  2SPZ A;  2OYH A;  3L75 G;  1BSN A;  1SQX D;  5B5E H;  2KZI A;  3CXH H;  1IO4 A;  4GOF A;  2WSC J;  5AVT B;  2JWA A;  1BE3 G;  1FAV A;  3L75 E;  1ZOY C;  1LP1 A;  2C0X A;  2FYU K;  1AVY A;  2IZ1 A;  3CC7 P;  3IF4 A;  3EWK A;  1SQB D;  3Q1M A;  2W6B A;  2OQQ A;  2NPS C;  1NTM G;  1IFI A;  1R5S A;  1NOH A;  1PP9 E;  4PJ0 E;  3BCC D;  5AW5 B;  2GM4 A;  1WRG A;  3W68 A;  2XZR A;  1E5W A;  1NTM E;  2IBZ D;  1CSB A;  2JWD A;  1GU4 A;  1PIX A;  3H1I J;  3PRJ A;  3CWB D;  3NFQ A;  4K35 A;  2WT7 A;  3H25 A;  1YQ3 C;  1YTZ T;  3IR9 A;  1JCC A;  2JP3 A;  1P84 E;  4PJ0 H;  1LP1 B;  1LTJ B;  5H2F E;  3AE8 C;  1PPJ G;  1W2E A;  2KIK A;  1YBK A;  1QLE D;  3HE4 A;  4HKZ H;  2OTJ P;  1Y9B A;  3CME P;  1SQV G;  1L4A D;  2KB7 P;  5CCG C;  3PH0 A;  4WY4 A;  1BDC A;  1MFT A;  2YMK A;  2WIT A;  2WSE H;  1NTK J;  1SQP K;  2OYH C;  2A06 G;  2R5D A;  1NTZ K;  1P84 H;  3AEF C;  2O01 H;  3RK3 C;  1H8A A;  1SQV E;  1VQ7 P;  4L73 A;  1S9K E;  3TDK A;  1RF1 A;  5H2F H;  4ASV A;  3L70 D;  1DD4 A;  4LGD E;  2A06 E;  1KIL B;  5KJ7 D;  1K73 Q;  2AEM A;  2PGD A;  4NPF X;  3IFM A;  4XA4 A;  4YXD C;  3GHG A;  2I1K A;  1NJI Q;  1FJP A;  3T97 A;  1HGZ A;  2P7J A;  1BGY G;  2HOD B;  2NZ2 A;  4IFF A;  1RE4 C;  2PRR A;  5CCH D;  5AVS B;  2GUV A;  3FGA D;  3H1H J;  4IL6 X;  3H1J E;  2K37 A;  3WMM 0;  1ZLL A;  1M1J A;  3HE4 B;  4H0L B;  1BGY E;  1S4X A;  4H13 D;  1PZQ A;  3RK2 C;  2PFX A;  3I5C A;  2YO2 A;  2HR3 A;  1SFC A;  3L75 J;  3HRN A;  5CMZ A;  1JM0 A;  2FFD A;  2Q1K A;  2W90 A;  2Y9Y A;  2IYP A;  1HTL C;  3PTZ A;  5AVZ B;  4H0L C;  1ZN5 A;  3H1I D;  3BAT A;  2GA1 A;  1VQN P;  4WY4 C;  3V2R A;  1PP9 J;  1SQX G;  2FYU G;  3L72 E;  4D6T D;  1KYO E;  1NTM J;  5GTI E;  3CL3 D;  1U7J A;  1RF1 C;  3HUS B;  1MUU A;  1IK7 A;  3RGU A;  1AQ5 A;  1SQX E;  3QH9 A;  5TJH A;  2B9B A;  2WSE J;  3GHG C;  2D2C D;  2K88 A;  3V2Q A;  5APY A;  2O01 J;  1KQF B;  1S72 P;  2FFD B;  1KYO H;  1NTK D;  1X8Y A;  5GTI H;  1SQB E;  3TYY A;  3BCC G;  1QL1 A;  1J1E B;  1FZE A;  2O1K A;  1JO5 A;  3HD7 D;  3L4F A;  2VRS A;  1R5L A;  3BCC E;  3O6Q A;  1N7S B;  1Q7Y Q;  1JY2 N;  1SQV J;  4OGQ B;  2HLO A;  4IFM A;  1KD1 Q;  1HF9 A;  2IDB A;  1SFC C;  1VF5 B;  3JSV C;  3CWB E;  2QVA A;  3USS A;  3G9R A;  3B5N D;  2FFD C;  2M0B A;  1IZN B;  1RF0 A;  2ZVN B;  1SQP G;  1J1E C;  1L0L D;  4PV1 D;  1NTZ G;  1JY3 O;  3M0D A;  1H0T A;  3V2N A;  2Z5H A;  3OA7 A;  1RE3 C;  3WUU A;  5KLV G;  1BGY J;  1N7S C;  3PJS K;  2FY8 A;  1LTG C;  1N2D C;  3OW2 O;  1EDK A;  2FXO A;  4OGQ C;  3L75 D;  1SQQ D;  3L70 G;  2IFN A;  1XTC C;  1YIJ P;  1N7L A;  1VF5 C;  3C1L A;  2Q5U A;  3CCR P;  3B71 A;  3AE1 C;  1GMJ A;  1BE3 D;  4JF7 A;  5APT A;  3L70 E;  4B86 A;  1W5C E;  1M7L A;  2XU6 A;  3VMX A;  4A7P A;  1G2C A;  3KPE A;  1NTM D;  2BEQ D;  2GUS A;  2R5B A;  3OAK A;  3K5B A;  3TNU A;  2LKM A;  2FBW C;  3CI9 A;  3F89 A;  2WTY A;  2Q7C A;  1FE6 A;  1IFJ A;  3L72 J;  2WQY C;  1DEB A;  3AEB C;  2WVR A;  5CJ0 A;  2OYI A;  3AE9 C;  1NKN A;  3C9I A;  5E79 E;  1NKZ B;  4AYC A;  1SQX J;  3VMA A;  2HG5 D;  3V4Q A;  2Y9Z A;  1URQ B;  3Q5S A;  1RF0 C;  2JDI H;  1RQU A;  4JBZ A;  1HJB A;  1FZB A;  2QJP C;  4GIF A;  5AW1 B;  1PPJ D;  4DT0 A;  1G1J A;  3M0D C;  1G2C B;  1SQB J;  3C8V A;  4K3A A;  1S9K D;  5E79 H;  1IK9 A;  1U7M A;  2A06 D;  2YNY A;  2CPB A;  3BCC J;  4L76 A;  1MFZ A;  2B89 A;  1NH4 A;  2XV5 A;  2N1T D;  1K04 A;  4D6T E;  1FZC B;  2OTL P;  1URQ C;  2KYV A;  2WPR A;  4BXL A;  5L8R J;  4H44 B;  3H1K G;  3KDP B;  4BRY B;  3CWB J;  1FZA A;  2E76 C;  4WVZ A;  1BGY D;  5AW0 B;  4RKU J;  1KB9 E;  4HYT B;  4YTP C;  1JMM A;  3H1K E;  2C0W A;  3O8Z A;  1NTK E;  4EYY Q;  2M5A B;  1MV8 A;  1KQG B;  3CCV P;  2ZT9 B;  5APQ A;  5KLI C;  3L71 G;  1L4A A;  4AQR D;  3RL0 D;  3MTU E;  1USE A;  2OYI C;  1KB9 H;  1Q90 D;  1PFI A;  5KLV J;  1X22 A;  1EDI A;  2N9Y B;  3L70 J;  4KT0 J;  3L35 A;  5K5G B;  1M8O B;  1DH3 A;  1NU1 K;  5KJ7 A;  4Y99 B;  4EI2 A;  3AED C;  2KSE A;  2E74 D;  2Y0C A;  1AQT A;  5AVR B;  1Q82 Q;  1R8E A;  4WB4 A;  3AE6 C;  1L0L E;  1S3J A;  3MUD A;  5CCH A;  1Q81 Q;  1RY3 A;  4PD4 D;  3CC2 P;  1SQQ G;  4R4M A;  2FYU D;  3TSI A;  3TK1 A;  1SVF A;  3G4S P;  4ZMD A;  1K9M Q;  2R3S A;  1GU5 A;  1AFO A;  2E75 D;  1SQQ E;  1IFN A;  5AW8 B;  1LWU A;  4KHX A;  1QVG O;  4U3F G;  4Y99 C;  1OWA A;  1T8Z A;  1BE3 E;  3N7N A;  3D6Y A;  2ZFC A;  1VPC A;  5APS A;  2LR2 A;  3V2P A;  3P7K A;  3EFF K;  1HWT C;  2K9Y A;  2AEF A;  1JMB A;  2W6J H;  1L4A C;  3HE5 A;  2OYH B;  3CCL P;  3RK3 B;  1PGO A;  4D6T J;  5DJU B;  1X9V A;  1GK4 A;  1OXZ A;  3VYI A;  2P1J A;  3SFD C;  5KKZ B;  3LW5 J;  1N86 A;  4H13 B;  3CX5 I;  3RL0 g;  3L36 A;  3FXE A;  5KJ7 C;  1SQP D;  1NTZ D;  2Q3E A;  1LGH B;  1FOS F;  2W8Z A;  3H1K J;  3MUD C;  1PPJ E;  5B66 E;  1TU3 F;  5KLV D;  2UWJ E;  2I8D A;  2G3A A;  4DOJ A;  3HE5 B;  1ZV8 A;  1NAF A;  4RO0 A;  3HD7 A;  5KKZ C;  4H13 C;  3RK2 B;  3PHL A;  4ZKU A;  2WT7 B;  1LWU C;  1FOS E;  1VL2 A;  3L71 J;  3G71 P;  5B66 H;  2A45 I;  4I2L C;  3A3Y B;  3BRT B;  4EIJ A;  3BVH A;  2H89 C;  1DEE G;  1L0N K;  3B5N A;  1OVU A;  2O01 N;  3PLN A;  5AW4 B;  3E1R A;  1IC2 A;  1L0L J;  4JPZ B;  1K05 A;  2AXT E;  1N73 A;  4WY4 B;  3AEE C;  2J5U A;  3TF5 A;  1OW6 A;  3M0A A;  1NHL A;  1GW3 A;  1IFP A;  1EZV I;  1Y8A A;  2KLV A;  1RF1 B;  1NU1 G;  1N8R Q;  1YYC A;  2RMZ A;  3CD6 P;  1SQQ J;  1S1C X;  1ZME C;  3HD7 B;  2POH A;  1NYH A;  3GHG B;  2AXT H;  3WUT A;  2P58 A;  3ZDM A;  3AEA C;  3T97 B;  2C9L Y;  1BE3 J;  1S5L E;  3V4W A;  4RES B;  2D2C C;  2KZJ A;  5KAF E;  1OX3 A;  1BCC G;  1D7M A;  3NTN A;  1NO4 A;  3B5N B;  3A2A A;  1KMI Z;  1M1J B;  5APW A;  3CXH I;  2QIW A;  2JR8 A;  1HUC A;  3KXD A;  2LXB A;  3CC4 P;  3H6P A;  1SLQ A;  4PD4 E;  3RBZ A;  1KIL D;  3AEG C;  1S5L H;  2FYU E;  1FS0 E;  3HD7 C;  2XKM A;  4W7Y A;  1GK6 A;  5KAF H;  1KB9 D;  2V4H A;  1QVF O;  1T6A A;  2Z4E A;  1SFC B;  3IAO A;  3H1K D;  1JOC A;  1T2K D;  2YXQ B;  5AVY B;  1Q86 Q;  3B5N C;  1HJ0 A;  4H0L D;  3VMY A;  5TIS E;  4PD4 H;  2N9B A;  1KZU B;  1M1J C;  1VQ8 P;  2G8Y A;  4PV1 C;  1N73 C;  2WPV B;  3D71 A;  4BWN A;  1YTZ I;  3VMZ A;  3GLM A;  3L71 D;  3I55 P;  2W27 A;  3KZI E;  2K3R A;  1YQ4 C;  2LXC B;  1NTK K;  2R32 A;  2Z5I A;  5TIS H;  3AE2 C;  2YMY A;  2N1T A;  1KN7 A;  1RH5 B;  2IYO A;  1YJN P;  3SWY A;  5AW2 B;  2QJK C;  4L75 A;  2ZAE B;  3L74 G;  3P8C D;  4LLH A;  2YIU B;  4YPC A;  4C46 A;  2ZYD A;  1AA0 A;  1NAY A;  3KZI H;  1SQP E;  1EC5 A;  3D6Z A;  1NTZ E;  2W83 C;  3CCE P;  4EDF A;  1P84 I;  1AVO A;  3L74 E;  2YKO A;  1S2E A;  2L5G B;  2YXR B;  3JC2 2;  2QRX A;  2H88 C;  2P67 A;  2WSF H;  3JCU E;  3PP5 A;  3O6Q B;  5KLV E;  2CPS A;  2FYZ A;  2RKL A;  2XNX A;  2Y0E A;  5AVQ B;  1L0N G;  1CZQ A;  3MGN A;  1GW4 A;  5GTH E;  2BAS A;  1ZRT D;  5CHX A;  4IOI H;  4U3F D;  1EDJ A;  2YIU C;  1NVO A;  1NU1 J;  1JUN A;  3MZW B;  4JYB A;  1FDO A;  2QJP B;  1GL2 D;  3JCU H;  1VQO P;  2R44 A;  1H0T B;  4OWF A;  1LT9 A;  2NRG A;  1RHZ B;  1M56 D;  2I1J A;  2C9N Y;  5GTH H;  1DIP A;  1X0T A;  2J58 A;  4C7N A;  4Z1M H;  3QWO C;  4O9B A;  2KSJ A;  3CCM P;  4DCK A;  1BCC J;  3N4X A;  1CW5 A;  3CCJ P;  2FYU J;  1NTM K;  3NMD A;  4OVN F;  3M9Q A;  4L74 A;  4IFD K;  2N1T C;  1IJD B;  1DD3 A;  3OJA B;  1NWQ A;  1JTH A;  2IX7 C;  3H32 A;  1BDD A;  1MZ9 A;  2E76 B;  1JY2 P;  2M8R A;  5AVX B;  3L37 A;  3BAS A;  2M3E A;  2Q9I A;  3TNU B;  1QEX A;  1KOR A;  2BEZ F;  2A45 G;  4DJG A;  3GF3 A;  2OGU A;  5KLI B;  1OZH A;  1FC2 C;  1JB0 J;  2ITA A;  4UB6 E;  1LTB C;  2YO3 A;  3U1C A;  4EOT A;  2OYI B;  1OVR A;  2KS1 A;  1KIL E;  3RL0 C;  1JEK A;  2OTK E;  2ZVO B;  4QMA A;  1SQV K;  5AW7 B;  1OW7 A;  4HB1 A;  2FYN B;  5KAI E;  1KYO I;  1EZV G;  2WSF J;  4HH2 A;  2E75 B;  2AEJ A;  4ZKP A;  1H88 A;  4UB6 H;  1VQM P;  2RH0 A;  2E42 A;  1EZV E;  2ZYA A;  1SQP J;  1LT9 C;  2E74 C;  1QX8 A;  3LW5 H;  1NTZ J;  1GD2 E;  1KTM A;  2KOG A;  3L74 J;  1BSH A;  4HJG H;  5KAI H;  5BU8 B;  4NPD A;  1A02 F;  1JNM A;  2BCC G;  2IPP A;  4C7R A;  1LT1 A;  1NU1 D;  2R3C A;  3I56 P;  2OAR A;  3L71 E;  3AE7 C;  2FYN C;  1EXJ A;  2P10 A;  3VOP A;  2E75 C;  3NXS A;  2H7H A;  3H1H G; 
#chains in the Genus database with same CATH homology
 2FYU J;  3CXH I;  5KLV J;  1L0N J;  1P84 I;  4PD4 I;  3H1H J;  2IBZ I;  1EZV I;  1BE3 J;  2BCC J;  4D6T J;  3TGU J;  1SQV J;  3CWB J;  3L72 J;  3H1K J;  3L73 J;  1SQP J;  1KB9 I;  3L70 J;  1NTZ J;  1NTK J;  1NU1 J;  3H1L J;  3BCC J;  3L75 J;  1PP9 J;  1L0L J;  1KYO I;  1SQQ J;  3H1J J;  3L74 J;  4U3F J;  1SQB J;  3CX5 I;  3H1I J;  3L71 J;  1BCC J;  1SQX J;  1NTM J;  1BGY J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...