3CXHI

Structure of yeast complex iii with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
55
structure length
55
Chain Sequence
SSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
pubmed doi rcsb
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
molecule tags Oxidoreductase
source organism Mus musculus
total genus 18
structure length 55
sequence length 55
chains with identical sequence T
ec nomenclature
pdb deposition date 2008-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 3cxhI00
1EZVI 3CX5I 1PP9J 3H1IJ 4PD4I 1NU1J 3L75J 3L73J 1NTKJ 1L0LJ 3H1HJ 1NTMJ 1KYOI 3L70J 3L72J 3TGUJ 2BCCJ 1BGYJ 3BCCJ 1NTZJ 2FYUJ 3CXHI 4U3FJ 3H1JJ 5KLVJ 1BE3J 1KB9I 1SQQJ 1L0NJ 3L74J 4D6TJ 1SQXJ 3H1LJ 1BCCJ 3L71J 3H1KJ 1P84I 1SQVJ 3CWBJ 1SQBJ 2IBZI 1SQPJ
chains in the Genus database with same CATH superfamily
2Y9YA 1HBWA 1SQPG 1WMKA 1T2KD 2Q6QA 4WWIA 1EDIA 3MUDA 4HKZH 2KNCA 1QVGO 3CPWO 1HJBA 4IFDK 2KP8A 3EQ2A 3N4XA 2MKVA 2IFMA 2HYNA 1SQXE 2QJKB 2VRSA 5AW2B 2Q5UA 3RBXA 5TISH 5BU8B 3M0DA 2QJKC 2OYIC 4C7NB 1J2JB 2E75B 5APUA 4OH8B 3TGUJ 3VMAA 2E75C 3VYIA 3IN6A 2XV5A 2Y0EA 3CCEP 2HFED 4XFJA 2N9YB 3AEGC 1FJPA 1VQ5P 4A7PA 1LTIC 3SFEC 1BCCD 1VQPP 1FZBA 1RE4C 1T6AA 1NGMB 2OYHB 1NWQA 1G2CA 2A45H 2N1TA 3MD0A 1U7MA 2K3RA 1JEKA 1JOCA 1FE6A 4OGQD 1LNQA 2FYNB 3R4YA 2LKMA 2GA1A 1XTCC 2BCCE 1IFIA 3FX0A 2KYVA 3TGUG 2FYNC 1J1DB 3GHGC 1KILE 1H89A 2YKPA 2W6AA 1PL5A 4K35A 3H32A 1VQOP 2FBWC 3H1JD 2C9NY 3LIDA 2IZ1A 5GTIE 5APVA 5DJTB 2WSCH 1FC2C 1LT9C 4OWFA 2WPSA 3H1KJ 3EWKA 1GTWA 4EI2A 1YJNP 1PP9E 3B71A 3TK1A 3L72E 4GIFA 5CCGA 3MTUE 4YTPC 3CWBD 3AEAC 1RF0C 1IFPA 3AEDC 4W7YA 3I5CA 3MP7B 3RGUA 2JP3A 5DJUB 3S9OA 4U3FJ 2KK7A 1L4AA 2QVAA 2OTJP 2AEMA 1LTBC 1KILB 2QG4A 1Q2NA 3PP5A 1IO4A 3RL0B 1AQTA 4H13B 1X22A 1KILC 2K1AA 1NU1E 2KZJA 1L0LJ 1T3UA 3RL0C 2IYPA 2XDJA 1XTGB 2PP6A 1P84D 2KOGA 3F89A 3V6IA 3CCSP 1GMJA 4DT0A 1Y8AA 2ZAEB 1M56D 5CHXA 3II6A 1SFCC 1KFMA 3L75J 1GL2D 3T97B 1JO5A 1S4XA 2WPQA 3L73J 3NMDA 1FZCA 3V5BA 3Q5SA 2NPSD 1LTSC 1JTHA 5KJ7D 1X0TA 1Q81Q 3H6PA 1QVFO 3FXEA 3WUUA 3L71J 3G4SP 5EFWB 1YIJP 4HH2A 5GTIH 5KLIB 3H1IE 1OWAA 4NPFX 4EOTA 1VQ4P 1L0LG 5KLIC 2O01H 3FGAD 1NTZE 1KD1Q 5KKZB 2K37A 2IBZD 3W68A 1P84I 3TNUA 5KKZC 2R5DA 1NVOA 3AEEC 2ZT9D 3HTKB 2OTKE 3SFDC 2R3SA 1PPJE 1M1JA 4H44D 1HH0A 2GUVA 3HE4B 3L73G 1FZGA 4PV1D 1GDTA 1SQQE 5CCHD 3B5NB 2Y9ZA 2CK3H 1NTKK 3L71G 2N9BA 3N7NA 1M8OB 5CJ4A 1KQSO 1X8YA 2O1JA 1CW5A 1OXZA 3MUDC 1NTKD 2KLUA 4AQRD 2IBZI 3CCRP 1QL2A 3KHUA 3NTNA 1YTZI 4JQ0D 3VN0A 3P7KA 5AW0B 5BVZA 1VQ9P 3KXDA 4LGDE 3PRJA 1WRGA 2R32A 1L0NE 3HRNA 1N73A 2MJZA 2GUSA 3MZWB 1X79B 4R4LA 2KZIA 3M9QA 1AVOA 2Q3IA 3WU2H 3V2QA 3BRTB 2W83C 2R44A 3KYQA 1EXIA 2KLVA 1N86A 3CMEP 4JF7A 3PTZA 2FY8A 2QJYB 4NPDA 3Q2YA 1PZQA 1KC8Q 4L73A 2E75D 3LIEA 3TDKA 1YITP 2H8PD 2QJYC 2Q9IA 1N2DC 1HF9A 2JWDA 2O01N 1RE3A 5AW3B 1NTME 1LP1A 3WUTA 5BU5A 1G2CB 2N1TB 2YNYA 1SP4A 1BCCJ 1USDA 2E42A 1PGPA 1EDKA 1FS0E 5AVQB 3PJSK 1OIPA 2P2UA 3L70E 1SQXK 4RKUJ 5AVTB 3V4QA 3Q3DA 1E5WA 4I7ZC 2BASA 1VDFA 2Q1KA 1SQVE 3H32B 1G1JA 1OFCX 2I8DA 1PFIA 2A45I 1H8AA 4N6JA 1SQXD 4ASWA 1U57A 1YYCA 1OMIA 1BE3E 3H1JJ 3EFGA 2WZ7A 3L74J 3H1LE 1IJDB 3RK3E 2V4HA 3RK2B 1BCCG 3TF5A 3U1AA 1PIXA 3RK2C 3HE5A 5KJ7C 3CXHE 2FYUE 1P84H 2ZYGA 2JKVA 1JY2N 1OW8A 1VL2A 4WY4A 1NYHA 5KAFH 1IZNB 2HG5D 3BASA 3CWBJ 1EZVE 3QWOC 3GW6A 1DEBA 2W6JH 1L4AB 4UB8E 3HUSA 2FFDC 2QM8A 3H1JG 1L4AC 4IFMA 2JEEA 1LTGC 3ZDMA 2BCCD 3M06A 1CI6A 5K5GB 3AE3C 1GU5A 2P7JA 3CCQP 2YMKA 1ZOYC 1KILD 3RL0D 1S3JA 2GM4A 3H1KE 3RK3B 1HTLC 4XA4A 3P32A 1FZCB 3HD7A 3CWBG 1W2BO 4DJGA 1MZ9A 1JTHB 1SFCD 4DZOA 2W90A 3Q1MA 3CCVP 1JY3O 3IF4A 1PP9D 5GTHE 3CCLP 3L72D 5AVSB 1R8EA 1ZMEC 2AXTE 2M3BA 1ZXGA 4LLHA 4CPGA 4U3FE 4AYCA 2K9JA 3TNUB 2OARA 3AE2C 1S72P 1NU1K 1YQ3C 4ZKPA 1QL1A 1J1EB 1M1JB 3CXHH 1JY2O 4IL6H 1LWUA 4HB1A 1LTAC 5AVVB 4XE5B 2H7HA 1NU1D 1ZLLA 1NO4A 2WQYC 2IFNA 1SQBE 4UB8H 3L75E 2JJLA 1R5LA 1LJ2A 2KSJA 3B5ND 2AEFA 1JMBA 1JY3P 3K5BA 1FOSE 3IFMA 2HLOA 2QSIA 1OVVA 1E79H 1YBKA 2OYHC 1YTZT 2IBZG 1NTZK 4EDFA 1NTKJ 3L35A 4YXDC 3S1KA 1N73B 3A0BE 1QGKB 1IK9A 5AVUB 3H1ID 3O6QA 1JB0J 3A7OA 3CC7P 4KT0J 1J1DC 3CX5E 1JY2P 2OQQA 1NTZD 1GW3A 5B5EE 1R5SA 1SQQK 3QH9A 4L75A 1KB9E 2I1JA 3G3ZA 1UIXA 5AVRB 1PPJD 2J59M 3JCUE 3MHVA 1G1IA 1Q86Q 1LP1B 1Y47A 5AW7B 1SQQD 1NTKG 5KLVE 1VQLP 1HJ0A 1KQFB 5AVYB 1BSNA 2H89C 1VQ8P 2YO2A 3KDPB 1MKMA 1YI2P 1CSBA 1BSHA 1EQ7A 3W67A 2N1TD 3AE4C 1L0NK 1RH5B 1N7SB 1GW4A 2ZXEB 1SVFA 1MFTA 1NAYA 1OW7A 2QA4P 3S4RA 2A06E 1N7SC 2WSCJ 2A45G 1L0ND 4H13C 4JYCA 3VMZA 2ZJSE 1ZR4A 1SQXJ 1QLED 2POHA 1HVVA 1NTMK 3TSIA 1ZV8A 2B88A 3HE5B 2BEQD 1N8RQ 3H1HE 2J58A 2YO3A 3CCJP 4WY4B 2FXOA 2WSEH 2KB7P 3RK2D 3VP8A 1AFOA 1URQA 3CX5H 1SLQA 4WY4C 5B5EH 1NTMD 1K9MQ 4MN4C 3E7KA 2CPBA 1JCCA 2XNXA 3L4FA 3HUSB 1BGYE 3VOPA 1SQVK 3JCUH 2M8RA 4D6TE 3NXSA 3AECC 1RHZB 1SQXG 3L70D 4I1LA 1L4AD 3AE9C 1KYOE 1VQNP 2QEXP 1PGQA 2BCCJ 5CJ0A 3BCCE 2KI7B 1SQVD 3OJAB 5APYA 3CCMP 2IZ0A 2QE7H 3L74E 1QEXA 1PGOA 2M5AA 3HD7B 2OYIA 3LW5H 4L74A 2YIUB 1AA0A 4GODA 3B5NC 1M57D 2FYUK 5APSA 1BE3D 3HD7C 3H1LD 2YIUC 1YJWP 3CI9A 4WVZA 3RK3D 2D2CB 2KNCB 1BDCA 3CL3D 3G71P 2O01J 2D2CC 3AE6C 1HGVA 1SQPE 3CXHD 2E74B 3GF3A 4GOFA 1PP9J 2FYUD 2Y0DA 1RE4A 2RKLA 2K9JB 2V7QH 4EIJA 2E74C 1M1KQ 4IFFA 3M9BA 2B89A 4KJMA 2BCCG 3OA7A 1EZVD 2ZVNB 1W5CE 4BRYA 2RH0A 1ZP0C 2ZYDA 2O1KA 2P67A 1LWUB 3LW5J 3M0DC 2C0XA 4ZMDA 2NRGA 2HODA 3GHGA 4DOJA 4TT3H 1LGHB 2PGDA 1X9VA 5B66E 2E5TA 5M1BA 1FBMA 1NHLA 3WUVA 2WPRA 1NU1J 1RQUA 3V4WA 1PP9G 4BXLA 2KSEA 3H1KD 1KTMA 3L72G 4Y99B 3IAOA 1LT9A 3CXHI 1KQLA 2KUBA 2J5UA 5AVXB 3D6ZA 3NFQA 2N1TC 1EZVI 3AEBC 1BDDA 2YXQB 3D70A 1W2EA 3O6QB 2H43A 2I1KA 5AW5B 1H0TA 5H2FE 4YXWH 3E1IA 2YMYA 3AEFC 1FJKA 3JC22 1JY3N 4OVNF 4U3FD 3H1IJ 1NU1G 3TGUE 1NTZJ 2PFXA 1NKNA 1SQBK 1GK6A 4W80A 2FKWB 4N78E 1RF1A 1IFNA 3KZIE 4GKGA 1UIIA 4JBZA 1VF5B 1FOSF 2XKMA 2E76B 3G9RA 2XZRA 3KQGA 3P8CE 5CCGC 3GLMA 1SQBD 1VF5C 1SQQJ 3CCUP 1D7MA 3L75D 2R3CA 1SFCA 3R2PA 2AEJA 2WSFH 3H1IG 3KPEA 2K88A 2OYOA 1VPCA 1NTZG 3RBZA 1MV8A 3D6YA 1RQVA 4DCKA 1N7SD 1PPJG 4NPEA 2OGUA 1A02F 3GG2A 3SWFA 4H44B 1Q90D 1L0NJ 3CX5D 3GF7A 4H13D 2KIKA 1SQQG 1Y9BA 5KLVK 1KB9D 3RK3C 2P10A 2W27A 1RY3A 3A5TA 3B4SA 3PLNA 1URQB 1FZCC 5H2FH 2WVRA 3I55P 1S9KE 2DW3A 3M91A 1KFNA 1URQC 1YJ9P 2KS1A 1S5LE 4WY4D 4WB4A 5KLVD 1VQKP 1M7LA 1NTMJ 4C46A 4Z1MH 1LTTC 4M3LA 1S2EA 3KZIH 1GU4A 3L36A 3AE7C 1L0NG 1ZRTE 3SSUA 3OW2O 3VMYA 3FXDA 5AVWB 1ZR2A 3CX5I 1VQ7P 1L0LE 3A2AA 3L70J 1J1EC 1M1JC 1GK4A 3CD6P 2A06D 4TLFA 2QM7A 1KB9I 2M5AB 2OYIB 5AW9B 2LXCB 1SQVJ 2L91A 2YKOA 1KORA 4PD4E 3D71A 2OTLP 3L73E 1S5LX 3A0HE 1NTMG 3HD7D 2WT7A 1BE3J 1LTJA 2G8YA 3H1LJ 2NZ2A 1K04A 3L71E 2KXPB 3H1HD 2Z5HA 1EDLA 4PJ0E 3U59A 2ZXXA 1FDMA 4YPCA 2D2CD 3L70G 2FYUJ 1FZEA 3ITKA 4BRYB 2WITA 2E74D 2B9BA 2PAJA 4EYYQ 2B87A 1N73C 3PHLA 3FWLA 3A3YB 4N3YB 1SQVG 1BGYD 3JSVC 2HODB 3GHGB 1EC5A 4D6TD 1NOHA 2C9LY 4LC1A 1T3JA 5GTHH 1KV4A 3M9HA 3AE5C 1BE3G 1S5LH 4W7ZA 1AJYA 2AXTH 3H1LG 3Q5PA 1KYOD 1VQMP 2E43A 5E79E 3BCCD 2YXRB 3L74D 1LT9B 1DIPA 1JM0A 1RE3C 3CC4P 3USSA 1OVUA 1KMIZ 1SQPK 2FYUG 1GL2A 4H0LB 3PH0A 1IFJA 2NPSA 2ZYAA 2FYZA 4H0LC 2IDBA 1EZVG 5KJ7A 4I2LC 2WSSH 3F5HA 4R4MA 1H0TB 4ASVA 1CZQA 1SQPD 4JPZB 4PD4H 1JUNA 5APXA 4U7JA 3A0HH 2E5YA 3CLQA 2IPPA 1KYOI 2FFDA 2HPCA 4ZNCA 1IK7A 3P8MC 3FWNA 3B8EB 3AE1C 2RN0A 2QRXA 4PJ0H 1RF1B 3H1KG 3WMM0 1H88A 2M3EA 3C8VA 2IYOA 3V2NA 5CCHA 1RF1C 2HR3A 3MGNA 3M0AA 3A0BH 1PGJA 1DD3A 3O8ZA 1SFCB 5AVZB 2O3JA 1PV3A 1FZAA 2JDIH 1OZHA 1BCCE 5CCGD 1VF5D 1SQBJ 2E76D 2Z4EA 1T2KC 1VQ6P 2L5GB 2C0WA 3AE8C 5APWA 1KB9H 1SS1A 3WU2E 3IR9A 2M0BA 3GMAA 5APTA 2QJPB 1QX8A 4U3FG 1AQ5A 3HUSC 1TU3F 5E79H 1GD2E 1CI6B 2QJPC 2W8ZA 4HJGH 2AXCA 4KHXA 1JMMA 1KZUB 2Z5IA 3H1JE 1HWTC 5AW8B 2XNDH 1DD4A 1EXJA 1OX3A 2WSEJ 4QMAA 1NH4A 1LT1A 3TGUD 5KTBA 4UB6E 3V2RA 1SQBG 4GOEA 3L75G 3RL0g 4C7NA 2QIWA 3CMAP 1U7JA 2WMMA 4N78D 2KS1B 1A02J 1K73Q 1FDIA 1KQGB 3CWBE 2ZFCA 2LXBA 2JR8A 2SPZA 1URQD 2LR2A 3P8CD 1GZLA 1HUCA 3E1RA 4AUWA 3ABVC 3L72J 4OGQB 3V2PA 5KLVJ 2K9YA 4K3AA 2WWWA 2YKQA 2Y0CA 1HGZA 5AW4B 4OGQC 2H88C 2ZVOB 2OYHA 1L2PA 4RESB 4IOIH 5CBNA 1ZW0A 1OVRA 1K05A 1LWUC 1JCDA 2ITAA 3SWYA 1P84E 3VTPC 5AW1B 1K8AQ 1AV1A 3Q5RA 5KAFE 1IC2A 2RMZA 5L8RJ 2WT7B 1LTJB 1NAFA 5KAIE 1NKZB 1DX7A 1MFZA 5KLVG 1LTJC 2V7QJ 2PRRA 4Y99C 1FDOA 4RO0A 1KYOH 3UIAA 3C9IA 1S9KD 3H1HJ 2FXPA 2Q3EA 1RF0A 2G3AA 2B87B 2XU6A 4UB6H 1DH3A 1L0LK 2IBZE 1YQ4C 4L76A 1FU1A 2A06G 3MIWA 4I7ZB 1BGYJ 1ZRTD 1NJIQ 4O9BA 1FAVA 1N7SA 4I6MC 4D6TJ 1AVYA 1L0LD 3U1CA 1KILA 2BEZF 1M90Q 2WPVB 5CBOA 1N7LA 4BWNA 1YHQP 4GT1A 1FZFA 5CMZA 3H1HG 1Q82Q 2Q7CA 3BCCJ 3I56P 1GL2B 3OAKA 3BVHA 1USEA 4PD4D 2NPSB 4RJTA 2E76C 4B86A 3L73D 1WT6A 1GL2C 3L37A 1Z56A 2NPSC 2P58A 5TISE 1NTKE 1IFDA 3TYYA 1DEEG 3T97A 4H0LD 5B66H 2CPSA 3L71D 5C39A 3BRVB 4IL6E 1BGYG 2W6BA 1Q7YQ 4D6TG 1SQPJ 5KAIH 3VP9A 3G6EP 2FFDB 2HPCB 2IX7C 3SWKA 1S1CX 4JYBA 2ZT9B 3CC2P 5TJHA 5AW6B 2UWJE 3EFFK 1MUUA 3BCCG 1KN7A 2ZT9C 3L74G 1T8ZA 2WTYA 4H44C 4PV1B 2FXMA 3H25A 5APQA 1JNMA 2JO1A 4PD4I 3HTKA 1ZN5A 1OW6A 1IFMA 4PV1C 5CCHC 2R5BA 4Y28J 4HYTB 3HE4A 2WSFJ 4ZKUA 3C1LA 4GDOA 4IL6X 3BATA 4C7RA 3B5NA 1EDJA 3VMXA 2P1JA 4WBAA 2JWAA
chains in the Genus database with same CATH topology
1EZVI 3CX5I 1PP9J 3H1IJ 4PD4I 1NU1J 3L75J 3L73J 1NTKJ 1L0LJ 3H1HJ 1NTMJ 1KYOI 3L70J 3L72J 3TGUJ 2BCCJ 1BGYJ 3BCCJ 1NTZJ 2FYUJ 3CXHI 4U3FJ 3H1JJ 5KLVJ 1BE3J 1KB9I 1SQQJ 1L0NJ 3L74J 4D6TJ 1SQXJ 3H1LJ 1BCCJ 3L71J 3H1KJ 1P84I 1SQVJ 3CWBJ 1SQBJ 2IBZI 1SQPJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EZV I;  3CX5 I;  1PP9 J;  3H1I J;  4PD4 I;  1NU1 J;  3L75 J;  3L73 J;  1NTK J;  1L0L J;  3H1H J;  1NTM J;  1KYO I;  3L70 J;  3L72 J;  3TGU J;  2BCC J;  1BGY J;  3BCC J;  1NTZ J;  2FYU J;  3CXH I;  4U3F J;  3H1J J;  5KLV J;  1BE3 J;  1KB9 I;  1SQQ J;  1L0N J;  3L74 J;  4D6T J;  1SQX J;  3H1L J;  1BCC J;  3L71 J;  3H1K J;  1P84 I;  1SQV J;  3CWB J;  1SQB J;  2IBZ I;  1SQP J; 
#chains in the Genus database with same CATH topology
 2Y9Y A;  1HBW A;  1SQP G;  1WMK A;  1T2K D;  2Q6Q A;  4WWI A;  1EDI A;  3MUD A;  4HKZ H;  2KNC A;  1QVG O;  3CPW O;  1HJB A;  4IFD K;  2KP8 A;  3EQ2 A;  3N4X A;  2MKV A;  2IFM A;  2HYN A;  1SQX E;  2QJK B;  2VRS A;  5AW2 B;  2Q5U A;  3RBX A;  5TIS H;  5BU8 B;  3M0D A;  2QJK C;  2OYI C;  4C7N B;  1J2J B;  2E75 B;  5APU A;  4OH8 B;  3TGU J;  3VMA A;  2E75 C;  3VYI A;  3IN6 A;  2XV5 A;  2Y0E A;  3CCE P;  2HFE D;  4XFJ A;  2N9Y B;  3AEG C;  1FJP A;  1VQ5 P;  4A7P A;  1LTI C;  3SFE C;  1BCC D;  1VQP P;  1FZB A;  1RE4 C;  1T6A A;  1NGM B;  2OYH B;  1NWQ A;  1G2C A;  2A45 H;  2N1T A;  3MD0 A;  1U7M A;  2K3R A;  1JEK A;  1JOC A;  1FE6 A;  4OGQ D;  1LNQ A;  2FYN B;  3R4Y A;  2LKM A;  2GA1 A;  1XTC C;  2BCC E;  1IFI A;  3FX0 A;  2KYV A;  3TGU G;  2FYN C;  1J1D B;  3GHG C;  1KIL E;  1H89 A;  2YKP A;  2W6A A;  1PL5 A;  4K35 A;  3H32 A;  1VQO P;  2FBW C;  3H1J D;  2C9N Y;  3LID A;  2IZ1 A;  5GTI E;  5APV A;  5DJT B;  2WSC H;  1FC2 C;  1LT9 C;  4OWF A;  2WPS A;  3H1K J;  3EWK A;  1GTW A;  4EI2 A;  1YJN P;  1PP9 E;  3B71 A;  3TK1 A;  3L72 E;  4GIF A;  5CCG A;  3MTU E;  4YTP C;  3CWB D;  3AEA C;  1RF0 C;  1IFP A;  3AED C;  4W7Y A;  3I5C A;  3MP7 B;  3RGU A;  2JP3 A;  5DJU B;  3S9O A;  4U3F J;  2KK7 A;  1L4A A;  2QVA A;  2OTJ P;  2AEM A;  1LTB C;  1KIL B;  2QG4 A;  1Q2N A;  3PP5 A;  1IO4 A;  3RL0 B;  1AQT A;  4H13 B;  1X22 A;  1KIL C;  2K1A A;  1NU1 E;  2KZJ A;  1L0L J;  1T3U A;  3RL0 C;  2IYP A;  2XDJ A;  1XTG B;  2PP6 A;  1P84 D;  2KOG A;  3F89 A;  3V6I A;  3CCS P;  1GMJ A;  4DT0 A;  1Y8A A;  2ZAE B;  1M56 D;  5CHX A;  3II6 A;  1SFC C;  1KFM A;  3L75 J;  1GL2 D;  3T97 B;  1JO5 A;  1S4X A;  2WPQ A;  3L73 J;  3NMD A;  1FZC A;  3V5B A;  3Q5S A;  2NPS D;  1LTS C;  1JTH A;  5KJ7 D;  1X0T A;  1Q81 Q;  3H6P A;  1QVF O;  3FXE A;  3WUU A;  3L71 J;  3G4S P;  5EFW B;  1YIJ P;  4HH2 A;  5GTI H;  5KLI B;  3H1I E;  1OWA A;  4NPF X;  4EOT A;  1VQ4 P;  1L0L G;  5KLI C;  2O01 H;  3FGA D;  1NTZ E;  1KD1 Q;  5KKZ B;  2K37 A;  2IBZ D;  3W68 A;  1P84 I;  3TNU A;  5KKZ C;  2R5D A;  1NVO A;  3AEE C;  2ZT9 D;  3HTK B;  2OTK E;  3SFD C;  2R3S A;  1PPJ E;  1M1J A;  4H44 D;  1HH0 A;  2GUV A;  3HE4 B;  3L73 G;  1FZG A;  4PV1 D;  1GDT A;  1SQQ E;  5CCH D;  3B5N B;  2Y9Z A;  2CK3 H;  1NTK K;  3L71 G;  2N9B A;  3N7N A;  1M8O B;  5CJ4 A;  1KQS O;  1X8Y A;  2O1J A;  1CW5 A;  1OXZ A;  3MUD C;  1NTK D;  2KLU A;  4AQR D;  2IBZ I;  3CCR P;  1QL2 A;  3KHU A;  3NTN A;  1YTZ I;  4JQ0 D;  3VN0 A;  3P7K A;  5AW0 B;  5BVZ A;  1VQ9 P;  3KXD A;  4LGD E;  3PRJ A;  1WRG A;  2R32 A;  1L0N E;  3HRN A;  1N73 A;  2MJZ A;  2GUS A;  3MZW B;  1X79 B;  4R4L A;  2KZI A;  3M9Q A;  1AVO A;  2Q3I A;  3WU2 H;  3V2Q A;  3BRT B;  2W83 C;  2R44 A;  3KYQ A;  1EXI A;  2KLV A;  1N86 A;  3CME P;  4JF7 A;  3PTZ A;  2FY8 A;  2QJY B;  4NPD A;  3Q2Y A;  1PZQ A;  1KC8 Q;  4L73 A;  2E75 D;  3LIE A;  3TDK A;  1YIT P;  2H8P D;  2QJY C;  2Q9I A;  1N2D C;  1HF9 A;  2JWD A;  2O01 N;  1RE3 A;  5AW3 B;  1NTM E;  1LP1 A;  3WUT A;  5BU5 A;  1G2C B;  2N1T B;  2YNY A;  1SP4 A;  1BCC J;  1USD A;  2E42 A;  1PGP A;  1EDK A;  1FS0 E;  5AVQ B;  3PJS K;  1OIP A;  2P2U A;  3L70 E;  1SQX K;  4RKU J;  5AVT B;  3V4Q A;  3Q3D A;  1E5W A;  4I7Z C;  2BAS A;  1VDF A;  2Q1K A;  1SQV E;  3H32 B;  1G1J A;  1OFC X;  2I8D A;  1PFI A;  2A45 I;  1H8A A;  4N6J A;  1SQX D;  4ASW A;  1U57 A;  1YYC A;  1OMI A;  1BE3 E;  3H1J J;  3EFG A;  2WZ7 A;  3L74 J;  3H1L E;  1IJD B;  3RK3 E;  2V4H A;  3RK2 B;  1BCC G;  3TF5 A;  3U1A A;  1PIX A;  3RK2 C;  3HE5 A;  5KJ7 C;  3CXH E;  2FYU E;  1P84 H;  2ZYG A;  2JKV A;  1JY2 N;  1OW8 A;  1VL2 A;  4WY4 A;  1NYH A;  5KAF H;  1IZN B;  2HG5 D;  3BAS A;  3CWB J;  1EZV E;  3QWO C;  3GW6 A;  1DEB A;  2W6J H;  1L4A B;  4UB8 E;  3HUS A;  2FFD C;  2QM8 A;  3H1J G;  1L4A C;  4IFM A;  2JEE A;  1LTG C;  3ZDM A;  2BCC D;  3M06 A;  1CI6 A;  5K5G B;  3AE3 C;  1GU5 A;  2P7J A;  3CCQ P;  2YMK A;  1ZOY C;  1KIL D;  3RL0 D;  1S3J A;  2GM4 A;  3H1K E;  3RK3 B;  1HTL C;  4XA4 A;  3P32 A;  1FZC B;  3HD7 A;  3CWB G;  1W2B O;  4DJG A;  1MZ9 A;  1JTH B;  1SFC D;  4DZO A;  2W90 A;  3Q1M A;  3CCV P;  1JY3 O;  3IF4 A;  1PP9 D;  5GTH E;  3CCL P;  3L72 D;  5AVS B;  1R8E A;  1ZME C;  2AXT E;  2M3B A;  1ZXG A;  4LLH A;  4CPG A;  4U3F E;  4AYC A;  2K9J A;  3TNU B;  2OAR A;  3AE2 C;  1S72 P;  1NU1 K;  1YQ3 C;  4ZKP A;  1QL1 A;  1J1E B;  1M1J B;  3CXH H;  1JY2 O;  4IL6 H;  1LWU A;  4HB1 A;  1LTA C;  5AVV B;  4XE5 B;  2H7H A;  1NU1 D;  1ZLL A;  1NO4 A;  2WQY C;  2IFN A;  1SQB E;  4UB8 H;  3L75 E;  2JJL A;  1R5L A;  1LJ2 A;  2KSJ A;  3B5N D;  2AEF A;  1JMB A;  1JY3 P;  3K5B A;  1FOS E;  3IFM A;  2HLO A;  2QSI A;  1OVV A;  1E79 H;  1YBK A;  2OYH C;  1YTZ T;  2IBZ G;  1NTZ K;  4EDF A;  1NTK J;  3L35 A;  4YXD C;  3S1K A;  1N73 B;  3A0B E;  1QGK B;  1IK9 A;  5AVU B;  3H1I D;  3O6Q A;  1JB0 J;  3A7O A;  3CC7 P;  4KT0 J;  1J1D C;  3CX5 E;  1JY2 P;  2OQQ A;  1NTZ D;  1GW3 A;  5B5E E;  1R5S A;  1SQQ K;  3QH9 A;  4L75 A;  1KB9 E;  2I1J A;  3G3Z A;  1UIX A;  5AVR B;  1PPJ D;  2J59 M;  3JCU E;  3MHV A;  1G1I A;  1Q86 Q;  1LP1 B;  1Y47 A;  5AW7 B;  1SQQ D;  1NTK G;  5KLV E;  1VQL P;  1HJ0 A;  1KQF B;  5AVY B;  1BSN A;  2H89 C;  1VQ8 P;  2YO2 A;  3KDP B;  1MKM A;  1YI2 P;  1CSB A;  1BSH A;  1EQ7 A;  3W67 A;  2N1T D;  3AE4 C;  1L0N K;  1RH5 B;  1N7S B;  1GW4 A;  2ZXE B;  1SVF A;  1MFT A;  1NAY A;  1OW7 A;  2QA4 P;  3S4R A;  2A06 E;  1N7S C;  2WSC J;  2A45 G;  1L0N D;  4H13 C;  4JYC A;  3VMZ A;  2ZJS E;  1ZR4 A;  1SQX J;  1QLE D;  2POH A;  1HVV A;  1NTM K;  3TSI A;  1ZV8 A;  2B88 A;  3HE5 B;  2BEQ D;  1N8R Q;  3H1H E;  2J58 A;  2YO3 A;  3CCJ P;  4WY4 B;  2FXO A;  2WSE H;  2KB7 P;  3RK2 D;  3VP8 A;  1AFO A;  1URQ A;  3CX5 H;  1SLQ A;  4WY4 C;  5B5E H;  1NTM D;  1K9M Q;  4MN4 C;  3E7K A;  2CPB A;  1JCC A;  2XNX A;  3L4F A;  3HUS B;  1BGY E;  3VOP A;  1SQV K;  3JCU H;  2M8R A;  4D6T E;  3NXS A;  3AEC C;  1RHZ B;  1SQX G;  3L70 D;  4I1L A;  1L4A D;  3AE9 C;  1KYO E;  1VQN P;  2QEX P;  1PGQ A;  2BCC J;  5CJ0 A;  3BCC E;  2KI7 B;  1SQV D;  3OJA B;  5APY A;  3CCM P;  2IZ0 A;  2QE7 H;  3L74 E;  1QEX A;  1PGO A;  2M5A A;  3HD7 B;  2OYI A;  3LW5 H;  4L74 A;  2YIU B;  1AA0 A;  4GOD A;  3B5N C;  1M57 D;  2FYU K;  5APS A;  1BE3 D;  3HD7 C;  3H1L D;  2YIU C;  1YJW P;  3CI9 A;  4WVZ A;  3RK3 D;  2D2C B;  2KNC B;  1BDC A;  3CL3 D;  3G71 P;  2O01 J;  2D2C C;  3AE6 C;  1HGV A;  1SQP E;  3CXH D;  2E74 B;  3GF3 A;  4GOF A;  1PP9 J;  2FYU D;  2Y0D A;  1RE4 A;  2RKL A;  2K9J B;  2V7Q H;  4EIJ A;  2E74 C;  1M1K Q;  4IFF A;  3M9B A;  2B89 A;  4KJM A;  2BCC G;  3OA7 A;  1EZV D;  2ZVN B;  1W5C E;  4BRY A;  2RH0 A;  1ZP0 C;  2ZYD A;  2O1K A;  2P67 A;  1LWU B;  3LW5 J;  3M0D C;  2C0X A;  4ZMD A;  2NRG A;  2HOD A;  3GHG A;  4DOJ A;  4TT3 H;  1LGH B;  2PGD A;  1X9V A;  5B66 E;  2E5T A;  5M1B A;  1FBM A;  1NHL A;  3WUV A;  2WPR A;  1NU1 J;  1RQU A;  3V4W A;  1PP9 G;  4BXL A;  2KSE A;  3H1K D;  1KTM A;  3L72 G;  4Y99 B;  3IAO A;  1LT9 A;  3CXH I;  1KQL A;  2KUB A;  2J5U A;  5AVX B;  3D6Z A;  3NFQ A;  2N1T C;  1EZV I;  3AEB C;  1BDD A;  2YXQ B;  3D70 A;  1W2E A;  3O6Q B;  2H43 A;  2I1K A;  5AW5 B;  1H0T A;  5H2F E;  4YXW H;  3E1I A;  2YMY A;  3AEF C;  1FJK A;  3JC2 2;  1JY3 N;  4OVN F;  4U3F D;  3H1I J;  1NU1 G;  3TGU E;  1NTZ J;  2PFX A;  1NKN A;  1SQB K;  1GK6 A;  4W80 A;  2FKW B;  4N78 E;  1RF1 A;  1IFN A;  3KZI E;  4GKG A;  1UII A;  4JBZ A;  1VF5 B;  1FOS F;  2XKM A;  2E76 B;  3G9R A;  2XZR A;  3KQG A;  3P8C E;  5CCG C;  3GLM A;  1SQB D;  1VF5 C;  1SQQ J;  3CCU P;  1D7M A;  3L75 D;  2R3C A;  1SFC A;  3R2P A;  2AEJ A;  2WSF H;  3H1I G;  3KPE A;  2K88 A;  2OYO A;  1VPC A;  1NTZ G;  3RBZ A;  1MV8 A;  3D6Y A;  1RQV A;  4DCK A;  1N7S D;  1PPJ G;  4NPE A;  2OGU A;  1A02 F;  3GG2 A;  3SWF A;  4H44 B;  1Q90 D;  1L0N J;  3CX5 D;  3GF7 A;  4H13 D;  2KIK A;  1SQQ G;  1Y9B A;  5KLV K;  1KB9 D;  3RK3 C;  2P10 A;  2W27 A;  1RY3 A;  3A5T A;  3B4S A;  3PLN A;  1URQ B;  1FZC C;  5H2F H;  2WVR A;  3I55 P;  1S9K E;  2DW3 A;  3M91 A;  1KFN A;  1URQ C;  1YJ9 P;  2KS1 A;  1S5L E;  4WY4 D;  4WB4 A;  5KLV D;  1VQK P;  1M7L A;  1NTM J;  4C46 A;  4Z1M H;  1LTT C;  4M3L A;  1S2E A;  3KZI H;  1GU4 A;  3L36 A;  3AE7 C;  1L0N G;  1ZRT E;  3SSU A;  3OW2 O;  3VMY A;  3FXD A;  5AVW B;  1ZR2 A;  3CX5 I;  1VQ7 P;  1L0L E;  3A2A A;  3L70 J;  1J1E C;  1M1J C;  1GK4 A;  3CD6 P;  2A06 D;  4TLF A;  2QM7 A;  1KB9 I;  2M5A B;  2OYI B;  5AW9 B;  2LXC B;  1SQV J;  2L91 A;  2YKO A;  1KOR A;  4PD4 E;  3D71 A;  2OTL P;  3L73 E;  1S5L X;  3A0H E;  1NTM G;  3HD7 D;  2WT7 A;  1BE3 J;  1LTJ A;  2G8Y A;  3H1L J;  2NZ2 A;  1K04 A;  3L71 E;  2KXP B;  3H1H D;  2Z5H A;  1EDL A;  4PJ0 E;  3U59 A;  2ZXX A;  1FDM A;  4YPC A;  2D2C D;  3L70 G;  2FYU J;  1FZE A;  3ITK A;  4BRY B;  2WIT A;  2E74 D;  2B9B A;  2PAJ A;  4EYY Q;  2B87 A;  1N73 C;  3PHL A;  3FWL A;  3A3Y B;  4N3Y B;  1SQV G;  1BGY D;  3JSV C;  2HOD B;  3GHG B;  1EC5 A;  4D6T D;  1NOH A;  2C9L Y;  4LC1 A;  1T3J A;  5GTH H;  1KV4 A;  3M9H A;  3AE5 C;  1BE3 G;  1S5L H;  4W7Z A;  1AJY A;  2AXT H;  3H1L G;  3Q5P A;  1KYO D;  1VQM P;  2E43 A;  5E79 E;  3BCC D;  2YXR B;  3L74 D;  1LT9 B;  1DIP A;  1JM0 A;  1RE3 C;  3CC4 P;  3USS A;  1OVU A;  1KMI Z;  1SQP K;  2FYU G;  1GL2 A;  4H0L B;  3PH0 A;  1IFJ A;  2NPS A;  2ZYA A;  2FYZ A;  4H0L C;  2IDB A;  1EZV G;  5KJ7 A;  4I2L C;  2WSS H;  3F5H A;  4R4M A;  1H0T B;  4ASV A;  1CZQ A;  1SQP D;  4JPZ B;  4PD4 H;  1JUN A;  5APX A;  4U7J A;  3A0H H;  2E5Y A;  3CLQ A;  2IPP A;  1KYO I;  2FFD A;  2HPC A;  4ZNC A;  1IK7 A;  3P8M C;  3FWN A;  3B8E B;  3AE1 C;  2RN0 A;  2QRX A;  4PJ0 H;  1RF1 B;  3H1K G;  3WMM 0;  1H88 A;  2M3E A;  3C8V A;  2IYO A;  3V2N A;  5CCH A;  1RF1 C;  2HR3 A;  3MGN A;  3M0A A;  3A0B H;  1PGJ A;  1DD3 A;  3O8Z A;  1SFC B;  5AVZ B;  2O3J A;  1PV3 A;  1FZA A;  2JDI H;  1OZH A;  1BCC E;  5CCG D;  1VF5 D;  1SQB J;  2E76 D;  2Z4E A;  1T2K C;  1VQ6 P;  2L5G B;  2C0W A;  3AE8 C;  5APW A;  1KB9 H;  1SS1 A;  3WU2 E;  3IR9 A;  2M0B A;  3GMA A;  5APT A;  2QJP B;  1QX8 A;  4U3F G;  1AQ5 A;  3HUS C;  1TU3 F;  5E79 H;  1GD2 E;  1CI6 B;  2QJP C;  2W8Z A;  4HJG H;  2AXC A;  4KHX A;  1JMM A;  1KZU B;  2Z5I A;  3H1J E;  1HWT C;  5AW8 B;  2XND H;  1DD4 A;  1EXJ A;  1OX3 A;  2WSE J;  4QMA A;  1NH4 A;  1LT1 A;  3TGU D;  5KTB A;  4UB6 E;  3V2R A;  1SQB G;  4GOE A;  3L75 G;  3RL0 g;  4C7N A;  2QIW A;  3CMA P;  1U7J A;  2WMM A;  4N78 D;  2KS1 B;  1A02 J;  1K73 Q;  1FDI A;  1KQG B;  3CWB E;  2ZFC A;  2LXB A;  2JR8 A;  2SPZ A;  1URQ D;  2LR2 A;  3P8C D;  1GZL A;  1HUC A;  3E1R A;  4AUW A;  3ABV C;  3L72 J;  4OGQ B;  3V2P A;  5KLV J;  2K9Y A;  4K3A A;  2WWW A;  2YKQ A;  2Y0C A;  1HGZ A;  5AW4 B;  4OGQ C;  2H88 C;  2ZVO B;  2OYH A;  1L2P A;  4RES B;  4IOI H;  5CBN A;  1ZW0 A;  1OVR A;  1K05 A;  1LWU C;  1JCD A;  2ITA A;  3SWY A;  1P84 E;  3VTP C;  5AW1 B;  1K8A Q;  1AV1 A;  3Q5R A;  5KAF E;  1IC2 A;  2RMZ A;  5L8R J;  2WT7 B;  1LTJ B;  1NAF A;  5KAI E;  1NKZ B;  1DX7 A;  1MFZ A;  5KLV G;  1LTJ C;  2V7Q J;  2PRR A;  4Y99 C;  1FDO A;  4RO0 A;  1KYO H;  3UIA A;  3C9I A;  1S9K D;  3H1H J;  2FXP A;  2Q3E A;  1RF0 A;  2G3A A;  2B87 B;  2XU6 A;  4UB6 H;  1DH3 A;  1L0L K;  2IBZ E;  1YQ4 C;  4L76 A;  1FU1 A;  2A06 G;  3MIW A;  4I7Z B;  1BGY J;  1ZRT D;  1NJI Q;  4O9B A;  1FAV A;  1N7S A;  4I6M C;  4D6T J;  1AVY A;  1L0L D;  3U1C A;  1KIL A;  2BEZ F;  1M90 Q;  2WPV B;  5CBO A;  1N7L A;  4BWN A;  1YHQ P;  4GT1 A;  1FZF A;  5CMZ A;  3H1H G;  1Q82 Q;  2Q7C A;  3BCC J;  3I56 P;  1GL2 B;  3OAK A;  3BVH A;  1USE A;  4PD4 D;  2NPS B;  4RJT A;  2E76 C;  4B86 A;  3L73 D;  1WT6 A;  1GL2 C;  3L37 A;  1Z56 A;  2NPS C;  2P58 A;  5TIS E;  1NTK E;  1IFD A;  3TYY A;  1DEE G;  3T97 A;  4H0L D;  5B66 H;  2CPS A;  3L71 D;  5C39 A;  3BRV B;  4IL6 E;  1BGY G;  2W6B A;  1Q7Y Q;  4D6T G;  1SQP J;  5KAI H;  3VP9 A;  3G6E P;  2FFD B;  2HPC B;  2IX7 C;  3SWK A;  1S1C X;  4JYB A;  2ZT9 B;  3CC2 P;  5TJH A;  5AW6 B;  2UWJ E;  3EFF K;  1MUU A;  3BCC G;  1KN7 A;  2ZT9 C;  3L74 G;  1T8Z A;  2WTY A;  4H44 C;  4PV1 B;  2FXM A;  3H25 A;  5APQ A;  1JNM A;  2JO1 A;  4PD4 I;  3HTK A;  1ZN5 A;  1OW6 A;  1IFM A;  4PV1 C;  5CCH C;  2R5B A;  4Y28 J;  4HYT B;  3HE4 A;  2WSF J;  4ZKU A;  3C1L A;  4GDO A;  4IL6 X;  3BAT A;  4C7R A;  3B5N A;  1EDJ A;  3VMX A;  2P1J A;  4WBA A;  2JWA A; 
#chains in the Genus database with same CATH homology
 1EZV I;  3CX5 I;  1PP9 J;  3H1I J;  4PD4 I;  1NU1 J;  3L75 J;  3L73 J;  1NTK J;  1L0L J;  3H1H J;  1NTM J;  1KYO I;  3L70 J;  3L72 J;  3TGU J;  2BCC J;  1BGY J;  3BCC J;  1NTZ J;  2FYU J;  3CXH I;  4U3F J;  3H1J J;  5KLV J;  1BE3 J;  1KB9 I;  1SQQ J;  1L0N J;  3L74 J;  4D6T J;  1SQX J;  3H1L J;  1BCC J;  3L71 J;  3H1K J;  1P84 I;  1SQV J;  3CWB J;  1SQB J;  2IBZ I;  1SQP J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...