3CXHI

Structure of yeast complex iii with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
55
structure length
55
Chain Sequence
b'SSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 18
structure length 55
sequence length 55
chains with identical sequence T
ec nomenclature
pdb deposition date 2008-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 3cxhI00
1BCCJ 3BCCJ 3H1IJ 1NTKJ 1PP9J 1NU1J 3L75J 1SQPJ 1L0NJ 3CWBJ 3L71J 2IBZI 3L72J 3L73J 3L74J 1EZVI 3H1KJ 1BE3J 3CX5I 1SQXJ 3H1JJ 1P84I 2FYUJ 1SQQJ 3L70J 5KLVJ 3H1LJ 1SQBJ 4U3FJ 3H1HJ 1L0LJ 4PD4I 2BCCJ 1BGYJ 3CXHI 4D6TJ 1NTZJ 1KB9I 1KYOI 1SQVJ 1NTMJ 3TGUJ
chains in the Genus database with same CATH superfamily
4N78E 3GF3A 2RN0A 1S1CX 3GHGB 4RO0A 1OVVA 1ZRTE 4KT0J 3H1JE 1AV1A 1LTAC 1QVFO 1G2CA 2W6BA 3Q5PA 2W27A 1AVOA 3MP7B 2ZYDA 1L0NK 1L0LJ 3MGNA 2E74B 4NPFX 3FGAD 1SQPE 2E76D 1SQXK 1NTMJ 3CWBG 1PGPA 1LNQA 3HE4A 1HGZA 3L74G 1BE3G 5AW5B 3VP9A 1RE4A 3CX5I 1EDKA 1JY3P 2E76C 2PRRA 3MTUE 1QEXA 3EFFK 1IFIA 3G71P 2Y0DA 3SFDC 1VF5B 3IAOA 3TNUA 1YI2P 1HVVA 1LTGC 1NTKD 2QG4A 2HFED 1Q2NA 2FYUE 3L72J 3H6PA 3BATA 1J1EC 3CCMP 1FOSE 3Q2YA 1K73Q 1URQB 3H1IE 2AEMA 1S4XA 1SQXD 1ZR2A 2FFDA 3AE6C 3GF7A 5KLVD 3PTZA 2Y0CA 5E79E 2YKPA 1IC2A 2I1KA 1BGYJ 3SWFA 4D6TJ 4DJGA 1PP9E 2WSCJ 1KQFB 1BCCD 1OVRA 1LT9A 2JWDA 5APYA 3B71A 3D71A 4IFMA 1RHZB 5TISE 1U7JA 4AQRD 1IZNB 1FU1A 1L0LE 2NPSB 1SQVK 4M3LA 1JY3N 5TISH 1YJWP 1GL2A 4NPDA 1NTME 1YQ3C 2HODA 4OWFA 3C8VA 1VQ4P 3WUVA 1NU1G 5TJHA 2GUVA 2B87A 2AXTH 1SQBK 3L73J 2JO1A 3QWOC 1UIIA 1CSBA 3PP5A 3L72E 4JQ0D 3BASA 2P67A 2IYPA 1WT6A 2YKOA 1FZGA 4GDOA 2P7JA 1ZRTD 2K1AA 2BEQD 2KLUA 3HTKA 4GKGA 2W83C 1NTZJ 5AVUB 3BRTB 3JSVC 5BVZA 1SQPD 2YKQA 3H1KG 2YXRB 1FJPA 2K9JA 3L4FA 1HWTC 2QJPB 1BGYE 4D6TE 1W2EA 1N2DC 2N1TB 5GTIH 1N8RQ 1RF1B 1AA0A 2ZYAA 2WSCH 1PFIA 3CMEP 5BU5A 3VTPC 3H32B 3PH0A 2OYHC 2JDIH 1FZEA 1M1JB 2I8DA 2WSFJ 2WSEJ 4H13D 3HE4B 3GHGC 2FYUD 3L70J 2E74D 4GOEA 1OW6A 5AW3B 2KB7P 4H13C 5AVQB 1FAVA 3L73E 4IFFA 3HRNA 4GIFA 2OYIC 1NU1J 2E74C 3RK2B 3P8MC 2ZVOB 1T3UA 1DIPA 3A0HE 2YMKA 1KQGB 1PL5A 3AECC 1SQQJ 3A0HH 2OGUA 1VF5D 3S1KA 2BCCG 3SWKA 3BVHA 5APWA 1R5SA 1VQMP 4N6JA 2YXQB 3TGUG 1YTZI 5AW4B 1L0NG 1N73B 1VF5C 1IFDA 2O3JA 1NTZE 5BU8B 5APSA 1L0LD 2FFDB 2D2CB 1KB9I 4Z1MH 4WBAA 1S3JA 5B5EH 1URQC 1PPJG 3KPEA 4Y28J 2YMYA 1JMBA 1LT9B 4BRYB 3OAKA 3A0BH 4Y99B 2AXCA 1GL2B 3H25A 1PZQA 2FYZA 3L72D 3L70E 2WSFH 1EZVG 2B87B 2FY8A 1KZUB 1M1KQ 4IOIH 2E5YA 1EDLA 1VQ9P 3FXDA 1VQ8P 4BWNA 1YHQP 1LWUC 1SQQE 2Q3EA 1BDDA 2W8ZA 2OYHA 1LTIC 1JY2P 2BCCJ 1BGYD 2R44A 4D6TD 3GHGA 2G3AA 1SQVG 1W5CE 2O1KA 3HTKB 3KZIE 1OZHA 3TGUJ 1OW7A 4I2LC 2V7QH 2E76B 1L0NJ 5KJ7C 3KZIH 1X8YA 4W7ZA 2WTYA 1FDMA 2WMMA 1SQXJ 2OYIA 1VL2A 1T6AA 1Y8AA 2WPQA 2K9JB 2QRXA 1L4AD 4H0LD 1GU5A 1KFNA 3NFQA 1BCCJ 1PIXA 2FKWB 3L73D 1BE3D 1IFJA 3PHLA 3L36A 2Z5HA 3V6IA 3II6A 3TDKA 1IO4A 2QJPC 1KYOI 1N7LA 2R3SA 3B8EB 1HJ0A 1N7SD 2N1TC 1RF1C 2XDJA 3SFEC 3U1AA 5CCGC 3VOPA 2PFXA 2L91A 2HR3A 3CC4P 3I56P 1KFMA 1N7SC 4OH8B 1BSHA 1M1JC 1IFNA 1GK4A 1JY2N 2KUBA 1NTZD 2KNCB 4ZNCA 2WZ7A 3AEFC 1QGKB 3RK2D 2R5BA 3CL3D 3ABVC 3OW2O 2KZJA 4C7NA 3O6QA 4C7RA 2BCCE 3RK2C 4KJMA 1KB9E 3TGUE 1FZCB 4DOJA 1L0NE 2CK3H 1SQVJ 2K3RA 1T3JA 5CCHC 1SQXE 1ZP0C 4LC1A 3P8CE 3CI9A 2QIWA 4DCKA 1S2EA 3UIAA 3GG2A 1LWUA 1N73C 1S9KD 4GOFA 3HD7D 1SQBJ 1BCCE 2GUSA 4LLHA 5AVRB 3RGUA 1NHLA 2ITAA 3OJAB 5KAFE 1U57A 1NU1D 2D2CC 1YTZT 2RH0A 2ZT9D 5KJ7A 1SQQD 2XNDH 4QMAA 4TT3H 1DX7A 2OTLP 1RE3C 2ZT9C 4K35A 5APUA 1KORA 4Y99C 1EZVE 1RF0C 3QH9A 2CPBA 1CW5A 3L35A 1JCDA 3B4SA 2LR2A 4I6MC 4ZKUA 3JC22 3VMAA 1ZMEC 1AQ5A 3FWNA 5AVXB 5L8RJ 3IR9A 4L74A 3NMDA 2SPZA 1ZXGA 2N1TA 2Q6QA 3H1KD 1BSNA 1KMIZ 1RF1A 4UB6E 1GZLA 5CCGA 1D7MA 4H13B 4EIJA 4UB6H 3H32A 2OYIB 1N7SA 1MKMA 3CCLP 2P1JA 3AEAC 1M1JA 3BCCG 2PAJA 2IPPA 4TLFA 1LTJB 2VRSA 4GT1A 1SQBE 2PGDA 1AVYA 3AE8C 1Y47A 2HPCA 1GDTA 5CBNA 4A7PA 1S5LX 2POHA 1EDIA 5CCHA 2N9YB 2HLOA 3S4RA 4B86A 3IF4A 2BCCD 2FXOA 3O8ZA 1Q7YQ 1N73A 3VP8A 2Z5IA 1KB9D 2I1JA 3TGUD 1KN7A 2WQYC 3E1RA 1L0ND 1LGHB 1FZFA 1BDCA 3R2PA 4C7NB 3P8CD 3MD0A 4H44D 3O6QB 1G1IA 1X79B 3Q1MA 5E79H 3B5ND 3VN0A 4H44C 1PPJD 3L71G 4BRYA 2NZ2A 3G4SP 1RE3A 4PJ0E 1Z56A 1L2PA 3MIWA 4PJ0H 2M8RA 3MHVA 1RF0A 4JPZB 4PD4I 2KP8A 4XE5B 1LWUB 2Y9ZA 3A5TA 5KTBA 3C1LA 1OX3A 1VQLP 2A45H 1FZCC 3CWBJ 3L74J 1BE3J 1EZVD 1JUNA 1S72P 2OYOA 2KZIA 2WT7A 1AFOA 3CXHI 1K05A 1GTWA 3ZDMA 2XNXA 1DH3A 2V4HA 4U3FG 1LJ2A 3H1LG 3A7OA 5AVWB 1SQVD 1L4AB 4H0LB 2O1JA 3RL0D 1KQLA 2Q7CA 4JBZA 3IFMA 4HH2A 2WPSA 1VQNP 3TK1A 1P84I 2YIUC 1ZW0A 2B9BA 1SQBD 2QM8A 3D6YA 2P10A 4ZKPA 4PV1D 2XKMA 3L75G 1NAYA 1NVOA 1N7SB 4RESB 3L71J 3LIEA 3CX5E 2P2UA 1VPCA 2IBZG 4PV1C 2J59M 1XTGB 2JJLA 5CJ0A 1PGJA 3CX5H 2Q9IA 3H1HG 3CWBE 1IFPA 3L74E 3KDPB 1BE3E 1EC5A 5KKZB 2IBZI 2HPCB 1QX8A 1S5LE 1DEEG 1LTJC 2KNCA 1A02F 3AEEC 1S5LH 3WUUA 2JP3A 5AVVB 1X0TA 1VQ6P 1H88A 1NTKG 4N3YB 2K9YA 1ZLLA 5APQA 1FE6A 2KXPB 5K5GB 2OTJP 3P32A 1E79H 1FZCA 3KYQA 1ZR4A 3RK3D 1Y9BA 3H1LJ 2WSSH 3HD7B 4HYTB 2KSJA 3N7NA 4HKZH 3PRJA 1H0TB 3H1KJ 3KQGA 3V2PA 2ZT9B 1YYCA 1JCCA 1R5LA 1EXJA 2NRGA 2LXCB 1S9KE 5AW6B 2WSEH 2FYNB 3W68A 4OGQD 2ZXEB 3CXHE 3Q5SA 1GMJA 3RBXA 3D6ZA 3H1HJ 5CJ4A 5B66E 4OVNF 1NU1E 1FJKA 1DEBA 2W6AA 2WT7B 5B66H 1HUCA 3MUDC 2LKMA 1HBWA 1OW8A 5EFWB 1KTMA 1LTTC 1NH4A 1KQSO 2BASA 2W6JH 5DJUB 5CMZA 3CCJP 2C0XA 3AE2C 1LP1B 3SWYA 4HB1A 3H1LE 3H1JG 3JCUE 3CX5D 1VQ7P 1RQUA 2CPSA 2ZYGA 1KILD 2LXBA 3JCUH 1NGMB 2MKVA 1LTJA 4EOTA 3H1KE 1SQPG 2KOGA 3CWBD 1L4AC 3L74D 2MJZA 4H0LC 3U59A 3M9HA 5CHXA 1GU4A 2E75B 1EQ7A 3F5HA 4L76A 1OIPA 1NJIQ 2KS1B 1QLED 1Q81Q 3LIDA 1HF9A 1OXZA 4NPEA 1YJNP 1Q90D 4K3AA 1XTCC 1FOSF 4H44B 2QVAA 2B88A 3KXDA 1K04A 3H1IG 5AVTB 3L37A 3B5NB 1J2JB 1JM0A 5C39A 4I1LA 2H89C 5KKZC 3T97A 2J58A 4PD4D 2UWJE 2IX7C 1KB9H 1RQVA 1MFZA 1PP9G 4C46A 3L71D 1FS0E 4UB8E 4RKUJ 2JEEA 1RY3A 1M7LA 1QVGO 2YNYA 2QA4P 4UB8H 1ZN5A 2ZVNB 3MUDA 1L0LG 4MN4C 2KK7A 1PPJE 1NTMG 3CXHD 3ITKA 1LT1A 1HJBA 2IFNA 2Q3IA 1GK6A 3IN6A 5APVA 2QJYC 3HD7C 4DZOA 5KAFH 2M3EA 3RL0g 4EI2A 1FZAA 2IYOA 2WVRA 4R4MA 2A06G 4WB4A 4DT0A 4EDFA 4W7YA 3RL0B 2YIUB 3MZWB 3A2AA 1MZ9A 2H8PD 1CI6B 2H88C 3V4WA 1JOCA 1L4AA 5AW7B 3H1LD 3E1IA 2FYNC 4R4LA 1T8ZA 3M06A 4PV1B 3H1IJ 3VYIA 1JNMA 1M90Q 1OVUA 3I55P 3G6EP 3V2RA 1HH0A 2C9NY 1NTKK 1SQVE 1BGYG 3LW5J 4IL6X 2PP6A 5M1BA 2Q5UA 3P7KA 1PP9J 3L75D 1NYHA 2IBZD 1QL1A 2QM7A 1T2KD 1FZBA 3H1HD 1KYOE 1M56D 1PV3A 1KYOH 1KD1Q 2H7HA 1T2KC 2C0WA 5AVSB 5KLVK 3L73G 3Q5RA 4WY4B 2E75D 3V5BA 4BXLA 1MFTA 3AE4C 3RK3B 3AEGC 2E75C 2OARA 3AE3C 4AYCA 4XA4A 2WPRA 2WPVB 2GA1A 1EXIA 5CBOA 3NXSA 1K9MQ 2Q1KA 3HD7A 3HUSC 4WWIA 1NTZG 3WU2E 2HYNA 1H0TA 3T97B 2Y0EA 3WU2H 3S9OA 3RK3E 1MV8A 2E43A 1LTBC 3B5NC 4OGQB 3KHUA 3LW5H 5APXA 3V4QA 1GW3A 1IFMA 3BCCJ 3CCEP 1YIJP 3N4XA 2M5AB 4KHXA 2KI7B 3L70G 2IDBA 1JTHB 1SQPK 1QL2A 2AXTE 3CCVP 1FC2C 1IJDB 3CCUP 3GW6A 1YQ4C 2Y9YA 3CCQP 1SQQG 1USEA 3NTNA 2A06E 1NAFA 2JKVA 2O01J 1DD4A 2H43A 2L5GB 4EYYQ 1KILB 1LP1A 1AJYA 4W80A 2E5TA 2FYUK 3G3ZA 3M0DC 1E5WA 1JEKA 5APTA 3HE5A 2JWAA 2QJKB 4N78D 4IFDK 5KLIC 3H1JD 5AW1B 1VQOP 2HG5D 3RL0C 1NOHA 4I7ZC 3A3YB 4L75A 1ZV8A 2ZXXA 2J5UA 3USSA 1KYOD 1R8EA 2M0BA 4IL6E 3GMAA 5GTIE 1VQ5P 2FXMA 2C9LY 1KILE 4IL6H 3FX0A 1H89A 2FBWC 2KS1A 5KAIE 3M9QA 1G2CB 1SP4A 1TU3F 1X22A 3BCCE 4GODA 1SFCD 5KAIH 2IZ1A 3HUSA 4O9BA 3M91A 2AEJA 2ZAEB 1J1DC 3CC7P 1L0LK 1SFCC 3M9BA 2GM4A 1JY3O 2W90A 1NTMK 1GD2E 2KIKA 2QE7H 3V2NA 4LGDE 4YPCA 3D70A 5AW9B 3B5NA 1WRGA 3EFGA 2JR8A 3H1ID 3AEDC 5GTHE 3TNUB 4WY4D 3R4YA 1CZQA 5GTHH 4ZMDA 4YXWH 3CCSP 1HTLC 1RH5B 4U3FJ 2O01H 4WY4C 3W67A 1PGQA 4ASWA 4WVZA 2QJYB 1NKZB 3EQ2A 3WUTA 2V7QJ 1FDIA 1PP9D 1WMKA 3RK3C 1SQXG 2WITA 1URQD 1NWQA 3Q3DA 4PD4E 1PGOA 2QSIA 5KLVG 5B5EE 2O01N 3FXEA 3AE1C 1DD3A 4PD4H 1OWAA 2P58A 1H8AA 2Z4EA 3L71E 1NTMD 1BCCG 1GW4A 3L75J 2WWWA 1K8AQ 3A0BE 1YBKA 3M0DA 2B89A 2N9BA 2FXPA 3V2QA 2A06D 4HJGH 3CXHH 1FDOA 4OGQC 2KLVA 2HODB 3VMXA 1CI6A 2RKLA 1N86A 2NPSD 3TF5A 3AE7C 3CMAP 1OFCX 5AW2B 1Q86Q 4XFJA 2NPSC 4U7JA 1IK7A 1UIXA 1A02J 1M57D 3CD6P 5H2FE 1JB0J 2ZFCA 3CLQA 3VMZA 2OQQA 1NTKJ 3AE9C 1VQKP 5H2FH 2QEXP 1YITP 1VDFA 1EZVI 4U3FE 1P84E 1LTSC 2IZ0A 1EDJA 1SFCA 1P84H 3HE5B 5KJ7D 3E7KA 2IFMA 4JYBA 1W2BO 4YXDC 3BCCD 1IK9A 1KILC 1NTZK 3CCRP 2KSEA 1Q82Q 1SQBG 4ASVA 5KLVJ 2KYVA 2QJKC 5AW0B 1KC8Q 3L75E 3M0AA 4WY4A 2IBZE 2ZJSE 3C9IA 1J1EB 1ZOYC 3HUSB 1M8OB 2RMZA 2N1TD 3FWLA 3H1HE 2XU6A 2FYUG 3I5CA 1KV4A 5CCGD 3AE5C 3CC2P 3TSIA 4JYCA 1JO5A 5AW8B 3BRVB 1URQA 4RJTA 1YJ9P 4CPGA 2YO3A 3OA7A 1NU1K 1FBMA 1X9VA 1NTKE 2XZRA 1NO4A 4JF7A 1MUUA 3EWKA 5DJTB 1RE4C 1SQQK 3VMYA 3H1JJ 5CCHD 2M3BA 1HGVA 2R5DA 2M5AA 2A45G 2NPSA 2R3CA 3AEBC 1SQPJ 1JTHA 5KLVE 3RBZA 3G9RA 3GLMA 5AVZB 2XV5A 3L70D 2D2CD 2DW3A 3PJSK 4L73A 2BEZF 2A45I 1NKNA 3K5BA 2YO2A 2FFDC 5KLIB 2AEFA 3L72G 3CPWO 1VQPP 2G8YA 3WMM0 2OTKE 4I7ZB 1OMIA 2FYUJ 1KILA 4U3FD 5AVYB 1P84D 1G1JA 1LT9C 1GL2D 4AUWA 2K37A 3F89A 3TYYA 3SSUA 1AQTA 3U1CA 3PLNA 1USDA 1GL2C 1SLQA 2K88A 1SS1A 1JY2O 4D6TG 2OYHB 2R32A 2E42A 1J1DB 1U7MA 1SFCB 1SVFA 4YTPC 1JMMA
chains in the Genus database with same CATH topology
1BCCJ 3BCCJ 3H1IJ 1NTKJ 1PP9J 1NU1J 3L75J 1SQPJ 1L0NJ 3CWBJ 3L71J 2IBZI 3L72J 3L73J 3L74J 1EZVI 3H1KJ 1BE3J 3CX5I 1SQXJ 3H1JJ 1P84I 2FYUJ 1SQQJ 3L70J 5KLVJ 3H1LJ 1SQBJ 4U3FJ 3H1HJ 1L0LJ 4PD4I 2BCCJ 1BGYJ 3CXHI 4D6TJ 1NTZJ 1KB9I 1KYOI 1SQVJ 1NTMJ 3TGUJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BCC J;  3BCC J;  3H1I J;  1NTK J;  1PP9 J;  1NU1 J;  3L75 J;  1SQP J;  1L0N J;  3CWB J;  3L71 J;  2IBZ I;  3L72 J;  3L73 J;  3L74 J;  1EZV I;  3H1K J;  1BE3 J;  3CX5 I;  1SQX J;  3H1J J;  1P84 I;  2FYU J;  1SQQ J;  3L70 J;  5KLV J;  3H1L J;  1SQB J;  4U3F J;  3H1H J;  1L0L J;  4PD4 I;  2BCC J;  1BGY J;  3CXH I;  4D6T J;  1NTZ J;  1KB9 I;  1KYO I;  1SQV J;  1NTM J;  3TGU J; 
#chains in the Genus database with same CATH topology
 4N78 E;  3GF3 A;  2RN0 A;  1S1C X;  3GHG B;  4RO0 A;  1OVV A;  1ZRT E;  4KT0 J;  3H1J E;  1AV1 A;  1LTA C;  1QVF O;  1G2C A;  2W6B A;  3Q5P A;  2W27 A;  1AVO A;  3MP7 B;  2ZYD A;  1L0N K;  1L0L J;  3MGN A;  2E74 B;  4NPF X;  3FGA D;  1SQP E;  2E76 D;  1SQX K;  1NTM J;  3CWB G;  1PGP A;  1LNQ A;  3HE4 A;  1HGZ A;  3L74 G;  1BE3 G;  5AW5 B;  3VP9 A;  1RE4 A;  3CX5 I;  1EDK A;  1JY3 P;  2E76 C;  2PRR A;  3MTU E;  1QEX A;  3EFF K;  1IFI A;  3G71 P;  2Y0D A;  3SFD C;  1VF5 B;  3IAO A;  3TNU A;  1YI2 P;  1HVV A;  1LTG C;  1NTK D;  2QG4 A;  2HFE D;  1Q2N A;  2FYU E;  3L72 J;  3H6P A;  3BAT A;  1J1E C;  3CCM P;  1FOS E;  3Q2Y A;  1K73 Q;  1URQ B;  3H1I E;  2AEM A;  1S4X A;  1SQX D;  1ZR2 A;  2FFD A;  3AE6 C;  3GF7 A;  5KLV D;  3PTZ A;  2Y0C A;  5E79 E;  2YKP A;  1IC2 A;  2I1K A;  1BGY J;  3SWF A;  4D6T J;  4DJG A;  1PP9 E;  2WSC J;  1KQF B;  1BCC D;  1OVR A;  1LT9 A;  2JWD A;  5APY A;  3B71 A;  3D71 A;  4IFM A;  1RHZ B;  5TIS E;  1U7J A;  4AQR D;  1IZN B;  1FU1 A;  1L0L E;  2NPS B;  1SQV K;  4M3L A;  1JY3 N;  5TIS H;  1YJW P;  1GL2 A;  4NPD A;  1NTM E;  1YQ3 C;  2HOD A;  4OWF A;  3C8V A;  1VQ4 P;  3WUV A;  1NU1 G;  5TJH A;  2GUV A;  2B87 A;  2AXT H;  1SQB K;  3L73 J;  2JO1 A;  3QWO C;  1UII A;  1CSB A;  3PP5 A;  3L72 E;  4JQ0 D;  3BAS A;  2P67 A;  2IYP A;  1WT6 A;  2YKO A;  1FZG A;  4GDO A;  2P7J A;  1ZRT D;  2K1A A;  2BEQ D;  2KLU A;  3HTK A;  4GKG A;  2W83 C;  1NTZ J;  5AVU B;  3BRT B;  3JSV C;  5BVZ A;  1SQP D;  2YKQ A;  3H1K G;  2YXR B;  1FJP A;  2K9J A;  3L4F A;  1HWT C;  2QJP B;  1BGY E;  4D6T E;  1W2E A;  1N2D C;  2N1T B;  5GTI H;  1N8R Q;  1RF1 B;  1AA0 A;  2ZYA A;  2WSC H;  1PFI A;  3CME P;  5BU5 A;  3VTP C;  3H32 B;  3PH0 A;  2OYH C;  2JDI H;  1FZE A;  1M1J B;  2I8D A;  2WSF J;  2WSE J;  4H13 D;  3HE4 B;  3GHG C;  2FYU D;  3L70 J;  2E74 D;  4GOE A;  1OW6 A;  5AW3 B;  2KB7 P;  4H13 C;  5AVQ B;  1FAV A;  3L73 E;  4IFF A;  3HRN A;  4GIF A;  2OYI C;  1NU1 J;  2E74 C;  3RK2 B;  3P8M C;  2ZVO B;  1T3U A;  1DIP A;  3A0H E;  2YMK A;  1KQG B;  1PL5 A;  3AEC C;  1SQQ J;  3A0H H;  2OGU A;  1VF5 D;  3S1K A;  2BCC G;  3SWK A;  3BVH A;  5APW A;  1R5S A;  1VQM P;  4N6J A;  2YXQ B;  3TGU G;  1YTZ I;  5AW4 B;  1L0N G;  1N73 B;  1VF5 C;  1IFD A;  2O3J A;  1NTZ E;  5BU8 B;  5APS A;  1L0L D;  2FFD B;  2D2C B;  1KB9 I;  4Z1M H;  4WBA A;  1S3J A;  5B5E H;  1URQ C;  1PPJ G;  3KPE A;  4Y28 J;  2YMY A;  1JMB A;  1LT9 B;  4BRY B;  3OAK A;  3A0B H;  4Y99 B;  2AXC A;  1GL2 B;  3H25 A;  1PZQ A;  2FYZ A;  3L72 D;  3L70 E;  2WSF H;  1EZV G;  2B87 B;  2FY8 A;  1KZU B;  1M1K Q;  4IOI H;  2E5Y A;  1EDL A;  1VQ9 P;  3FXD A;  1VQ8 P;  4BWN A;  1YHQ P;  1LWU C;  1SQQ E;  2Q3E A;  1BDD A;  2W8Z A;  2OYH A;  1LTI C;  1JY2 P;  2BCC J;  1BGY D;  2R44 A;  4D6T D;  3GHG A;  2G3A A;  1SQV G;  1W5C E;  2O1K A;  3HTK B;  3KZI E;  1OZH A;  3TGU J;  1OW7 A;  4I2L C;  2V7Q H;  2E76 B;  1L0N J;  5KJ7 C;  3KZI H;  1X8Y A;  4W7Z A;  2WTY A;  1FDM A;  2WMM A;  1SQX J;  2OYI A;  1VL2 A;  1T6A A;  1Y8A A;  2WPQ A;  2K9J B;  2QRX A;  1L4A D;  4H0L D;  1GU5 A;  1KFN A;  3NFQ A;  1BCC J;  1PIX A;  2FKW B;  3L73 D;  1BE3 D;  1IFJ A;  3PHL A;  3L36 A;  2Z5H A;  3V6I A;  3II6 A;  3TDK A;  1IO4 A;  2QJP C;  1KYO I;  1N7L A;  2R3S A;  3B8E B;  1HJ0 A;  1N7S D;  2N1T C;  1RF1 C;  2XDJ A;  3SFE C;  3U1A A;  5CCG C;  3VOP A;  2PFX A;  2L91 A;  2HR3 A;  3CC4 P;  3I56 P;  1KFM A;  1N7S C;  4OH8 B;  1BSH A;  1M1J C;  1IFN A;  1GK4 A;  1JY2 N;  2KUB A;  1NTZ D;  2KNC B;  4ZNC A;  2WZ7 A;  3AEF C;  1QGK B;  3RK2 D;  2R5B A;  3CL3 D;  3ABV C;  3OW2 O;  2KZJ A;  4C7N A;  3O6Q A;  4C7R A;  2BCC E;  3RK2 C;  4KJM A;  1KB9 E;  3TGU E;  1FZC B;  4DOJ A;  1L0N E;  2CK3 H;  1SQV J;  2K3R A;  1T3J A;  5CCH C;  1SQX E;  1ZP0 C;  4LC1 A;  3P8C E;  3CI9 A;  2QIW A;  4DCK A;  1S2E A;  3UIA A;  3GG2 A;  1LWU A;  1N73 C;  1S9K D;  4GOF A;  3HD7 D;  1SQB J;  1BCC E;  2GUS A;  4LLH A;  5AVR B;  3RGU A;  1NHL A;  2ITA A;  3OJA B;  5KAF E;  1U57 A;  1NU1 D;  2D2C C;  1YTZ T;  2RH0 A;  2ZT9 D;  5KJ7 A;  1SQQ D;  2XND H;  4QMA A;  4TT3 H;  1DX7 A;  2OTL P;  1RE3 C;  2ZT9 C;  4K35 A;  5APU A;  1KOR A;  4Y99 C;  1EZV E;  1RF0 C;  3QH9 A;  2CPB A;  1CW5 A;  3L35 A;  1JCD A;  3B4S A;  2LR2 A;  4I6M C;  4ZKU A;  3JC2 2;  3VMA A;  1ZME C;  1AQ5 A;  3FWN A;  5AVX B;  5L8R J;  3IR9 A;  4L74 A;  3NMD A;  2SPZ A;  1ZXG A;  2N1T A;  2Q6Q A;  3H1K D;  1BSN A;  1KMI Z;  1RF1 A;  4UB6 E;  1GZL A;  5CCG A;  1D7M A;  4H13 B;  4EIJ A;  4UB6 H;  3H32 A;  2OYI B;  1N7S A;  1MKM A;  3CCL P;  2P1J A;  3AEA C;  1M1J A;  3BCC G;  2PAJ A;  2IPP A;  4TLF A;  1LTJ B;  2VRS A;  4GT1 A;  1SQB E;  2PGD A;  1AVY A;  3AE8 C;  1Y47 A;  2HPC A;  1GDT A;  5CBN A;  4A7P A;  1S5L X;  2POH A;  1EDI A;  5CCH A;  2N9Y B;  2HLO A;  3S4R A;  4B86 A;  3IF4 A;  2BCC D;  2FXO A;  3O8Z A;  1Q7Y Q;  1N73 A;  3VP8 A;  2Z5I A;  1KB9 D;  2I1J A;  3TGU D;  1KN7 A;  2WQY C;  3E1R A;  1L0N D;  1LGH B;  1FZF A;  1BDC A;  3R2P A;  4C7N B;  3P8C D;  3MD0 A;  4H44 D;  3O6Q B;  1G1I A;  1X79 B;  3Q1M A;  5E79 H;  3B5N D;  3VN0 A;  4H44 C;  1PPJ D;  3L71 G;  4BRY A;  2NZ2 A;  3G4S P;  1RE3 A;  4PJ0 E;  1Z56 A;  1L2P A;  3MIW A;  4PJ0 H;  2M8R A;  3MHV A;  1RF0 A;  4JPZ B;  4PD4 I;  2KP8 A;  4XE5 B;  1LWU B;  2Y9Z A;  3A5T A;  5KTB A;  3C1L A;  1OX3 A;  1VQL P;  2A45 H;  1FZC C;  3CWB J;  3L74 J;  1BE3 J;  1EZV D;  1JUN A;  1S72 P;  2OYO A;  2KZI A;  2WT7 A;  1AFO A;  3CXH I;  1K05 A;  1GTW A;  3ZDM A;  2XNX A;  1DH3 A;  2V4H A;  4U3F G;  1LJ2 A;  3H1L G;  3A7O A;  5AVW B;  1SQV D;  1L4A B;  4H0L B;  2O1J A;  3RL0 D;  1KQL A;  2Q7C A;  4JBZ A;  3IFM A;  4HH2 A;  2WPS A;  1VQN P;  3TK1 A;  1P84 I;  2YIU C;  1ZW0 A;  2B9B A;  1SQB D;  2QM8 A;  3D6Y A;  2P10 A;  4ZKP A;  4PV1 D;  2XKM A;  3L75 G;  1NAY A;  1NVO A;  1N7S B;  4RES B;  3L71 J;  3LIE A;  3CX5 E;  2P2U A;  1VPC A;  2IBZ G;  4PV1 C;  2J59 M;  1XTG B;  2JJL A;  5CJ0 A;  1PGJ A;  3CX5 H;  2Q9I A;  3H1H G;  3CWB E;  1IFP A;  3L74 E;  3KDP B;  1BE3 E;  1EC5 A;  5KKZ B;  2IBZ I;  2HPC B;  1QX8 A;  1S5L E;  1DEE G;  1LTJ C;  2KNC A;  1A02 F;  3AEE C;  1S5L H;  3WUU A;  2JP3 A;  5AVV B;  1X0T A;  1VQ6 P;  1H88 A;  1NTK G;  4N3Y B;  2K9Y A;  1ZLL A;  5APQ A;  1FE6 A;  2KXP B;  5K5G B;  2OTJ P;  3P32 A;  1E79 H;  1FZC A;  3KYQ A;  1ZR4 A;  3RK3 D;  1Y9B A;  3H1L J;  2WSS H;  3HD7 B;  4HYT B;  2KSJ A;  3N7N A;  4HKZ H;  3PRJ A;  1H0T B;  3H1K J;  3KQG A;  3V2P A;  2ZT9 B;  1YYC A;  1JCC A;  1R5L A;  1EXJ A;  2NRG A;  2LXC B;  1S9K E;  5AW6 B;  2WSE H;  2FYN B;  3W68 A;  4OGQ D;  2ZXE B;  3CXH E;  3Q5S A;  1GMJ A;  3RBX A;  3D6Z A;  3H1H J;  5CJ4 A;  5B66 E;  4OVN F;  1NU1 E;  1FJK A;  1DEB A;  2W6A A;  2WT7 B;  5B66 H;  1HUC A;  3MUD C;  2LKM A;  1HBW A;  1OW8 A;  5EFW B;  1KTM A;  1LTT C;  1NH4 A;  1KQS O;  2BAS A;  2W6J H;  5DJU B;  5CMZ A;  3CCJ P;  2C0X A;  3AE2 C;  1LP1 B;  3SWY A;  4HB1 A;  3H1L E;  3H1J G;  3JCU E;  3CX5 D;  1VQ7 P;  1RQU A;  2CPS A;  2ZYG A;  1KIL D;  2LXB A;  3JCU H;  1NGM B;  2MKV A;  1LTJ A;  4EOT A;  3H1K E;  1SQP G;  2KOG A;  3CWB D;  1L4A C;  3L74 D;  2MJZ A;  4H0L C;  3U59 A;  3M9H A;  5CHX A;  1GU4 A;  2E75 B;  1EQ7 A;  3F5H A;  4L76 A;  1OIP A;  1NJI Q;  2KS1 B;  1QLE D;  1Q81 Q;  3LID A;  1HF9 A;  1OXZ A;  4NPE A;  1YJN P;  1Q90 D;  4K3A A;  1XTC C;  1FOS F;  4H44 B;  2QVA A;  2B88 A;  3KXD A;  1K04 A;  3H1I G;  5AVT B;  3L37 A;  3B5N B;  1J2J B;  1JM0 A;  5C39 A;  4I1L A;  2H89 C;  5KKZ C;  3T97 A;  2J58 A;  4PD4 D;  2UWJ E;  2IX7 C;  1KB9 H;  1RQV A;  1MFZ A;  1PP9 G;  4C46 A;  3L71 D;  1FS0 E;  4UB8 E;  4RKU J;  2JEE A;  1RY3 A;  1M7L A;  1QVG O;  2YNY A;  2QA4 P;  4UB8 H;  1ZN5 A;  2ZVN B;  3MUD A;  1L0L G;  4MN4 C;  2KK7 A;  1PPJ E;  1NTM G;  3CXH D;  3ITK A;  1LT1 A;  1HJB A;  2IFN A;  2Q3I A;  1GK6 A;  3IN6 A;  5APV A;  2QJY C;  3HD7 C;  4DZO A;  5KAF H;  2M3E A;  3RL0 g;  4EI2 A;  1FZA A;  2IYO A;  2WVR A;  4R4M A;  2A06 G;  4WB4 A;  4DT0 A;  4EDF A;  4W7Y A;  3RL0 B;  2YIU B;  3MZW B;  3A2A A;  1MZ9 A;  2H8P D;  1CI6 B;  2H88 C;  3V4W A;  1JOC A;  1L4A A;  5AW7 B;  3H1L D;  3E1I A;  2FYN C;  4R4L A;  1T8Z A;  3M06 A;  4PV1 B;  3H1I J;  3VYI A;  1JNM A;  1M90 Q;  1OVU A;  3I55 P;  3G6E P;  3V2R A;  1HH0 A;  2C9N Y;  1NTK K;  1SQV E;  1BGY G;  3LW5 J;  4IL6 X;  2PP6 A;  5M1B A;  2Q5U A;  3P7K A;  1PP9 J;  3L75 D;  1NYH A;  2IBZ D;  1QL1 A;  2QM7 A;  1T2K D;  1FZB A;  3H1H D;  1KYO E;  1M56 D;  1PV3 A;  1KYO H;  1KD1 Q;  2H7H A;  1T2K C;  2C0W A;  5AVS B;  5KLV K;  3L73 G;  3Q5R A;  4WY4 B;  2E75 D;  3V5B A;  4BXL A;  1MFT A;  3AE4 C;  3RK3 B;  3AEG C;  2E75 C;  2OAR A;  3AE3 C;  4AYC A;  4XA4 A;  2WPR A;  2WPV B;  2GA1 A;  1EXI A;  5CBO A;  3NXS A;  1K9M Q;  2Q1K A;  3HD7 A;  3HUS C;  4WWI A;  1NTZ G;  3WU2 E;  2HYN A;  1H0T A;  3T97 B;  2Y0E A;  3WU2 H;  3S9O A;  3RK3 E;  1MV8 A;  2E43 A;  1LTB C;  3B5N C;  4OGQ B;  3KHU A;  3LW5 H;  5APX A;  3V4Q A;  1GW3 A;  1IFM A;  3BCC J;  3CCE P;  1YIJ P;  3N4X A;  2M5A B;  4KHX A;  2KI7 B;  3L70 G;  2IDB A;  1JTH B;  1SQP K;  1QL2 A;  2AXT E;  3CCV P;  1FC2 C;  1IJD B;  3CCU P;  3GW6 A;  1YQ4 C;  2Y9Y A;  3CCQ P;  1SQQ G;  1USE A;  3NTN A;  2A06 E;  1NAF A;  2JKV A;  2O01 J;  1DD4 A;  2H43 A;  2L5G B;  4EYY Q;  1KIL B;  1LP1 A;  1AJY A;  4W80 A;  2E5T A;  2FYU K;  3G3Z A;  3M0D C;  1E5W A;  1JEK A;  5APT A;  3HE5 A;  2JWA A;  2QJK B;  4N78 D;  4IFD K;  5KLI C;  3H1J D;  5AW1 B;  1VQO P;  2HG5 D;  3RL0 C;  1NOH A;  4I7Z C;  3A3Y B;  4L75 A;  1ZV8 A;  2ZXX A;  2J5U A;  3USS A;  1KYO D;  1R8E A;  2M0B A;  4IL6 E;  3GMA A;  5GTI E;  1VQ5 P;  2FXM A;  2C9L Y;  1KIL E;  4IL6 H;  3FX0 A;  1H89 A;  2FBW C;  2KS1 A;  5KAI E;  3M9Q A;  1G2C B;  1SP4 A;  1TU3 F;  1X22 A;  3BCC E;  4GOD A;  1SFC D;  5KAI H;  2IZ1 A;  3HUS A;  4O9B A;  3M91 A;  2AEJ A;  2ZAE B;  1J1D C;  3CC7 P;  1L0L K;  1SFC C;  3M9B A;  2GM4 A;  1JY3 O;  2W90 A;  1NTM K;  1GD2 E;  2KIK A;  2QE7 H;  3V2N A;  4LGD E;  4YPC A;  3D70 A;  5AW9 B;  3B5N A;  1WRG A;  3EFG A;  2JR8 A;  3H1I D;  3AED C;  5GTH E;  3TNU B;  4WY4 D;  3R4Y A;  1CZQ A;  5GTH H;  4ZMD A;  4YXW H;  3CCS P;  1HTL C;  1RH5 B;  4U3F J;  2O01 H;  4WY4 C;  3W67 A;  1PGQ A;  4ASW A;  4WVZ A;  2QJY B;  1NKZ B;  3EQ2 A;  3WUT A;  2V7Q J;  1FDI A;  1PP9 D;  1WMK A;  3RK3 C;  1SQX G;  2WIT A;  1URQ D;  1NWQ A;  3Q3D A;  4PD4 E;  1PGO A;  2QSI A;  5KLV G;  5B5E E;  2O01 N;  3FXE A;  3AE1 C;  1DD3 A;  4PD4 H;  1OWA A;  2P58 A;  1H8A A;  2Z4E A;  3L71 E;  1NTM D;  1BCC G;  1GW4 A;  3L75 J;  2WWW A;  1K8A Q;  3A0B E;  1YBK A;  3M0D A;  2B89 A;  2N9B A;  2FXP A;  3V2Q A;  2A06 D;  4HJG H;  3CXH H;  1FDO A;  4OGQ C;  2KLV A;  2HOD B;  3VMX A;  1CI6 A;  2RKL A;  1N86 A;  2NPS D;  3TF5 A;  3AE7 C;  3CMA P;  1OFC X;  5AW2 B;  1Q86 Q;  4XFJ A;  2NPS C;  4U7J A;  1IK7 A;  1UIX A;  1A02 J;  1M57 D;  3CD6 P;  5H2F E;  1JB0 J;  2ZFC A;  3CLQ A;  3VMZ A;  2OQQ A;  1NTK J;  3AE9 C;  1VQK P;  5H2F H;  2QEX P;  1YIT P;  1VDF A;  1EZV I;  4U3F E;  1P84 E;  1LTS C;  2IZ0 A;  1EDJ A;  1SFC A;  1P84 H;  3HE5 B;  5KJ7 D;  3E7K A;  2IFM A;  4JYB A;  1W2B O;  4YXD C;  3BCC D;  1IK9 A;  1KIL C;  1NTZ K;  3CCR P;  2KSE A;  1Q82 Q;  1SQB G;  4ASV A;  5KLV J;  2KYV A;  2QJK C;  5AW0 B;  1KC8 Q;  3L75 E;  3M0A A;  4WY4 A;  2IBZ E;  2ZJS E;  3C9I A;  1J1E B;  1ZOY C;  3HUS B;  1M8O B;  2RMZ A;  2N1T D;  3FWL A;  3H1H E;  2XU6 A;  2FYU G;  3I5C A;  1KV4 A;  5CCG D;  3AE5 C;  3CC2 P;  3TSI A;  4JYC A;  1JO5 A;  5AW8 B;  3BRV B;  1URQ A;  4RJT A;  1YJ9 P;  4CPG A;  2YO3 A;  3OA7 A;  1NU1 K;  1FBM A;  1X9V A;  1NTK E;  2XZR A;  1NO4 A;  4JF7 A;  1MUU A;  3EWK A;  5DJT B;  1RE4 C;  1SQQ K;  3VMY A;  3H1J J;  5CCH D;  2M3B A;  1HGV A;  2R5D A;  2M5A A;  2A45 G;  2NPS A;  2R3C A;  3AEB C;  1SQP J;  1JTH A;  5KLV E;  3RBZ A;  3G9R A;  3GLM A;  5AVZ B;  2XV5 A;  3L70 D;  2D2C D;  2DW3 A;  3PJS K;  4L73 A;  2BEZ F;  2A45 I;  1NKN A;  3K5B A;  2YO2 A;  2FFD C;  5KLI B;  2AEF A;  3L72 G;  3CPW O;  1VQP P;  2G8Y A;  3WMM 0;  2OTK E;  4I7Z B;  1OMI A;  2FYU J;  1KIL A;  4U3F D;  5AVY B;  1P84 D;  1G1J A;  1LT9 C;  1GL2 D;  4AUW A;  2K37 A;  3F89 A;  3TYY A;  3SSU A;  1AQT A;  3U1C A;  3PLN A;  1USD A;  1GL2 C;  1SLQ A;  2K88 A;  1SS1 A;  1JY2 O;  4D6T G;  2OYH B;  2R32 A;  2E42 A;  1J1D B;  1U7M A;  1SFC B;  1SVF A;  4YTP C;  1JMM A; 
#chains in the Genus database with same CATH homology
 1BCC J;  3BCC J;  3H1I J;  1NTK J;  1PP9 J;  1NU1 J;  3L75 J;  1SQP J;  1L0N J;  3CWB J;  3L71 J;  2IBZ I;  3L72 J;  3L73 J;  3L74 J;  1EZV I;  3H1K J;  1BE3 J;  3CX5 I;  1SQX J;  3H1J J;  1P84 I;  2FYU J;  1SQQ J;  3L70 J;  5KLV J;  3H1L J;  1SQB J;  4U3F J;  3H1H J;  1L0L J;  4PD4 I;  2BCC J;  1BGY J;  3CXH I;  4D6T J;  1NTZ J;  1KB9 I;  1KYO I;  1SQV J;  1NTM J;  3TGU J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...