3CXSA

Crystal structure of human gna1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
182
structure length
181
Chain Sequence
MKPDETPMFDPSLLKEVDWSQNTATFSPAISPTHPGEGLVLRPLCTADLNRGFFKVLGQLTETGVVSPEQFMKSFEHMKKSGDYYVTVVEDVTLGQIVATATLIIEHKFIHSCAKRGRVEDVVVSDECRKQLGKLLLSTLTLLSKKLNCYKITLECLPQNVGFYKKFGYTVSEENYMCRRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucosamine 6-phosphate N-acetyltransferase
publication title Acceptor substrate binding revealed by crystal structure of human glucosamine-6-phosphate N-acetyltransferase 1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 41
structure length 181
sequence length 182
ec nomenclature ec 2.3.1.4: Glucosamine-phosphate N-acetyltransferase.
pdb deposition date 2008-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3cxsA01
4OAEA 3QB8A 1IICA 1NE9A 2VI7A 1RXTA 2ZW6A 3H4QA 4AG9A 4CS0B 3D8PA 4H6ZA 1NMTA 3EO4A 4MJ8A 1L0CA 2R1IA 2HUZA 4II9A 4MHDA 2OZHA 1YX0A 4YGOA 5H86A 2D4PA 4XPDC 3N7ZA 5EBVA 4KOYA 4UWJA 2VEZA 5EC4A 5DWMA 1I21A 3D2MA 2P6GA 3TTHA 4OADA 2JEVA 2F5IA 4YFJA 5HH1A 4XPDB 4PSWA 2BL1A 4LX9A 2QECA 2P6EA 4KOTA 2Z0ZA 1Y9KA 1WK4A 2K5TA 4KOVA 4AVAA 3G3SA 2REFA 4UA3A 1M1DA 1YREA 4JXRA 3E0KA 4R87A 2B4DB 5KTAA 4F6AA 1S5KA 1YR0A 4Y49B 2HQYA 4KUBA 3SHPA 5F49A 3KKWA 2J8MA 2HV2A 2KCWA 4HNYB 2FXFA 5C88A 3LD2A 3PGPA 3R95A 4X5KA 2PSWA 2WPXA 1Z4RA 2EVNA 5CNPA 2PQ8A 2CNSA 4R3KA 4KORA 2EUIA 4H6UA 2OU2A 1Y7RA 2ZW5A 4AG7A 2BEIA 4CAXA 4XPKA 2VZZA 1KZFA 2C27A 3EY5A 4XNHC 3UY5A 2PC1A 1MJ9A 5J8FA 2Q7BA 2B3VA 1S7LA 1IIDA 2B5GB 1NSLA 3GYAA 4CAVA 4KVME 3B8GA 4ZBGA 5I0CA 2B5GA 4L89A 4QBJA 1FY7A 4U9ZA 1QSTA 4XNHB 4AB7A 2R7HA 3OWCA 4R3LA 3BJ8A 1ON0A 2FL4A 2WPWA 1YLEA 1R57A 4HKFA 4CRYB 1YVKA 1YVOA 1S7FA 2Q0YA 3CXPA 4ORFA 4RS2A 4DNCA 3SXOA 1U6MA 1K4JA 3C26A 2AE6A 3ZJ0A 2B3UA 3K9UA 5DWNA 4KLWA 3WR7A 1TIQA 3CXSA 4NCZA 4EVYA 5KTDA 2J8NA 1MJBA 2Q4VA 1VHSA 1BO4A 3VWDA 4NSQA 4JWPA 4JJXA 2FE7A 1KUYA 3I9SA 4F0YA 4H89A 1QSNA 4KOUA 4QVTA 5GCNA 2JDCA 3DR6A 3FIXA 4RI1A 2Q4YA 4JD6A 3W6XA 4KVOE 2P6FA 3R9FA 5HMNA 2Q44A 1M4GA 1CJWA 3EFAA 2GIVA 4LUAA 1LRZA 4JXQA 4HNWB 4B5PB 3FXTA 1GHEA 2BUEA 4HNXB 4MI4A 2ZXVA 3IWGA 4B5PA 1J4JA 2FIAA 1IB1E 4KUAA 5IV0A 4YRHA 3I3GA 3P2FA 3DDDA 1RO5A 2OZUA 4K30A 3SXNA 4L8AA 1PUAA 1N71A 1QSRA 1XF8A 3T90A 1CM0A 2P0WA 4GS4A 3PP9A 2CY2A 2B4BA 3JUWA 2PR1A 5F47A 1S60A 4U9YA 2B58A 2QIRA 2ZW4A 4MY0A 5F46A 2FSRA 4BMHA 3F5BA 3FRMA 5JPHA 2AJ6A 1SQHA 2CNTA 4U5YA 3JVNA 3R96A 2J8RA 3QAHA 1XE4A 2PDOA 4KVXA 1Z4EA 2REEA 1XMTA 5KTCA 1S7KA 3S6FA 3W6SA 2PRBA 3PZJA 3TFYA 4CAWA 1I1DA 1S7NA 3LODA 1OZPA 2VZYA 3BJ7A 4PK3A 1VKCA 2X7BA 2O28A 3F8KA 3TT2A 3S6KA 4MBUA 2R8VA 5ISVA 4UBRA 4E8OA 4KLVA 2OH1A 1Q2DA 3FYNA 5F48A 1V0CA 2G3TA 4FD6A 4CRZB 4J3GA 1M4IA 4KOSA 4NF1A 1B87A 2BSWA 3RYOA 2QMLA 4KZTA 1M4DA 1XIXA 4IF5A 2IL4A 3D2PA 3R9GA 1MJAA 4E0AA 1Z9UA 5C82A 2RC4A 4QUSA 2OB0A 2VBQA 3S6HA 1IYLA 3GY9A 3MGDA 2D4OA 2I79A 2G3AA 4IUSA 3P2HA 3EXNA 1P4NA 3TO6A 2VXKA 3NE7A 4KOWA 1PU9A 2GE3A 2A4NA 1QSMA 2FT0A 3FNCA 3TOAA 3FBUA 5JQ4A 2FCKA 4FD4A 2G0BA 2H5MA 2OZGA 4OLLA 3FB3A 1I12A 3ZZIA 3IGRA 4MY3A 1KUXA 2R98A 3VWEA 1Q2YA 4FD7A 4QC6A 3DSBA 3S6GA 3TE4A 2ARHA 4Y49C 5IX3A 3D3SA 3F0AA 4PV6A 1S3ZA 4XPLA 3TOBA 2ATRA 1Y9WA 4PK2A 2Z10A 1IYKA 3DR8A 3EC4A 4M85A 4QB9A 1UFHA 4B5OA 3DNSA 1KUVA 4R57A 3W91A 2B4DA 2FS5A 2VQYA 3CXQA 3TCVA 2Y0MA 4AVBA 1YK3A 4M3SA 4ONUA 2GANA 1B6BA 4UWIA 3GKRA 5H84A 2NMTA 2I00A 2CNMA 4E2AA 1P0HA 1M44A 5IB0A 3T9YA 2JDDA 3G8WA 1YGHA 2Z11A 2ZW7A 3BLNA 3TO7A 4AVCA 2ZPAA 3TO9A 1WWZA 1QSOA 2PR8A 1XEBA 2DXQA 5FVJA 4KOXA 3V8IA 1MK4A 2JLMA 2FIWA 4NXYA 4R9MA 4FD5A 4NEXA 4JLYA 4PSXA 5E96A 1Q2CA 3R1KA 4I49A 5J8CA 2Q04A 1BOBA 3R9EA
chains in the Genus database with same CATH superfamily
3D68A 4OAEA 3QB8A 1IICA 1NE9A 2VI7A 4OKOA 1RXTA 4MCSA 4CAXA 2ZW6A 3H4QA 4MFPA 4GM5A 3D8PA 4H6ZA 4JYWA 2C6CA 2PJ7A 4MFZA 4OP4A 4CS0B 4ZI6A 5HVFA 1NMTA 4RUHA 3EO4A 2O4HA 4MJ8A 1F57A 4C2YA 1L0CA 1QMUA 2R1IA 2HUZA 2Z3OA 4MHDA 4II9A 2BOAA 2AFMA 2OZHA 1YX0A 2PRQA 3BI0A 4YGOA 5H86A 1TF8A 2D4PA 3NE8A 1X12A 3N7ZA 4XPDC 4ZX9A 4C2ZA 5EBVA 2CIJA 4UFVA 1TF9A 4KOYA 4UWJA 2VEZA 4EMEA 1DTDA 5EC4A 4UIAA 5DWMA 1I21A 4CYNA 4AXVA 2VL1A 3D2MA 5G22A 2P6GA 4MFKA 2J9AA 4BINA 2XEJA 4B14A 1Y0YA 3TTHA 4DJLA 2EWBA 4MHPA 1ARMA 3NFZA 2Q51A 3BI1A 1HEEA 4NJRA 4OADA 4MHYA 3WC6A 2JEVA 3GUXA 2F5IA 2PJ4A 4YFJA 4B6ZA 5K8NA 3IO1A 2C6PA 2AFUA 4B13A 2O53A 5HH1A 4XPDB 1IOFA 2C6GA 4Z65A 1ARLA 1M4LA 4PSWA 3WC5A 4F9UA 4R6TA 2BL1A 3D7GA 3D4UA 2Z3LA 2GFQA 4HPSA 4LX9A 1X10A 5AGEA 1Z8TA 3A9LA 3IJ3A 3HUVA 3FEDA 4NGMA 4P45A 2QECA 3NH4A 2P6EA 4KOTA 4O23A 2Z0ZA 1WK4A 1Y9KA 2K5TA 4KOVA 1LFWA 4PXBA 4AVAA 1PYTB 3G3SA 4TNUA 4CAEA 2REFA 2ZEOA 1BAVA 1KWMA 4UA3A 5EMIA 4F0XA 1XFOA 4A30A 4YU9A 1M1DA 1YREA 1XRYA 4JXRA 3E0KA 4P4IA 4R87A 2B4DB 3IIBA 4FBEA 5KTAA 3IEHA 1TKJA 1A2ZA 1YW4A 3KHXA 1TKHA 4F6AA 1S5KA 1YR0A 5G21A 1ZLIA 4UEZA 4Y49B 3GIUA 2HQYA 4KUBA 3SHPA 2Q7SA 2GLJA 5F49A 3KKWA 2J8MA 4A32A 3PB4X 1QQ9A 4P10A 4PXEA 2HV2A 3VH9A 3D7DA 2KCWA 4NJQA 1AUGA 4HNYB 2FXFA 4A2ZA 2WSAA 3KZWA 3LD2A 1IGBA 3PGPA 3R95A 2DEAA 5C88A 1ZLHA 4NGNA 3GLJA 4BD9A 4UCPA 4P4BA 4X5KA 2PSWA 2WPXA 1Z4RA 2EVNA 4MHNA 2PQ8A 2CNSA 4R3KA 5CNPA 2Z3MA 3WT4A 4B10A 4CYQA 5HXDA 3CZXA 4KORA 3KR5A 4CGOA 2EUIA 4H6UA 2XEIA 3V38A 2OU2A 2YNCC 2YNDA 1Y7RA 4BBHA 2ZW5A 4MFQA 4AG7A 2BEIA 3IWWA 3KHZA 3JTKA 2ODFA 2RFHA 2VZZA 3IU2A 4XPKA 3SI1A 3S9NA 3BXMA 1AMPA 3LACA 2PJ9A 3H8GA 1KZFA 2C27A 1Z2LA 3EY5A 4P4DA 1LAPA 4UIBA 4XNHC 3UY5A 2PC1A 1JQGA 1MJ9A 4ZYQA 5J8FA 2GREA 3B7IA 2Q7BA 4UFXA 2GU2A 1CP6A 1F2OA 4FUUA 4NGQA 2B3VA 3PB8X 1S7LA 2PVWA 4MHZA 3WABA 1IIDA 4KS9A 2ZENA 4ZY1A 2B5GB 1NSLA 3GYAA 5K8PA 4CAVA 2AFSA 4GXHA 4OC1A 1VHOA 2JBKA 2V8DA 2ZEMA 4KVME 5AG5A 3KQXA 1LCPA 2QVPA 3B8GA 4ZBGA 2YNCA 5I0CA 2B5GA 2PVVA 3FEEA 4L89A 4CGLA 4QBJA 1FY7A 4U9ZA 4CYPA 1QSTA 4XNHB 4AB7A 2R7HA 3OWCA 4R3LA 4DUKA 3BJ8A 5LYLA 3PFOA 1LANA 1ON0A 4OC0A 2FL4A 2WPWA 2IQ6A 4NGSA 3DGVA 1YLEA 1R57A 4HKFA 4CRYB 1YVKA 2PJAA 3LMSA 2F7VA 1YVOA 1S7FA 2Q0YA 3CXPA 4ORFA 4R8FA 4RS2A 5D8NA 3SXOA 1U6MA 4DNCA 4OC5A 1K4JA 3C26A 4F8ZA 2YNEA 2AE6A 3RAMA 3ZJ0A 2B3UA 4CAFA 5K8MA 2PCUA 3K9UA 5DWNA 1CX8A 3QNVA 4KLWA 3WR7A 1TIQA 3CXSA 4NCZA 4EVYA 5KTDA 2J8NA 1YW6A 3FH4A 1MJBA 2Q4VA 1VHSA 1BO4A 3VWDA 4A95A 3ISZA 1VGYA 4NSQA 3NH8A 4JWPA 4JJXA 3SI0A 3VATA 3HLPA 2FE7A 3SJFA 1KUYA 3RNZA 2HB6A 3I9SA 3MN8A 4R76A 1IOIA 4H89A 4F0YA 1QSNA 4KOUA 4QVTA 5AG6A 5ELYA 5GCNA 4ZGYB 2JDCA 3DR6A 3FIXA 4P4FA 5LRKA 4RI1A 2Q4YA 4PQAA 4P44A 2PJ3A 4JD6A 3W6XA 4KVOE 4A37A 2P6FA 3PB6X 3R9FA 5HMNA 2Q44A 1M4GA 2RB7A 4MMOA 1CJWA 3EFAA 3PBBA 1JWQA 2PIYA 1FT7A 2V8HA 1VIXA 4KSFA 2GIVA 4LUAA 4MCPA 1LRZA 4JXQA 2XEGA 3B2YA 4OC3A 4UEEA 2GLFA 4HNWB 4B5PB 1Z8XA 3FXTA 4NGPA 1GHEA 2BUEA 4HNXB 3IU1A 4MI4A 4A31A 3KGQA 5AG7A 1CPXA 2Q43A 2OR4A 2ZXVA 3IWGA 3LWUA 1YSJA 4TWEA 4B5PA 3WC7A 1J4JA 2FIAA 1IB1E 4KUAA 4A38A 5IV0A 4W9YA 4NGTA 4YRHA 3FX6A 3I3GA 2PIZA 8CPAA 3P2FA 3DDDA 2ZEPA 1RO5A 2OZUA 4M6IA 4K30A 3TC8A 3PBEA 3SJGA 3SXNA 2DF5A 4L8AA 1PUAA 1N71A 1QSRA 1YMEA 4H2KA 1XF8A 3T90A 4WWVA 1CM0A 2Z3PA 2P0WA 4UFWA 3IFEA 5JM6A 1BPMA 3BHXA 4MCQA 2CY2A 3PP9A 4GS4A 2B4BA 3JUWA 4IAVA 2AFWA 2PR1A 4OC4A 5F47A 1S60A 4U9YA 3RBUA 4K3NA 3DLJA 2B58A 2I3CA 2QIRA 5D29A 4CGPA 3FVLA 3KI9A 2ZW4A 4MY0A 2WZNA 4JZ0A 2FSRA 5F46A 4BMHA 1ZG9A 2EK8A 2V8GA 3TX8A 3F5BA 3PFEA 6CPAA 2PJCA 3SI2A 3FRMA 5JPHA 1AYEA 2FVGA 2EBJA 2AJ6A 4X8IA 2PJ6A 2V8VA 3S9LA 2YGWA 1SQHA 2CNTA 1DE4C 3KQZA 4U5YA 3IWEA 5DS0A 3JVNA 3R96A 2J8RA 3FF3A 3QAHA 1XE4A 2PDOA 4UCNA 4KVXA 1Z4EA 7CPAA 3B3SA 2REEA 1XMTA 4IHMA 5KTCA 1S7KA 3H8EA 2BCOA 3S6FA 4OIDA 3W6SA 2PRBA 3D66A 2ANPA 3PZJA 3QAYA 3NH5A 4NGRA 4X2TA 3TFYA 2NSMA 2PJ2A 2OOTA 4CAWA 1I1DA 1S7NA 3LODA 2C1CA 5IB9A 1OZPA 3B3VA 2VZYA 3BJ7A 4PK3A 4P4JA 5LYDA 5BWAB 1VKCA 5JGFA 2ABZA 2X7BA 2O28A 2XEFA 4Q7AA 3B3TA 3F8KA 3TT2A 3S6KA 1R43A 4MBUA 3RZAA 2HC9A 1CP7A 4CYOA 5LRJA 4OIWA 2R8VA 5ISVA 5THWA 3NA6A 1OBRA 4UBRA 4E8OA 4KLVA 2OH1A 1Q2DA 2F8HA 3FYNA 3ISXA 5F48A 2ZOFA 1CPSA 1V0CA 4ZY0A 2Z3KA 1XBUA 2G3TA 4FD6A 1CG2A 1Z8WA 3K9TA 2PJ5A 2PJ0A 4CRZB 1BPNA 3T8WA 4J3GA 1M4IA 1Z5RA 1ZG7A 1EE3P 4KOSA 4NF1A 1F2PA 1B87A 4PXCA 2BSWA 3RYOA 3KL9A 2QMLA 2JEWA 4LQGA 1XOVA 1XMBA 4KZTA 4CPAA 1M4DA 1HDUA 1XIXA 4IF5A 2IL4A 3D2PA 4PXDA 2V77A 4MFJA 5G20A 3R9GA 3I1UA 1MJAA 4M6HA 4E0AA 1Z9UA 4RN7A 5C82A 2RC4A 4QUSA 2OB0A 2VBQA 1YLOA 4AG9A 1UWYA 5LYIA 1IYLA 3S6HA 3RO0A 4FWUA 5HVGA 3SJEA 1ZG8A 3B3CA 3GY9A 3MGDA 1YQEA 3PB9X 2D4OA 2G9DA 2G3AA 2I79A 1Y0RA 3KASA 1RTQA 4IUSA 4A94A 3P2HA 4CGNA 3EXNA 1P4NA 2DPSA 3TO6A 2PJBA 3D7FA 5HVHA 1CBXA 3V7ZA 2VXKA 3NE7A 4KOWA 1PU9A 3CT9A 1PCAA 2A4NA 2GE3A 5LYFA 1QSMA 2FT0A 3FNCA 5K8OA 5JH9A 1TXRA 3SJXA 2IJZA 1R3NA 2AFOA 3TOAA 4EWTA 3FBUA 3PB7X 2PE3A 2FCKA 3KR4A 5JQ4A 3FMCA 4FD4A 4P4EA 5A27A 2G0BA 2H5MA 2OZGA 4Q38A 4OLLA 1GYTA 1Z8LA 3FECA 3FB3A 4UCMA 1XJOA 2PJ1A 2ZEEA 4ZX8A 1I12A 3ZZIA 3D7HA 2ZOGA 1IU8A 3H5ZA 3IGRA 4MY3A 1KUXA 1NSAA 2R98A 1Q2YA 2ZEDA 4OC2A 3VWEA 4A33A 4EFDA 4FD7A 3PRTA 3VARA 4KSIA 4QC6A 3DSBA 3S6GA 2ZELA 4ONWA 2NYQA 3TE4A 2ARHA 4Y49C 1ELMP 5IX3A 3D3SA 3F0AA 1LOKA 2AFXA 4PV6A 1HDQA 1S3ZA 4UEFA 4XPLA 3TOBA 2ATRA 4C7IA 1Y9WA 4PK2A 2Z10A 4IK2A 1IYKA 3DR8A 3EC4A 4KSAA 4M85A 4QB9A 2EO8A 1UFHA 4B5OA 3DNSA 3S9MA 1KUVA 4A39A 3PEIA 1BLLE 2CTCA 1ELLP 4R57A 4ZY2A 1ZO0A 4FAIA 1H8LA 3W91A 2B4DA 2Q4ZA 2FS5A 4C2XA 5CBMA 3B35A 4WJBA 2ZEHA 3CPAA 2VQYA 3CXQA 4OMEA 5F09A 3TCVA 4Q36A 2Y0MA 3R9EA 1FNOA 4AVBA 2DPTA 1YK3A 2QYVA 4MFLA 4M3SA 3IC1A 1Y7EA 4ONUA 5CPAA 2WYRA 2PJ8A 2AFZA 4B11A 4NFRA 3H8FA 2EK9A 4YWYA 2GANA 1B6BA 4R7MA 4PPZA 3FJUA 4UWIA 3GKRA 2BO9A 5H84A 1LAMA 2NMTA 5LRGA 4DYOA 4F9VA 2I00A 4B12A 2CNMA 5G1ZA 3D67A 5I4MA 3K2KA 4E2AA 1P0HA 1M44A 5IB0A 3T9YA 2JDDA 2Z3NA 3G8WA 4G1PA 2POKA 3B3WA 1YGHA 2Z11A 2CTBA 2ZW7A 3BLNA 2QJ8A 3TO7A 4AVCA 2ZPAA 3TO9A 1QSOA 1WWZA 2PR8A 1XEBA 2DXQA 2WUUA 3GB0A 4UF4A 4KOXA 4P6YA 4LQ6A 5FVJA 3JRUA 2CXAA 4C68A 5AG4A 2IMOA 5A28A 1Q7LA 4MXUA 3V8IA 2ZEFA 3CDXA 1IY7A 1VHEA 4C7HA 1MK4A 2CF4A 2JLMA 4M6GA 2FIWA 4NXYA 4R9MA 4FD5A 1TKFA 2JBJA 3N5FA 4JLYA 4NEXA 4PSXA 3MRUA 4X3RA 5J1QA 2ZEGA 4MCRA 3CPXA 5E96A 1Q2CA 3R1KA 4I49A 4MRIA 5J8CA 2Q04A 1BOBA 3L2NA 4CGMA
chains in the Genus database with same CATH topology
4OAEA 3QB8A 1IICA 1NE9A 2VI7A 1RXTA 2ZW6A 3H4QA 4MFPA 4AG9A 3D8PA 4H6ZA 4CS0B 4MFZA 1NMTA 3EO4A 4MJ8A 4C2YA 1L0CA 2R1IA 2HUZA 2Z3OA 4MHDA 4II9A 2OZHA 1YX0A 4YGOA 5H86A 2D4PA 4XPDC 3N7ZA 4C2ZA 5EBVA 4UFVA 4KOYA 4UWJA 2VEZA 5EC4A 5DWMA 1I21A 4CYNA 3D2MA 5G22A 2P6GA 4MFKA 4B14A 3TTHA 4OADA 2JEVA 2F5IA 4YFJA 4B13A 5HH1A 4XPDB 4PSWA 2BL1A 2Z3LA 4LX9A 5AGEA 3A9LA 2QECA 2P6EA 4KOTA 2Z0ZA 1Y9KA 1WK4A 2K5TA 4KOVA 4AVAA 3G3SA 4CAEA 2REFA 4UA3A 4F0XA 4A30A 1M1DA 1YREA 4JXRA 3E0KA 4R87A 2B4DB 5KTAA 4F6AA 1S5KA 1YR0A 5G21A 4Y49B 2HQYA 4KUBA 3SHPA 5F49A 3KKWA 2J8MA 4A32A 2HV2A 2KCWA 4HNYB 2FXFA 4A2ZA 2WSAA 3LD2A 3PGPA 3R95A 5C88A 4UCPA 4X5KA 2PSWA 2WPXA 1Z4RA 2EVNA 5CNPA 2PQ8A 2CNSA 4R3KA 4B10A 2Z3MA 4CYQA 4KORA 4CGOA 2EUIA 4H6UA 2OU2A 2YNCC 2YNDA 1Y7RA 4BBHA 2ZW5A 4MFQA 4AG7A 2BEIA 4CAXA 4XPKA 3JTKA 2VZZA 3IU2A 1KZFA 2C27A 3EY5A 4XNHC 3UY5A 2PC1A 1MJ9A 5J8FA 2Q7BA 4UFXA 2B3VA 1S7LA 1IIDA 4KS9A 2B5GB 1NSLA 3GYAA 4CAVA 5AG5A 4KVME 3B8GA 4ZBGA 2YNCA 5I0CA 2B5GA 4L89A 4CGLA 4QBJA 1FY7A 4U9ZA 4CYPA 1QSTA 4XNHB 4AB7A 2R7HA 3OWCA 4R3LA 3BJ8A 1ON0A 2FL4A 2WPWA 1YLEA 1R57A 4HKFA 4CRYB 1YVKA 1YVOA 1S7FA 2Q0YA 3CXPA 4ORFA 4RS2A 4DNCA 3SXOA 1U6MA 1K4JA 3C26A 2YNEA 2AE6A 3ZJ0A 4CAFA 2B3UA 3K9UA 5DWNA 4KLWA 3WR7A 1TIQA 3CXSA 4NCZA 4EVYA 5KTDA 2J8NA 1MJBA 2Q4VA 1VHSA 1BO4A 3VWDA 4A95A 4NSQA 4JWPA 4JJXA 2FE7A 1KUYA 3I9SA 4F0YA 4H89A 1QSNA 4KOUA 4QVTA 5AG6A 5GCNA 4ZGYB 2JDCA 3DR6A 3FIXA 4RI1A 2Q4YA 4JD6A 3W6XA 4KVOE 2P6FA 3R9FA 5HMNA 2Q44A 1M4GA 1CJWA 3EFAA 4KSFA 2GIVA 4LUAA 1LRZA 4JXQA 4HNWB 4B5PB 3FXTA 1GHEA 2BUEA 4HNXB 3IU1A 4MI4A 4A31A 5AG7A 2ZXVA 3IWGA 4B5PA 1J4JA 2FIAA 1IB1E 4KUAA 5IV0A 4YRHA 3I3GA 3P2FA 3DDDA 1RO5A 2OZUA 4K30A 3SXNA 4L8AA 1PUAA 1N71A 1QSRA 1XF8A 3T90A 1CM0A 2Z3PA 2P0WA 4UFWA 4GS4A 3PP9A 2CY2A 2B4BA 3JUWA 2PR1A 5F47A 1S60A 4U9YA 2B58A 2QIRA 4CGPA 2ZW4A 4MY0A 5F46A 2FSRA 4BMHA 3F5BA 3FRMA 5JPHA 2AJ6A 2YGWA 1SQHA 2CNTA 4U5YA 3IWEA 3JVNA 3R96A 2J8RA 3QAHA 1XE4A 2PDOA 4UCNA 4KVXA 1Z4EA 2REEA 1XMTA 5KTCA 1S7KA 3S6FA 3W6SA 2PRBA 3PZJA 3TFYA 4CAWA 1I1DA 1S7NA 3LODA 1OZPA 2VZYA 3BJ7A 4PK3A 5BWAB 1VKCA 2X7BA 2O28A 3F8KA 3TT2A 3S6KA 4MBUA 4CYOA 2R8VA 5ISVA 4UBRA 4E8OA 4KLVA 2OH1A 1Q2DA 3FYNA 5F48A 1V0CA 2Z3KA 2G3TA 4FD6A 4CRZB 4J3GA 1M4IA 4KOSA 4NF1A 1B87A 2BSWA 3RYOA 2QMLA 4KZTA 1M4DA 1XIXA 4IF5A 2IL4A 3D2PA 5G20A 4MFJA 3R9GA 1MJAA 4E0AA 1Z9UA 5C82A 2RC4A 4QUSA 2OB0A 2VBQA 3S6HA 1IYLA 3GY9A 3MGDA 2D4OA 2I79A 2G3AA 4IUSA 4CGNA 3P2HA 3EXNA 1P4NA 2DPSA 3TO6A 2VXKA 3NE7A 4KOWA 1PU9A 2GE3A 2A4NA 1QSMA 2FT0A 3FNCA 3TOAA 3FBUA 5JQ4A 2FCKA 4FD4A 5A27A 2G0BA 2H5MA 2OZGA 4Q38A 4OLLA 3FB3A 4UCMA 1I12A 3ZZIA 3H5ZA 3IGRA 4MY3A 1KUXA 2R98A 3VWEA 1Q2YA 4A33A 4FD7A 4QC6A 3DSBA 3S6GA 3TE4A 2ARHA 4Y49C 5IX3A 3D3SA 3F0AA 4PV6A 1S3ZA 4C7IA 4XPLA 3TOBA 2ATRA 1Y9WA 4PK2A 2Z10A 1IYKA 3DR8A 3EC4A 4KSAA 4M85A 4QB9A 1UFHA 4B5OA 3DNSA 1KUVA 4R57A 1ZO0A 3W91A 2B4DA 4C2XA 2FS5A 2VQYA 3CXQA 3TCVA 4Q36A 2Y0MA 4AVBA 2DPTA 1YK3A 4MFLA 4M3SA 4ONUA 4B11A 2GANA 1B6BA 4UWIA 3GKRA 5H84A 2NMTA 2I00A 4B12A 2CNMA 5G1ZA 4E2AA 1P0HA 1M44A 5IB0A 3T9YA 2JDDA 2Z3NA 3G8WA 1YGHA 2Z11A 2ZW7A 3BLNA 3TO7A 4AVCA 2ZPAA 3TO9A 1WWZA 1QSOA 2PR8A 1XEBA 2DXQA 2WUUA 5FVJA 4KOXA 2CXAA 4C68A 5AG4A 5A28A 3V8IA 4C7HA 1MK4A 2JLMA 2FIWA 4NXYA 4R9MA 4FD5A 4NEXA 4JLYA 4PSXA 5E96A 1Q2CA 3R1KA 4I49A 5J8CA 2Q04A 1BOBA 3R9EA 4CGMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OAE A;  3QB8 A;  1IIC A;  1NE9 A;  2VI7 A;  1RXT A;  2ZW6 A;  3H4Q A;  4AG9 A;  4CS0 B;  3D8P A;  4H6Z A;  1NMT A;  3EO4 A;  4MJ8 A;  1L0C A;  2R1I A;  2HUZ A;  4II9 A;  4MHD A;  2OZH A;  1YX0 A;  4YGO A;  5H86 A;  2D4P A;  4XPD C;  3N7Z A;  5EBV A;  4KOY A;  4UWJ A;  2VEZ A;  5EC4 A;  5DWM A;  1I21 A;  3D2M A;  2P6G A;  3TTH A;  4OAD A;  2JEV A;  2F5I A;  4YFJ A;  5HH1 A;  4XPD B;  4PSW A;  2BL1 A;  4LX9 A;  2QEC A;  2P6E A;  4KOT A;  2Z0Z A;  1Y9K A;  1WK4 A;  2K5T A;  4KOV A;  4AVA A;  3G3S A;  2REF A;  4UA3 A;  1M1D A;  1YRE A;  4JXR A;  3E0K A;  4R87 A;  2B4D B;  5KTA A;  4F6A A;  1S5K A;  1YR0 A;  4Y49 B;  2HQY A;  4KUB A;  3SHP A;  5F49 A;  3KKW A;  2J8M A;  2HV2 A;  2KCW A;  4HNY B;  2FXF A;  5C88 A;  3LD2 A;  3PGP A;  3R95 A;  4X5K A;  2PSW A;  2WPX A;  1Z4R A;  2EVN A;  5CNP A;  2PQ8 A;  2CNS A;  4R3K A;  4KOR A;  2EUI A;  4H6U A;  2OU2 A;  1Y7R A;  2ZW5 A;  4AG7 A;  2BEI A;  4CAX A;  4XPK A;  2VZZ A;  1KZF A;  2C27 A;  3EY5 A;  4XNH C;  3UY5 A;  2PC1 A;  1MJ9 A;  5J8F A;  2Q7B A;  2B3V A;  1S7L A;  1IID A;  2B5G B;  1NSL A;  3GYA A;  4CAV A;  4KVM E;  3B8G A;  4ZBG A;  5I0C A;  2B5G A;  4L89 A;  4QBJ A;  1FY7 A;  4U9Z A;  1QST A;  4XNH B;  4AB7 A;  2R7H A;  3OWC A;  4R3L A;  3BJ8 A;  1ON0 A;  2FL4 A;  2WPW A;  1YLE A;  1R57 A;  4HKF A;  4CRY B;  1YVK A;  1YVO A;  1S7F A;  2Q0Y A;  3CXP A;  4ORF A;  4RS2 A;  4DNC A;  3SXO A;  1U6M A;  1K4J A;  3C26 A;  2AE6 A;  3ZJ0 A;  2B3U A;  3K9U A;  5DWN A;  4KLW A;  3WR7 A;  1TIQ A;  3CXS A;  4NCZ A;  4EVY A;  5KTD A;  2J8N A;  1MJB A;  2Q4V A;  1VHS A;  1BO4 A;  3VWD A;  4NSQ A;  4JWP A;  4JJX A;  2FE7 A;  1KUY A;  3I9S A;  4F0Y A;  4H89 A;  1QSN A;  4KOU A;  4QVT A;  5GCN A;  2JDC A;  3DR6 A;  3FIX A;  4RI1 A;  2Q4Y A;  4JD6 A;  3W6X A;  4KVO E;  2P6F A;  3R9F A;  5HMN A;  2Q44 A;  1M4G A;  1CJW A;  3EFA A;  2GIV A;  4LUA A;  1LRZ A;  4JXQ A;  4HNW B;  4B5P B;  3FXT A;  1GHE A;  2BUE A;  4HNX B;  4MI4 A;  2ZXV A;  3IWG A;  4B5P A;  1J4J A;  2FIA A;  1IB1 E;  4KUA A;  5IV0 A;  4YRH A;  3I3G A;  3P2F A;  3DDD A;  1RO5 A;  2OZU A;  4K30 A;  3SXN A;  4L8A A;  1PUA A;  1N71 A;  1QSR A;  1XF8 A;  3T90 A;  1CM0 A;  2P0W A;  4GS4 A;  3PP9 A;  2CY2 A;  2B4B A;  3JUW A;  2PR1 A;  5F47 A;  1S60 A;  4U9Y A;  2B58 A;  2QIR A;  2ZW4 A;  4MY0 A;  5F46 A;  2FSR A;  4BMH A;  3F5B A;  3FRM A;  5JPH A;  2AJ6 A;  1SQH A;  2CNT A;  4U5Y A;  3JVN A;  3R96 A;  2J8R A;  3QAH A;  1XE4 A;  2PDO A;  4KVX A;  1Z4E A;  2REE A;  1XMT A;  5KTC A;  1S7K A;  3S6F A;  3W6S A;  2PRB A;  3PZJ A;  3TFY A;  4CAW A;  1I1D A;  1S7N A;  3LOD A;  1OZP A;  2VZY A;  3BJ7 A;  4PK3 A;  1VKC A;  2X7B A;  2O28 A;  3F8K A;  3TT2 A;  3S6K A;  4MBU A;  2R8V A;  5ISV A;  4UBR A;  4E8O A;  4KLV A;  2OH1 A;  1Q2D A;  3FYN A;  5F48 A;  1V0C A;  2G3T A;  4FD6 A;  4CRZ B;  4J3G A;  1M4I A;  4KOS A;  4NF1 A;  1B87 A;  2BSW A;  3RYO A;  2QML A;  4KZT A;  1M4D A;  1XIX A;  4IF5 A;  2IL4 A;  3D2P A;  3R9G A;  1MJA A;  4E0A A;  1Z9U A;  5C82 A;  2RC4 A;  4QUS A;  2OB0 A;  2VBQ A;  3S6H A;  1IYL A;  3GY9 A;  3MGD A;  2D4O A;  2I79 A;  2G3A A;  4IUS A;  3P2H A;  3EXN A;  1P4N A;  3TO6 A;  2VXK A;  3NE7 A;  4KOW A;  1PU9 A;  2GE3 A;  2A4N A;  1QSM A;  2FT0 A;  3FNC A;  3TOA A;  3FBU A;  5JQ4 A;  2FCK A;  4FD4 A;  2G0B A;  2H5M A;  2OZG A;  4OLL A;  3FB3 A;  1I12 A;  3ZZI A;  3IGR A;  4MY3 A;  1KUX A;  2R98 A;  3VWE A;  1Q2Y A;  4FD7 A;  4QC6 A;  3DSB A;  3S6G A;  3TE4 A;  2ARH A;  4Y49 C;  5IX3 A;  3D3S A;  3F0A A;  4PV6 A;  1S3Z A;  4XPL A;  3TOB A;  2ATR A;  1Y9W A;  4PK2 A;  2Z10 A;  1IYK A;  3DR8 A;  3EC4 A;  4M85 A;  4QB9 A;  1UFH A;  4B5O A;  3DNS A;  1KUV A;  4R57 A;  3W91 A;  2B4D A;  2FS5 A;  2VQY A;  3CXQ A;  3TCV A;  2Y0M A;  4AVB A;  1YK3 A;  4M3S A;  4ONU A;  2GAN A;  1B6B A;  4UWI A;  3GKR A;  5H84 A;  2NMT A;  2I00 A;  2CNM A;  4E2A A;  1P0H A;  1M44 A;  5IB0 A;  3T9Y A;  2JDD A;  3G8W A;  1YGH A;  2Z11 A;  2ZW7 A;  3BLN A;  3TO7 A;  4AVC A;  2ZPA A;  3TO9 A;  1WWZ A;  1QSO A;  2PR8 A;  1XEB A;  2DXQ A;  5FVJ A;  4KOX A;  3V8I A;  1MK4 A;  2JLM A;  2FIW A;  4NXY A;  4R9M A;  4FD5 A;  4NEX A;  4JLY A;  4PSX A;  5E96 A;  1Q2C A;  3R1K A;  4I49 A;  5J8C A;  2Q04 A;  1BOB A;  3R9E A; 
#chains in the Genus database with same CATH topology
 3D68 A;  4OAE A;  3QB8 A;  1IIC A;  1NE9 A;  2VI7 A;  4OKO A;  1RXT A;  4MCS A;  4CAX A;  2ZW6 A;  3H4Q A;  4MFP A;  4GM5 A;  3D8P A;  4H6Z A;  4JYW A;  2C6C A;  2PJ7 A;  4MFZ A;  4OP4 A;  4CS0 B;  4ZI6 A;  5HVF A;  1NMT A;  4RUH A;  3EO4 A;  2O4H A;  4MJ8 A;  1F57 A;  4C2Y A;  1L0C A;  1QMU A;  2R1I A;  2HUZ A;  2Z3O A;  4MHD A;  4II9 A;  2BOA A;  2AFM A;  2OZH A;  1YX0 A;  2PRQ A;  3BI0 A;  4YGO A;  5H86 A;  1TF8 A;  2D4P A;  3NE8 A;  1X12 A;  3N7Z A;  4XPD C;  4ZX9 A;  4C2Z A;  5EBV A;  2CIJ A;  4UFV A;  1TF9 A;  4KOY A;  4UWJ A;  2VEZ A;  4EME A;  1DTD A;  5EC4 A;  4UIA A;  5DWM A;  1I21 A;  4CYN A;  4AXV A;  2VL1 A;  3D2M A;  5G22 A;  2P6G A;  4MFK A;  2J9A A;  4BIN A;  2XEJ A;  4B14 A;  1Y0Y A;  3TTH A;  4DJL A;  2EWB A;  4MHP A;  1ARM A;  3NFZ A;  2Q51 A;  3BI1 A;  1HEE A;  4NJR A;  4OAD A;  4MHY A;  3WC6 A;  2JEV A;  3GUX A;  2F5I A;  2PJ4 A;  4YFJ A;  4B6Z A;  5K8N A;  3IO1 A;  2C6P A;  2AFU A;  4B13 A;  2O53 A;  5HH1 A;  4XPD B;  1IOF A;  2C6G A;  4Z65 A;  1ARL A;  1M4L A;  4PSW A;  3WC5 A;  4F9U A;  4R6T A;  2BL1 A;  3D7G A;  3D4U A;  2Z3L A;  2GFQ A;  4HPS A;  4LX9 A;  1X10 A;  5AGE A;  1Z8T A;  3A9L A;  3IJ3 A;  3HUV A;  3FED A;  4NGM A;  4P45 A;  2QEC A;  3NH4 A;  2P6E A;  4KOT A;  4O23 A;  2Z0Z A;  1WK4 A;  1Y9K A;  2K5T A;  4KOV A;  1LFW A;  4PXB A;  4AVA A;  1PYT B;  3G3S A;  4TNU A;  4CAE A;  2REF A;  2ZEO A;  1BAV A;  1KWM A;  4UA3 A;  5EMI A;  4F0X A;  1XFO A;  4A30 A;  4YU9 A;  1M1D A;  1YRE A;  1XRY A;  4JXR A;  3E0K A;  4P4I A;  4R87 A;  2B4D B;  3IIB A;  4FBE A;  5KTA A;  3IEH A;  1TKJ A;  1A2Z A;  1YW4 A;  3KHX A;  1TKH A;  4F6A A;  1S5K A;  1YR0 A;  5G21 A;  1ZLI A;  4UEZ A;  4Y49 B;  3GIU A;  2HQY A;  4KUB A;  3SHP A;  2Q7S A;  2GLJ A;  5F49 A;  3KKW A;  2J8M A;  4A32 A;  3PB4 X;  1QQ9 A;  4P10 A;  4PXE A;  2HV2 A;  3VH9 A;  3D7D A;  2KCW A;  4NJQ A;  1AUG A;  4HNY B;  2FXF A;  4A2Z A;  2WSA A;  3KZW A;  3LD2 A;  1IGB A;  3PGP A;  3R95 A;  2DEA A;  5C88 A;  1ZLH A;  4NGN A;  3GLJ A;  4BD9 A;  4UCP A;  4P4B A;  4X5K A;  2PSW A;  2WPX A;  1Z4R A;  2EVN A;  4MHN A;  2PQ8 A;  2CNS A;  4R3K A;  5CNP A;  2Z3M A;  3WT4 A;  4B10 A;  4CYQ A;  5HXD A;  3CZX A;  4KOR A;  3KR5 A;  4CGO A;  2EUI A;  4H6U A;  2XEI A;  3V38 A;  2OU2 A;  2YNC C;  2YND A;  1Y7R A;  4BBH A;  2ZW5 A;  4MFQ A;  4AG7 A;  2BEI A;  3IWW A;  3KHZ A;  3JTK A;  2ODF A;  2RFH A;  2VZZ A;  3IU2 A;  4XPK A;  3SI1 A;  3S9N A;  3BXM A;  1AMP A;  3LAC A;  2PJ9 A;  3H8G A;  1KZF A;  2C27 A;  1Z2L A;  3EY5 A;  4P4D A;  1LAP A;  4UIB A;  4XNH C;  3UY5 A;  2PC1 A;  1JQG A;  1MJ9 A;  4ZYQ A;  5J8F A;  2GRE A;  3B7I A;  2Q7B A;  4UFX A;  2GU2 A;  1CP6 A;  1F2O A;  4FUU A;  4NGQ A;  2B3V A;  3PB8 X;  1S7L A;  2PVW A;  4MHZ A;  3WAB A;  1IID A;  4KS9 A;  2ZEN A;  4ZY1 A;  2B5G B;  1NSL A;  3GYA A;  5K8P A;  4CAV A;  2AFS A;  4GXH A;  4OC1 A;  1VHO A;  2JBK A;  2V8D A;  2ZEM A;  4KVM E;  5AG5 A;  3KQX A;  1LCP A;  2QVP A;  3B8G A;  4ZBG A;  2YNC A;  5I0C A;  2B5G A;  2PVV A;  3FEE A;  4L89 A;  4CGL A;  4QBJ A;  1FY7 A;  4U9Z A;  4CYP A;  1QST A;  4XNH B;  4AB7 A;  2R7H A;  3OWC A;  4R3L A;  4DUK A;  3BJ8 A;  5LYL A;  3PFO A;  1LAN A;  1ON0 A;  4OC0 A;  2FL4 A;  2WPW A;  2IQ6 A;  4NGS A;  3DGV A;  1YLE A;  1R57 A;  4HKF A;  4CRY B;  1YVK A;  2PJA A;  3LMS A;  2F7V A;  1YVO A;  1S7F A;  2Q0Y A;  3CXP A;  4ORF A;  4R8F A;  4RS2 A;  5D8N A;  3SXO A;  1U6M A;  4DNC A;  4OC5 A;  1K4J A;  3C26 A;  4F8Z A;  2YNE A;  2AE6 A;  3RAM A;  3ZJ0 A;  2B3U A;  4CAF A;  5K8M A;  2PCU A;  3K9U A;  5DWN A;  1CX8 A;  3QNV A;  4KLW A;  3WR7 A;  1TIQ A;  3CXS A;  4NCZ A;  4EVY A;  5KTD A;  2J8N A;  1YW6 A;  3FH4 A;  1MJB A;  2Q4V A;  1VHS A;  1BO4 A;  3VWD A;  4A95 A;  3ISZ A;  1VGY A;  4NSQ A;  3NH8 A;  4JWP A;  4JJX A;  3SI0 A;  3VAT A;  3HLP A;  2FE7 A;  3SJF A;  1KUY A;  3RNZ A;  2HB6 A;  3I9S A;  3MN8 A;  4R76 A;  1IOI A;  4H89 A;  4F0Y A;  1QSN A;  4KOU A;  4QVT A;  5AG6 A;  5ELY A;  5GCN A;  4ZGY B;  2JDC A;  3DR6 A;  3FIX A;  4P4F A;  5LRK A;  4RI1 A;  2Q4Y A;  4PQA A;  4P44 A;  2PJ3 A;  4JD6 A;  3W6X A;  4KVO E;  4A37 A;  2P6F A;  3PB6 X;  3R9F A;  5HMN A;  2Q44 A;  1M4G A;  2RB7 A;  4MMO A;  1CJW A;  3EFA A;  3PBB A;  1JWQ A;  2PIY A;  1FT7 A;  2V8H A;  1VIX A;  4KSF A;  2GIV A;  4LUA A;  4MCP A;  1LRZ A;  4JXQ A;  2XEG A;  3B2Y A;  4OC3 A;  4UEE A;  2GLF A;  4HNW B;  4B5P B;  1Z8X A;  3FXT A;  4NGP A;  1GHE A;  2BUE A;  4HNX B;  3IU1 A;  4MI4 A;  4A31 A;  3KGQ A;  5AG7 A;  1CPX A;  2Q43 A;  2OR4 A;  2ZXV A;  3IWG A;  3LWU A;  1YSJ A;  4TWE A;  4B5P A;  3WC7 A;  1J4J A;  2FIA A;  1IB1 E;  4KUA A;  4A38 A;  5IV0 A;  4W9Y A;  4NGT A;  4YRH A;  3FX6 A;  3I3G A;  2PIZ A;  8CPA A;  3P2F A;  3DDD A;  2ZEP A;  1RO5 A;  2OZU A;  4M6I A;  4K30 A;  3TC8 A;  3PBE A;  3SJG A;  3SXN A;  2DF5 A;  4L8A A;  1PUA A;  1N71 A;  1QSR A;  1YME A;  4H2K A;  1XF8 A;  3T90 A;  4WWV A;  1CM0 A;  2Z3P A;  2P0W A;  4UFW A;  3IFE A;  5JM6 A;  1BPM A;  3BHX A;  4MCQ A;  2CY2 A;  3PP9 A;  4GS4 A;  2B4B A;  3JUW A;  4IAV A;  2AFW A;  2PR1 A;  4OC4 A;  5F47 A;  1S60 A;  4U9Y A;  3RBU A;  4K3N A;  3DLJ A;  2B58 A;  2I3C A;  2QIR A;  5D29 A;  4CGP A;  3FVL A;  3KI9 A;  2ZW4 A;  4MY0 A;  2WZN A;  4JZ0 A;  2FSR A;  5F46 A;  4BMH A;  1ZG9 A;  2EK8 A;  2V8G A;  3TX8 A;  3F5B A;  3PFE A;  6CPA A;  2PJC A;  3SI2 A;  3FRM A;  5JPH A;  1AYE A;  2FVG A;  2EBJ A;  2AJ6 A;  4X8I A;  2PJ6 A;  2V8V A;  3S9L A;  2YGW A;  1SQH A;  2CNT A;  1DE4 C;  3KQZ A;  4U5Y A;  3IWE A;  5DS0 A;  3JVN A;  3R96 A;  2J8R A;  3FF3 A;  3QAH A;  1XE4 A;  2PDO A;  4UCN A;  4KVX A;  1Z4E A;  7CPA A;  3B3S A;  2REE A;  1XMT A;  4IHM A;  5KTC A;  1S7K A;  3H8E A;  2BCO A;  3S6F A;  4OID A;  3W6S A;  2PRB A;  3D66 A;  2ANP A;  3PZJ A;  3QAY A;  3NH5 A;  4NGR A;  4X2T A;  3TFY A;  2NSM A;  2PJ2 A;  2OOT A;  4CAW A;  1I1D A;  1S7N A;  3LOD A;  2C1C A;  5IB9 A;  1OZP A;  3B3V A;  2VZY A;  3BJ7 A;  4PK3 A;  4P4J A;  5LYD A;  5BWA B;  1VKC A;  5JGF A;  2ABZ A;  2X7B A;  2O28 A;  2XEF A;  4Q7A A;  3B3T A;  3F8K A;  3TT2 A;  3S6K A;  1R43 A;  4MBU A;  3RZA A;  2HC9 A;  1CP7 A;  4CYO A;  5LRJ A;  4OIW A;  2R8V A;  5ISV A;  5THW A;  3NA6 A;  1OBR A;  4UBR A;  4E8O A;  4KLV A;  2OH1 A;  1Q2D A;  2F8H A;  3FYN A;  3ISX A;  5F48 A;  2ZOF A;  1CPS A;  1V0C A;  4ZY0 A;  2Z3K A;  1XBU A;  2G3T A;  4FD6 A;  1CG2 A;  1Z8W A;  3K9T A;  2PJ5 A;  2PJ0 A;  4CRZ B;  1BPN A;  3T8W A;  4J3G A;  1M4I A;  1Z5R A;  1ZG7 A;  1EE3 P;  4KOS A;  4NF1 A;  1F2P A;  1B87 A;  4PXC A;  2BSW A;  3RYO A;  3KL9 A;  2QML A;  2JEW A;  4LQG A;  1XOV A;  1XMB A;  4KZT A;  4CPA A;  1M4D A;  1HDU A;  1XIX A;  4IF5 A;  2IL4 A;  3D2P A;  4PXD A;  2V77 A;  4MFJ A;  5G20 A;  3R9G A;  3I1U A;  1MJA A;  4M6H A;  4E0A A;  1Z9U A;  4RN7 A;  5C82 A;  2RC4 A;  4QUS A;  2OB0 A;  2VBQ A;  1YLO A;  4AG9 A;  1UWY A;  5LYI A;  1IYL A;  3S6H A;  3RO0 A;  4FWU A;  5HVG A;  3SJE A;  1ZG8 A;  3B3C A;  3GY9 A;  3MGD A;  1YQE A;  3PB9 X;  2D4O A;  2G9D A;  2G3A A;  2I79 A;  1Y0R A;  3KAS A;  1RTQ A;  4IUS A;  4A94 A;  3P2H A;  4CGN A;  3EXN A;  1P4N A;  2DPS A;  3TO6 A;  2PJB A;  3D7F A;  5HVH A;  1CBX A;  3V7Z A;  2VXK A;  3NE7 A;  4KOW A;  1PU9 A;  3CT9 A;  1PCA A;  2A4N A;  2GE3 A;  5LYF A;  1QSM A;  2FT0 A;  3FNC A;  5K8O A;  5JH9 A;  1TXR A;  3SJX A;  2IJZ A;  1R3N A;  2AFO A;  3TOA A;  4EWT A;  3FBU A;  3PB7 X;  2PE3 A;  2FCK A;  3KR4 A;  5JQ4 A;  3FMC A;  4FD4 A;  4P4E A;  5A27 A;  2G0B A;  2H5M A;  2OZG A;  4Q38 A;  4OLL A;  1GYT A;  1Z8L A;  3FEC A;  3FB3 A;  4UCM A;  1XJO A;  2PJ1 A;  2ZEE A;  4ZX8 A;  1I12 A;  3ZZI A;  3D7H A;  2ZOG A;  1IU8 A;  3H5Z A;  3IGR A;  4MY3 A;  1KUX A;  1NSA A;  2R98 A;  1Q2Y A;  2ZED A;  4OC2 A;  3VWE A;  4A33 A;  4EFD A;  4FD7 A;  3PRT A;  3VAR A;  4KSI A;  4QC6 A;  3DSB A;  3S6G A;  2ZEL A;  4ONW A;  2NYQ A;  3TE4 A;  2ARH A;  4Y49 C;  1ELM P;  5IX3 A;  3D3S A;  3F0A A;  1LOK A;  2AFX A;  4PV6 A;  1HDQ A;  1S3Z A;  4UEF A;  4XPL A;  3TOB A;  2ATR A;  4C7I A;  1Y9W A;  4PK2 A;  2Z10 A;  4IK2 A;  1IYK A;  3DR8 A;  3EC4 A;  4KSA A;  4M85 A;  4QB9 A;  2EO8 A;  1UFH A;  4B5O A;  3DNS A;  3S9M A;  1KUV A;  4A39 A;  3PEI A;  1BLL E;  2CTC A;  1ELL P;  4R57 A;  4ZY2 A;  1ZO0 A;  4FAI A;  1H8L A;  3W91 A;  2B4D A;  2Q4Z A;  2FS5 A;  4C2X A;  5CBM A;  3B35 A;  4WJB A;  2ZEH A;  3CPA A;  2VQY A;  3CXQ A;  4OME A;  5F09 A;  3TCV A;  4Q36 A;  2Y0M A;  3R9E A;  1FNO A;  4AVB A;  2DPT A;  1YK3 A;  2QYV A;  4MFL A;  4M3S A;  3IC1 A;  1Y7E A;  4ONU A;  5CPA A;  2WYR A;  2PJ8 A;  2AFZ A;  4B11 A;  4NFR A;  3H8F A;  2EK9 A;  4YWY A;  2GAN A;  1B6B A;  4R7M A;  4PPZ A;  3FJU A;  4UWI A;  3GKR A;  2BO9 A;  5H84 A;  1LAM A;  2NMT A;  5LRG A;  4DYO A;  4F9V A;  2I00 A;  4B12 A;  2CNM A;  5G1Z A;  3D67 A;  5I4M A;  3K2K A;  4E2A A;  1P0H A;  1M44 A;  5IB0 A;  3T9Y A;  2JDD A;  2Z3N A;  3G8W A;  4G1P A;  2POK A;  3B3W A;  1YGH A;  2Z11 A;  2CTB A;  2ZW7 A;  3BLN A;  2QJ8 A;  3TO7 A;  4AVC A;  2ZPA A;  3TO9 A;  1QSO A;  1WWZ A;  2PR8 A;  1XEB A;  2DXQ A;  2WUU A;  3GB0 A;  4UF4 A;  4KOX A;  4P6Y A;  4LQ6 A;  5FVJ A;  3JRU A;  2CXA A;  4C68 A;  5AG4 A;  2IMO A;  5A28 A;  1Q7L A;  4MXU A;  3V8I A;  2ZEF A;  3CDX A;  1IY7 A;  1VHE A;  4C7H A;  1MK4 A;  2CF4 A;  2JLM A;  4M6G A;  2FIW A;  4NXY A;  4R9M A;  4FD5 A;  1TKF A;  2JBJ A;  3N5F A;  4JLY A;  4NEX A;  4PSX A;  3MRU A;  4X3R A;  5J1Q A;  2ZEG A;  4MCR A;  3CPX A;  5E96 A;  1Q2C A;  3R1K A;  4I49 A;  4MRI A;  5J8C A;  2Q04 A;  1BOB A;  3L2N A;  4CGM A; 
#chains in the Genus database with same CATH homology
 4OAE A;  3QB8 A;  1IIC A;  1NE9 A;  2VI7 A;  1RXT A;  2ZW6 A;  3H4Q A;  4MFP A;  4AG9 A;  3D8P A;  4H6Z A;  4CS0 B;  4MFZ A;  1NMT A;  3EO4 A;  4MJ8 A;  4C2Y A;  1L0C A;  2R1I A;  2HUZ A;  2Z3O A;  4MHD A;  4II9 A;  2OZH A;  1YX0 A;  4YGO A;  5H86 A;  2D4P A;  4XPD C;  3N7Z A;  4C2Z A;  5EBV A;  4UFV A;  4KOY A;  4UWJ A;  2VEZ A;  5EC4 A;  5DWM A;  1I21 A;  4CYN A;  3D2M A;  5G22 A;  2P6G A;  4MFK A;  4B14 A;  3TTH A;  4OAD A;  2JEV A;  2F5I A;  4YFJ A;  4B13 A;  5HH1 A;  4XPD B;  4PSW A;  2BL1 A;  2Z3L A;  4LX9 A;  5AGE A;  3A9L A;  2QEC A;  2P6E A;  4KOT A;  2Z0Z A;  1Y9K A;  1WK4 A;  2K5T A;  4KOV A;  4AVA A;  3G3S A;  4CAE A;  2REF A;  4UA3 A;  4F0X A;  4A30 A;  1M1D A;  1YRE A;  4JXR A;  3E0K A;  4R87 A;  2B4D B;  5KTA A;  4F6A A;  1S5K A;  1YR0 A;  5G21 A;  4Y49 B;  2HQY A;  4KUB A;  3SHP A;  5F49 A;  3KKW A;  2J8M A;  4A32 A;  2HV2 A;  2KCW A;  4HNY B;  2FXF A;  4A2Z A;  2WSA A;  3LD2 A;  3PGP A;  3R95 A;  5C88 A;  4UCP A;  4X5K A;  2PSW A;  2WPX A;  1Z4R A;  2EVN A;  5CNP A;  2PQ8 A;  2CNS A;  4R3K A;  4B10 A;  2Z3M A;  4CYQ A;  4KOR A;  4CGO A;  2EUI A;  4H6U A;  2OU2 A;  2YNC C;  2YND A;  1Y7R A;  4BBH A;  2ZW5 A;  4MFQ A;  4AG7 A;  2BEI A;  4CAX A;  4XPK A;  3JTK A;  2VZZ A;  3IU2 A;  1KZF A;  2C27 A;  3EY5 A;  4XNH C;  3UY5 A;  2PC1 A;  1MJ9 A;  5J8F A;  2Q7B A;  4UFX A;  2B3V A;  1S7L A;  1IID A;  4KS9 A;  2B5G B;  1NSL A;  3GYA A;  4CAV A;  5AG5 A;  4KVM E;  3B8G A;  4ZBG A;  2YNC A;  5I0C A;  2B5G A;  4L89 A;  4CGL A;  4QBJ A;  1FY7 A;  4U9Z A;  4CYP A;  1QST A;  4XNH B;  4AB7 A;  2R7H A;  3OWC A;  4R3L A;  3BJ8 A;  1ON0 A;  2FL4 A;  2WPW A;  1YLE A;  1R57 A;  4HKF A;  4CRY B;  1YVK A;  1YVO A;  1S7F A;  2Q0Y A;  3CXP A;  4ORF A;  4RS2 A;  4DNC A;  3SXO A;  1U6M A;  1K4J A;  3C26 A;  2YNE A;  2AE6 A;  3ZJ0 A;  4CAF A;  2B3U A;  3K9U A;  5DWN A;  4KLW A;  3WR7 A;  1TIQ A;  3CXS A;  4NCZ A;  4EVY A;  5KTD A;  2J8N A;  1MJB A;  2Q4V A;  1VHS A;  1BO4 A;  3VWD A;  4A95 A;  4NSQ A;  4JWP A;  4JJX A;  2FE7 A;  1KUY A;  3I9S A;  4F0Y A;  4H89 A;  1QSN A;  4KOU A;  4QVT A;  5AG6 A;  5GCN A;  4ZGY B;  2JDC A;  3DR6 A;  3FIX A;  4RI1 A;  2Q4Y A;  4JD6 A;  3W6X A;  4KVO E;  2P6F A;  3R9F A;  5HMN A;  2Q44 A;  1M4G A;  1CJW A;  3EFA A;  4KSF A;  2GIV A;  4LUA A;  1LRZ A;  4JXQ A;  4HNW B;  4B5P B;  3FXT A;  1GHE A;  2BUE A;  4HNX B;  3IU1 A;  4MI4 A;  4A31 A;  5AG7 A;  2ZXV A;  3IWG A;  4B5P A;  1J4J A;  2FIA A;  1IB1 E;  4KUA A;  5IV0 A;  4YRH A;  3I3G A;  3P2F A;  3DDD A;  1RO5 A;  2OZU A;  4K30 A;  3SXN A;  4L8A A;  1PUA A;  1N71 A;  1QSR A;  1XF8 A;  3T90 A;  1CM0 A;  2Z3P A;  2P0W A;  4UFW A;  4GS4 A;  3PP9 A;  2CY2 A;  2B4B A;  3JUW A;  2PR1 A;  5F47 A;  1S60 A;  4U9Y A;  2B58 A;  2QIR A;  4CGP A;  2ZW4 A;  4MY0 A;  5F46 A;  2FSR A;  4BMH A;  3F5B A;  3FRM A;  5JPH A;  2AJ6 A;  2YGW A;  1SQH A;  2CNT A;  4U5Y A;  3IWE A;  3JVN A;  3R96 A;  2J8R A;  3QAH A;  1XE4 A;  2PDO A;  4UCN A;  4KVX A;  1Z4E A;  2REE A;  1XMT A;  5KTC A;  1S7K A;  3S6F A;  3W6S A;  2PRB A;  3PZJ A;  3TFY A;  4CAW A;  1I1D A;  1S7N A;  3LOD A;  1OZP A;  2VZY A;  3BJ7 A;  4PK3 A;  5BWA B;  1VKC A;  2X7B A;  2O28 A;  3F8K A;  3TT2 A;  3S6K A;  4MBU A;  4CYO A;  2R8V A;  5ISV A;  4UBR A;  4E8O A;  4KLV A;  2OH1 A;  1Q2D A;  3FYN A;  5F48 A;  1V0C A;  2Z3K A;  2G3T A;  4FD6 A;  4CRZ B;  4J3G A;  1M4I A;  4KOS A;  4NF1 A;  1B87 A;  2BSW A;  3RYO A;  2QML A;  4KZT A;  1M4D A;  1XIX A;  4IF5 A;  2IL4 A;  3D2P A;  5G20 A;  4MFJ A;  3R9G A;  1MJA A;  4E0A A;  1Z9U A;  5C82 A;  2RC4 A;  4QUS A;  2OB0 A;  2VBQ A;  3S6H A;  1IYL A;  3GY9 A;  3MGD A;  2D4O A;  2I79 A;  2G3A A;  4IUS A;  4CGN A;  3P2H A;  3EXN A;  1P4N A;  2DPS A;  3TO6 A;  2VXK A;  3NE7 A;  4KOW A;  1PU9 A;  2GE3 A;  2A4N A;  1QSM A;  2FT0 A;  3FNC A;  3TOA A;  3FBU A;  5JQ4 A;  2FCK A;  4FD4 A;  5A27 A;  2G0B A;  2H5M A;  2OZG A;  4Q38 A;  4OLL A;  3FB3 A;  4UCM A;  1I12 A;  3ZZI A;  3H5Z A;  3IGR A;  4MY3 A;  1KUX A;  2R98 A;  3VWE A;  1Q2Y A;  4A33 A;  4FD7 A;  4QC6 A;  3DSB A;  3S6G A;  3TE4 A;  2ARH A;  4Y49 C;  5IX3 A;  3D3S A;  3F0A A;  4PV6 A;  1S3Z A;  4C7I A;  4XPL A;  3TOB A;  2ATR A;  1Y9W A;  4PK2 A;  2Z10 A;  1IYK A;  3DR8 A;  3EC4 A;  4KSA A;  4M85 A;  4QB9 A;  1UFH A;  4B5O A;  3DNS A;  1KUV A;  4R57 A;  1ZO0 A;  3W91 A;  2B4D A;  4C2X A;  2FS5 A;  2VQY A;  3CXQ A;  3TCV A;  4Q36 A;  2Y0M A;  4AVB A;  2DPT A;  1YK3 A;  4MFL A;  4M3S A;  4ONU A;  4B11 A;  2GAN A;  1B6B A;  4UWI A;  3GKR A;  5H84 A;  2NMT A;  2I00 A;  4B12 A;  2CNM A;  5G1Z A;  4E2A A;  1P0H A;  1M44 A;  5IB0 A;  3T9Y A;  2JDD A;  2Z3N A;  3G8W A;  1YGH A;  2Z11 A;  2ZW7 A;  3BLN A;  3TO7 A;  4AVC A;  2ZPA A;  3TO9 A;  1WWZ A;  1QSO A;  2PR8 A;  1XEB A;  2DXQ A;  2WUU A;  5FVJ A;  4KOX A;  2CXA A;  4C68 A;  5AG4 A;  5A28 A;  3V8I A;  4C7H A;  1MK4 A;  2JLM A;  2FIW A;  4NXY A;  4R9M A;  4FD5 A;  4NEX A;  4JLY A;  4PSX A;  5E96 A;  1Q2C A;  3R1K A;  4I49 A;  5J8C A;  2Q04 A;  1BOB A;  3R9E A;  4CGM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...