3CXSA

Crystal structure of human gna1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
182
structure length
181
Chain Sequence
MKPDETPMFDPSLLKEVDWSQNTATFSPAISPTHPGEGLVLRPLCTADLNRGFFKVLGQLTETGVVSPEQFMKSFEHMKKSGDYYVTVVEDVTLGQIVATATLIIEHKFIHSCAKRGRVEDVVVSDECRKQLGKLLLSTLTLLSKKLNCYKITLECLPQNVGFYKKFGYTVSEENYMCRRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Acceptor substrate binding revealed by crystal structure of human glucosamine-6-phosphate N-acetyltransferase 1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Glucosamine 6-phosphate N-acetyltransferase
total genus 41
structure length 181
sequence length 182
ec nomenclature ec 2.3.1.4: Glucosamine-phosphate N-acetyltransferase.
pdb deposition date 2008-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3cxsA01
3C26A 2I00A 3W91A 2FT0A 2OB0A 1YK3A 2CY2A 4GS4A 1YX0A 4QVTA 1R57A 3DR6A 2D4PA 3V8IA 4FD7A 2AJ6A 1CJWA 2OZHA 3QB8A 3ZZIA 1S3ZA 4R3KA 3ZJ0A 2H5MA 4KOYA 3H4QA 2Q04A 4QUSA 3TO7A 4AG7A 1QSNA 4XPKA 3F5BA 5F48A 3TCVA 3FBUA 5HH1A 2CNSA 3I3GA 2REEA 3PZJA 4NF1A 3VWDA 1S7NA 2JEVA 5IB0A 2R98A 2B58A 4II9A 1YREA 3KKWA 1S60A 4AB7A 3DNSA 4QB9A 1YVOA 1BO4A 1IYLA 4M85A 4EVYA 3BJ7A 4RS2A 3FXTA 2P6EA 3W6XA 3T9YA 3R96A 1KUVA 2JDDA 3WR7A 1Z9UA 2FCKA 3R9EA 5IV0A 1Q2YA 4U9YA 3D3SA 4XPLA 5IX3A 2P6FA 2GANA 4AVCA 2O28A 5KTAA 3BJ8A 4PV6A 1MJ9A 5DWMA 4FD5A 4MY0A 2B3UA 4KVOE 4K30A 2J8RA 2I79A 4AVBA 2FIWA 2B4BA 4HKFA 5CNPA 1IIDA 1M1DA 2FXFA 5J8CA 3UY5A 3B8GA 1QSTA 4CRZB 4H6ZA 4RI1A 3RYOA 4AVAA 2PR1A 1Z4EA 2PR8A 1PUAA 3TOAA 2Q4YA 2QIRA 2PRBA 3F0AA 2Z10A 1M4IA 3R9FA 5GCNA 1KZFA 1K4JA 1NSLA 1YGHA 2ATRA 4R9MA 4Y49B 3CXQA 1FY7A 5C88A 5H84A 2VZZA 1Q2CA 4KOVA 2VEZA 2VBQA 1M44A 3TE4A 2PSWA 3SXOA 2EVNA 3I9SA 2G3AA 4X5KA 2AE6A 2JDCA 1IYKA 1YVKA 1S7LA 1S7KA 2BEIA 1IB1E 2B4DB 2PC1A 5H86A 3TTHA 1M4DA 1QSRA 2VXKA 4E8OA 4HNWB 1VKCA 3S6KA 4KVXA 3LODA 3T90A 3TO6A 1TIQA 2GE3A 2NMTA 4LUAA 3DDDA 4YRHA 2B3VA 2G0BA 4OADA 2HUZA 4F0YA 4M3SA 1KUYA 4PSXA 1VHSA 4I49A 4KLVA 3GKRA 4JWPA 2R1IA 2PDOA 1QSOA 2X7BA 2J8NA 4PK2A 1MK4A 2VZYA 1I1DA 4YFJA 5HMNA 2A4NA 3TFYA 4NSQA 2ZXVA 4L89A 1S5KA 1ON0A 4J3GA 2KCWA 2CNMA 2B5GB 3GY9A 4XNHC 2FS5A 2G3TA 4JLYA 1V0CA 2Q0YA 4UBRA 3D2PA 4ZBGA 3OWCA 1I21A 3DR8A 3TOBA 4R57A 2OU2A 1Y9KA 1MJBA 3F8KA 3LD2A 1MJAA 2P6GA 4U5YA 4U9ZA 4H6UA 4JXRA 4KLWA 4FD4A 2Q7BA 1XF8A 2ZW5A 2PQ8A 3FNCA 4YGOA 4KOTA 1L0CA 1U6MA 2F5IA 1J4JA 3FRMA 2QECA 3G8WA 4OLLA 3EFAA 1N71A 2D4OA 2FSRA 3R1KA 4HNYB 4KZTA 2BSWA 3SXNA 4JD6A 2JLMA 1M4GA 1P0HA 2Q4VA 3NE7A 1WK4A 2Y0MA 1P4NA 1Y9WA 1PU9A 4BMHA 3TT2A 2HQYA 2VQYA 4QBJA 4NEXA 4FD6A 4JJXA 3EXNA 5JPHA 4UWIA 3EC4A 4ONUA 1B6BA 4E2AA 3VWEA 1OZPA 2P0WA 4XNHB 3K9UA 4B5OA 3S6HA 2HV2A 4PSWA 5C82A 1YR0A 3SHPA 1WWZA 3S6FA 3BLNA 2J8MA 4OAEA 4KOXA 4CAVA 4PK3A 4CAWA 3DSBA 1XEBA 3PGPA 4H89A 1XE4A 4HNXB 2Z0ZA 4CS0B 4KUAA 2OZUA 2EUIA 3P2FA 4MY3A 3S6GA 1Z4RA 2K5TA 3P2HA 4MI4A 4KVME 5I0CA 4XPDB 3FB3A 2R7HA 3IWGA 1QSMA 1NMTA 2QMLA 4NXYA 3MGDA 1XMTA 2BUEA 1LRZA 3GYAA 5FVJA 5E96A 4L8AA 3R9GA 2ARHA 4AG9A 1KUXA 2CNTA 2ZW4A 1B87A 1YLEA 4KOUA 2DXQA 5KTCA 3QAHA 4JXQA 4MHDA 5ISVA 4F6AA 4XPDC 2RC4A 1IICA 3R95A 1Q2DA 2BL1A 1UFHA 4KUBA 2WPXA 1S7FA 5JQ4A 2IL4A 5F47A 2ZW6A 4QC6A 2FL4A 5EC4A 2R8VA 4DNCA 4KOSA 2ZPAA 1GHEA 4R3LA 3IGRA 2ZW7A 4R87A 3CXPA 2FE7A 3D8PA 3EO4A 2OH1A 5EBVA 2Z11A 4CRYB 1RO5A 3W6SA 5F49A 2B5GA 2GIVA 4NCZA 3E0KA 2OZGA 3N7ZA 4MJ8A 2FIAA 3EY5A 2WPWA 4ORFA 3JVNA 1NE9A 2C27A 4B5PB 1I12A 4B5PA 5J8FA 4Y49C 1XIXA 3JUWA 2REFA 4LX9A 3CXSA 4UA3A 3FYNA 4UWJA 5KTDA 3D2MA 3PP9A 3G3SA 5DWNA 1SQHA 1BOBA 4IUSA 1Y7RA 2B4DA 2VI7A 4CAXA 4MBUA 2Q44A 4E0AA 1CM0A 5F46A 1RXTA 4KORA 4KOWA 3TO9A 3FIXA 4IF5A
chains in the Genus database with same CATH superfamily
3C26A 2I00A 4NGNA 4GXHA 4A95A 2IQ6A 3NH4A 3W91A 1R3NA 1ZLHA 2FT0A 3FVLA 3IWWA 4UFXA 3FH4A 3JRUA 2OB0A 1YK3A 5J8FA 2CY2A 4GS4A 1YX0A 4QVTA 4PXCA 1R57A 3DR6A 3D7HA 4MXUA 2D4PA 4CGNA 3KI9A 1LANA 3V8IA 4FD7A 2AJ6A 1CJWA 2OZHA 1RTQA 3QB8A 3ZZIA 4MHZA 4OIDA 5DS0A 5CPAA 1S3ZA 4R3KA 3ZJ0A 2H5MA 5D29A 4KOYA 3H4QA 5AGEA 2Q04A 1Q7LA 4W9YA 3FEDA 4QUSA 3SJGA 3TO7A 4WWVA 1LAMA 4AG7A 1QSNA 4EMEA 4XPKA 4PQAA 3N5FA 3F5BA 5F48A 1TKJA 3TCVA 3FBUA 3WC6A 3IJ3A 5HH1A 2CNSA 5ELYA 5EMIA 3BXMA 3I3GA 2REEA 1EE3P 1GYTA 3PZJA 3GLJA 4NF1A 3VWDA 1S7NA 2JEVA 4A31A 3QAYA 4ZY1A 5THWA 5AG7A 5IB0A 2R98A 4CYQA 4O23A 5F09A 2B58A 4X8IA 4II9A 2GLJA 4B10A 4B6ZA 1YREA 4NGQA 4UFVA 2O53A 3TX8A 3KKWA 1S60A 2PVWA 4AB7A 4C2XA 5A27A 3DNSA 4QB9A 2GU2A 5LRGA 1YVOA 1BO4A 1IYLA 4M85A 3S9LA 4CGMA 4EVYA 3BJ7A 4RS2A 3S9MA 4CGOA 4NGMA 4CAFA 1XOVA 1YSJA 3D4UA 3FXTA 4PXBA 2P6EA 4CAEA 2AFZA 1M4LA 1LFWA 3T9YA 3W6XA 1ARLA 3R96A 4BINA 1KUVA 2JDDA 5I4MA 3NA6A 1BLLE 3WR7A 3S9NA 1Z9UA 3RAMA 2FCKA 3R9EA 5IV0A 1Q2YA 4U9YA 3D3SA 4XPLA 5K8PA 3FMCA 5IX3A 4KS9A 2P6FA 2Z3NA 2GANA 5CBMA 4AVCA 2O28A 1KWMA 5KTAA 3BJ8A 4PV6A 3K2KA 1XMBA 3I1UA 2PJCA 3ISZA 1MJ9A 5DWMA 4FD5A 4NJRA 4MY0A 4C7HA 2B3UA 4KVOE 2Q43A 2QYVA 4K30A 3L2NA 4P4EA 2J8RA 2CIJA 2C6PA 5AG6A 2JBKA 2I79A 1CP7A 4AVBA 5JH9A 2FIWA 2PJ2A 2B4BA 2DEAA 2Z3OA 5G20A 1F2OA 4HKFA 5CNPA 1IIDA 2PIYA 3D67A 1ZLIA 4OC4A 1M1DA 1TF9A 4Z65A 1ZG9A 2FXFA 2AFOA 5J8CA 3UY5A 3B8GA 1QSTA 2Q4ZA 3SJFA 4H6ZA 4CRZB 4RI1A 3RYOA 1FT7A 3SI0A 1HDUA 2JEWA 4AVAA 2PR1A 4EFDA 2XEJA 1Z4EA 2PR8A 1Y7EA 1CPXA 1PUAA 1ELMP 3PB4X 3TOAA 2IJZA 2Q4YA 1PYTB 2QIRA 2PRBA 4KSAA 3F0AA 2Z10A 3NFZA 1M4IA 3R9FA 3QNVA 4ZX8A 5GCNA 3RBUA 1KZFA 1K4JA 1NSLA 1YGHA 1TKHA 3IFEA 1HDQA 2ATRA 3RZAA 4R9MA 4Y49B 2ABZA 3RNZA 2PJ7A 3RO0A 3IIBA 3NH5A 3CXQA 1FY7A 4OC5A 4OC2A 2PJBA 4M6IA 5C88A 2WYRA 5H84A 1Z8TA 2VZZA 4M6GA 4PPZA 1Q2CA 2IMOA 4KOVA 4PXDA 5K8NA 3VH9A 2EBJA 2VEZA 3D7GA 4KSFA 2VBQA 3IWEA 5JGFA 4UCMA 1M44A 3TE4A 2PSWA 3T8WA 4UEZA 3SXOA 3FJUA 2EVNA 3I9SA 2G3AA 4X5KA 1IY7A 1AMPA 5LYFA 2AE6A 2JDCA 1IYKA 4OC1A 4MCQA 1YVKA 4ZY2A 1S7LA 1S7KA 1YLOA 2BEIA 2GREA 1IB1E 2QJ8A 2B4DB 3JTKA 4PXEA 5G21A 2PC1A 5H86A 3TTHA 4MFKA 1M4DA 4BD9A 1CP6A 1QSRA 4CAWA 5AG5A 2VXKA 3VATA 4LQ6A 1VIXA 4BBHA 4HNWB 4E8OA 1VKCA 2NYQA 4GM5A 4KVXA 3S6KA 3CZXA 1X12A 2EK8A 2PE3A 3LODA 3T90A 1UWYA 4MFJA 4UIBA 1TIQA 3TO6A 4ZGYB 2F8HA 2GE3A 3KQZA 3NH8A 2NMTA 3H8FA 3DDDA 3KHZA 4LUAA 5LRKA 3D7DA 3DLJA 4AXVA 1F57A 1FNOA 4YRHA 2B3VA 2G0BA 4OADA 2HUZA 3A9LA 4F0YA 4M3SA 1KUYA 3PBBA 4PSXA 1VHSA 2GFQA 4I49A 4KLVA 2WSAA 3GKRA 4JWPA 1AYEA 2R1IA 2PDOA 4TWEA 1QSOA 2X7BA 2J8NA 4P6YA 4DYOA 4PK2A 1MK4A 2VZYA 3KR4A 4NGSA 1I1DA 4YFJA 5HMNA 2A4NA 3TFYA 4NGPA 4MCRA 4NSQA 4A30A 2XEIA 3KHXA 4JZ0A 3FECA 2AFMA 2ZXVA 1AUGA 4FWUA 4L89A 2ZENA 1Y0YA 1S5KA 1ON0A 4J3GA 3B35A 4R6TA 3FX6A 1OBRA 2KCWA 1Y0RA 4CPAA 2CNMA 2B5GB 3GY9A 4XNHC 2CF4A 4CYPA 2FS5A 2JBJA 3NE8A 4X3RA 5LYDA 2G3TA 4OP4A 2ZEFA 3V7ZA 4JLYA 1V0CA 3LMSA 2Q0YA 4UBRA 3D2PA 4ZBGA 4A32A 4R8FA 1Z8LA 5HVFA 4R7MA 3B7IA 3OWCA 1I21A 3DR8A 3ISXA 4CGPA 4F9VA 3TOBA 2OU2A 4R57A 4YU9A 4A37A 1Y9KA 1MJBA 3F8KA 2O4HA 3IC1A 1MJAA 2J9AA 3LD2A 4G1PA 2P6GA 4U5YA 4U9ZA 2AFXA 2G9DA 4H6UA 4JXRA 4KLWA 5AG4A 2Q7SA 2YNCC 4FD4A 2Z3LA 1YQEA 2Q7BA 1XF8A 4C7IA 1HEEA 2ZW5A 2ODFA 4X2TA 2PQ8A 2WUUA 3FNCA 4EWTA 4YGOA 2EK9A 4KOTA 4CGLA 1L0CA 1IOIA 1Z2LA 2POKA 1U6MA 1ZO0A 4A2ZA 4FAIA 1CX8A 4P45A 2F5IA 1J4JA 1ZG7A 3TC8A 3FRMA 2PIZA 2QECA 1BPMA 3G8WA 3PB6X 4MCSA 4OLLA 1Z8WA 4P4DA 3EFAA 1N71A 1IOFA 2D4OA 2FSRA 3V38A 1Z8XA 4CYNA 5D8NA 3R1KA 5JM6A 4HNYB 2YGWA 4KZTA 2BSWA 1IGBA 2VL1A 2CTCA 3SXNA 4OMEA 4JD6A 1F2PA 2JLMA 1M4GA 1P0HA 2Q4VA 4DUKA 3NE7A 4A33A 1WK4A 4F8ZA 1TF8A 2Y0MA 5A28A 1P4NA 1Y9WA 2PRQA 3B3CA 4MHYA 2PJ6A 3HLPA 1PU9A 3DGVA 4BMHA 2HB6A 3WT4A 2PJAA 2V8DA 4K3NA 3TT2A 2HQYA 2VQYA 2Q51A 2ZEOA 4NEXA 4QBJA 4NJQA 2AFUA 3KASA 4FD6A 4HPSA 3KL9A 2ZOGA 4JJXA 3EXNA 3KGQA 4M6HA 1XJOA 4UWIA 5JPHA 3EC4A 1JQGA 1JWQA 1PCAA 5IB9A 4R76A 1LAPA 4ONUA 4LQGA 4Q7AA 3GB0A 1B6BA 4P10A 4B11A 4B12A 3VWEA 4E2AA 1OZPA 2P0WA 4XNHB 3K9UA 1CG2A 4B5OA 3S6HA 2HV2A 2OR4A 4PSWA 4P44A 4ZX9A 5C82A 1YR0A 3SHPA 1DTDA 3PRTA 1WWZA 4KSIA 2NSMA 3S6FA 4UF4A 3BLNA 5K8OA 2J8MA 4MFLA 4KOXA 4OAEA 1IU8A 4CAVA 4UFWA 5J1QA 1X10A 3SJEA 3PBEA 4PK3A 2ZEPA 1CBXA 1XEBA 2HC9A 3DSBA 3PGPA 1BPNA 4P4BA 4H89A 2RFHA 4UEFA 3SJXA 1QQ9A 2V8HA 4NGRA 1XE4A 2C1CA 4HNXB 2Z0ZA 3BI1A 2Z3KA 4Q36A 4RUHA 4P4FA 3GUXA 4FUUA 5HVGA 3PFEA 2PCUA 2PJ4A 4CS0B 4ZI6A 2ZEEA 3B3WA 4KUAA 2OZUA 2CTBA 2EUIA 3P2FA 4Q38A 4H2KA 4NFRA 4MY3A 3S6GA 1Z4RA 2PJ1A 2K5TA 3B2YA 1LCPA 3P2HA 3WC7A 1YW4A 6CPAA 4MI4A 1XFOA 4KVME 2PJ3A 5I0CA 4WJBA 4XPDB 2V77A 3B3VA 3FB3A 4ZY0A 5HXDA 1H8LA 2R7HA 3IWGA 3KR5A 3PB9X 1QSMA 1NMTA 2Z3PA 2QMLA 4NXYA 1ARMA 3MGDA 1XMTA 2BUEA 2EO8A 1LRZA 3GYAA 2Z3MA 5FVJA 3H8GA 4OC3A 2V8GA 5E96A 3KQXA 4L8AA 3R9GA 2ARHA 2F7VA 4AG9A 3PB7X 4OKOA 1KUXA 4F9UA 2CNTA 2ZW4A 1B87A 1YLEA 4F0XA 1NSAA 3CPXA 4KOUA 1TKFA 2FVGA 2ZEGA 8CPAA 2DXQA 3K9TA 3QAHA 5KTCA 4P4IA 4JXQA 4MHDA 2ZEMA 2ZEDA 3PEIA 5ISVA 1VHEA 2PJ5A 4F6AA 4ZYQA 4XPDC 4A94A 2DF5A 3CT9A 1Z5RA 2RC4A 1IICA 4A39A 3BHXA 3IO1A 1DE4C 1YW6A 3R95A 4IHMA 5LYLA 1Q2DA 2PJ9A 3IEHA 4NGTA 5BWAB 3PB8X 4MFZA 2BL1A 1UFHA 4KUBA 3H8EA 2PJ0A 4UEEA 3SI2A 2WPXA 1S7FA 2ANPA 3VARA 1VGYA 2YNDA 5JQ4A 2IL4A 5F47A 2ZW6A 5K8MA 4MMOA 4QC6A 2FL4A 1CPSA 2R8VA 5EC4A 4DNCA 4KOSA 2ZPAA 3CPAA 3IU1A 2YNCA 2V8VA 1GHEA 4R3LA 3IGRA 3WABA 2ZW7A 4MCPA 3KZWA 4R87A 4OC0A 2XEGA 2CXAA 4MFPA 3CXPA 3MN8A 1QMUA 3D7FA 1A2ZA 2FE7A 2AFWA 3D8PA 3EO4A 4C2ZA 2OH1A 5EBVA 1LOKA 3H5ZA 2PJ8A 2Z11A 4CRYB 1RO5A 3W6SA 5F49A 5HVHA 2C6GA 2PVVA 2B5GA 2WZNA 3D66A 2GIVA 4UCNA 4NCZA 2AFSA 3E0KA 4JYWA 7CPAA 3FEEA 4B14A 1XRYA 2BO9A 2OZGA 3N7ZA 4IK2A 4MJ8A 2I3CA 2FIAA 3EY5A 2WPWA 4ORFA 3JVNA 4B13A 1NE9A 2RB7A 2YNEA 3D68A 2XEFA 5LRJA 2C27A 4UCPA 4B5PB 1I12A 4B5PA 3MRUA 2DPTA 4OIWA 4Y49C 3CDXA 4ONWA 4C2YA 4A38A 1XIXA 3JUWA 4MHNA 1BAVA 2EWBA 3WC5A 1XBUA 4UIAA 4RN7A 1TXRA 4C68A 2REFA 4TNUA 4LX9A 5G22A 3CXSA 2ZEHA 2OOTA 2ZELA 3IU2A 4UA3A 4YWYA 1R43A 3FYNA 2GLFA 4UWJA 1VHOA 5KTDA 3LACA 4MFQA 3D2MA 2BCOA 3BI0A 4IAVA 3HUVA 3PP9A 3B3TA 2DPSA 3G3SA 5DWNA 4CYOA 1YMEA 1SQHA 1BOBA 2QVPA 4FBEA 5LYIA 1ZG8A 4IUSA 3PFOA 3LWUA 4P4JA 3GIUA 1Y7RA 4MHPA 2B4DA 2VI7A 4CAXA 4MBUA 4DJLA 2Q44A 4MRIA 3SI1A 4E0AA 1ELLP 1CM0A 3B3SA 5F46A 1RXTA 4KORA 4KOWA 5G1ZA 3FF3A 3TO9A 2BOAA 2ZOFA 3FIXA 2C6CA 4IF5A
chains in the Genus database with same CATH topology
3C26A 2I00A 4A95A 3W91A 2FT0A 4UFXA 2OB0A 1YK3A 2CY2A 4GS4A 1YX0A 4QVTA 1R57A 3DR6A 2D4PA 4CGNA 3V8IA 4FD7A 2AJ6A 1CJWA 2OZHA 3QB8A 3ZZIA 1S3ZA 4R3KA 3ZJ0A 2H5MA 4KOYA 3H4QA 5AGEA 2Q04A 4QUSA 3TO7A 4AG7A 1QSNA 4XPKA 3F5BA 5F48A 3TCVA 3FBUA 5HH1A 2CNSA 3I3GA 2REEA 3PZJA 4NF1A 3VWDA 1S7NA 2JEVA 4A31A 5AG7A 5IB0A 2R98A 4CYQA 2B58A 4II9A 4B10A 1YREA 4UFVA 3KKWA 1S60A 4AB7A 4C2XA 5A27A 3DNSA 4QB9A 1YVOA 1BO4A 1IYLA 4M85A 4CGMA 4EVYA 3BJ7A 4RS2A 4CGOA 4CAFA 3FXTA 2P6EA 4CAEA 3W6XA 3T9YA 3R96A 1KUVA 2JDDA 3WR7A 1Z9UA 2FCKA 3R9EA 5IV0A 1Q2YA 4U9YA 3D3SA 4XPLA 5IX3A 4KS9A 2P6FA 2Z3NA 2GANA 4AVCA 2O28A 5KTAA 3BJ8A 4PV6A 1MJ9A 5DWMA 4FD5A 4MY0A 4C7HA 2B3UA 4KVOE 4K30A 2J8RA 5AG6A 2I79A 4AVBA 2FIWA 2B4BA 2Z3OA 5G20A 4HKFA 5CNPA 1IIDA 1M1DA 2FXFA 5J8CA 3UY5A 3B8GA 1QSTA 4CRZB 4H6ZA 4RI1A 3RYOA 4AVAA 2PR1A 1Z4EA 2PR8A 1PUAA 3TOAA 2Q4YA 2QIRA 4KSAA 2PRBA 3F0AA 2Z10A 1M4IA 3R9FA 5GCNA 1KZFA 1K4JA 1NSLA 1YGHA 2ATRA 4R9MA 4Y49B 3CXQA 1FY7A 5C88A 5H84A 2VZZA 1Q2CA 4KOVA 2VEZA 4KSFA 2VBQA 3IWEA 4UCMA 1M44A 3TE4A 2PSWA 3SXOA 2EVNA 3I9SA 2G3AA 4X5KA 2AE6A 2JDCA 1IYKA 1YVKA 1S7LA 1S7KA 2BEIA 3JTKA 1IB1E 2B4DB 5G21A 2PC1A 5H86A 3TTHA 4MFKA 1M4DA 1QSRA 5AG5A 2VXKA 4BBHA 4E8OA 4HNWB 1VKCA 3S6KA 4KVXA 3LODA 3T90A 4MFJA 4ZGYB 3TO6A 1TIQA 2GE3A 2NMTA 4LUAA 3DDDA 4YRHA 2B3VA 2G0BA 4OADA 2HUZA 3A9LA 4F0YA 4M3SA 1KUYA 4PSXA 1VHSA 4I49A 4KLVA 2WSAA 3GKRA 4JWPA 2R1IA 2PDOA 1QSOA 2X7BA 2J8NA 4PK2A 1MK4A 2VZYA 1I1DA 4YFJA 5HMNA 2A4NA 3TFYA 4NSQA 4A30A 2ZXVA 4L89A 1S5KA 1ON0A 4J3GA 2KCWA 2CNMA 2B5GB 3GY9A 4XNHC 4CYPA 2FS5A 2G3TA 4JLYA 1V0CA 2Q0YA 4UBRA 3D2PA 4ZBGA 4A32A 3OWCA 1I21A 3DR8A 4CGPA 3TOBA 2OU2A 4R57A 1Y9KA 1MJBA 3F8KA 3LD2A 1MJAA 2P6GA 4U5YA 4U9ZA 4H6UA 4JXRA 4KLWA 5AG4A 2YNCC 4FD4A 2Z3LA 2Q7BA 1XF8A 4C7IA 2ZW5A 2PQ8A 2WUUA 3FNCA 4YGOA 4KOTA 4CGLA 1L0CA 1U6MA 1ZO0A 4A2ZA 2F5IA 1J4JA 3FRMA 2QECA 3G8WA 4OLLA 3EFAA 1N71A 2D4OA 2FSRA 4CYNA 3R1KA 4HNYB 2YGWA 4KZTA 2BSWA 3SXNA 4JD6A 2JLMA 1M4GA 1P0HA 2Q4VA 3NE7A 4A33A 1WK4A 2Y0MA 5A28A 1P4NA 1Y9WA 1PU9A 4BMHA 3TT2A 2HQYA 2VQYA 4QBJA 4NEXA 4FD6A 4JJXA 3EXNA 5JPHA 4UWIA 3EC4A 4ONUA 1B6BA 4B12A 4B11A 4E2AA 3VWEA 1OZPA 2P0WA 4XNHB 3K9UA 4B5OA 3S6HA 2HV2A 4PSWA 5C82A 1YR0A 3SHPA 1WWZA 3S6FA 3BLNA 2J8MA 4MFLA 4KOXA 4OAEA 4CAVA 4UFWA 4PK3A 4CAWA 3DSBA 1XEBA 3PGPA 4H89A 1XE4A 4HNXB 2Z0ZA 2Z3KA 4Q36A 4CS0B 4KUAA 2OZUA 2EUIA 3P2FA 4Q38A 4MY3A 3S6GA 1Z4RA 2K5TA 3P2HA 4MI4A 4KVME 5I0CA 4XPDB 3FB3A 2R7HA 3IWGA 1QSMA 1NMTA 2Z3PA 2QMLA 4NXYA 3MGDA 1XMTA 2BUEA 1LRZA 3GYAA 2Z3MA 5FVJA 5E96A 4L8AA 3R9GA 2ARHA 4AG9A 1KUXA 2CNTA 2ZW4A 1B87A 1YLEA 4F0XA 4KOUA 2DXQA 5KTCA 3QAHA 4JXQA 4MHDA 5ISVA 4F6AA 4XPDC 2RC4A 1IICA 3R95A 1Q2DA 5BWAB 4MFZA 2BL1A 1UFHA 4KUBA 2WPXA 1S7FA 5JQ4A 2YNDA 2IL4A 5F47A 2ZW6A 4QC6A 2FL4A 5EC4A 2R8VA 4DNCA 4KOSA 2ZPAA 3IU1A 2YNCA 1GHEA 4R3LA 3IGRA 2ZW7A 4R87A 2CXAA 4MFPA 3CXPA 2FE7A 3D8PA 4C2ZA 3EO4A 2OH1A 5EBVA 3H5ZA 2Z11A 4CRYB 1RO5A 3W6SA 5F49A 2B5GA 2GIVA 4UCNA 4NCZA 3E0KA 4B14A 2OZGA 3N7ZA 4MJ8A 2FIAA 3EY5A 2WPWA 4ORFA 3JVNA 4B13A 1NE9A 2YNEA 2C27A 4UCPA 4B5PB 1I12A 4B5PA 5J8FA 2DPTA 4Y49C 4C2YA 1XIXA 3JUWA 4C68A 2REFA 4LX9A 5G22A 3CXSA 3IU2A 4UA3A 3FYNA 4UWJA 5KTDA 4MFQA 3D2MA 3PP9A 2DPSA 3G3SA 5DWNA 4CYOA 1SQHA 1BOBA 4IUSA 1Y7RA 2B4DA 2VI7A 4CAXA 4MBUA 2Q44A 4E0AA 1CM0A 5F46A 1RXTA 4KORA 4KOWA 5G1ZA 3TO9A 3FIXA 4IF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C26 A;  2I00 A;  3W91 A;  2FT0 A;  2OB0 A;  1YK3 A;  2CY2 A;  4GS4 A;  1YX0 A;  4QVT A;  1R57 A;  3DR6 A;  2D4P A;  3V8I A;  4FD7 A;  2AJ6 A;  1CJW A;  2OZH A;  3QB8 A;  3ZZI A;  1S3Z A;  4R3K A;  3ZJ0 A;  2H5M A;  4KOY A;  3H4Q A;  2Q04 A;  4QUS A;  3TO7 A;  4AG7 A;  1QSN A;  4XPK A;  3F5B A;  5F48 A;  3TCV A;  3FBU A;  5HH1 A;  2CNS A;  3I3G A;  2REE A;  3PZJ A;  4NF1 A;  3VWD A;  1S7N A;  2JEV A;  5IB0 A;  2R98 A;  2B58 A;  4II9 A;  1YRE A;  3KKW A;  1S60 A;  4AB7 A;  3DNS A;  4QB9 A;  1YVO A;  1BO4 A;  1IYL A;  4M85 A;  4EVY A;  3BJ7 A;  4RS2 A;  3FXT A;  2P6E A;  3W6X A;  3T9Y A;  3R96 A;  1KUV A;  2JDD A;  3WR7 A;  1Z9U A;  2FCK A;  3R9E A;  5IV0 A;  1Q2Y A;  4U9Y A;  3D3S A;  4XPL A;  5IX3 A;  2P6F A;  2GAN A;  4AVC A;  2O28 A;  5KTA A;  3BJ8 A;  4PV6 A;  1MJ9 A;  5DWM A;  4FD5 A;  4MY0 A;  2B3U A;  4KVO E;  4K30 A;  2J8R A;  2I79 A;  4AVB A;  2FIW A;  2B4B A;  4HKF A;  5CNP A;  1IID A;  1M1D A;  2FXF A;  5J8C A;  3UY5 A;  3B8G A;  1QST A;  4CRZ B;  4H6Z A;  4RI1 A;  3RYO A;  4AVA A;  2PR1 A;  1Z4E A;  2PR8 A;  1PUA A;  3TOA A;  2Q4Y A;  2QIR A;  2PRB A;  3F0A A;  2Z10 A;  1M4I A;  3R9F A;  5GCN A;  1KZF A;  1K4J A;  1NSL A;  1YGH A;  2ATR A;  4R9M A;  4Y49 B;  3CXQ A;  1FY7 A;  5C88 A;  5H84 A;  2VZZ A;  1Q2C A;  4KOV A;  2VEZ A;  2VBQ A;  1M44 A;  3TE4 A;  2PSW A;  3SXO A;  2EVN A;  3I9S A;  2G3A A;  4X5K A;  2AE6 A;  2JDC A;  1IYK A;  1YVK A;  1S7L A;  1S7K A;  2BEI A;  1IB1 E;  2B4D B;  2PC1 A;  5H86 A;  3TTH A;  1M4D A;  1QSR A;  2VXK A;  4E8O A;  4HNW B;  1VKC A;  3S6K A;  4KVX A;  3LOD A;  3T90 A;  3TO6 A;  1TIQ A;  2GE3 A;  2NMT A;  4LUA A;  3DDD A;  4YRH A;  2B3V A;  2G0B A;  4OAD A;  2HUZ A;  4F0Y A;  4M3S A;  1KUY A;  4PSX A;  1VHS A;  4I49 A;  4KLV A;  3GKR A;  4JWP A;  2R1I A;  2PDO A;  1QSO A;  2X7B A;  2J8N A;  4PK2 A;  1MK4 A;  2VZY A;  1I1D A;  4YFJ A;  5HMN A;  2A4N A;  3TFY A;  4NSQ A;  2ZXV A;  4L89 A;  1S5K A;  1ON0 A;  4J3G A;  2KCW A;  2CNM A;  2B5G B;  3GY9 A;  4XNH C;  2FS5 A;  2G3T A;  4JLY A;  1V0C A;  2Q0Y A;  4UBR A;  3D2P A;  4ZBG A;  3OWC A;  1I21 A;  3DR8 A;  3TOB A;  4R57 A;  2OU2 A;  1Y9K A;  1MJB A;  3F8K A;  3LD2 A;  1MJA A;  2P6G A;  4U5Y A;  4U9Z A;  4H6U A;  4JXR A;  4KLW A;  4FD4 A;  2Q7B A;  1XF8 A;  2ZW5 A;  2PQ8 A;  3FNC A;  4YGO A;  4KOT A;  1L0C A;  1U6M A;  2F5I A;  1J4J A;  3FRM A;  2QEC A;  3G8W A;  4OLL A;  3EFA A;  1N71 A;  2D4O A;  2FSR A;  3R1K A;  4HNY B;  4KZT A;  2BSW A;  3SXN A;  4JD6 A;  2JLM A;  1M4G A;  1P0H A;  2Q4V A;  3NE7 A;  1WK4 A;  2Y0M A;  1P4N A;  1Y9W A;  1PU9 A;  4BMH A;  3TT2 A;  2HQY A;  2VQY A;  4QBJ A;  4NEX A;  4FD6 A;  4JJX A;  3EXN A;  5JPH A;  4UWI A;  3EC4 A;  4ONU A;  1B6B A;  4E2A A;  3VWE A;  1OZP A;  2P0W A;  4XNH B;  3K9U A;  4B5O A;  3S6H A;  2HV2 A;  4PSW A;  5C82 A;  1YR0 A;  3SHP A;  1WWZ A;  3S6F A;  3BLN A;  2J8M A;  4OAE A;  4KOX A;  4CAV A;  4PK3 A;  4CAW A;  3DSB A;  1XEB A;  3PGP A;  4H89 A;  1XE4 A;  4HNX B;  2Z0Z A;  4CS0 B;  4KUA A;  2OZU A;  2EUI A;  3P2F A;  4MY3 A;  3S6G A;  1Z4R A;  2K5T A;  3P2H A;  4MI4 A;  4KVM E;  5I0C A;  4XPD B;  3FB3 A;  2R7H A;  3IWG A;  1QSM A;  1NMT A;  2QML A;  4NXY A;  3MGD A;  1XMT A;  2BUE A;  1LRZ A;  3GYA A;  5FVJ A;  5E96 A;  4L8A A;  3R9G A;  2ARH A;  4AG9 A;  1KUX A;  2CNT A;  2ZW4 A;  1B87 A;  1YLE A;  4KOU A;  2DXQ A;  5KTC A;  3QAH A;  4JXQ A;  4MHD A;  5ISV A;  4F6A A;  4XPD C;  2RC4 A;  1IIC A;  3R95 A;  1Q2D A;  2BL1 A;  1UFH A;  4KUB A;  2WPX A;  1S7F A;  5JQ4 A;  2IL4 A;  5F47 A;  2ZW6 A;  4QC6 A;  2FL4 A;  5EC4 A;  2R8V A;  4DNC A;  4KOS A;  2ZPA A;  1GHE A;  4R3L A;  3IGR A;  2ZW7 A;  4R87 A;  3CXP A;  2FE7 A;  3D8P A;  3EO4 A;  2OH1 A;  5EBV A;  2Z11 A;  4CRY B;  1RO5 A;  3W6S A;  5F49 A;  2B5G A;  2GIV A;  4NCZ A;  3E0K A;  2OZG A;  3N7Z A;  4MJ8 A;  2FIA A;  3EY5 A;  2WPW A;  4ORF A;  3JVN A;  1NE9 A;  2C27 A;  4B5P B;  1I12 A;  4B5P A;  5J8F A;  4Y49 C;  1XIX A;  3JUW A;  2REF A;  4LX9 A;  3CXS A;  4UA3 A;  3FYN A;  4UWJ A;  5KTD A;  3D2M A;  3PP9 A;  3G3S A;  5DWN A;  1SQH A;  1BOB A;  4IUS A;  1Y7R A;  2B4D A;  2VI7 A;  4CAX A;  4MBU A;  2Q44 A;  4E0A A;  1CM0 A;  5F46 A;  1RXT A;  4KOR A;  4KOW A;  3TO9 A;  3FIX A;  4IF5 A; 
#chains in the Genus database with same CATH topology
 3C26 A;  2I00 A;  4NGN A;  4GXH A;  4A95 A;  2IQ6 A;  3NH4 A;  3W91 A;  1R3N A;  1ZLH A;  2FT0 A;  3FVL A;  3IWW A;  4UFX A;  3FH4 A;  3JRU A;  2OB0 A;  1YK3 A;  5J8F A;  2CY2 A;  4GS4 A;  1YX0 A;  4QVT A;  4PXC A;  1R57 A;  3DR6 A;  3D7H A;  4MXU A;  2D4P A;  4CGN A;  3KI9 A;  1LAN A;  3V8I A;  4FD7 A;  2AJ6 A;  1CJW A;  2OZH A;  1RTQ A;  3QB8 A;  3ZZI A;  4MHZ A;  4OID A;  5DS0 A;  5CPA A;  1S3Z A;  4R3K A;  3ZJ0 A;  2H5M A;  5D29 A;  4KOY A;  3H4Q A;  5AGE A;  2Q04 A;  1Q7L A;  4W9Y A;  3FED A;  4QUS A;  3SJG A;  3TO7 A;  4WWV A;  1LAM A;  4AG7 A;  1QSN A;  4EME A;  4XPK A;  4PQA A;  3N5F A;  3F5B A;  5F48 A;  1TKJ A;  3TCV A;  3FBU A;  3WC6 A;  3IJ3 A;  5HH1 A;  2CNS A;  5ELY A;  5EMI A;  3BXM A;  3I3G A;  2REE A;  1EE3 P;  1GYT A;  3PZJ A;  3GLJ A;  4NF1 A;  3VWD A;  1S7N A;  2JEV A;  4A31 A;  3QAY A;  4ZY1 A;  5THW A;  5AG7 A;  5IB0 A;  2R98 A;  4CYQ A;  4O23 A;  5F09 A;  2B58 A;  4X8I A;  4II9 A;  2GLJ A;  4B10 A;  4B6Z A;  1YRE A;  4NGQ A;  4UFV A;  2O53 A;  3TX8 A;  3KKW A;  1S60 A;  2PVW A;  4AB7 A;  4C2X A;  5A27 A;  3DNS A;  4QB9 A;  2GU2 A;  5LRG A;  1YVO A;  1BO4 A;  1IYL A;  4M85 A;  3S9L A;  4CGM A;  4EVY A;  3BJ7 A;  4RS2 A;  3S9M A;  4CGO A;  4NGM A;  4CAF A;  1XOV A;  1YSJ A;  3D4U A;  3FXT A;  4PXB A;  2P6E A;  4CAE A;  2AFZ A;  1M4L A;  1LFW A;  3T9Y A;  3W6X A;  1ARL A;  3R96 A;  4BIN A;  1KUV A;  2JDD A;  5I4M A;  3NA6 A;  1BLL E;  3WR7 A;  3S9N A;  1Z9U A;  3RAM A;  2FCK A;  3R9E A;  5IV0 A;  1Q2Y A;  4U9Y A;  3D3S A;  4XPL A;  5K8P A;  3FMC A;  5IX3 A;  4KS9 A;  2P6F A;  2Z3N A;  2GAN A;  5CBM A;  4AVC A;  2O28 A;  1KWM A;  5KTA A;  3BJ8 A;  4PV6 A;  3K2K A;  1XMB A;  3I1U A;  2PJC A;  3ISZ A;  1MJ9 A;  5DWM A;  4FD5 A;  4NJR A;  4MY0 A;  4C7H A;  2B3U A;  4KVO E;  2Q43 A;  2QYV A;  4K30 A;  3L2N A;  4P4E A;  2J8R A;  2CIJ A;  2C6P A;  5AG6 A;  2JBK A;  2I79 A;  1CP7 A;  4AVB A;  5JH9 A;  2FIW A;  2PJ2 A;  2B4B A;  2DEA A;  2Z3O A;  5G20 A;  1F2O A;  4HKF A;  5CNP A;  1IID A;  2PIY A;  3D67 A;  1ZLI A;  4OC4 A;  1M1D A;  1TF9 A;  4Z65 A;  1ZG9 A;  2FXF A;  2AFO A;  5J8C A;  3UY5 A;  3B8G A;  1QST A;  2Q4Z A;  3SJF A;  4H6Z A;  4CRZ B;  4RI1 A;  3RYO A;  1FT7 A;  3SI0 A;  1HDU A;  2JEW A;  4AVA A;  2PR1 A;  4EFD A;  2XEJ A;  1Z4E A;  2PR8 A;  1Y7E A;  1CPX A;  1PUA A;  1ELM P;  3PB4 X;  3TOA A;  2IJZ A;  2Q4Y A;  1PYT B;  2QIR A;  2PRB A;  4KSA A;  3F0A A;  2Z10 A;  3NFZ A;  1M4I A;  3R9F A;  3QNV A;  4ZX8 A;  5GCN A;  3RBU A;  1KZF A;  1K4J A;  1NSL A;  1YGH A;  1TKH A;  3IFE A;  1HDQ A;  2ATR A;  3RZA A;  4R9M A;  4Y49 B;  2ABZ A;  3RNZ A;  2PJ7 A;  3RO0 A;  3IIB A;  3NH5 A;  3CXQ A;  1FY7 A;  4OC5 A;  4OC2 A;  2PJB A;  4M6I A;  5C88 A;  2WYR A;  5H84 A;  1Z8T A;  2VZZ A;  4M6G A;  4PPZ A;  1Q2C A;  2IMO A;  4KOV A;  4PXD A;  5K8N A;  3VH9 A;  2EBJ A;  2VEZ A;  3D7G A;  4KSF A;  2VBQ A;  3IWE A;  5JGF A;  4UCM A;  1M44 A;  3TE4 A;  2PSW A;  3T8W A;  4UEZ A;  3SXO A;  3FJU A;  2EVN A;  3I9S A;  2G3A A;  4X5K A;  1IY7 A;  1AMP A;  5LYF A;  2AE6 A;  2JDC A;  1IYK A;  4OC1 A;  4MCQ A;  1YVK A;  4ZY2 A;  1S7L A;  1S7K A;  1YLO A;  2BEI A;  2GRE A;  1IB1 E;  2QJ8 A;  2B4D B;  3JTK A;  4PXE A;  5G21 A;  2PC1 A;  5H86 A;  3TTH A;  4MFK A;  1M4D A;  4BD9 A;  1CP6 A;  1QSR A;  4CAW A;  5AG5 A;  2VXK A;  3VAT A;  4LQ6 A;  1VIX A;  4BBH A;  4HNW B;  4E8O A;  1VKC A;  2NYQ A;  4GM5 A;  4KVX A;  3S6K A;  3CZX A;  1X12 A;  2EK8 A;  2PE3 A;  3LOD A;  3T90 A;  1UWY A;  4MFJ A;  4UIB A;  1TIQ A;  3TO6 A;  4ZGY B;  2F8H A;  2GE3 A;  3KQZ A;  3NH8 A;  2NMT A;  3H8F A;  3DDD A;  3KHZ A;  4LUA A;  5LRK A;  3D7D A;  3DLJ A;  4AXV A;  1F57 A;  1FNO A;  4YRH A;  2B3V A;  2G0B A;  4OAD A;  2HUZ A;  3A9L A;  4F0Y A;  4M3S A;  1KUY A;  3PBB A;  4PSX A;  1VHS A;  2GFQ A;  4I49 A;  4KLV A;  2WSA A;  3GKR A;  4JWP A;  1AYE A;  2R1I A;  2PDO A;  4TWE A;  1QSO A;  2X7B A;  2J8N A;  4P6Y A;  4DYO A;  4PK2 A;  1MK4 A;  2VZY A;  3KR4 A;  4NGS A;  1I1D A;  4YFJ A;  5HMN A;  2A4N A;  3TFY A;  4NGP A;  4MCR A;  4NSQ A;  4A30 A;  2XEI A;  3KHX A;  4JZ0 A;  3FEC A;  2AFM A;  2ZXV A;  1AUG A;  4FWU A;  4L89 A;  2ZEN A;  1Y0Y A;  1S5K A;  1ON0 A;  4J3G A;  3B35 A;  4R6T A;  3FX6 A;  1OBR A;  2KCW A;  1Y0R A;  4CPA A;  2CNM A;  2B5G B;  3GY9 A;  4XNH C;  2CF4 A;  4CYP A;  2FS5 A;  2JBJ A;  3NE8 A;  4X3R A;  5LYD A;  2G3T A;  4OP4 A;  2ZEF A;  3V7Z A;  4JLY A;  1V0C A;  3LMS A;  2Q0Y A;  4UBR A;  3D2P A;  4ZBG A;  4A32 A;  4R8F A;  1Z8L A;  5HVF A;  4R7M A;  3B7I A;  3OWC A;  1I21 A;  3DR8 A;  3ISX A;  4CGP A;  4F9V A;  3TOB A;  2OU2 A;  4R57 A;  4YU9 A;  4A37 A;  1Y9K A;  1MJB A;  3F8K A;  2O4H A;  3IC1 A;  1MJA A;  2J9A A;  3LD2 A;  4G1P A;  2P6G A;  4U5Y A;  4U9Z A;  2AFX A;  2G9D A;  4H6U A;  4JXR A;  4KLW A;  5AG4 A;  2Q7S A;  2YNC C;  4FD4 A;  2Z3L A;  1YQE A;  2Q7B A;  1XF8 A;  4C7I A;  1HEE A;  2ZW5 A;  2ODF A;  4X2T A;  2PQ8 A;  2WUU A;  3FNC A;  4EWT A;  4YGO A;  2EK9 A;  4KOT A;  4CGL A;  1L0C A;  1IOI A;  1Z2L A;  2POK A;  1U6M A;  1ZO0 A;  4A2Z A;  4FAI A;  1CX8 A;  4P45 A;  2F5I A;  1J4J A;  1ZG7 A;  3TC8 A;  3FRM A;  2PIZ A;  2QEC A;  1BPM A;  3G8W A;  3PB6 X;  4MCS A;  4OLL A;  1Z8W A;  4P4D A;  3EFA A;  1N71 A;  1IOF A;  2D4O A;  2FSR A;  3V38 A;  1Z8X A;  4CYN A;  5D8N A;  3R1K A;  5JM6 A;  4HNY B;  2YGW A;  4KZT A;  2BSW A;  1IGB A;  2VL1 A;  2CTC A;  3SXN A;  4OME A;  4JD6 A;  1F2P A;  2JLM A;  1M4G A;  1P0H A;  2Q4V A;  4DUK A;  3NE7 A;  4A33 A;  1WK4 A;  4F8Z A;  1TF8 A;  2Y0M A;  5A28 A;  1P4N A;  1Y9W A;  2PRQ A;  3B3C A;  4MHY A;  2PJ6 A;  3HLP A;  1PU9 A;  3DGV A;  4BMH A;  2HB6 A;  3WT4 A;  2PJA A;  2V8D A;  4K3N A;  3TT2 A;  2HQY A;  2VQY A;  2Q51 A;  2ZEO A;  4NEX A;  4QBJ A;  4NJQ A;  2AFU A;  3KAS A;  4FD6 A;  4HPS A;  3KL9 A;  2ZOG A;  4JJX A;  3EXN A;  3KGQ A;  4M6H A;  1XJO A;  4UWI A;  5JPH A;  3EC4 A;  1JQG A;  1JWQ A;  1PCA A;  5IB9 A;  4R76 A;  1LAP A;  4ONU A;  4LQG A;  4Q7A A;  3GB0 A;  1B6B A;  4P10 A;  4B11 A;  4B12 A;  3VWE A;  4E2A A;  1OZP A;  2P0W A;  4XNH B;  3K9U A;  1CG2 A;  4B5O A;  3S6H A;  2HV2 A;  2OR4 A;  4PSW A;  4P44 A;  4ZX9 A;  5C82 A;  1YR0 A;  3SHP A;  1DTD A;  3PRT A;  1WWZ A;  4KSI A;  2NSM A;  3S6F A;  4UF4 A;  3BLN A;  5K8O A;  2J8M A;  4MFL A;  4KOX A;  4OAE A;  1IU8 A;  4CAV A;  4UFW A;  5J1Q A;  1X10 A;  3SJE A;  3PBE A;  4PK3 A;  2ZEP A;  1CBX A;  1XEB A;  2HC9 A;  3DSB A;  3PGP A;  1BPN A;  4P4B A;  4H89 A;  2RFH A;  4UEF A;  3SJX A;  1QQ9 A;  2V8H A;  4NGR A;  1XE4 A;  2C1C A;  4HNX B;  2Z0Z A;  3BI1 A;  2Z3K A;  4Q36 A;  4RUH A;  4P4F A;  3GUX A;  4FUU A;  5HVG A;  3PFE A;  2PCU A;  2PJ4 A;  4CS0 B;  4ZI6 A;  2ZEE A;  3B3W A;  4KUA A;  2OZU A;  2CTB A;  2EUI A;  3P2F A;  4Q38 A;  4H2K A;  4NFR A;  4MY3 A;  3S6G A;  1Z4R A;  2PJ1 A;  2K5T A;  3B2Y A;  1LCP A;  3P2H A;  3WC7 A;  1YW4 A;  6CPA A;  4MI4 A;  1XFO A;  4KVM E;  2PJ3 A;  5I0C A;  4WJB A;  4XPD B;  2V77 A;  3B3V A;  3FB3 A;  4ZY0 A;  5HXD A;  1H8L A;  2R7H A;  3IWG A;  3KR5 A;  3PB9 X;  1QSM A;  1NMT A;  2Z3P A;  2QML A;  4NXY A;  1ARM A;  3MGD A;  1XMT A;  2BUE A;  2EO8 A;  1LRZ A;  3GYA A;  2Z3M A;  5FVJ A;  3H8G A;  4OC3 A;  2V8G A;  5E96 A;  3KQX A;  4L8A A;  3R9G A;  2ARH A;  2F7V A;  4AG9 A;  3PB7 X;  4OKO A;  1KUX A;  4F9U A;  2CNT A;  2ZW4 A;  1B87 A;  1YLE A;  4F0X A;  1NSA A;  3CPX A;  4KOU A;  1TKF A;  2FVG A;  2ZEG A;  8CPA A;  2DXQ A;  3K9T A;  3QAH A;  5KTC A;  4P4I A;  4JXQ A;  4MHD A;  2ZEM A;  2ZED A;  3PEI A;  5ISV A;  1VHE A;  2PJ5 A;  4F6A A;  4ZYQ A;  4XPD C;  4A94 A;  2DF5 A;  3CT9 A;  1Z5R A;  2RC4 A;  1IIC A;  4A39 A;  3BHX A;  3IO1 A;  1DE4 C;  1YW6 A;  3R95 A;  4IHM A;  5LYL A;  1Q2D A;  2PJ9 A;  3IEH A;  4NGT A;  5BWA B;  3PB8 X;  4MFZ A;  2BL1 A;  1UFH A;  4KUB A;  3H8E A;  2PJ0 A;  4UEE A;  3SI2 A;  2WPX A;  1S7F A;  2ANP A;  3VAR A;  1VGY A;  2YND A;  5JQ4 A;  2IL4 A;  5F47 A;  2ZW6 A;  5K8M A;  4MMO A;  4QC6 A;  2FL4 A;  1CPS A;  2R8V A;  5EC4 A;  4DNC A;  4KOS A;  2ZPA A;  3CPA A;  3IU1 A;  2YNC A;  2V8V A;  1GHE A;  4R3L A;  3IGR A;  3WAB A;  2ZW7 A;  4MCP A;  3KZW A;  4R87 A;  4OC0 A;  2XEG A;  2CXA A;  4MFP A;  3CXP A;  3MN8 A;  1QMU A;  3D7F A;  1A2Z A;  2FE7 A;  2AFW A;  3D8P A;  3EO4 A;  4C2Z A;  2OH1 A;  5EBV A;  1LOK A;  3H5Z A;  2PJ8 A;  2Z11 A;  4CRY B;  1RO5 A;  3W6S A;  5F49 A;  5HVH A;  2C6G A;  2PVV A;  2B5G A;  2WZN A;  3D66 A;  2GIV A;  4UCN A;  4NCZ A;  2AFS A;  3E0K A;  4JYW A;  7CPA A;  3FEE A;  4B14 A;  1XRY A;  2BO9 A;  2OZG A;  3N7Z A;  4IK2 A;  4MJ8 A;  2I3C A;  2FIA A;  3EY5 A;  2WPW A;  4ORF A;  3JVN A;  4B13 A;  1NE9 A;  2RB7 A;  2YNE A;  3D68 A;  2XEF A;  5LRJ A;  2C27 A;  4UCP A;  4B5P B;  1I12 A;  4B5P A;  3MRU A;  2DPT A;  4OIW A;  4Y49 C;  3CDX A;  4ONW A;  4C2Y A;  4A38 A;  1XIX A;  3JUW A;  4MHN A;  1BAV A;  2EWB A;  3WC5 A;  1XBU A;  4UIA A;  4RN7 A;  1TXR A;  4C68 A;  2REF A;  4TNU A;  4LX9 A;  5G22 A;  3CXS A;  2ZEH A;  2OOT A;  2ZEL A;  3IU2 A;  4UA3 A;  4YWY A;  1R43 A;  3FYN A;  2GLF A;  4UWJ A;  1VHO A;  5KTD A;  3LAC A;  4MFQ A;  3D2M A;  2BCO A;  3BI0 A;  4IAV A;  3HUV A;  3PP9 A;  3B3T A;  2DPS A;  3G3S A;  5DWN A;  4CYO A;  1YME A;  1SQH A;  1BOB A;  2QVP A;  4FBE A;  5LYI A;  1ZG8 A;  4IUS A;  3PFO A;  3LWU A;  4P4J A;  3GIU A;  1Y7R A;  4MHP A;  2B4D A;  2VI7 A;  4CAX A;  4MBU A;  4DJL A;  2Q44 A;  4MRI A;  3SI1 A;  4E0A A;  1ELL P;  1CM0 A;  3B3S A;  5F46 A;  1RXT A;  4KOR A;  4KOW A;  5G1Z A;  3FF3 A;  3TO9 A;  2BOA A;  2ZOF A;  3FIX A;  2C6C A;  4IF5 A; 
#chains in the Genus database with same CATH homology
 3C26 A;  2I00 A;  4A95 A;  3W91 A;  2FT0 A;  4UFX A;  2OB0 A;  1YK3 A;  2CY2 A;  4GS4 A;  1YX0 A;  4QVT A;  1R57 A;  3DR6 A;  2D4P A;  4CGN A;  3V8I A;  4FD7 A;  2AJ6 A;  1CJW A;  2OZH A;  3QB8 A;  3ZZI A;  1S3Z A;  4R3K A;  3ZJ0 A;  2H5M A;  4KOY A;  3H4Q A;  5AGE A;  2Q04 A;  4QUS A;  3TO7 A;  4AG7 A;  1QSN A;  4XPK A;  3F5B A;  5F48 A;  3TCV A;  3FBU A;  5HH1 A;  2CNS A;  3I3G A;  2REE A;  3PZJ A;  4NF1 A;  3VWD A;  1S7N A;  2JEV A;  4A31 A;  5AG7 A;  5IB0 A;  2R98 A;  4CYQ A;  2B58 A;  4II9 A;  4B10 A;  1YRE A;  4UFV A;  3KKW A;  1S60 A;  4AB7 A;  4C2X A;  5A27 A;  3DNS A;  4QB9 A;  1YVO A;  1BO4 A;  1IYL A;  4M85 A;  4CGM A;  4EVY A;  3BJ7 A;  4RS2 A;  4CGO A;  4CAF A;  3FXT A;  2P6E A;  4CAE A;  3W6X A;  3T9Y A;  3R96 A;  1KUV A;  2JDD A;  3WR7 A;  1Z9U A;  2FCK A;  3R9E A;  5IV0 A;  1Q2Y A;  4U9Y A;  3D3S A;  4XPL A;  5IX3 A;  4KS9 A;  2P6F A;  2Z3N A;  2GAN A;  4AVC A;  2O28 A;  5KTA A;  3BJ8 A;  4PV6 A;  1MJ9 A;  5DWM A;  4FD5 A;  4MY0 A;  4C7H A;  2B3U A;  4KVO E;  4K30 A;  2J8R A;  5AG6 A;  2I79 A;  4AVB A;  2FIW A;  2B4B A;  2Z3O A;  5G20 A;  4HKF A;  5CNP A;  1IID A;  1M1D A;  2FXF A;  5J8C A;  3UY5 A;  3B8G A;  1QST A;  4CRZ B;  4H6Z A;  4RI1 A;  3RYO A;  4AVA A;  2PR1 A;  1Z4E A;  2PR8 A;  1PUA A;  3TOA A;  2Q4Y A;  2QIR A;  4KSA A;  2PRB A;  3F0A A;  2Z10 A;  1M4I A;  3R9F A;  5GCN A;  1KZF A;  1K4J A;  1NSL A;  1YGH A;  2ATR A;  4R9M A;  4Y49 B;  3CXQ A;  1FY7 A;  5C88 A;  5H84 A;  2VZZ A;  1Q2C A;  4KOV A;  2VEZ A;  4KSF A;  2VBQ A;  3IWE A;  4UCM A;  1M44 A;  3TE4 A;  2PSW A;  3SXO A;  2EVN A;  3I9S A;  2G3A A;  4X5K A;  2AE6 A;  2JDC A;  1IYK A;  1YVK A;  1S7L A;  1S7K A;  2BEI A;  3JTK A;  1IB1 E;  2B4D B;  5G21 A;  2PC1 A;  5H86 A;  3TTH A;  4MFK A;  1M4D A;  1QSR A;  5AG5 A;  2VXK A;  4BBH A;  4E8O A;  4HNW B;  1VKC A;  3S6K A;  4KVX A;  3LOD A;  3T90 A;  4MFJ A;  4ZGY B;  3TO6 A;  1TIQ A;  2GE3 A;  2NMT A;  4LUA A;  3DDD A;  4YRH A;  2B3V A;  2G0B A;  4OAD A;  2HUZ A;  3A9L A;  4F0Y A;  4M3S A;  1KUY A;  4PSX A;  1VHS A;  4I49 A;  4KLV A;  2WSA A;  3GKR A;  4JWP A;  2R1I A;  2PDO A;  1QSO A;  2X7B A;  2J8N A;  4PK2 A;  1MK4 A;  2VZY A;  1I1D A;  4YFJ A;  5HMN A;  2A4N A;  3TFY A;  4NSQ A;  4A30 A;  2ZXV A;  4L89 A;  1S5K A;  1ON0 A;  4J3G A;  2KCW A;  2CNM A;  2B5G B;  3GY9 A;  4XNH C;  4CYP A;  2FS5 A;  2G3T A;  4JLY A;  1V0C A;  2Q0Y A;  4UBR A;  3D2P A;  4ZBG A;  4A32 A;  3OWC A;  1I21 A;  3DR8 A;  4CGP A;  3TOB A;  2OU2 A;  4R57 A;  1Y9K A;  1MJB A;  3F8K A;  3LD2 A;  1MJA A;  2P6G A;  4U5Y A;  4U9Z A;  4H6U A;  4JXR A;  4KLW A;  5AG4 A;  2YNC C;  4FD4 A;  2Z3L A;  2Q7B A;  1XF8 A;  4C7I A;  2ZW5 A;  2PQ8 A;  2WUU A;  3FNC A;  4YGO A;  4KOT A;  4CGL A;  1L0C A;  1U6M A;  1ZO0 A;  4A2Z A;  2F5I A;  1J4J A;  3FRM A;  2QEC A;  3G8W A;  4OLL A;  3EFA A;  1N71 A;  2D4O A;  2FSR A;  4CYN A;  3R1K A;  4HNY B;  2YGW A;  4KZT A;  2BSW A;  3SXN A;  4JD6 A;  2JLM A;  1M4G A;  1P0H A;  2Q4V A;  3NE7 A;  4A33 A;  1WK4 A;  2Y0M A;  5A28 A;  1P4N A;  1Y9W A;  1PU9 A;  4BMH A;  3TT2 A;  2HQY A;  2VQY A;  4QBJ A;  4NEX A;  4FD6 A;  4JJX A;  3EXN A;  5JPH A;  4UWI A;  3EC4 A;  4ONU A;  1B6B A;  4B12 A;  4B11 A;  4E2A A;  3VWE A;  1OZP A;  2P0W A;  4XNH B;  3K9U A;  4B5O A;  3S6H A;  2HV2 A;  4PSW A;  5C82 A;  1YR0 A;  3SHP A;  1WWZ A;  3S6F A;  3BLN A;  2J8M A;  4MFL A;  4KOX A;  4OAE A;  4CAV A;  4UFW A;  4PK3 A;  4CAW A;  3DSB A;  1XEB A;  3PGP A;  4H89 A;  1XE4 A;  4HNX B;  2Z0Z A;  2Z3K A;  4Q36 A;  4CS0 B;  4KUA A;  2OZU A;  2EUI A;  3P2F A;  4Q38 A;  4MY3 A;  3S6G A;  1Z4R A;  2K5T A;  3P2H A;  4MI4 A;  4KVM E;  5I0C A;  4XPD B;  3FB3 A;  2R7H A;  3IWG A;  1QSM A;  1NMT A;  2Z3P A;  2QML A;  4NXY A;  3MGD A;  1XMT A;  2BUE A;  1LRZ A;  3GYA A;  2Z3M A;  5FVJ A;  5E96 A;  4L8A A;  3R9G A;  2ARH A;  4AG9 A;  1KUX A;  2CNT A;  2ZW4 A;  1B87 A;  1YLE A;  4F0X A;  4KOU A;  2DXQ A;  5KTC A;  3QAH A;  4JXQ A;  4MHD A;  5ISV A;  4F6A A;  4XPD C;  2RC4 A;  1IIC A;  3R95 A;  1Q2D A;  5BWA B;  4MFZ A;  2BL1 A;  1UFH A;  4KUB A;  2WPX A;  1S7F A;  5JQ4 A;  2YND A;  2IL4 A;  5F47 A;  2ZW6 A;  4QC6 A;  2FL4 A;  5EC4 A;  2R8V A;  4DNC A;  4KOS A;  2ZPA A;  3IU1 A;  2YNC A;  1GHE A;  4R3L A;  3IGR A;  2ZW7 A;  4R87 A;  2CXA A;  4MFP A;  3CXP A;  2FE7 A;  3D8P A;  4C2Z A;  3EO4 A;  2OH1 A;  5EBV A;  3H5Z A;  2Z11 A;  4CRY B;  1RO5 A;  3W6S A;  5F49 A;  2B5G A;  2GIV A;  4UCN A;  4NCZ A;  3E0K A;  4B14 A;  2OZG A;  3N7Z A;  4MJ8 A;  2FIA A;  3EY5 A;  2WPW A;  4ORF A;  3JVN A;  4B13 A;  1NE9 A;  2YNE A;  2C27 A;  4UCP A;  4B5P B;  1I12 A;  4B5P A;  5J8F A;  2DPT A;  4Y49 C;  4C2Y A;  1XIX A;  3JUW A;  4C68 A;  2REF A;  4LX9 A;  5G22 A;  3CXS A;  3IU2 A;  4UA3 A;  3FYN A;  4UWJ A;  5KTD A;  4MFQ A;  3D2M A;  3PP9 A;  2DPS A;  3G3S A;  5DWN A;  4CYO A;  1SQH A;  1BOB A;  4IUS A;  1Y7R A;  2B4D A;  2VI7 A;  4CAX A;  4MBU A;  2Q44 A;  4E0A A;  1CM0 A;  5F46 A;  1RXT A;  4KOR A;  4KOW A;  5G1Z A;  3TO9 A;  3FIX A;  4IF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...