3CXUA

Structure of a y149f mutant of epoxide hydrolase from solanum tuberosum
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
320
structure length
320
Chain Sequence
KKIEHKMVAVNGLNMHLAELGEGPTILFIHGFPELWYSWRHQMVYLAERGYRAVAPDLRGYGDTTGAPLNDPSKFSILHLVGDVVALLEAIAPNEEKVFVVAHDWGALIAWHLCLFRPDKVKALVNLSVHFSKRNPKMNVVEGLKAIFGEDHYISRFQVPGEIEAEFAPIGAKSVLKKILTYRDPAPFYFPKGKGLEAIPDAPVALSSWLSEEELDYYANKFEQTGFTGAVNYYRALPINWELTAPWTGAQVKVPTKFIVGEFDLVYHIPGAKEYIHNGGFKKDVPLLEEVVVLEGAAHFVSQERPHEISKHIYDFIQKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epoxide hydrolase
publication title Removal of distal protein-water hydrogen bonds in a plant epoxide hydrolase increases catalytic turnover but decreases thermostability
pubmed doi rcsb
source organism Solanum tuberosum
molecule tags Hydrolase
total genus 117
structure length 320
sequence length 320
chains with identical sequence B
ec nomenclature ec 3.3.2.10: Soluble epoxide hydrolase.
pdb deposition date 2008-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3cxuA00
4BZZA 2AJCA 3VJLA 3HXKA 1NX9A 1E66A 1Q84A 2DR0A 2G5PA 3DKKA 3EQ9A 4DNPA 1HDEA 2JEZA 4QDOA 5D3KA 1GPKA 1DWQA 1H2ZA 3STTA 2ONCA 5ALFA 4UFPA 3AINA 3NUZA 3C87A 3V1KA 4K5QA 4OB6A 3KOOA 3KWFA 1SCIA 1LPMA 1QGED 4OD0A 3ESBA 1BN6A 5DLPA 3G9TA 2RONA 4B6GA 4BDTA 3WJ2A 1EA5A 1SCKA 5J3JA 4OYLA 3C8DA 1ORWA 4DLNA 5K3AA 4PSUA 5HKBA 1H2YA 1CFJA 4G8BA 2WILA 2OCIA 3FWHA 1U8EA 3WK5A 4IH1A 4Q05A 1XZGA 2WG0A 4G8DA 1QO9A 2QR5A 4XX1A 5JYCA 1WB6A 3PDCA 3F9CA 4ZREA 1A8QA 2VAXA 3BF8A 4ZI5A 4ETWA 4BP8A 5FDFA 4BBZA 2OGTA 4PV7A 4RGYA 4WY5A 3ZI7A 1XZCA 2ZYHA 4B85A 3HRHA 4U2EA 2QJRA 4BC1A 3V1LA 1IUNA 5CBKA 4UUQA 4BAUA 3WKCA 4MQMA 4W1SA 1CUFA 3C6XA 3Q8WA 1DQZA 3C5VA 4P93A 1QOZA 5AM2A 3F8SA 3O4IA 3D0KA 4Y9SA 4X71A 3IDAA 2ZVDA 3ZPXA 2ZSIA 3BDIA 1P0PA 3WWPA 1L7QA 4N5IX 2CZQA 3R40A 1QONA 2ES4A 5HF6A 4FDMA 5K5EA 5T4HA 2Y6UA 2XUHA 1MX9A 3VISA 4LXIA 2BUCA 4KJXA 1J2EA 1CUXA 4Q3LA 5FXMA 2RI6A 5HK9A 2IIVA 1MN6A 2O7VA 3VXKA 2C5GA 1T2NA 1ZI6A 2ACEA 4UBJA 1XLWA 1EHYA 5AM4A 1K6EA 1PJAA 1FFBA 5EGNA 3FAKA 1TCAA 1QO7A 4AQDA 3WK7A 4KAFA 4J0GA 3EIOA 1XROA 1DT3A 4EY6A 3B5EA 3FYUB 3IA2A 3ZLVA 2DHEA 4N5HX 3W9UA 5A2GA 5ALKA 4H7KA 3FSGD 4DMKA 3ESAA 3R41A 4L72A 3BXPA 4X7BA 4QLAA 3A6ZA 3TEJA 1YR2A 2OQIA 5T4EA 1GKLA 2DHDA 1UKAA 2AJ8A 5T4BA 1MX5A 3Q0TA 2WFLB 2XMRA 4L3WA 5HF8A 1R9NA 1NU6A 4L9AA 5EIHA 3WYNA 2H7CA 7YASA 2VT7A 2GYVA 5CT5A 5LKRA 4LXGA 2ZJ6A 5JZSA 1XQVA 3O4JA 4MYDA 5K3EA 1TK3A 1CEXA 1TKRA 2JGIA 4OSEA 1UFOA 1ZJ4A 4MWTA 1UKBA 3IULA 3ED1A 1AUOA 4B0OA 2C0PA 3OM8A 1UOOA 2PSJA 5ALOA 1W6RA 3G02A 3H1AA 4G5XA 3C5WP 3BWXA 5JIBA 3GUUA 2EEPA 4QDUA 3DCNA 3R3VA 4QWWA 1JJIA 4QDTA 5JD5A 6YASA 1MAAA 2X5XA 1R3DA 4PSDA 5ALMA 4X97A 1P0MA 4J3JA 1CRLA 1E8NA 1CUAA 4GHWA 1K63A 1ZOIA 3HABA 2I3DA 4F0JA 3H18A 2XUKA 5JASA 1BRTA 4AO6A 2WFZA 1F0PA 2XE4A 2VATA 4ITVA 4Y2SA 2YXPX 1EB9A 2BGNA 1YSCA 2DFPA 3WQHA 5E4JA 1VA5A 4KRYA 5DTIA 5CXUA 4Y2YA 4NS4A 3WKAA 1XZDA 4U2GA 1QIHA 1WCYA 1E8DA 2C7BA 3WK9A 3GBSA 4CIAA 3VDXA 4WFJA 5LZ9A 4B83A 4B81A 2JGJA 1XZKA 5K3FB 4CG3A 3HJUA 3I28A 2XUGA 5DJ5A 4JEIA 2CMFA 3BL8A 3QH4A 3F67A 3B12A 2HDWA 3CN9A 3DLTA 1LPSA 4FNGA 4Q3OA 3RM3A 2XLCA 1B41A 3WMRA 1T4MA 2I78A 3IUJA 3IUMA 4V2IA 4Y2VA 5DTJA 3OG9A 4A23A 3DL4A 4H0CA 4Y2TA 1UOQA 1CUVA 3STYA 5A7GA 3K9BA 2XUFA 1QLWA 3C70A 3WK6A 4E15A 2X8BA 2HRQA 5AI6A 4AN1A 5AI5A 1HPLA 2XMZA 3DOIA 2RHTA 3PUIA 4X6XA 4BB0A 1Y37A 3EQ8A 3ANSA 2XQJA 4QDXA 4N8EA 2QS9A 3H04A 2QUBA 1H22A 4WY8A 4DNQA 1BU8A 5LP1A 1YA4A 3SK0A 3WWCA 5HKAA 1ORVA 2D0DA 3D4LA 2GYUA 1G42A 1YAJA 4CCYA 4DMHA 4ZRDA 3QBJA 2HA2A 1N8SA 4OPMA 1JT2A 1G4HA 3I6YA 1TAHA 2PSFA 1QIGA 3BJRA 2QXUA 1UK9A 4L0CA 3HYSA 5DYTA 3FBWA 1DWOA 3C6BA 5EHXA 4AXBA 4CFSA 1QIKA 5AHXA 4UHEA 4OU5A 3R3UA 1AQLA 2H1IA 1XQXA 3GZJA 5ALTA 5CT9A 2HU8A 1WB4A 5AOBA 4IO0A 2ZYSA 4DIUA 2PKYX 3KXPA 1SCQA 1TRHA 4EUSA 2OQVA 2ZJFA 2OCKA 3W9BA 4LYEA 2XQIA 1AGYA 2DQYA 4GBGA 1W52X 1CUGA 2B4KA 1R9MA 1JKMA 4GLBA 2VJBA 1ETHA 4G8CA 1GKKA 5A7FA 2HM7A 3MGAA 1UKCA 5DYWA 3FCXA 1JJBA 4WFKA 4K6KA 1VE6A 3PE6A 4QZVA 1RWQA 1XZHA 2DCMA 1P0IA 2WHPB 3RKSA 3H1BA 4W63A 4E46A 1EVEA 4K6GA 3VJMA 5FOQA 4YASA 2WG1A 3NWOA 4BRZA 2PBLA 5DNWA 1ZJ5A 2LIPA 5LKAA 4AZ0A 2JGKA 5JAPA 4W1PA 5BV7A 3GROA 1ACJA 4BAGA 2ZJ7A 4QWMA 1RYYA 1OCEA 2JGMA 5EIAA 3ESCA 1QIEA 5ALNA 3AZQA 4AZ3A 1Y7IA 4ZV7A 1MO2A 2R8BA 1WB5A 4RPCA 1QTIA 5FPPA 5AIBA 3C8HA 2B9VA 4Y7DA 4Y2QA 4H7JA 4X6UA 1HQDA 4YPVA 4HXEB 4CCYB 2HFKA 3WA7A 2PSHA 2O2GA 5E4TA 4WDRA 2PPLA 1UXOA 2FUKA 1AMNA 1LPNA 2D5LA 5AIAA 4BC0A 3P2MA 2BUAA 4GWLA 4JUIA 4KR0A 3I6MA 5H3HA 3FYUC 3LIIA 3IB3A 4X6YA 3H2KA 4DTCA 3WLAA 1THGA 4BVJA 4KACA 5LIPA 1JMKC 2GBCA 4BE9A 3LLCA 5ALGA 4UBIA 4QNNA 1CUHA 5HFAA 3SWWA 1MX1A 5K3DA 5AKGA 3OPMA 3QMVA 1H23A 1WM1A 2VJDA 1CUCA 2DQZA 3L1JA 2GBGA 4O08A 1R88A 1CQWA 2XMSA 4BAZA 5AKEA 2QOEA 3DYVA 1DQYA 3AJAA 1XRMA 3DJYA 4QLOA 2BAGA 5HZGA 1CUDA 3G9XA 1BEEA 1L7AA 4GEGA 1E5TA 4KAAA 4MQLA 5AM3A 3M83A 3HSSA 1ZICA 3STXA 3DEAA 5JAHA 3FYUA 3FNBA 4C87A 1A8SA 3QITA 1LGYA 1TIBA 5SYNA 4HVTA 1QJ4A 2GBIA 2BJHA 1VXOA 3HC7A 5E2IA 1XZBA 4DM7A 4FBLA 4WCVA 1AURA 2CBGA 2OAEA 1LPPA 5ALPA 2WFLA 5E4YA 3ZWQA 3D7RA 1FFDA 5CH5A 1E3QA 5ALWA 4EY5A 3V1NA 2WIKA 5HK8A 5EI5A 3R3XA 1CPYA 3X3HA 5AK5A 4XJVA 3F98A 4C88A 4KE7A 4KAJA 4FFWA 3FSGA 1EB8A 2E3JA 3BIWA 1DT5A 5DYYA 2PX6A 1VJ5A 1HBJA 2Z8XA 1R4ZA 4Q82A 4H77A 2VTVA 5EFZA 4BP9A 3K2IA 3STUA 1GQSA 3D3NA 1Q83A 3F96A 4UHCA 4EHBA 3AZOA 1UK8A 3GA7A 2J4FA 4N8SA 2OPHA 1USWA 5YASA 3RARA 3ESDA 2Y2UA 3OOSA 5AK3A 3O9VA 2XQFA 3U0VA 2HHAA 4X94A 5C81A 2WJ4A 2HL6A 3BF7A 5AKIA 3WYDA 2YH2A 2BKLA 5CRIA 4GXNA 4FFVA 3F97A 4OB8A 2V9ZA 2B61A 3I2KA 2XMGA 4C4ZA 5JADA 1E8MA 2XB6A 4LKOA 1OILA 3BJMA 4PNZA 5C8ZA 4W1RA 1J1IA 3VKFA 3KWJA 4G4GA 2QXTA 4HZGA 4EY4A 1GQRA 4DMFA 5ALJA 1M33A 4CG1A 3W04A 4QA9A 4HXGA 4FBMA 1ZI8A 1FFEA 4MJ3A 1EDDA 5IVIA 5ALEA 5K3FA 3WL8A 3PF9A 5ALHA 1LPBB 5FLKA 4BATA 2WLSA 1EK2A 4Q1VA 1EINA 1YA8A 5SYMA 2OAGA 3H2GA 2CB9A 1MNQA 5C8XA 4PW0A 4FLFA 5A71A 4BYMA 2HADA 3S8YA 3VJKA 3QPCA 1ZI9A 1C7JA 1UT6A 3C45A 4J0DA 3QPDA 1Z68A 5ALQA 4B82A 3AIOA 5FUMA 1QIJA 1VOTA 5I8PA 1CVLA 4INZA 3H2HA 3E0XA 4HXFB 4OU4A 1IZ7A 3I2HA 3ICVA 5LZ2A 2XUOA 3G0IA 4UHHA 3E3AA 3AILA 1F6WA 4FWBA 1GGVA 1XQWA 1QZ3A 1XKLA 1XZMA 5D7BA 4UBMA 1XZIA 1LBSA 2FX5A 3CN7A 3HLKA 2ZYRA 5ALYA 3KDAA 4D9JA 1UK6A 4TVKA 3BIXA 5KBYA 2PUJA 2JGFA 5HF9A 5ALLA 1QTRA 4W9RA 2JGLA 3W2TA 1XRQA 4HAIA 5F4ZA 1LPOA 2VEOA 3G9ZA 1THTA 4LHEA 2O2HA 4CG2A 1DU4A 2EDCA 4EBBA 4UBKA 4HS9A 2WHQA 4P9NA 3PFBA 1BCRA 1EVQA 4X3CA 4B9AA 1MT3A 1K4YA 1ZD5A 1ZIYA 1YASA 1XZLA 3R0VA 5AOCA 2R11A 4A5SA 2YYSA 4H7HA 5T4FA 5A62A 5FP0A 4BRSA 3OC0A 2DSNA 2QUAA 5K3CA 4YK7A 5EHNA 2CKMA 2QTBA 4DYHA 2PSEA 4UHDA 5LZ5A 4I3FA 3HACA 4QEKA 3DQZA 5ALRA 5CW2A 3AFIA 2VA9A 3O4GA 3R3WA 1BS9A 4AMYA 3QMWA 1O6GA 1EXWA 2WIDA 1XZJA 5ALXA 4MEAA 4PSCA 4GI1A 2FJPA 1GPLA 4AN0A 3C6YA 3I2GA 1SOMA 4TGLA 3L1IA 2WHPA 2XUQA 2JF0A 1DTEA 1JFRA 2HA3A 1L7RA 3OTQA 3WL6A 4UBOA 1FJ2A 2HRRA 4U2DA 4FNMA 2WG2A 3WL7A 3EQ7A 2PL5A 4H18A 2WIFA 1CUWA 3AZPA 5AOAA 1ZD3A 2OXEA 5KWIA 3WWDA 1WPXA 4G9GA 2PVSA 2V97A 1F0NA 2WSLA 5AI4A 3TGLA 5CXXA 4BVKA 1VZ2A 2PU5A 3N0TA 5LYYA 3QMMA 4DNFA 4LIPD 1TQHA 2Z8ZA 4H7FA 5ALVA 2BGRA 2RHWA 3WKDA 5AKYA 3G0CA 5AM1A 2I3ZA 4JYMA 4J0HA 1WHSA 1NU8A 5AKHA 2HA7A 2WTNA 5FRDA 1PFQA 5ALIA 1W75A 5BOVA 2FJ0A 3G8YA 4U2CA 1UK7A 4IQ4A 1QFSA 4UHBA 4X95A 2WIGA 4JYPA 4AO8A 5JZBA 3H0CA 1MNAA 4U2FA 1XRLA 3DNMA 4NZZA 2NW6A 3WK4A 2HU7A 4FHZA 4FTWA 4B7ZA 2BUBA 1MAHA 3BDVA 5CT4A 4EY7A 4M0EA 4BCCA 3WIOA 3PICA 1E89A 4ARBA 3G0DA 1A88A 4BE4A 3D2BA 4ZGBA 3FLBA 3A2NA 3H2IA 3LIPA 5FKJA 5AK4A 5HQ3B 2CUTA 1FFAA 5EHZA 3B3QA 4HTAA 4LXHA 3STVA 3V9AA 4G4JA 2G4LA 2PU7A 4M0MA 2ROQA 5JD4A 1JU4A 3FVRA 5EHQA 4J7AA 1IMJA 5C8VA 2ORYA 1VLQA 2WM2A 2H7XA 3KD2A 4FKBA 1G5FA 1MU0A 3D5EA 3RLIA 3WKBA 5A6VA 2QMQA 1C4XA 4P92A 4PO3X 4AB1A 2H7YA 4KE9A 4KE6A 4WDQA 4OUKX 1YS1X 3O95A 3VVMA 5I9IA 3I1YA 3UUFA 1JU3A 2JBWA 4XWGA 4K2AA 2GBFA 1ODCA 2XI4A 5A7HA 4ROTA 4CI9A 1XFDA 1VA4A 4KYVA 4FOLA 3FYTA 2QT9A 3HI4A 4H7IA 4IHAA 3JW8A 4MXDA 4X00A 2GYWA 3QPAA 4I19A 1XKTA 3JWEA 2UZ0A 3EBLA 4DNOA 1HKHA 2Q0XA 4FMPA 2J4CA 5AKXA 4Q3KA 1EI9A 1KEZA 1VZ3A 1UOPA 1X2BA 4CCWA 5CTAA 2ZSHA 5LLSA 5JATA 1J07A 4IH4A 5LZ7A 2WIJA 1R50A 2WJ3A 2RIPA 2WFMA 3R3ZA 4F5ZA 3CCCA 4G1FA 2HIHA 1YB7A 2JEYA 3DOHA 2XLBA 1X2EA 3I6ZA 4ZWNA 1AZWA 1XZFA 3H2JA 1JJFA 5ALSA 1F8UA 3BE8A 5K3BA 3AIMA 4GECA 2O7RA 2HA6A 2CJPA 2Z5GA 2WTMA 1K8QA 2WU4A 4GDMA 3STWA 4B80A 1BE0A 2XUAA 3CCBA 3ZLUA 3IURA 1LNSA 4Y2PA 3DL7A 3WK8A 5DWDA 4EA6A 5AI9A 3O9MA 1U4NA 3C6ZA 2Y2VA 2J3QA 5KWJA 1BN7A 1KU0A 4DMCA 5BWBA 5EIEA 1IZ8A 1GPNA 2AJBA 4S0XA 3MVEA 2WHRA 1BCSA 3GELA 2GZSA 4XVCA 4U2BA 5LZ4A 1BROA 3OURA 1XRPA 1MPXA 4PF1A 2PSDA 4C4YA 3LS2A 4C6HA 1YB6A 5ALDA 4X92A 5ALUA 3LCRA 1TCCA 2WU3A 1JI3A 2V96A 1FFCA 2Y6VA 3PF8A 3SC2A 2G5TA 4BCDA 5CT6A 4NMWA 2VSQA 5DNUA 1G66A 3W05A 5IKXA 3V1MA 2XQKA 1CUYA 3C43A 4KRXA 2XT0A 3DDUA 5IVKA 3IUNA 3ZV7A 4AMZA 2RAUA 3CXUA 3S2ZA 2CEKA 2BCEA 2I03A 3H19A 4JH0A 4G9EA 2C4HA 3E1GA 4KEAA 3WZLA 4P08A 3T52A 2AJDA 4AO7A 4WFIA 1ZD2P 1GT6A 3I1IA 2WKWA 4F60A 5CT8A 2EDAA 1CUEA 2K2QB 4RE6A 1CUZA 1W76A 1MJ5A 1SFRA 5CH8A 4J0JA 1ODSA 1N5RA 1LZKA 2VJCA 2WJ6A 3QYJA 1XLUA 1O6FA 1IUOA 2B20A 5D6OA 2HA5A 4GW3A 2QM0A 4ZXFA 4BCBA 2HA4A 1CIJA 4MYSA 2XDWA 4TPKA 1BEZA 4ARAA 5C7YA 1CUUA 3IIIA 5AP9A 3AIKA 3WI7A 2WUEA 4M0FA 3MUNA 2JIDA 1QIMA 3PFCA 4J03A 5AKKA 3QVMA 1IVYA 2HFJA 4ZV9A 1A8UA 3M81A 3FLAA 2O2IA 2GZRA 4UBLA 1EH5A 2PM8A 5CURA 1WPRA 4MEBA 5AKJA 1UWCA 3O4HA 2XMBA 4J0KA 4BDSA 4OYYA 5HF5A 2QRUA 1QFMA 5AICA 3UUEA 3JYHA 3O0DA 2W22A 2YASA 1VXRA 3YASA 4AX4A 1YS2X 2OCGA 2OG1A 3D59A 2ZYIA 1CUSA 2C0QA 2C5FA 4BZWA 4E11A 1RP1A 2PUHA 2Z3ZA 1JMYA 4QDZA 2XQGA 4BTLA 4OCZA 1W4LA 1DINA 2H9YA 4FLEA 2P8SA 1FSSA 3ICWA 4CIBA 5LZ8A 4UHFA 5IVDA 1QE3A 2G63A 4FLMA 3HEAA 5BWCA 3D2CA 3UMJA 3A70A 1B6GA 5AH0A 1P0QA 1N5MA 3PUHA 1QIDA 4EY8A 4YX9A 1ZD4A 3TJMA 4X91A 1A7UA 2AXEA 2QKYA 3T4UA 2AJLI 5FPQA 1CUIA 5HFNA 1KU6A 5I7UA 4DSAA 3LP5A 3V48A 4RNCA 5AM5A 3N2ZB 2RGUA 3WZMA 1EX9A 2VT6A 1EK1A 1XRNA 3AUKA 4N8DA 4Z49A 1U65A 4H7DA 2XUDA 1CV2A 4LYDA 3I2IA 1U2EA 2HU5A 4DSZA 2ECFA 3NGMA 4MWSA 4EZIA 5FV4A 1N1MA 1CUJA 5ALZA 3A2LA 3L1HA 3DS8A 2X76A 3PI6A 4OB7A 4JNCA 1ODTC 1QIFA 4I4CA 3R3YA 4UFNA 1VKHA 5JAOA 3WWOA 1S8OA 3EF3A 5HQ3A 5AK6A 3VVLA 2XMCA 1EDBA 3M3DA 2XMDA 3WJ1A 3DYIA 4B9EA 1J06A 1UZAA 4HRXA 1TCBA 3FVTA 1Y7HA 2OGSA 1XQYA 5AI0A 1W1IA 3KSRA 3MUOA 3WWEA 4B84A 1MTZA 1ZGBA 3H17A 5AI8A 4EB0A 4X85A 1PV1A 5CMLA 1IUPA 1XZAA 1ZGCA 4RE5A 2OCLA 3NOXA 4K6HA 2OLEA 4X93A 2WUGA 4H7EA 1LZLA 2JGEA 5AKLA 2XUJA 2WUFA 4QE3A 2DHCA 1H2WA 3WL5A 1CUBA 3FOBA 5JD6A 1GZ7A 5JANA 3SX4A 1DX6A 3RK4A 1K5PA 3K6KA 5AJHA 1VE7A 3QM1A 3U1TA 2QJWA 3ANTA 4DGQA 2HA0A 1AKNA 2IITA 3G0BA 1LPAB 1Q0RA 5ESRA 1ZIXA 2VF2A 3G7NA 3W06A 4Y2XA 1WHTA 3HZOA 5IH7A 3WIBA 1XZEA 3G9UA 2ACKA 2C58A 3I2FA 5CH3A 5D3ZA 1I6WA 1AC5A 2IX9A 1SC9A 2Y1KA 2W6CX 4Q34A 2VAVA 1LLFA 4XIIA 3A2MA 4C01A 1HL7A 1X70A 1CLEA 4W1QA 1XLVA 2XUPA 1YCDA 2V98A 2XUIA 4UBNA 1GXSA 1DWPA 4IH9A 3ILSA 3IBTA 1YAHA 5AKZA 1ISPA 1QIIA 4H35A 4NVRA 2J3DA 2BFNA 1Q0ZA 3I2JA 1R1DA 5JARA 4PQEA 2VQ6A 1D07A 1XRRA 4UPDA 5AM0A 3FLEA 2OGZA 4UFOA 4C4XA 1ACLA 2WUDA 1CR6A 3D2AA 3GFFA 2VJAA 5JAUA 3FCYA 4F21A 4B0PA 3E4DA 2QZPA 1HLGA 3IVMA 3WKEA 1C7IA 4E14A 1OXMA 3WA6A 4X90A 4G4IA 3ZLTA 2QVBA 3IUQA 4Y2JA 5IVHA 4Y2UA 4HRYA 5AO9A 5JZ9A 4WJLA 4C89A 5DNVA 5KREA 3QZUA 1LBTA 1WOMA 2Z3WA 1H2XA 5JALA 4J0CA 3TRDA 2XMQA 4A16A 3M82A 4J0IA 4BVLA 1CQZA 3DD5A 5ISMA 2WQZA 4Y2RA 1EDEA 4KE8A 4BTVA 1DX4A 3G0GA 5HCUA 1AX9A 3DKRA
chains in the Genus database with same CATH superfamily
4C7JA 1ARZA 2AEJA 2AJCA 2JAPA 3GHHA 3OHPA 3U80A 4D3XA 5J4KA 4MVJD 1I6KA 4IHJF 2IOYA 1W0CA 5DN9A 3V32A 1TO1E 2DR0A 2B8WA 2QW1A 4RVSA 1Y1TA 3DV0B 1N8TA 1W4ZA 1XJQA 2EV9A 4A8JB 3ZHTA 1FQOA 5J1TB 1O96B 2AFHE 4HQ0A 5B53A 3MYYA 2AZMA 2B8NA 4TQGA 1HDEA 3AI2A 4TV9A 4HBGA 1GNVA 3O93A 1FVFA 1G60A 4LDQA 2I7XA 4K0RA 1KI8A 3CNNA 1NVXQ 1DWQA 2EZ9A 2L18A 1P9RA 4MVYA 4V0NA 3B6JA 3QE2A 4NK4A 1C3OB 1GKIA 4MUYA 1N32B 1NYLA 4MB0A 4AZVA 2QVYX 1B1AA 3AINA 3NDJA 1SU7A 2CNWA 3NUZA 5B57C 1NXTA 1DO0A 2PG3A 1ZVQA 2A0FA 3IESA 3KOOA 4KXUA 1XDDA 5LA6B 2X23A 1RFGE 3CBGA 2WDPA 1MORA 2XVMA 4OD0A 3BTSA 5JCOC 2IHYA 3ESBA 3JARA 4QOHA 3M5WA 3CLVA 1T0PA 5DLPA 4QJBA 4F5YA 3LPDA 3E03A 2D3WA 4JOQA 4O4IB 3B20A 4YMIA 4B6GA 1JHRA 2PXXA 3BGVA 3WLJA 4I99A 2PZEA 3EW9A 1RHRA 1L8OA 1MV8A 1U04A 2CZGA 1OGYA 2J5KA 3NGLA 3Q1KA 3D6JA 4GKBA 3NUGA 3I05A 4US2R 1RKUA 1QV7A 3PRKE 2Y1DA 4DILA 1DDIA 1RAEA 4I5FA 4OXIA 4QQRA 4UEWA 3K0BA 1DUVG 4OYLA 4DLNA 3ABIA 1TC1A 2B3TA 2I1QA 3CZMA 3PUZA 4NJOA 1YQUA 5BW5A 4H7PA 3VPGA 4LMPA 4M9QA 9ATCA 2R86A 3K71B 4QPJC 3INYA 4WNCA 1CFJA 4W5QA 2IHZA 1F06A 2FQYA 2QRVB 4XCXA 5GQSA 3EF1A 3KCNA 2A3RA 2OCIA 4EKDA 1F14A 3R5XA 2UU9B 4QNRA 1Y9DA 4MITA 2F3QA 5KI6A 2JZCA 2LE0A 4Q05A 1JLSA 3RFVA 4BL5A 5DOVA 1ML3A 1SKBA 1XZGA 1NA5A 3ET5A 4A36A 2OZEA 4AZ0B 1CBUA 4NZPA 5G1OA 5FUQA 5KB3A 1J22A 3ZW9A 1TE2A 4QTZA 1V47A 2I9KA 5JJKA 1NJ5A 4Q9NA 3LSTA 1Z0DA 2XGMA 3EEBA 3QW2A 4ZU3A 1Q95A 2IIQA 1WB6A 4WBSA 3N6XA 5JYCA 3F9CA 4B6RA 1SN7A 2I4LA 3DOCA 4EHLA 3FFTA 2VAXA 3NHMA 1EJ0A 1W4CA 5DF1A 1DKPA 4NKRA 2ETXA 4AZ3B 3N70A 4BP8A 3KQUA 5JQWA 4RK4A 2BR4A 2OGTA 5JCOA 1GYRA 5EIBD 1HFJA 2GPBA 3HA7A 2PMCA 4RGYA 1YB2A 4MR7A 3LYHA 1XZCA 2JIPA 2G36A 1DHRA 2Q5LA 4WY5A 3ZI7A 1VBNA 4BEWA 4U2EA 3UJ8A 2BT4A 3FJ1A 3TVDA 4KITB 3FA2A 4BC1A 3VR5A 4I4TF 4NBKA 1C8KA 5ECYA 4L4UA 4A5OA 4OA8A 4BWGA 4P1ZA 3MWDA 1Y9EA 4URHA 4QD3A 4PYOA 2WJWA 4BAUA 2L17A 1YZ3A 1LRKA 3R5KA 4BLPA 4KFCA 1QYWA 2GK3A 2REQB 1FK8A 2I1VB 1GKUB 2D4HA 3O4IA 1E4VA 3TW4A 1N36B 1H4QA 2V7EA 4GWGA 3VI4B 1JSLA 4RM2A 3K05A 3P9XA 1DBRA 5LP6B 4K1LA 4MS3A 1U6KA 1AK9A 4X71A 2IHTA 2ZAGA 3NGXA 5ETJA 1Z6PA 3BMCA 3BDIA 2H4JA 4MRMA 4Q9IA 4J29A 1QGZA 3LFUA 3OVMA 1RQRA 1CR4A 1VDZA 2GN6A 2RHDA 2HGSA 1GFSA 2AR7A 4FN4A 2AG8A 3AU9A 4GF5A 1RKVA 1V96A 4N5IX 3R40A 4ONEA 3WHIA 4G2TA 1NWCA 1KO4A 1GU7A 4P80A 4QFDA 4O2AF 4FB5A 3IEKA 4PZYA 3LJKA 1JG3A 5HF6A 2OBYA 1ZUHA 3RRBA 5K5EA 5T4HA 3L6RA 3GIDA 3N2KB 2X1LA 1COWA 4BFLA 2H31A 2XUHA 3JAWA 3QWHA 4LXIA 3NIGB 4JI4B 1QYCA 3FVVA 4KJXA 1QQ7A 3Q85A 2FZVA 1UJCA 2JJ1D 3WIVA 3DTVB 4Q3LA 1WMBA 2UAGA 3V46A 5C5EA 4MCJA 3AR7A 1MAUA 4ERNA 3QVVA 3C1OA 1GITA 1MN6A 1UH5A 1ZL2A 2BONA 1PT7A 1YR9A 2GT1A 2O7VA 3GFPA 3HDQA 3QKIA 1EUCA 4G0YA 4HDSA 5I7WA 1E0JA 1XALA 1Z28A 2NO0A 2X8WA 3BJIC 3CURA 1Y5IA 2FW7A 2GSWA 4QEDA 4WKOA 4TL6A 3RHSA 4DCGA 4CEJB 4C5CA 1SVNA 1H5UA 1WOYA 3X1XA 4C08A 1L4BA 1MC1A 1XV5A 1OYYA 1XLWA 1EHYA 1XRJA 4Y8VA 5G4KA 3RYIA 3IAEA 1ODIA 4MS1A 1W5EA 3R7LA 3UT6A 2G88A 2IZOA 4C6RA 4CM8A 5KYXA 2O14A 5C51B 4AY6A 2J6HA 2RC5A 1C4KA 2GD6A 3U3ZA 4CGZA 4HCJA 4ZTBA 4HNAB 3WRWA 4QTUB 1GARA 1XSEA 4CBVA 1MDBA 2D00A 2X2OA 1JI0A 3H5TA 2DCUA 3OCVA 4S1OA 5JVDB 1D4FA 3PDIB 3HJRA 4MP3A 4EY6A 3NEJA 5KU1A 1NULA 4MX8A 1B93A 4DXDA 2ZRCA 5EEHA 2O2JA 4MW2A 1IONA 3U2QA 3W6PA 1HLDA 5BYJA 2ZZNA 1QCZA 5CVEA 5GWXA 3GLHA 3PJGA 3QYAA 4V0RA 1Z45A 1SCUB 4I50A 4G5GA 4S2EA 3S5UA 1AQNA 4N5HX 3MCVA 4IRXA 4CQLA 3OJEA 4X20A 3KQTA 2R87A 4M9UA 3MFYA 4ZCSA 1ORDA 4OAOA 2PKQO 5J2TF 3DL0A 4MUJA 1MD9A 2P4UA 4QOEA 3ANXA 3L4KA 1HT1E 3ESAA 1V2GA 3A0UA 3OZVA 4L72A 2OC9A 2R4TA 4MCHA 5HE9A 2FSIA 2DP4E 3BXPA 3CG4A 4HB3A 3TQTA 2H63A 1YB4A 1Y0BA 2Q45A 3GO4A 3LDAA 1EBUA 2A1UB 3KOUA 4HSEA 1DP4A 1VI2A 1UDAA 2DFNA 2HF9A 1YOBA 3GRUA 3TEJA 5DCWA 4XFJA 3AWDA 1EG7A 3TYXA 2Q28A 1G19A 3KUDA 1A8HA 2P4EA 4E5UA 1UKAA 3FRJA 1Q5PA 2JKVA 1BWPA 2VHWA 5DHUA 2I5PO 4DV3B 3BUSA 5G02A 1UBNA 3M6VA 5KTOA 4PXAA 2QN2A 1L7PA 4IUCS 1ODLA 2WFLB 4RQUA 2IODA 2QTZA 4KJZA 4K9QA 4L3WA 3EUAA 2ADOA 3IOEA 5HF8A 3E5RA 3VC7A 1FCJA 4AZWA 1PL0A 4EM6A 3C1TA 3MOSA 3WTBA 1U3TA 1HMPA 4BUZA 4S04A 5BSTA 2Q3EA 3HRIA 4EDFA 4EZEA 4XSHA 1XNGA 4WZAA 1LS1A 1I13A 1EVJA 3DMDA 4RHXA 4BGIA 4ESEA 3Q87B 3FX2A 3JQ7B 3PD1A 2XNJA 3R20A 4KIFA 4JYBA 4LXGA 3WYAA 5DP1A 4DFDA 3B1ZA 3T1QA 1XQVA 4MYDA 4Q1BA 2P90A 5K7SA 3GNQA 4NYMQ 4E7OA 2GN0A 1GGJA 1GGEA 4LYJA 4NENB 2JFNA 3RLFA 4QXQA 3A1FA 3AW9A 2D54A 2NU8A 4D4JA 1TKRA 3DZHA 2FEMA 4FMCB 2QPOA 2Y1CA 3PUXA 5TEWA 4C6SA 1QX3A 4KBYA 1F38A 4HGQA 2ZK7A 4Z9FA 1NLFA 3W1EA 2X1MA 4WY2A 4DEYA 3O8OB 4ABTA 3LECA 5TPWB 3Q15C 4RELA 2G1PA 1WXGA 3B6KA 4YJ2A 4YECA 3N7TA 1ZGJA 5BSEA 5EE1A 3KEFA 4BVAA 4UJ3A 1HDIA 1ZJ4A 3QVUA 4I5IA 4LPKA 3TI7A 4AKEA 4ANFA 1N0UA 2ZJYA 1O6BA 3COZA 4ZVTA 3UZUA 3D6TB 3M2PA 1JBQA 4LVCA 3IULA 3UXMA 5E6SA 4AWXA 4MHTA 2E48A 1G1MA 1NQVA 1AS0A 1NF8A 1GCUA 3LNTA 2YXLA 4R1PA 4NH0A 3W3AH 4EGQA 2YMQA 1XDZA 2C0PA 2NU7B 1TF2A 1UOOA 3EGXB 2PSJA 4XPIB 1SK8A 3CLTD 1BQ4A 2YW9A 3VX3A 1I7NA 3G02A 3H1AA 4JT8A 3OF2A 2AD1A 2EL7A 1EUYA 3C5WP 1CJVC 2NNWB 2H06A 3P8ZA 4R8KA 3VV2A 3ZBTA 3RS3A 1AA9A 1T4GA 3B2QA 1WTCA 4E2ZA 1PKXA 2B1JA 3GUUA 1JDZA 2A86A 1PEDA 1YMVA 4ZJUA 2GN1A 2PMKA 3ZHYA 4LXQA 4D26A 2W2VA 2B5OA 1I4EB 3R3VA 1P2GA 4GC5A 2IV7A 4HAYA 4QGHA 1YOVA 1NI3A 5JHGB 4QWWA 4UHJA 1TTHA 3RADC 1NIPA 2HMUA 1G3IA 3HXTA 4QDTA 3COSA 4EAQA 4EX7A 3PRYA 3BICA 4JYAB 3MW8A 2X2EA 1U2ZA 2AR0A 1QU2A 1AS2A 2QK4A 2XCUA 1AD2A 7ABPA 1MAAA 3FR7A 1N5JA 5ITVA 4P7FA 4CUKA 4DIDA 4PSDA 4YB8A 2IBMA 1MLDA 3AFOA 5ALMA 5C52B 1E2MA 1IAQA 3ORQA 3THRA 4TUYF 2GTHA 4DLTA 4EHKA 4UTNA 2QTCA 3MWEA 5JH7F 2V9CA 3ZD9A 5IK2D 2XUKA 3TN7A 1CCWA 1BRTA 3JX9A 5CW1A 4AO6A 3FCAA 3AL0C 1DC7A 4K03A 4TYPA 2QMEA 5DGXA 1PZGA 1U8FO 4TRRA 1G8JA 4WMLA 2P4QA 2RGNC 1UJ2A 5A4IS 5F5NA 5HJ2A 4J4TA 3EAGA 4IOMA 2EAUA 3CRRA 1NVTA 2BFCB 3AYZB 1GZSA 3K9CA 3LD9A 3R75A 3UVEA 1KEEA 2GKOA 3DZ8A 1QCCA 3EDOA 4HH0A 5DTIA 5IBCA 4PIPA 5FPHA 4ZI5A 1PT9A 4U2GA 3DT6A 4G1MB 2W6IA 2PNJA 2ZR9A 5KJEA 4I5EA 3A6EA 3LVQE 3SAJA 3V4ZA 2PUBA 4Q5IA 2JH8A 4JKOA 4K8RB 1U1CA 1KI9A 3WLSA 1VRCA 1KYYA 3DXFA 2R9VA 2F48A 4A82A 1GPMA 3QVGA 1VHJA 2GAJA 4GPEA 2XXAB 3TTYA 1T26A 2VRCA 3I28A 4JLWA 3ORFA 2DT5A 4K9LA 4MHOA 1VLHA 3IHLA 1VPVA 2B98A 3ZJUA 3MERA 4QUIA 2A6PA 1M7GA 1K6JA 4JLSA 4YJHA 2J08A 2GCPA 4TZKA 4YPVA 3LW8A 4CJXA 2FPPB 4ND7A 1FE8A 3ZHUA 3B12A 3CN9A 4ACAA 4DIKA 5JOQA 2VN8A 3TQSA 1ENPA 4FNGA 1ZR4A 2G1JA 3RM3A 3NIDB 2XB9A 5HMLA 2BSQA 3SMQA 3NEYA 2CLSA 3EZNA 2I78A 3N0RA 3ITKA 2P6UA 4NOJA 4DLPA 4V2IA 4DKXA 1U0HC 1QS0A 3LQQA 4Y2VA 3EVFA 4OJNA 1ORTA 3R3SA 4C0HA 2O07A 2F1IA 3OPXA 3JQBC 1I9CA 4A23A 3DL4A 3K94A 3M6XA 1DRVA 3CFYA 4H0CA 3GZNB 3STYA 5IAJA 1IYZA 4QQFA 1J0CA 1S3SA 2XUFA 2YJ6A 3LT1A 4PR0A 4D98A 3PQ4A 1KSFX 3KTAB 1KDOA 4K3UA 4ZPJA 4BMDA 1JR3A 3C70A 4FU0A 2RGNA 4MQFA 4N0EA 3PDJA 4IIJA 4P86A 4QVKA 4FGJA 4DRXA 2I91A 2RGWA 4PYIA 2UVPA 5FPKA 3WK6A 3INTA 1T6ZA 1W8IA 2JFPA 4AN1A 3GLGB 1TD9A 4RK6A 3WMFA 2EC5A 3WNCA 2O8FA 3CGWA 1LDBA 3DUWA 4RJKA 4MVXA 1XMQB 3Q7IA 2J3KA 1XA0A 1TQ6A 2XF8A 4UDYX 3LQ1A 3S99A 3EPPA 3U4IA 4D6XA 4DQ0A 4DCMA 3FSEA 4BB0A 3NHFA 1H85A 3CT6A 5KS2A 3LLUA 3EISA 3QP9A 1JLKA 3IEPA 3GLIE 4TKVB 1ZUNB 1E1YA 5FUWA 1W47A 3AFMA 3JQ8B 5G1PA 5CVVA 1QP4A 1GM5A 1ZDMA 3H04A 1SURA 3RIMA 3GLUA 1H22A 2CD7A 1A2OA 3GHYA 1QXSA 1SEPA 5B6IA 2F64A 4FGSA 5LWHA 4RJ2A 4FT2A 1G20E 1NQOA 1PDVA 5LP1A 1HDRA 4BQPA 4J07A 3ZKWB 2EFHB 4S1WA 2PRKA 2WKRA 3WNQA 3OQJA 1ORVA 1YR1A 1VGQA 4FR2A 4H27A 4X7PA 3R23A 3GJ3A 1OXKB 3WL4A 4I1UA 1TMKA 2C2BA 1YWGO 3CVOA 3U9SA 3KYJB 3QVJA 5IZCC 2ONJA 4GKKB 4M9RA 4DMHA 1VMKA 2H9AA 2O6HA 3MC1A 4MA0A 1JMVA 2X8JA 3RCBA 5DT9A 2HA2A 1XEAA 5LOVA 3JQBA 3SG0A 2Q27A 2VPPA 3LXMA 1P1KA 3OM0A 1RIFA 4YUAA 1NFQA 3KU1A 2O2XA 1JT2A 3EOAI 3RVPA 4DT1A 1G4HA 1CYEA 3B2NA 1TAHA 1IK4A 5JISA 1MO3A 3BQNB 1Z73A 2F3TA 2ZCUA 3B85A 3DEHA 1BMQA 3QK7A 1ZU5A 4J9UE 1N2XA 2FPLA 4LRTB 4Z3DA 3W6ZA 1Z4JA 3UJPA 1PWEA 2VJMA 1UK9A 4MO9A 3CSUA 2QLMA 3DWFA 1D1PA 3F7OA 4L0CA 1HEYA 1H8HA 1K7SN 3E22A 4FYKA 2OYCA 3VZBA 2Q3FA 4NFLA 3L07A 1UBMS 5ER6A 1R6VA 4GKAA 2A5JA 2GKSA 2P3SA 3ENVA 4P0TA 3SHOA 3U5ZB 1T9ZA 1WDWB 1U9JA 4PC6A 5AW1A 1PTKA 1QIKA 4A8HA 4UHEA 2F1KA 1RI2A 2OFFA 3VYTB 1AQLA 1M34A 2ASVA 4B4UA 1FFYA 1A9TA 2AC2A 2ATVA 4HMQA 4PC2A 2Y71A 1DG9A 2PUGA 3GZJA 4RF3A 4G4SO 3B7WA 2ZB7A 4Q9JA 2JFHA 1BEUB 1V16A 2HZBA 1R4MB 3K1YA 4LQCA 2ZYSA 3EUWA 4KDEA 2BEWB 1I3NA 4W8OA 1SCQA 2WF9A 3IUSA 3K9WA 2DFKB 1AKWA 5EHIA 2G4CA 3LUCA 4C0WA 4BYGA 1NVVR 3OPVA 3GFGA 1SBQA 1QPGA 3UO8B 1FFGA 3KT0A 1SWVA 5K0SA 5LQCA 3DLBA 2XQIA 3DZJA 3D64A 2E89A 2QP3A 2WPNA 1RPNA 4J1NA 2GCNA 1ENYA 1R9MA 2CYCA 2D2EA 3EULA 3DBVO 4PBRA 3ZHZA 1JT9A 2LIVA 5IZCA 3WGIA 2VJBA 1L4FA 3MGBA 3LT5A 4G0QA 2XX3A 3CZ5A 3KQWA 1G8AA 1JALA 2HCFA 4J16C 4GMDA 4DLYA 5A7FA 1JG4A 1KH2A 4IX9A 3LGXA 5DGDA 2H7VA 3L7IA 5DYWA 3FCXA 3VZRA 4I36A 1X87A 1JEDA 1U8UA 3HR4A 4QPDA 2SKCA 3BXEA 2WZBA 2B8EA 3GBVA 3W3AD 1MB2A 2XDQB 2WIAA 5ENDA 4WVFA 1WQ1R 4A92A 5I01A 3RF6A 2VPTA 3PE6A 4RKEA 4OHRA 1MENA 2A14A 3TSCA 2Z1DA 4EJMA 4UUPA 1E9RA 4OHCA 4CT5A 4JI8B 3GGCA 2QD1A 3KR2A 4QYSA 1N1EA 1SOUA 3DLIA 1Q1QA 2BM8A 3HS3A 4RYLA 4HHEA 4I4IA 3VNBA 2Q4DA 2GJ4A 2J85A 1G5TA 4JUAA 9GPBA 2B34A 1TJPB 2X0JA 3RIGA 1KWGA 5JI2E 4C7OA 1M2NA 4ZOLF 4NU5A 2X3UA 3TAUA 5FOQA 3V8VA 2FG7C 5IAKA 5TVGA 2IV3A 1BOOA 4Y0VA 2LW7A 3EZXA 3FDIA 3JQPA 4YASA 3FUXA 4IIXA 1NXWA 4BLVA 1ZJ5A 5EP1A 2QYTA 5LKAA 2PS1A 5FTLA 1GCOA 3ZJTA 1OU4A 2NUBA 2JGKA 1KP3A 4EYSA 2NXJA 1PR1A 2FWNA 5EIBC 4LHSA 1VE3A 3RYHA 3HV2A 3A1DA 3C5EA 3TD6A 4XDYA 1VG9B 1GA1A 2EJBA 3KHUA 3GH3A 5G0WA 1RYYA 4Q21A 3JQEA 4AKSA 3NKVA 5EIAA 2X4GA 5AHKA 3VMMA 3FW1A 1WUJS 3OIYA 4I2NA 1IL0A 3REOA 3RVKA 3GFQA 1Y7IA 3EHDA 3WE7A 3CF6R 1B2LA 4E5YA 2R8BA 1XK7A 2E21A 1B8UA 2NO6A 1B0AA 1ZRMA 3Q2KA 4XIJA 1L3IA 5K2OA 4CL8A 2EG9A 4EKEA 1YRLA 4CKZA 3PUJA 3FFAA 1T4CA 2ZWVA 2QW8A 1GT91 2OT3B 5IH3A 2IK8A 2VFAA 3BWBA 3I9OA 4G85A 4XJTA 4YAWA 2ZBGA 5C34B 1R6AA 3H65A 4J16A 3VVCA 4CMGA 1G5RA 4J7XA 4JLJA 4Y2QA 2CXSA 2RGYA 2OWDA 3T1NA 1WSAA 5EUQB 1IRXA 1LCIA 4X6UA 5EJ6A 2AHOA 4RJLA 4I9GA 2ODEA 4UEQA 2AKAB 2EHDA 2POQX 1GFIA 1CK4A 5M3BA 4R0MA 2HSWA 1E69A 1WULS 2HFKA 2IHUA 4Q4DA 3EVAA 2WVAA 4R7TA 3DVLA 4UAJA 4WDRA 3SXUA 2YDXA 2JLRA 1GZ3A 1NMSA 4OREX 2D5BA 4RUKA 1L5KA 4D9MA 2ZRGA 2NTYC 1XN1A 2YIMA 2RGXA 3G9QA 2AC7A 3LCVB 1NLZA 1ZOPA 1ULTA 2BUAA 2Q50A 4JFAA 1V71A 4JUIA 3I6MA 4KR0A 3T9BA 1M6VB 5HBGA 3LIIA 4HLCA 3WVNA 1PYDA 3MBKA 1THGA 3R77A 3RRJA 1YKSA 4BVJA 3D7SA 4CXMA 2ATXA 3CEPB 4IVRA 4MAAA 2G17A 1XZ8A 2ISSD 3A6LA 4HUQB 1JMKC 2P0EA 3KHTA 4NR0A 4DPLA 3I62A 4BE9A 4JGGA 3LLCA 1P3JA 3DH0A 2X8LA 1EP2B 4E4YA 1UAGA 1N5KA 4OLFA 4BN4A 5FB3A 3CKYA 2PJDA 2FE1A 2OCAA 1RRVA 1T5LA 2QDXA 1PQPA 4PG7A 5ESDA 1OZGA 3M3HA 3UW3A 2G6BA 1O95D 1LDEA 3A3YA 3EJ6A 3ZHBA 5AKGA 2QE7D 1NXSA 5JJIA 1H23A 1XCJA 3BD8A 5IASA 3ZE2B 1QKJA 4QIHA 3L1JA 1NUQA 5B64A 2GBGA 1RNLA 5K51A 1DLIA 2XIQA 2XITA 3PHBE 2EG5A 1UMCB 3AMVA 4RM3A 5JQGF 1CP3A 1KVTA 2XMSA 2Q8NA 2X4LA 1HT3A 3D3JA 1RJEA 2VRBA 4KK3A 2C29D 5CB4F 2QOEA 3RUDA 3GXOA 4YUWA 1ZL0A 2QTRA 3PPYA 4G09A 1DQYA 4UM9B 5CDYA 3GAAA 4GOND 2FKNA 4L6AA 4ZVSA 4IXWA 4EB6A 4UZFA 4QLOA 1VKJA 1FNNA 3AB3A 1CUDA 4M8IA 3WBFA 1WDLA 3G2MA 3G9XA 3OFVA 3PP8A 3DGFC 1IJFA 4YN3A 4IZHA 4K81B 1ZSYA 4MQLA 5E0KB 4YRNA 5AM3A 3O7WA 2V45A 7GPBA 3GCXA 1GZUA 1ZQ1A 2H52A 3GARA 3HSSA 4OAPA 4JI7B 1ZICA 3PFKA 4JI0B 4L74A 3DEAA 3LDHA 5LN1A 3GZTB 1FY2A 3WZ2A 3MILA 1H3EA 1V1JA 4MGEA 2I2AA 2O7SA 4A6EA 2C96A 3CLSC 4B35A 4YDRA 3O47A 4J4BA 1PAUA 4UTOA 4NG4A 3VRHA 1EUQA 1IN4A 2PUAA 3KYDB 2JJ1A 2RGCA 2C77A 2P6MA 2FA9A 5SYNA 1NDHA 4K6OA 4HVTA 1Z18A 1RJDA 3WFIA 2GBIA 1P5JA 1I6LA 2C07A 1R0LA 2OY0A 3BS4A 4D3ZA 4S05A 1VXOA 2W2NA 2ZOSA 2Q41A 3NHJA 3TQFA 4ZTUB 1NATA 2IUUA 1VQ1A 1OLUB 5ANRB 3ZS9A 1P2UA 4I6JA 4RVHA 5E2IA 5EWLA 3LUGA 1DBSA 3B13B 5DLDA 2VXOA 4LOLA 2H17A 3P9PA 5L40A 4XVQA 4CKXA 3QYPA 4HNHA 4PYRA 4R40A 1MJNA 4DCPA 3U62A 4E09A 4RPGA 4JB0A 3IR5A 1H9AA 5E2AA 4CMBA 2BFWA 3AJRA 4AM8A 4C78A 2B78A 5KYYA 5CH5A 1FW6A 4F8YA 2TRSB 1XVUA 4RJIA 1FP4A 1P4AA 3FN4A 4BLTA 4UNSA 1TRKA 2HH9A 4L1KA 4B5KA 2C8LA 3HUDA 1GUBA 2I1WA 2OHXA 1M0WA 2WIKA 3DC2A 2ZETA 5AVJA 1APBA 1FJXA 2IBTA 3GGSA 2FQQA 3PYMA 3NASA 2CE2X 2PA0A 3K30A 4B6FA 4YAEA 1JEAA 4FR5A 4ENQA 1PWYE 1KY2A 4XJVA 2I67A 3UWMA 3BD7A 5K4HA 1EWRA 4K9PA 1BJKA 1OC4A 3C3MA 3PPWA 4YFYA 1YQDA 3F46A 2X9NA 3LA6A 2WTXA 2DBYA 1T6NA 2E3JA 4NTZA 3BIWA 3OBBA 1AB5A 4ZAFA 1VC2A 1YHZA 2QRNA 2JAUA 3CG0A 3D8RA 3E9MA 2CF5A 3KVYA 4I55B 4WCFB 2VWHA 1UT5A 5JD3A 1XG5A 1KJ8A 1HBJA 1V7ZA 3CLTC 4URYR 5JY1A 2ATEA 2X40A 1SAYA 5EXDA 4YJ3B 3OQIA 4H77A 3D81A 4QSMA 3RK0A 4BKOA 5KNLA 4II3A 4BP9A 2QVCA 5TV2A 3U13A 4GBMA 1I14A 2JGNA 2YVLA 3T12A 3VNRA 2Z9DA 5K2MA 1DQRA 1R8SA 4I9UA 1JLRA 3MELA 3PGLA 1AHHA 2J9ZB 4P7JA 1VMDA 1AVTA 2J4FA 5E3JA 1L9KA 4LDNA 2OPHA 2NMVA 3VO2A 1FJHA 1USWA 2FG6C 3GJXC 4PE5B 1I7PA 3ZY3A 4B6PA 3RARA 3NNDA 4TS1A 2RBKA 1C9DB 2QPAA 3F5DA 1L4UA 2ABWA 2KJQA 1N3IA 1PGPA 3U0VA 4LQDA 1SUSA 4DQXA 4XRGA 5IABA 3MHTA 3EHEA 3EIFA 4PFKA 3T7DA 5I4CA 5ERGB 4CR8A 1PR2A 1TTQB 4XI9A 2WB2A 3NT4A 5J5CA 4GWKA 3SZGA 2XOKD 1DAKA 2ZI3A 3OP1A 3EYWA 3KL2A 4I1VA 3JTMA 1KDYA 3DVSX 3O4FA 3L7BA 4QJ5A 1SKYE 4WOPA 2HAEA 3F97A 5GAJA 4OB8A 2HHCA 2VA8A 3P2JA 2F62A 1EP9A 3AYXB 1WRBA 4R5HA 4WKCA 4BE7B 1KP9A 1GPDG 3P9CA 1V11A 3A58B 2XMGA 2VF8A 5JADA 2PUDA 1P3DA 2OO5C 5IVPA 4HNVA 1DLJA 4HJXA 4FGKA 1OX4A 2ERXA 3AJ9A 1OILA 3IQEA 3RYFB 4KQKA 1SG0A 1AGXA 1M6NA 1P2BA 4PNZA 2W71A 4ALLA 1XTTA 3PYXA 1Z0UA 5IDYA 3ZDRA 1XFAA 2F3RA 5B30A 1GSHA 3VKFA 5F77A 2OVFA 1N2BA 1Q1ZA 1T9CA 2JGAA 1SWWA 3LBFA 5F3RA 1SXQA 4C7BA 4EY4A 3H05A 1RHUA 4DMFA 3TLMA 1B16A 1PJCA 2RCNA 4L0QA 2CBXA 2AMVA 1FEZA 1XEWY 1P61B 1OYWA 3L6DA 4CG1A 3J80A 1VP3A 4OFBA 1U6JA 3RSQA 2AVNA 4HXGA 4W5JA 2GPWA 4MUGA 2A5LA 4LISA 1S3IA 3HEMA 3JU3A 2GK7A 2V8OA 4H3KB 5D87A 3ZOKA 1WP9A 2ZT5A 4EDHA 5I9SA 1EXVA 4L6IA 1K97A 3SC3A 3M9LA 3PUWA 1IH8A 5FQOA 3T1TA 3NC4A 5D84A 1T3LA 1F8XA 4TS9A 5ALEA 4CIYA 1DCFA 2VJYA 3AR5A 3PF9A 4YBZA 5FLKA 1EK2A 4FCCA 3EWAA 3K92A 1NOKA 1TCUA 2EBFX 3HL4A 2ZAYA 4Q1VA 3WRYC 1SOAA 3AY6A 3KB6A 4WNAA 4TN1A 1NBAA 2ZIGA 5KNDD 1BVRA 4D3YA 1IN6A 1UMBB 2X9GA 1Y4UA 4MW5A 3R7WA 3BXHA 3ML1A 3PITA 4N82A 5B2ZA 3TQRA 1V9SA 1QR6A 4ZDWA 2CB9A 4MPDA 2MINB 2GZ1A 2C2YA 3IV6A 3LT2A 1RQ7A 2HADA 5EPOA 3VJKA 1CDDA 1A04A 2BEUA 2P7HA 2OO5A 4B8WA 3A31A 3C45A 2Q4OA 3FWYA 3FKQA 3QRWA 3X1KA 3CU5A 3BFVA 1K2WA 3BEDA 4DV2B 2OXFA 1OA0A 2IUTA 3QPDA 5ALQA 4LNHA 1DJOA 3DBHB 1ENZA 4JLUA 3IE2A 3RT9A 4MQEA 5GONA 2Z8YM 2Q5FA 3Q11A 4JP2A 3EXG1 3C74A 4MJLA 1PR4A 4LHYA 4KHPB 5U1PA 5HQ3A 1A4UA 1J00A 2A7QA 2FFAA 3F4BA 3KJHA 4LGYA 1FTSA 3H2HA 2AG1A 4J1SA 1B8OA 2E4VA 4LZNA 4UPVA 1FYVA 3F78A 2TSYB 3NBYC 3OFSA 4MV9A 4ZO7A 5B4VA 1M72A 2I34A 2Z95A 1M2VB 1IZ7A 1QFYA 4PHHA 3DEFA 3H9UA 3MOGA 1F48A 4RFSA 5FCDA 2ZJ5A 5LZ2A 1B7GO 1EGAA 1F6WA 1SZDA 3AILA 3UQZA 1GGVA 1OFUA 3TXAA 4KNWA 2C9OA 4JBLA 3FPJA 4ZI7B 1YTUA 2MDTA 1XQWA 3GEGA 3ACBA 1DX9A 1QZ3A 3GYBA 1Z6TA 2ENWA 4D8TA 3TW6A 3ICOA 1IN1A 3V33A 2SKEA 4QOJA 4WINA 2ZQ5A 4DW8A 1WXHA 2FX5A 5FFFA 4IG4A 4QJ4A 3PCRB 4D9JA 4XUGB 1UK6A 3PIIA 3C6KA 5CG1A 1T5BA 2IZ7A 3W5HA 2PGAA 2LUOA 4G3XA 4NV0A 1KH1A 3L4EA 2ICAA 4US0R 1R3UA 5KBYA 2PUJA 1DGQA 2XYQA 3FCSB 3BXZA 3M8KA 5CFOA 3ME5A 5ALLA 1RI3A 3QI7A 2NZYA 2YYZA 3ILYA 5EQTA 1JAHA 3WO0A 2P4SA 3TSYA 3ZWPA 4PPQA 3IP7A 1GNRA 4QU0A 1QHIA 4UEOA 1O54A 3F7TA 5F4ZA 4YV1A 2JAHA 3OWHA 3T4PA 4QTYA 1VSQA 5E7IA 3OEEA 1JIUA 3I42A 4F6LA 2NO1A 1UBRS 5CPFA 3SXPA 5B55A 2IYPA 5DLEA 3JYPA 4XR4A 2FN4A 1CJBA 2R79A 4CCSA 3D7LA 4F9FA 3EH1A 3D4IA 1CR1A 1O8CA 2IZ1A 1NKSA 1Q0HA 1FFHA 2MSEB 4OP3A 2JBAA 3UH0A 1V1RB 3MD0A 3A6DA 3WGOA 1GTRA 4HPWA 1BCRA 1OF1A 4B9AA 1PW7A 2YHSA 4G5SA 4IV8A 6Q21A 1TGYA 2JS7A 1B8VA 1QGYA 1ZNWA 4LJRA 2GZDA 2J31A 1A1VA 4JODA 3W79A 2AA3A 2FHSA 1EJ6A 1XVTA 2P2NA 5EA2A 1KEPA 3G89A 4LY0A 3O4VA 3TR0A 1FLNA 1WDMA 2AN9A 2V6FA 5CAEA 3VTFA 3NS7A 4RD2A 4TMVA 4FDUA 4AJKA 4ND8B 5BQ3A 1QAQA 2G07A 1HE1C 2QUAA 1L5QA 3ENZA 1IXZA 1ULBA 2PX3A 3G2QA 3LZDA 3OLWA 1CDEA 3WDKA 3PJFA 2AI1A 5KTPA 1ZXBA 4Q4AA 1I0ZA 1P9LA 2GCOB 3NIBA 4N0PA 4B6JA 4Y6LA 5A4JA 5IYZF 5A6SA 4RDXA 3FCOA 5LZ5A 1ZK0A 4HDKA 4R41A 2QJFA 7REQB 2FSUA 1Z6YA 2KBEA 4PVDA 4IM7A 2HEIA 3EZ6A 3AFIA 1NQWA 5BVHB 3N0VA 4O1HA 1JEQB 1E77A 2FX3A 1ZYUA 2R6DA 4V0QA 1K5GA 1RTKA 4RVFA 2MIIA 2Q6IA 5BSRA 1BS9A 1G6HA 3QE4A 4O4IF 4U7HA 3KKLA 1DC4A 3QMWA 1VL8A 3U7IA 4WZAE 1XPOA 2G1KA 3UMMA 4KLRA 1KA9H 1O1YA 3D3WB 4HDRB 4F4CA 1QHEA 1RPZA 1GPLA 2LD4A 1V6CA 2IU0A 2ZR0A 1RXUA 2Y67A 1SCNE 2FEXA 3DDOA 3C6YA 3I2GA 4K3VA 3GRZA 4TGLA 3IMKA 3SY8A 3W2EA 3HVRA 1SUDA 1GNSA 1M2GA 1Y3CE 3L1IA 3TTTA 4ASUA 1X7GA 4DLAA 3EDRA 3KPVA 1P4SA 1IATA 2M32A 2XUQA 1V4VA 3KDSE 1N5OX 5BN5B 5BOSB 1KTVA 3DE1X 2UYCA 4M1ZA 1LFAA 3QFHA 5EG5A 4LY3A 3CLHA 1WUTA 3OM1A 2Y1EA 4D5EA 4DV1B 4AQYB 1T1RA 2HA3A 4C2BA 3QV1A 1L7MA 3BHJA 3DZCA 3HP4A 3WL6A 1FJ2A 3MRXA 1KO7A 2CNDA 1T5SA 1SELA 2H1HA 2KHZA 2WG2A 3KO8A 5AOVA 2B69A 2W4MA 3ZCVA 2WT9A 3NV7A 2YZMA 4FS3A 4I5DA 5HW0A 1YS4A 3G2OA 3EG9A 3GIWA 4YRCA 4DB2A 1LC3A 3ETCA 3ZZ1A 4H18A 2H51A 2J1LA 3UV6A 4LOIA 2I2DA 2A84A 4AYWA 3I8XA 1VFPA 5F1PA 3ZQ4A 4UE3S 4KXLA 2OHIA 4ZQIA 3LV8A 1M1NA 1N2CA 4P22A 5AVOA 2WABA 3N7UA 3ND7A 1GDDA 5JLJA 3AUSA 4BQSA 4FSXA 5HBRA 2V97A 2X9VA 2Q1XA 1GKYA 5AI4A 5SZHB 4Y1EA 1SXIA 5CXXA 1H4VB 2XHEA 3R4VA 3TUJC 3DDWA 4DRZA 3AUAA 2XKBA 4KVFA 4NX2A 1CXZA 3W3AA 1YQTA 1V5IA 2Z1MA 3IE1A 3K70C 4NEQA 4N41A 3WYCA 5KNCD 1KVQA 3ID6C 3GNSA 5TEVA 2BZSA 4QFCA 4PLGA 4A2QA 1XA3A 3WXBA 2F8LA 1UADA 2YRWA 2QUHA 2XMPA 2A35A 1F4PA 5CU7A 1TQHA 2Z8ZA 3MTIA 1YB1A 4RAOA 5AHRA 1H5NA 4AKTA 4HTFB 2P11A 4DCCA 1YRQA 3OICA 5AJZA 5BV0A 2PT7A 2I7DA 2YJ5A 3H4IA 3V34A 1G291 4KKVA 2RHWA 3WKDA 5BT8A 1NM5C 1H3NA 2WJYA 1KO5A 4H1UA 1NJ6A 4BO7A 3N8HA 4CM4B 1UPBA 2ZJ1A 5KYUA 5AW6A 1E3WB 4BASA 1X7HA 1WHSA 3A4MA 3C4QA 3P0FA 5AKHA 5DGTA 3K9GA 5KC9A 5C46F 2XRZA 1I5EA 5HA5A 2R7AA 2WTNA 3T5MA 2WU1A 2ZTHA 4JJKA 1LLCA 2LV8A 3AR2A 3LY7A 2KBFA 3MWKA 1JAZA 2YWRA 5BOVA 3H11A 1CY2A 3E4CA 4DF3A 3NVKI 1W29A 2EWMA 3OZEA 1B26A 4IGFA 3RW9A 5JS2A 1UINA 1PSDA 3HDTA 1BSVA 4EI2A 2NPFA 1A9ZA 3GLVA 3V7UA 1W44A 1AJEA 3AVPA 3LQ4A 3NALA 1P1BA 1XDWA 2FB9A 1XDUA 3WGJA 8AT1A 3TXXA 1Z25A 1RQNA 4PFJA 3S7TA 1MF7A 3A10A 4IDDA 4HAXA 3VR1A 2O48X 2GM4A 3W5JA 1GPWB 4NZZA 2VBCA 2WV7A 2YMPA 2F17A 1RAIA 3QELA 1OLXB 2HU7A 2WNHA 3LE8A 3FAZA 3VR4H 2BTOA 2WA1A 3PC4A 3UAGA 1BS2A 2QA5A 4UXIA 5DTEA 3VA7A 4B7ZA 4KXFB 3TK1A 1F4VA 4B3DA 1JDBB 4YNBA 1Z22A 1TK9A 2J3IA 2M9MA 3BDVA 4JBWA 3TRFA 3U7QA 3QY0A 2O52A 3W5UA 1L5VA 2GJKA 3K9QO 4KR9A 4B34A 3S1AB 1MG0A 2IWHA 1F20A 2Q99A 4OK3A 3N5CA 3Q8LA 1PS8A 3BWCA 3M4XA 5G1NA 4JT4A 1IPHA 5KC8A 3P52A 1G6OA 2FR1A 3EVCA 3LVRE 4KO4S 1QF9A 1WZCA 3NTLA 4IMIB 3L8EA 1NM5A 4W6ZA 2J6CA 4XX0B 4BE4A 2ARKA 4UVDA 4DCNA 5AVUA 5JVDF 3AJ8A 4L8FA 3HDJA 1JR3E 4IDBA 3UW1A 5HVNA 1EWVA 3WA7A 2QZ4A 2H1RA 1O0CA 3A2NA 3ANNA 3H2IA 4JR1A 2PFKA 4HUJA 4Y9UA 3FPLA 3LVBA 2NO5A 5AK4A 2ZE8A 3B9BA 4RTPA 1WP4A 1XYGA 3H0EA 2CUTA 2BTQA 3RS8A 3I04A 3B3QA 2QE7A 4G4JA 1K7YA 4DY6A 3WDMA 1GSOA 2PU7A 4EPTA 2XCOA 2E4AA 1GEGA 1JU4A 1WKVA 2C0CA 1FS4A 4UPEA 4BRWA 4L5BA 4ZOBA 5EHQA 3DF9A 2B4AA 2JH9A 3ROQA 3BAFA 3CEMA 3P71T 1M7HA 3E7DA 4P7GA 3THYA 4KNVA 5EJIA 4HNRA 1KC1A 1GCGA 3FRIA 4R9RA 1BGXT 5GP1A 5K8JB 3EVZA 3PPVA 4UNRA 3GGGA 3EGCA 4HMOA 2WM2A 4O2BB 2H7XA 1AUPA 5CX1A 1ZESA 5A6VA 1ZGGA 4ZHQB 3V7YA 2QMQA 1UP6A 3W7AA 5BMOA 1JEYB 4IIBA 4KZKA 5TE9A 1N2SA 5FTNA 1DDGA 4JOCA 2PKRA 3AY7A 1L6RA 4G63A 2GBLC 4Q18A 4A10A 1U94A 5L53A 1XMVA 4YCSA 1RWXA 3GVXA 1P1HA 3FNFA 3Q5DA 4H3VA 4ZAXA 2FQWA 2IQIA 5F7ZA 2OZVA 3NT2A 4F4UA 2WWFA 4PRZA 4IJ5A 4Z6KA 2P6RA 1RMTA 1BD3A 4F2GA 1M7BA 3I1YA 2V4ZA 2JBWA 3QXXA 4RY2A 3AM5A 4LN1A 1QG2A 2GEVA 2RG1A 1T6YA 1X86B 1QOPB 2GBFA 2OHHA 3C1UA 4JQOA 5FF9A 2FTKE 5G2OA 4ABYA 2F4VB 2AEMA 5BORA 3DM5A 3R7NA 1VCMA 3NAGA 3DEYX 4CMIB 2VOEA 2C3YA 3CLRD 1Y6JA 3T7TA 4CNQA 1U8TA 4UCXA 4BB5A 2D1RA 4IO1A 1TUBA 2R7MA 5FOUA 4ER0A 2DH6A 1LTKA 1VA4A 1F1JA 2QPTA 2QNRA 4NJMB 3UK2A 4YJKA 1I3LA 3FI0A 4KYVA 1GG8A 1U90A 1IPFA 4H7IA 4E6PA 4JXJA 3OO1A 2NVOA 2WPDD 1B6RA 4QJIA 1Z5ZA 3RABA 4JR2A 5DM60 2GYWA 1E4EB 1N6KA 1SXJB 3SSMA 3JWEA 3LM8A 2Q6OA 2WD7B 1KIMA 1TZCA 2Q1WA 5E7QA 2Q0XA 1M75A 1M34E 2QTHA 4Q3KA 3GMSA 4N01A 4A1FA 3G0HA 5HGJA 1ECJA 1EGMB 1OGJA 1ZRSA 5DOZA 4MPJA 3SX2A 2E87A 3X1ZA 1TUIA 1JWBB 3HCNA 4D82A 8LDHA 4JGBA 4WZBB 3TRHA 1BXGB 1AN9A 1BHQ1 3Q3HA 1M2JA 5FUYA 5JATA 2HTEA 1QQBA 3W4KA 1QHHB 2BEVA 2IOFA 4HX2A 1ZBQA 1R50A 4UTPA 2RIPA 2QMHA 1SVKA 2WFMA 2GBLA 3ESQA 4MV7A 4TRNA 1KAMA 1OTYA 4D45A 4DQVA 4F5ZA 4YQFA 2O8EA 4OP1A 5ED4A 3HXLA 2P27A 1MQ8B 4G1FA 4TSKA 3HB1A 2DWQA 4MAMA 1L1EA 3FKSD 5K4AA 1YB7A 4Y1RA 3T5GA 3UT5B 4AECA 1KMCA 4GO1A 5CHEA 4V0KA 5HJ5A 5IKMA 1X2EA 4U7DA 1EM8B 3CZ4A 2VJQA 4R1QA 1Q22A 2I6TA 2WHXA 4MVJE 3ESXA 1YI8A 3EPLA 2COUA 2WV9A 5EL0A 5AXBA 1G8FA 1X0VA 4HF7A 3TOCA 3H2JA 3QVSA 3FOCA 3LPCA 4N3GA 1CRZA 2BHNA 3JASB 2X0IA 2ZR8A 4EHHA 3AIMA 3R7BA 2AQIA 5DU2A 1LW7A 2HQRA 4GECA 4BNTA 2TMYA 3ZDFA 1ZZEA 3QWBA 4D1YA 5AUOB 5HIKA 1FLAA 1FBNA 5LFAA 1OY1A 1NVDA 4MJ7A 4EW3A 3ERCA 4BNDB 2TMGA 5H16A 1KPGA 4JXXA 4Z4QA 1QMPA 3SF8A 4DLKA 1MVOA 1AM4D 1E9AA 1PRYA 3Q7EA 4OGGA 3LC0A 4X8HA 1T9AA 5H83A 3UHJA 2ZIAA 4BHTA 1QNLA 3PEVA 3OE7D 4FYPA 4YAOA 3G1WA 2GF0A 1Z06A 3G2JA 5EN4A 5EQDA 1VMAA 1WPGA 4DQKA 1J0XO 1J6UA 2QSUA 5HUQA 5KU7A 2WU4A 1GSAA 1M8JA 3N1UA 3STWA 3DFKA 1BE0A 3CCBA 5DASA 1D2CA 3CX4A 3WNVA 4LHVA 4RHTA 1GPAA 4MINA 2ZWOA 5CEFA 2FPRA 3MRVA 1P7ZA 1KXZA 1GWNA 1R5OA 3REFA 2FMHA 3UJ9A 5CITA 5AXDA 3NDBB 1RYEA 2XOKA 3DL7A 2NOAA 4KBFA 3BFKA 4JJFA 3ZQJA 3WK8A 5DWDA 3EMDA 3W0LB 1TKCA 3O9MA 3BBPA 4K9KA 1OVMA 4M7RA 4F96A 5IAOA 2YHIA 3MJRA 2MOKA 3OD1A 1NUTA 3PJRA 3I9JA 1J0BA 1OQAA 3PX3A 4ZXPA 4C07A 5LJLA 1XNRB 1KU0A 2VUHB 1TVEA 1RI1A 4PZEA 3X1JA 1Q7CA 4UHKA 2NZWA 3LP6A 1C30A 2ZW9A 4I1SA 4UMEA 4YAFA 3U60B 3EZ2A 3KDPA 4MW1A 1XJ0A 1YFKA 1UQTA 2EX4A 4DR7B 4CT4B 1GDTA 5FBVB 3VU8A 1IDN1 4G5OA 5T7BA 1WD7A 2CFCA 4L5IA 1FRZA 1TKBA 3QBTA 4PM4A 3S4YA 2M98A 3FCUB 5LBUA 4AVYA 5B6JA 3RJ9A 2HUPA 4DLBA 1BKYA 4U2BA 5J4LA 3KQQA 4TKUB 3KEMA 3OURA 5JYEA 3DNPA 2MSNA 3SHWA 2VDNB 4M1SA 2BM9A 5AJXA 3VV3A 1E7SA 3IKTA 3KB2A 3LS2A 1KY5A 2DH5A 1W85A 5KTMA 1LX6A 1VI5A 2V6IA 5E0OA 1Q2UA 5K09A 5KJFA 4KR7A 1DFHA 3PZRA 5GV7A 4KQHA 2CFOA 5D6NA 1BA3A 3LCRA 3QFCA 5TMDA 2PIDA 4OUDB 1Q16A 4G97A 5BNFA 2GKGA 1G2OA 2Y05A 4BFXA 1AHPA 3WFJA 1GNQA 3PF8A 3CRMA 3DMNA 4PAQA 4MO2A 2G5TA 4RK1A 4BJ3A 3OIFA 5FWXB 3TAXA 3OKCA 2ZYDA 1NW7A 4G0OA 5DIFA 1JQKA 2O3UA 4JJGA 4ZYVA 3H84A 1G66A 4AP9A 3KQOA 1ESEA 5KNDA 5L8VA 2W6PA 2LKCA 3KSDO 1CUYA 1A9YA 4YT5A 1Z35A 2WWRA 2XBLA 4X41A 2I33A 3NHRA 1MQAA 1N77A 1NUUA 4F1KA 5IVKA 3IC5A 2Y99A 2JFFA 1PUIA 4XARA 3NEPX 4HEA1 2C2MA 4E4RA 2VLIA 2PUCA 2PAFA 4P4UA 2UZAA 3UG7A 3IKVA 3X1YA 2ZJBA 5JVDA 3CZQA 3AR3A 5IJZA 3PHCA 1JL3A 2HCRA 3GEEA 4KQMA 3S2ZA 1H0HA 2CEKA 5BMVB 3ENWA 1U4SA 5EPEA 4OHMA 1GQQA 2PMWB 4GSLA 3V2UA 1BDMA 3QW4B 16PKA 1DAMA 3JWPA 3MTBA 4IGKA 1KC3A 1JEOA 1YVUA 1BKSB 3P2KA 2B8JA 1H8EA 1NF9A 1L4YA 1H0SA 4B7XA 1J49A 4WERA 1L7OA 5GOZA 1HFKA 1TA9A 1ZVJA 2CVZA 2VNSA 2Z08A 3OT1B 2IE8A 2CMKA 4IHJA 4NU8X 1GRNA 3PNKA 5KNBH 1C1HA 2FWRA 2IXFA 4JSYA 2OVBA 2FMTA 1Z56C 2ZRBA 3EFEA 3WMXA 3QIAA 2MSWA 5EWJA 5TQ2B 4TQ9A 1E2QA 1L5HB 3A37A 2YZGA 1CUEA 1GZHB 3C85A 2VZ8A 2AVDA 2K2QB 3LXUX 4HWOA 4P7KA 1UANA 3EPKA 3OIWA 2UKDA 3KYBA 2XZLA 1EKXA 1SFRA 3KZNA 4NAUA 1XTQA 3DDHA 3JYOA 2FKAA 4FOSA 1MT0A 2G9ZA 4IFTA 3WISA 3PEFA 2C7QA 3BCUA 5LBTA 1N5RA 4NZ9A 1DCMA 3FOFC 4LWOA 2XD9A 1ZNXA 1IJKA 2UXDB 4QEZA 3E8MA 4X1IB 4QUHA 1WQ4A 3UG6A 4OYRA 1L5RA 1Q0UA 2IHBA 3EAQA 5D6OA 4L5CA 2E7ZA 4EHIA 1EEHA 3ZQKA 1NP7A 3LBNA 5I7SA 2X9LA 4ZIRB 3I1JA 4AK9A 5EHGA 1EPUA 1ISHA 1YL7A 3PHIA 4A1OA 2AMYA 1CIJA 1KO1A 2PUTA 2Q5OA 1FTQA 2DYKA 2XR1A 4G5HA 3H5WA 4D80A 4EGJA 3FMGA 3UGQA 3AV3A 1CDOA 2YKGA 4TS4A 3MGGA 5LMCA 2ZJ8A 3FTCA 1QHXA 2I62A 1ZJJA 4PWZA 4A26A 1I4OA 4ZK6A 4C5BA 1GQYA 3BCHA 3CC8A 2RHCA 3WI7A 2WUEA 4MWCA 1PJZA 3VZSA 3QEOA 1UJBA 1TVKA 4L85A 2ZSJA 3A9VA 3CCFA 2JIDA 5F76A 3TE6A 3PFCA 2OM6A 2WWWA 1J8YF 4Y0NA 5HPYB 4FW8A 4OP2A 5AKKA 4AW9A 2OKGA 1A8UA 3E1SA 2PS0A 2ZI4A 3N2GA 2I87A 2G0TA 3FLAA 3NV9A 1OI2A 3QE0A 4OQQA 1SUPA 4Y9RA 1PX2A 2O2IA 3WGYA 2GLXA 3MQFA 1VKNA 2Y92A 1FSPA 1FXSA 3KEOA 5CURA 1YI0A 4UUMA 1X80B 4A0RA 4QUEA 3I4FA 4PN3A 3VAZA 3ROZA 3PPXA 1D6JA 2O5RA 3SMVA 1QLJA 4F56A 5KQPA 1UWCA 1HNNA 3PL5A 2D7JA 3N59A 1YBAA 2H29A 3ZYZA 4BEVA 1XJ5A 3N6VA 4KVAA 2XMBA 1L4GA 1ZMRA 2YOFA 3PFHA 4M99A 4TXJA 5SICE 5TNXA 4BDSA 4OYYA 1K88A 4OKSA 2XCLA 4BECA 4F6RB 5CB8A 3S0JA 3BHMA 4U7GA 3UUEA 4HAVA 4NF2A 3WGQA 3F0TA 1JTVA 2DR3A 2W22A 2ZPAA 3IRUA 5K0GA 1QOQB 3ZHRA 1F8YA 2YASA 1TAUA 3OOHA 3SS7X 2GUGA 3O3MB 3T54A 3LHKA 2E5LB 2O0LA 1MB4A 1PLLA 1YS2X 3Q3CA 3IPYA 4P4SA 2QTVB 1CQJB 2OG1A 4Q4JA 7ADHA 1EMDA 3AFHA 1P60A 3H3JA 4PLHA 3NPMA 2VEDA 2B35A 1QO0D 3DOOA 3LUJA 2YV4A 4OHVA 4I4TA 5KHOC 3C7TA 2JKZA 3JWGA 5B7NA 1S2IA 3FWZA 4WXPA 3HWX1 3JZFA 1ZG3A 4QPPA 4JUDX 3SJBA 2R7NA 2GEBA 4GR4A 3TM4A 1I8TA 3QBVA 1GUZA 1W4LA 4OCZA 4DBZA 3D3KA 3SKYA 3MIIA 2H9YA 4HB0A 2BI7A 2PXHA 3SQOA 2BEKA 4ISBA 1ZP6A 3KVNA 1RTTA 5KYVA 1E99A 2B36A 3H6GA 2JD1A 5KTKA 2DWOA 4CIBA 5EP2A 5FOVA 3EC1A 4KPGA 5IVDA 1U1EA 3FMIA 4CPDA 4YPOA 3W1VA 2H65A 1WEKA 3NTVA 1RVDA 4KX3A 3OE4A 5EZYB 4X1YB 1YZQA 2QV7A 4KR2A 3IUBA 4CM5A 3KXLA 3GLFA 3D2CA 2OFWA 3MCAA 4O2AA 1V2HE 1XYYA 5D3MA 3UMJA 2DBQA 2IYNA 5CA0B 4GYYA 5JBNA 2IELA 5JAZA 3P19A 3OLZA 5CR9A 3DE5X 1I6MA 4LGCA 5HIIA 3JZDA 4EF6A 1N0VC 2VH2A 4KX5A 4CM3A 5LYJA 2JHGA 2FCRA 4ZO4A 5DXFA 1NZFA 4EY8A 2IYSA 1KEKA 1JQAA 1LTQA 1KY3A 4DN6A 2PNFA 1E61A 4QXRA 4FD3A 1OMOA 2ZCVA 4IDEA 5CIQA 4BV9A 2AXEA 4NULA 4ZCMA 2AJLI 2HNBA 1CUIA 1BJTA 3UOGA 4DBVO 1Y8RB 2JAQA 1OYVA 1JQ3A 2PS9A 5KSOA 1KHHA 1MUUA 4RTMA 3IIMA 2IYUA 1SG6A 4P5EA 3V48A 2MJLA 4CW7A 4ZYTA 1BWQA 4QARA 4DKJA 3KVVA 4TL7A 4C7MA 4YLEA 1DJLA 1Z47A 3DMRA 5LWQA 1EK1A 1QDLB 1XRNA 2BGKA 2YRFA 1J99A 4Z49A 3LWZA 3V8EA 3HKDB 4NECA 2OHOA 3AHDA 2OHFA 3A25A 2FZEA 3HCPA 1U65A 5IBPA 2WTBA 2XUDA 4CLRB 1U0TA 4MIEA 1ECBA 5MHTA 4WA7A 1D5CA 1KK0A 2WR8A 3I2IA 3Q5GA 1R27A 1U2EA 4M6WB 4DSZA 4MWSA 5CIWA 1FA9A 1FVHA 1UBKS 1N1MA 4NEGA 1GLNA 1CUJA 4N3AA 5ALZA 3SJZA 4YCMA 1ZW6A 2NUTB 5CIYA 3IPXA 1OC2A 3K5PA 3L1HA 1J23A 4JBYA 4H6PA 1ZOSA 1TAGA 1H65A 3FMFA 2H6EA 1Z2EA 2FUCA 2X76A 2ZTUA 3ZIDA 4WFQA 4CEHB 2BFOA 2XE6A 3VSAA 3IXLA 1QIFA 3ZH2A 2YHUA 4C03A 5J2TA 2RMKA 4QREA 1VGRA 5FA8A 1JFTA 1QFZA 5D5HA 3OPYI 5GM2A 5IDQA 4MV6A 1RC8A 1U8CB 2A30A 1NXQA 4DIFA 3UANA 1JECA 4AMGA 1KAHA 3LCJA 2R5WA 1YUBA 2GSDA 2XMCA 3B78A 3A11A 3LK7A 3ZUPA 4LKRA 3AVXA 3NHPA 3M3DA 1ICEA 3H1TA 2AC4A 5EMJA 4KOAA 3JVEA 3F1KA 4B9EA 4YCAA 1BRMA 1UXHA 1UZAA 1XTUA 2V03A 3MD9A 1XRSB 2G8NA 2VJKA 4Q03A 1YS7A 3FVTA 3GVIA 1U0SY 4DC9A 1I7QB 2YZNA 4UMFA 1U9IC 4KFRA 5AI0A 3LDFA 2WZCA 2VHJA 3KSRA 1EDZA 5JRDS 4QYIA 1OFVA 2V7TA 3U4GA 3E3MA 1KYVA 3MRTA 4EW2A 2H07A 1S1CA 4URXR 5I5GA 5DISB 2EZ8A 2IY9A 3A9SA 3KQVA 3O9ZA 4CKEA 2H4HA 5L95A 4TXLA 1KBQA 4ID9A 1ZEMA 5AI8A 3GDHA 1U7XA 2FSVC 4UU0A 2C2ZA 2P8JA 3CXRA 1EXNA 1NMXA 1VLVA 2J3EA 3G5MA 4MWOA 4P4LA 3TJRA 4KXWA 1B8NA 4XOIA 4JXKA 1X7XB 4IAOA 2A9FA 2WZQA 3H5LA 4KQ6A 1NN3A 1LC0A 2OLEA 2WYIA 3P27A 1I2DA 1LZLA 2PKXA 1YE5A 2GAFA 2OBFA 3X1DA 5AKLA 2XUJA 4XB2A 4MJXA 3FNIA 2EGGA 3G6WA 4FFNA 4UM7A 3RBZA 1YXMA 1UM9A 1PZHA 1KXJA 1S4QA 3FPEA 5G41A 5T5QA 4D3SA 3MINB 9LDTA 4PAWA 4KH0A 1X7ZA 1FRVA 4G67A 3VYSB 3AP2A 3U4AA 2BFBA 2VR1A 1G5QA 3W5SA 3MJSA 1PUXA 1YJXA 3BN3A 3SCZA 2RJ3A 3N9IA 5KZMB 3QFSA 1WO8A 4I8XA 1W73A 2AS0A 4Q4LA 1DVRA 3K6KA 1RYHA 4CLEA 5C8DA 3EY4A 1STOA 3KHSA 4OQYA 5AJHA 5F3DA 1NASA 1T8WA 2R8EA 3RC7A 2PGJA 3QM1A 5JMOA 3HBJA 2QJWA 1SVWA 1MAVA 3DOUA 4K86A 1C0EA 4EATA 4BKMA 5TMEA 1FXUA 2NUPA 3CV3A 1Z2NX 2ZDHA 2E18A 4DCVA 4AMUA 1DBPA 4OSOA 4KIJA 4L02A 1U63A 1EJ2A 5CG2A 1T29A 2PTHA 1YZHA 5BWOA 4NYJQ 4GRIA 1N3YA 1G8SA 2HPAA 1LPAB 1U9IA 3JXEA 1JAXA 1Q0RA 2YY5A 5ESRA 3TDKA 9MHTA 1RJFA 2MSLA 3VI3B 4TZ0A 3H8WA 3OMWA 3F7MA 2IX3A 5JFGA 1T1JA 1WHTA 4FINA 4NDNE 4NU6A 3JD2A 2IU4A 1C81A 3QLVC 1DIRA 3JQAD 1TYDE 3H7AA 4M2LA 4DIEA 1KYZA 1C4WA 5A5FA 4HP8A 1U0NA 2C58A 1UBEA 2RB4A 3L8HA 2C4WA 2FSVA 3PTLA 2FVYA 5KOHB 1I0LA 1XCBA 1Y8QB 4RL4A 5JPCA 4QBTA 5JH7A 3GFTA 2P62A 5J43A 1UPTA 1QK4A 3KV3O 3H8JA 1I6WA 2RHBA 1ZCBA 1NPDA 3IS3A 2IF2A 4ML3A 5ECDA 1AC5A 1XDSA 2IX9A 2NUAA 2OP1A 3CRW1 1SC9A 3TCNA 4ZQBA 3FBTA 2JLWA 4E31A 5IUNC 4X3OA 1BU5A 2A4MA 1CZRA 3GGJA 1K08A 3L8MA 3OQHA 1PTJC 1MHTA 4YQYA 2HRBA 2WPDA 1YCDA 1TYEB 2C5SA 1DKLA 1Q1GA 2Q5CA 2FSPA 3GVPA 4IJ6A 4M4SA 4EGSA 4LJLA 3ZIUA 3RUPA 1GXSA 2I99A 2RHOA 2QD5A 4AJIA 4RK0A 4B3XA 1Y6QA 5DMHA 2PWYA 3E3NA 5H3CA 4CQJA 1VCNA 2NV0A 5GY7A 3A6GA 1DIGA 2QVZX 1QIIA 3DAFA 4H35A 5LNK6 1H4SA 3BCRA 1RAHA 2J0QA 5AJYA 5IS2A 2KS6A 2YN2A 4Q48A 4QUJA 5FHRA 4F4HA 3CH4B 3L4JA 1Q0ZA 2A33A 2QP9X 1D4AA 2VCYA 1DKRA 2IYAA 2G25A 4IJWA 3ZU5A 4PQEA 1M0EA 1E3SA 1ATZA 2DG2A 2H1SA 3NYIA 4I7EA 1D07A 4FZ3A 2PUFA 2XBMA 3GCDA 5KJ1A 4B40A 5C4GB 4OJMX 4CKCB 1ZC3A 1HNWB 4I1RA 5DI9A 3S5JA 3VOTA 2AN1A 3OSZA 3B6ZA 3HPRA 3U4QA 2UVQA 1U7DA 4G89A 3QLVA 5EIWA 2OGZA 3RAJA 1V8OA 4H6WA 1NBEA 1EWKA 1B0PA 2DPGA 3V3TA 5CCDA 1R6TA 4JB3A 4JJZA 3NYWA 4OI0A 1C0LA 4QFBA 1ZAYA 2JI8A 3CR7A 4J9VA 4FM9A 1Z2OX 4F21A 3QXSA 3B1FA 3MCTA 2XGJA 3A05A 1PG0A 4XD2A 5CNMA 2GO7A 5JAMA 4B0PA 1JTEA 2RHMA 2WF5A 1PL6A 2B92A 5T57A 4QPZA 1A9PA 3N75A 4IQ0A 3UICA 1P5ZB 3ZDYB 3H3XA 5IANA 4G1CA 1OZFA 3AEQA 3SDZA 4MRSA 3IVMA 3W7VA 4ZMBA 4CT0A 4BMZA 1M6HA 3A6JA 3PGJA 3PI7A 2HQSA 1CNEA 2XCRB 2Q5JA 1OXMA 2FWJA 2WMOB 4M76B 5M34A 3GJQA 1Q0PA 3VR3D 1I94B 3IIKA 1PTJA 3OE7A 4JEMA 4ENTA 4FR0A 1T3GA 2QM3A 4TMKA 3WBKA 2Q6LA 2YDYA 3GG2A 4QHSA 1L1FA 3VH3A 4RLHA 1OJLA 2VH1A 4EGCB