3CYNA

The structure of human gpx8
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
174
structure length
174
Chain Sequence
ENLYFQSMINSFYAFEVKDAKGRTVSLEKYKGKVSLVVNVASDCQLTDRNYLGLKELHKEFGPSHFSVLAFPCNQFGESEPRPSKEVESFARKNYGVTFPIFHKIKILGSEGEPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVKFWRPEEPIEVIRPDIAALVRQVIIKKKEDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable glutathione peroxidase 8
publication title The structure of human GPX8
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 52
structure length 174
sequence length 174
chains with identical sequence B, C
ec nomenclature ec 1.11.1.9: Glutathione peroxidase.
pdb deposition date 2008-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00255 GSHPx Glutathione peroxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3cynA00
1V58A 1Z6MA 3FK8A 3GA4A 4MP4A 4EXJA 5F8BA 4FYUA 4V2MA 3UAPA 2H6ZA 4FYBA 4ZBBA 2IMKA 2FLSA 2GTUA 1Z7RA 4L5OA 4D73B 2LJAA 1B9YC 1K0NA 1AQXA 1F37A 2C0FA 5AIXA 1B8XA 5DALB 1EV4A 5AIVA 1EV9A 1G7OA 4TVEA 4YQUA 1SKSB 1VF1A 5ECMB 4IP6A 4OMVA 1TW9A 4MMMA 4QL7A 2CVKA 4PX1A 5FT3A 2C0DA 1B4PA 2ON5A 2O8VB 4EL1A 3WD6A 1NHYA 3HJPA 3NOFA 2NBSA 3ZVJA 3HJOA 1VF2A 2C3TA 3RBTA 4JZQA 1XW5A 4F9ZA 3S9FA 3IHQA 1N2AA 4ECIA 4MZCA 2VUPA 2NPBA 3KGKA 2OKAA 3QPMA 2L4CA 2FCHA 1J08A 2VLTA 2HZEA 1FOVA 5HR3A 4WF4A 5DAKA 3FR9A 3CXGA 4ZL7A 2VLVA 3UARA 5ECHB 4NXIA 1HQOA 3IBHA 2GSSA 2LNTA 4DSRA 4KNDA 1CQHA 2EIQA 4MA9A 4FO5A 4PGTA 1IYHA 3LQ7A 4WBJA 5HFKA 4KAEA 1GNWA 5HR2A 3I43A 5EL8A 2GGTA 1EP7A 2VD0A 2R5GA 5IQYA 2H0IA 2GDRA 3RDWA 3G9BA 5GZZB 1AXDA 1AAZA 5B7CA 1DSBA 4EVMA 3GL5A 3QFBC 4MF7A 3H8QA 2FD3A 3WYWA 14GSA 1Z9HA 4HU9A 1OYJA 4WR4A 4KE3A 1A23A 4ECBA 3HCZA 1Z6NA 3KH7A 3HZ4A 2OA7A 1JLWA 3EURA 2VL2A 1EGRA 1NHOA 2CA8A 2GS3A 3F3RA 3VWWA 5INYA 3GUSA 4K2DA 2E2GA 2LKUA 3Q6OA 1X0RA 4TXVA 4XHMA 3ERGA 3IK7A 3HA9A 3C71A 1ZCPA 1F9MA 4TXOB 4HI7A 4ML6A 2LEGA 1ON4A 2YZUA 3KZQA 3EMXA 2LRCA 1HNAA 3TRQA 2V1MA 1TI1A 2WGRA 3FW2A 1DE2A 1M2BA 4XCSA 3DWVA 2H1BA 3ERFA 3C8EA 1E6BA 1GUKA 4I8BA 1S3AA 3BBYA 3VWXA 3TKSA 1XCCA 1QMVA 3EC3A 4RI7A 4X43A 4O5RA 2F3MA 2BMXA 1XWCA 2L57A 2VOCA 3A2VA 5C00A 1FVKA 3D0ZA 2M46A 6GSYA 1X9MB 2E2MA 3GURA 3TJGA 3KM6A 3GFKA 1GUHA 5IIZA 1RK4A 3A2XA 3BOAA 3W6GA 3TKPA 2H76A 5ELGA 1U87A 3CRUA 3F8UA 3FZAA 1HNBA 1AC1A 3TKSE 3H79A 4EKZA 2ZUPA 4BL7A 3TDGA 3DEXA 4YAVA 1YF0A 1SYXA 4KSMA 1QFNA 4Q5QA 3KP8A 1WWJA 4OCFA 2N5AA 17GSA 4MJAA 1FVJA 1XOBA 2IMIA 2JL4A 2RM6A 4D73A 1GWCA 3C73A 4IBPA 2C80A 4RQRA 2R4VA 1GSSA 3DKSA 2H75A 1TK8B 2LJRA 2YANA 4IGJA 4ZL8A 2HRFA 1ML6A 2RIIA 2VCQA 2TIRA 5A5KA 3J7Yb 1TU7A 3HXSA 3UL3A 5G5FA 4NAXA 2NVLA 1I9DA 5DAKB 2OADA 2PU9C 1VF4A 1PL1A 3FZ4A 1GUMA 4ZB6A 1Q98A 2WB9A 2OE3A 5HQPA 1G7EA 2H1AA 1O85A 2B7JA 2L59A 3G7YA 2VCTA 4TR4A 2GT6A 4G9HA 1T4ZA 1A24A 4FH8A 2KP2A 4TW5A 1TJDA 2V2GA 3WT1A 3ZVJD 3GSTA 3UBLA 2YCDA 4G10A 4WXTA 4N10A 4Q5RA 3DYRA 3JCML 3UIWA 1KNGA 2VM2A 1U88A 2XC2A 5GAPD 1SENA 2PWJA 5CAXA 2AV4A 3PR8A 1SYRA 4Q5FA 3M9JA 4ACSA 4Q5NA 4ILFA 4HJ2A 2MMAA 1THOA 1T1VA 1KTEA 2A2SA 3HVXA 3HYPA 2H0GA 3PH9A 5IOXA 2C3QA 4WBRD 5J4UA 4TRXA 1GTBA 1M7TA 2H8LA 5G30A 5D9XA 3IC4A 5JCGA 2GQLA 5H5RA 3ISOA 1SJIA 2FWFA 3A3TA 4HUAA 5B8AA 3GTUB 1H4OA 1X5CA 1S3DA 5CP1A 4PXOA 3NZNA 1GNEA 1TXXA 3APQA 4GSTA 5ELAA 4KSOA 1ERTA 2DJ1A 3DVWA 3TGZA 3DXBA 2MYGA 1Y25A 1U3AA 3QR6A 2GZZA 1M9BA 3TJBA 6GSSA 4ZXGA 1K0DA 5B6MA 3D21A 4XS6A 3E3EA 3ZFLA 3TOUA 3EVIA 2GQKA 3WGXA 2MBSA 2WFCA 4K0GA 3SWLA 4L5LA 7GSSA 2V6OA 1ZYEA 3IPZA 2DJ3A 4NV2A 1XOAA 2CVBA 1T4YA 3U6VA 2D2ZA 1EOGA 3F9UA 1PL2A 5CO3A 2IMDA 3W8SA 2OE0A 1V57A 2H66A 1YEXA 1SL2B 1ERUA 2E7PA 1V40A 3UMAA 2DIYA 3BCKA 4MJBA 5B8BA 1E2YA 2DJ2A 4EC0A 2HFDA 5JCWA 3AY8A 5D8IA 5E4WA 1AW9A 3ME7A 2AJQB 4BWQA 1WE0A 1X5DA 3MAKA 2B6MA 2DJ0A 5ECOB 2L4QA 5HR0A 5KN2A 4I97A 2LTKA 1X9SB 4OFTA 2O89A 3WT2A 3D4MA 5KN1A 4F0BA 3HY2A 5KN0A 1Y6EA 2C4JA 2XHFA 4DEJA 1GP1A 2YJ7A 3QMXA 3TJKA 3KP9A 2F9SA 3HDCA 2MBTA 6GSXA 19GSA 5J9BA 3FRCA 4F2IA 4PUFC 2REMA 1OC8A 3ZMLA 4MJCA 1Z7PA 4IJIA 3F0IA 4NHZA 1U6TA 1UC7A 3IOSA 3TRPA 2R6KA 1B48A 1SD8A 4OD7A 2H73A 1M99A 2MMNA 4OWYA 4DSQA 3Q74A 1SJZA 5A4VA 6GSWA 5IO2A 4PUAA 5CRHA 4CW9A 1PN9A 4HS1A 3HVSA 2QKEA 4BVYA 1TRUA 2B5EA 2YPMA 2H6YA 1C72A 2A2RA 5J5NA 3OR5A 3ZREA 1LU4A 5CYYA 4ZILA 5DQSA 1J9BA 3DD3A 2A4VA 5DCGA 1QK8A 4V2LA 1YQ1A 4KW6A 2FA8A 2DC5A 4KCAA 5G31A 4YQMA 2WS2A 3QAWA 2YV7A 5E59A 3EWLA 3PGTA 2Z9SA 3BJ5A 3TKQA 2XPEA 2H70A 2AAWA 5IPGA 1NW2A 4NWYA 5H5QA 1OC9B 4NHWA 2LUSA 2RM5A 1UVZA 1J0FA 5ECSA 1A2JA 2GSRA 3V1WA 2B5XA 1V98A 2PN8A 1USBA 4TR0A 2CVDA 1B9XC 1YJ6A 2B3SA 1EGOA 4EO3A 4FIWA 2XPDA 3D6IA 13GSA 1YF1A 2HZFA 1AQWA 2ES7A 4I6XA 5G2ZA 3DVXA 2WULA 2L5OA 2QC7A 5IOWA 2EC4A 5F07A 4L8EA 2I9HA 1MTCA 4YQVA 2VCZA 2VCVA 2KP1A 2LQOA 3US3A 2HI7A 4JE1A 1GSEA 2C3NA 4BPYA 1AUCA 3GKNA 4LL1B 2H6XA 1PQNA 5GAND 4XRDA 3I69A 1GSFA 1RQMA 3QFAC 4F03A 5D73A 3L0HA 4O92A 1V9WA 3GTUA 3TUEA 2FGXA 1TI3A 2YWIA 3G7JA 1ACVA 2LRTA 3VPQA 4XIHA 2JU5A 4ML1A 5AN1A 4E8HA 1G6WA 2P31A 2DMLA 5IPHA 2L5LA 3QDNA 3CYNA 3DMLA 4F0CA 1YKAA 1G0TA 3G7IA 1WMJA 2IPAA 2X8HA 4J56E 5DVBA 1O6JA 1ST9A 1WOUA 5AGYA 1VF3A 2WRTA 3ED3A 4MK3A 4V1Ag 3TJJA 4N11A 4AF2A 3ZLPA 3TOTA 5IO0A 2BJXA 2VD1A 2GLRA 1FAAA 4JR6A 1GSUA 2KLXA 1TK5B 4BVXA 3IAS2 1N8JA 4YAPA 4WF5A 4XTSA 1UN2A 1ZZYA 3K8NA 1HYUA 1BJXA 4I2TA 4XS4B 4HQZA 1OKTA 5LNKe 1SJ6A 3GSSA 3FY7A 1MDKA 2C8UA 5IMAA 5KN3A 1PX6A 4K7NA 2MZCA 1DE1A 2WJUA 3RPNA 2L6DA 4WETA 3ZMKA 3KJYA 1YKCA 2B5YA 4GF0A 4X0XA 1DUGA 5D93A 4HDEA 4EE0A 4K0NA 3UBKA 4HJMA 4KX4A 5DQYA 4IP1A 1K0OA 3C1RA 1U3IA 3M8NA 2MMZA 5L71A 4MH2A 3IRAA 1NM3A 1Q4JA 4G2EA 4IW9A 1F2EA 2GT5A 3L4NA 5GSSA 2GZYA 4GSNA 1R26A 1KBNA 4DSSA 1BEDA 1F6MC 5H5SA 1GL8A 2VIMA 1OAZA 4PQHA 3LGCA 4F82A 5F0GA 3CBUA 4BA7A 3ZFBA 3CMIA 1EOHA 2PUKC 1VRSD 3KCMA 2B7KA 6GSUA 2YV9A 1ZGNA 1K3OA 2FWGA 5J9CA 4POMA 1PSQA 3F3QA 4KUNA 1F3AA 4GQCA 4ECCA 5F05A 3GNJA 3FEUA 3M1GA 3IDVA 3M3MA 4NV5A 2GVPA 5J41A 1A0RP 2H71A 1LJRA 2FA4A 2J23A 3CSIA 3J7Yk 1XW6A 3IA1A 3LYPA 1A8YA 3KXOA 2HRNA 1TRWA 1XWBA 4MCUA 4IQAA 3LG6A 1OE7A 4OO4A 3APSA 4POKA 2AHEA 3WGDA 1NSWA 3ZTLA 4WEYA 2IMEA 3EU4A 2DLXA 5A4UA 4KDUA 1GSYA 12GSA 2VCWA 1XWKA 1K0CA 1YEPA 1OC9A 3FZ9A 1GLPA 5IMCA 4TR3A 3RPPA 5IMDA 1JZDA 2EIRA 1LBKA 1GTIA 3DGQA 22GSA 3LXZA 2KHPA 4LMWA 1F3BA 1VGLA 4TKYA 4OFNA 5G1LA 4L0WA 3A2WA 3P90A 2H0HA 1SU9A 4HOJA 2P5RA 4AJ8A 4GTUA 3CTGA 1JZRA 4RUVA 5CRWA 4IKHA 2WCIA 1GH2A 2QGVA 3KMOA 2YWMA 4TOPA 2TRXA 1T00A 2VO4A 5B6NA 2PERA 3CTFA 4IQ1A 1ERWA 3KMNA 2DJJA 3NIVA 2AYTA 3HHVA 5D9WA 5CREA 2OBIA 3SBCA 3IE3A 4E8EA 3ZIJA 9GSSA 2ZNMA 2C1YA 1O8WA 2I81A 2F51A 4CDOA 3UVHA 1JHBA 3VK9A 4N0VA 2E0QA 1R5AA 4KDXA 3HJMA 3IAM2 4ISDA 1S3CA 1T3BA 4BWSA 2HYXA 3TJFA 2YWOA 5IMFA 3QD9A 4ULXA 2PVQA 4LA1A 4KDYA 5IM9A 3LORA 3FYGA 2H1GA 3F6FA 2CT6A 1FB0A 2ZCTA 2LS5A 1W89A 2LQQA 2DJKA 1XIYA 2AB6A 3LJRA 3GHAA 2CAQA 1HNCA 5ID2B 4TR1A 2DIZA 2H30A 4OO5A 1BYEA 3L9UA 3MWHA 4ZB9A 1UA5A 5ECPB 2OBKA 1URMA 3M9KA 3KEBA 4IJ3A 2LNSA 2VL3A 1YDKA 5DJMA 2CQ9A 1BG5A 2ON7A 3KD0A 4MPGA 3ERWA 1R7HA 5HFIA 1GULA 3UOMA 2I4AA 4XS4A 4IN0A 3DRNA 1PMTA 4GCIA 3Q18A 1MEKA 1GLQA 1H75A 2K6VA 3MNGA 3GH6A 5LD0A 5G5EA 1O81A 4DSSB 8GSSA 5D96A 3LXTA 2F8AA 4ECJA 3F4SA 1KEBA 1EP8A 1A2LA 2LRNA 4PURA 2IL3A 3F6DA 2B1KA 4IVFA 2IWTA 2C0GA 1ZL9A 1O8XA 1JZWA 2FUG2 2RUEA 2XBQA 3GL3A 2K18A 4X1UA 3VLNA 4MDCA 1DBYA 4P3YB 1GSDA 3U5RE 2O7KA 5JWQB 3IV4A 2H19A 3EINA 6GSVA 3UVTA 2N5BA 5DBQA 4ZB8A 2MMOA 4EUYA 4KGIA 2GZPA 4FYCA 3H4KA 5LCZA 3LSZA 1ZYQB 1PKWA 3TKRA 2F8FA 5EPFA 2CZ2A 1TK0B 3KTBA 3UJ1A 2HNLA 1K0AA 1BQ7A 1M0UA 3P7XA 2DSAA 1OC3A 4JBBA 1GRXA 1R4WA 2HXKA 3RAZA 3P8WA 1OKDA 5JWRB 4V2NA 1FG4A 3FKFA 4K8MA 1SD9A 4PNFA 3W8JA 3VPTA 3M0FA 3EYTA 3L78A 2B1LA 3F4RA 1T8EB 3GKMA 5C04A 3VWVA 1SL1B 4J2FA 3DIEA 4MF6A 1XVQA 2HSYA 2H72A 1K3YA 1SKRB 1EZKA 2G0FA 5IMVA 1MD4A 4L0UA 3CSJA 20GSA 1R5PA 2YZHA 2YP6A 3R2QA 1PA3A 4PNGA 3D5JA 3MSZA 3VWUA 3GKXA 4EDZA 2IFQB 4IELA 4XS1A 3BCIA 4MZWA 1I5GA 4AGSA 4EDYA 2G2QA 16GSA 1ILOA 4I5QA 2OACA 3TB2A 1OVNA 2FY6A 1WIKA 1TU8A 1XBSA 3H1NA 1EWXA 4GSSA 3GYKA 5FWGA 4RI6A 3RHBA 4K6XA 3QAGA 1WPIA 4K9ZA 5ECRB 3HVVA 1B4QA 3GH9A 4ID0A 1QXHA 1ERVA 2GSQA 2R2JA 2VL2C 2YN1A 1SK0A 4IS0A 1GTUA 3CSHA 2P0GA 3C1SA 4LLRA 4JEDA 1G6YA 3VI7A 4MABA 3GX8A 3IK9A 2IMFA 2V32A 4EF0A 1ZOFA 2IIYA 2X64A 2LJKA 4OFMA 4LL4B 3TCOA 1FB6A 2X99A 1TDIA 1YZXA 4WR5A 5ENUA 2FHEA 2P5QA 1PKZA 5ECNB 2LV3A 2RLIA 1PD21 4PQIA 5JCUA 5ECQB 3EU3A 2PVOC 2X8GA 4GLTA 5D9TA 4TR1B 1GSQA 3GN3A 1RW1A 4N30A 1TP9A 3I6AA 4QQ7A 2IN3A 5FHIA 4WKWA 5EVOA 4YH2A 5DDLA 1AIUA 1BX9A 1HD2A 1MD3A 3D22A 4V1Ap 5GSTA 1OE8A 3PINA 3KTLA 3TKSC 5J3RA 5CRDA 4NPBA 2M80A 3BD2A 2ALBA 1W4VA 2OJLA 1A8LA 2DMMA 1JZOA 5D9VA 2NDOA 1GTAA 3HKRA 2JACA 3LEFA 1WJKA 1MDJA 2H1DA 4IHUA 2N5FA 3HZ8A 3ME8A 4HZ4A 3ZYWA 5IMZA 5ID2A 4POLA 4KB3A 4HZ2A 2VL9A 4QL9A 3MDKA 4ZIJA 3L9SA 4K1FA 5F06A 3CRTA 2C0EA 6GSTA 4O32A 5DCHA 1O73A 4N0ZA 4KCEA 2JZTA 1O7UA 1XVWA 5ECKB 3E9JB 1TKDB 3GV1A 2CV4A 2CAIA 2JADA 3O76A 1WP0A 2KOKA 4GXZA 1K0BA 4ZBDA 2O87A 3FZ5A 4MF5A 5COHA 5ABRA 3FHKA 3LYKA 5EY6A 5HR1A 2FNOA 1SKWB 5DALA 3D4TA 3A5WA 4ZL9A 4HEA2 3ZRDA 3Q19A 1PRXA 3HD5A 1QQ2A 2V6KA 1QUWA 2J9HA 1M2DA 2JZSA 2TRCP 1Z3EA 1JFUA 2HZEB 3I9V2 2JSYA 11GSA 3F4TA 3GKKA 4MLYA 2K8SA 4J57E 2NTOA 4ZBAA 4Z7XA 3L9VA 3VI5A 3IR4A 4HU7A 2XBIA 2YWNA 2JZRA 4AJ6A 2V41A 2GQMA 2O85A 2CX4A 3ZZXA 3F63A 2YJHA 3GMFA 5AISA 2FWHA 2PGTA 4JR4A 1FW1A 1A0FA 3N9JA 3FR6A 1TTZA 4LMVA 2K9FA 4NMUA 3N5OA 4JRRA 1PX7A 2BTOT 3APOA 2PBJA 1FHEA 1TOFA 2IJYA 3C7MA 3EMPA 3O6TA 2M72A 1V2AA 4K7IA 4MJEA 1K3LA 4CHSA 5CNWA 2H01A 2PPTA 2EIOA 4PQ1A 3GRXA 3RHCA 1Z5YE 1XPVA 1XWGA 1PGTA 1X5EA 3FR3A 3GIXA 3IXRA 1IYIA 3UEMA 1ABAA 4RQXA 2PMTA 1TRVA 2I3YA 1JLVA 2CZ3A 2CX3A 2VM1A 1XFLA 4GQFA 3WGEA 4KH7A 2K8VA 2KUCA 5DJLA 1QGVA 2YOIA 2WZ9A 3ZL5A 5ECIB 1XW9A 3ZIVA 2GSTA 3P2AA 1XZOA 1FO5A 2IFQA 4AJ7A 2VCXA 2YNXA 2I1UA 1X9WB 2X8CA 1MDIA 18GSA 1AQVA 4KA0A 1T7PB 2QSIA 3KH9A 4DVCA 3VFIA 2JSZA 5HFGA 4MPFA 5CRGA 10GSA 1K0MA 5ECLB 3GX0A 3QAVA 4I2UA 3ZITA 2VLUA 4XRAA 3EE2A 4GRFA 4GWRA 2HLSA 1A2MA 2H74A 1M2AA 1YY7A 4G19A 4K7OA 3QOUA 2RUFA 1CQGA 5KEJA 4MZBA 1SK2A 4TXOA 1M9AA 2LSTA 4MH3A 1THXA 1SK1A 2VAFA 2R37A 2HT9A 1EEMA 2HSHA 3H93A 1SL0B 1WRYA 2R3XA 3TRXA 1XWAA 1TRSA 5G1KA 3QCPA 4H86A 4OCEA 4POBA 5JWOB 1ZMAA 5A4WA 3LWAA 2WDUA 3VURA 4TN8A 1XXUA 3KIJA 2L6CA 2DBCA 3O3TA 3LFLA 1EEJA 4JU5A 4HQSA 2HE3A 2FWEA 2AUVA 1BAYA 4O7HA 2OE1A 3E0UA
chains in the Genus database with same CATH superfamily
1V58A 1Z6MA 3FK8A 3GA4A 4MP4A 4EXJA 5F8BA 4FYUA 4V2MA 3UAPA 2H6ZA 4FYBA 4ZBBA 2IMKA 2FLSA 4K5RA 2GTUA 1Z7RA 4L5OA 4D73B 2LJAA 1B9YC 1K0NA 1AQXA 1F37A 2C0FA 5AIXA 1B8XA 5DALB 1EV4A 1M3JA 5AIVA 1EV9A 1G7OA 4TVEA 4YQUA 1SKSB 1VF1A 5ECMB 4IP6A 4OMVA 1TW9A 4MMMA 4QL7A 2CVKA 4PX1A 5FT3A 2C0DA 1B4PA 2ON5A 2O8VB 4EL1A 3WD6A 1NHYA 3HJPA 3NOFA 2NBSA 3ZVJA 3HJOA 1VF2A 2C3TA 3RBTA 4JZQA 1XW5A 4F9ZA 3S9FA 3IHQA 1N2AA 4ECIA 4MZCA 2VUPA 2NPBA 3KGKA 2OKAA 3QPMA 2L4CA 2FCHA 1J08A 2VLTA 2HZEA 1FOVA 5HR3A 4WF4A 5DAKA 3FR9A 3CXGA 4ZL7A 2VLVA 3UARA 5ECHB 4NXIA 1HQOA 2X4AA 3IBHA 2GSSA 4G0LA 2LNTA 4DSRA 4KNDA 1CQHA 2EIQA 4MA9A 4FO5A 1ZYNA 4PGTA 1IYHA 3LQ7A 4WBJA 5HFKA 4KAEA 1GNWA 5HR2A 3I43A 2A2PA 5EL8A 2GGTA 1EP7A 2VD0A 2R5GA 5IQYA 2H0IA 2HSMA 2GDRA 3RDWA 3G9BA 2UZ8A 5GZZB 1AXDA 1AAZA 5B7CA 1DSBA 4EVMA 3GL5A 3QFBC 4MF7A 3H8QA 2FD3A 3WYWA 14GSA 1Z9HA 4HU9A 1OYJA 4WR4A 4KE3A 4O5QA 1A23A 4ECBA 3HCZA 1Z6NA 3KH7A 3HZ4A 2OA7A 1JLWA 3EURA 2VL2A 1EGRA 1NHOA 2CA8A 2GS3A 3F3RA 3VWWA 5INYA 3GUSA 4K2DA 2E2GA 2LKUA 4HSCX 3Q6OA 1X0RA 4EIQA 4TXVA 4XHMA 3ERGA 3IK7A 3HA9A 3C71A 1ZCPA 1F9MA 4TXOB 4HI7A 4ML6A 2LEGA 1ON4A 2YZUA 3KZQA 3EMXA 2LRCA 1HNAA 3TRQA 2V1MA 1TI1A 2WGRA 3FW2A 1DE2A 1M2BA 4XCSA 3DWVA 2H1BA 3ERFA 3C8EA 1E6BA 1GUKA 4I8BA 1S3AA 3BBYA 3VWXA 3TKSA 1XCCA 1QMVA 3EC3A 4RI7A 4X43A 4O5RA 2F3MA 2BMXA 1XWCA 2L57A 2VOCA 3A2VA 5C00A 3A5IA 1FVKA 3D0ZA 2M46A 6GSYA 1X9MB 2E2MA 3GURA 3TJGA 3KM6A 3GFKA 1GUHA 5IIZA 1RK4A 3A2XA 3BOAA 3W6GA 2A4HA 3TKPA 2H76A 1PN0A 5ELGA 1U87A 3CRUA 3F8UA 3FZAA 1HNBA 1AC1A 3TKSE 3H79A 4EKZA 3MIXA 2ZUPA 4BL7A 3TDGA 3DEXA 4YAVA 1YF0A 1SYXA 4KSMA 1QFNA 4Q5QA 3KP8A 1WWJA 4OCFA 2N5AA 17GSA 4MJAA 1FVJA 1XOBA 2IMIA 2JL4A 2RM6A 4D73A 1GWCA 3C73A 4IBPA 2C80A 4RQRA 2R4VA 1GSSA 3DKSA 2H75A 1TK8B 2LJRA 2YANA 4IGJA 4ZL8A 2HRFA 1ML6A 2RIIA 2VCQA 2TIRA 5A5KA 3J7Yb 1TU7A 3HXSA 3UL3A 4BVYB 5G5FA 4NAXA 2NVLA 1I9DA 5DAKB 2OADA 2PU9C 1VF4A 1PL1A 3FZ4A 1GUMA 4ZB6A 1Q98A 2WB9A 2OE3A 5HQPA 1G7EA 2H1AA 2DKIA 1O85A 2B7JA 2L59A 3G7YA 2VCTA 4TR4A 2GT6A 4G9HA 1T4ZA 1A24A 4FH8A 2KP2A 4TW5A 1TJDA 2V2GA 3WT1A 3ZVJD 3GSTA 3UBLA 2YCDA 4G10A 4Z2TA 4WXTA 4N10A 4Q5RA 3DYRA 2R0PA 3JCML 3UIWA 1KNGA 2X49A 2VM2A 1U88A 2XC2A 5GAPD 1SENA 2PWJA 5CAXA 2AV4A 3PR8A 1SYRA 4Q5FA 3M9JA 4ACSA 4Q5NA 4ILFA 4HJ2A 2MMAA 1THOA 1T1VA 1KTEA 2A2SA 3HVXA 3HYPA 2H0GA 3PH9A 5IOXA 2C3QA 4WBRD 5J4UA 4TRXA 1GTBA 1M7TA 2H8LA 5G30A 5D9XA 3IC4A 5JCGA 2GQLA 5H5RA 3ISOA 1SJIA 2FWFA 3A3TA 4HUAA 5B8AA 3GTUB 1H4OA 1X5CA 1S3DA 5CP1A 4PXOA 3NZNA 1GNEA 1TXXA 3APQA 4GSTA 5ELAA 4KSOA 1ERTA 2DJ1A 3DVWA 3TGZA 3DXBA 2MYGA 1Y25A 1U3AA 3QR6A 2GZZA 1M9BA 3TJBA 6GSSA 4ZXGA 1K0DA 5B6MA 3D21A 4XS6A 3E3EA 3ZFLA 3TOUA 4USSA 3EVIA 2GQKA 3WGXA 2MBSA 2WFCA 4K0GA 3SWLA 4L5LA 7GSSA 2V6OA 1ZYEA 3IPZA 2DJ3A 4NV2A 1XOAA 2CVBA 1T4YA 3U6VA 2D2ZA 5BRTA 1EOGA 3F9UA 1PL2A 5CO3A 2IMDA 3W8SA 2OE0A 1V57A 2H66A 4X4JA 1YEXA 4BVXB 1SL2B 1ERUA 2E7PA 1V40A 3UMAA 2DIYA 3BCKA 4MJBA 5B8BA 4A5PA 1E2YA 2DJ2A 4EC0A 2HFDA 5JCWA 3AY8A 5D8IA 4BL7B 5E4WA 1AW9A 3ME7A 2AJQB 4BWQA 1WE0A 1X5DA 3MAKA 2B6MA 2DJ0A 5ECOB 2L4QA 5HR0A 5KN2A 4I97A 2LTKA 1X9SB 4OFTA 2O89A 3WT2A 3D4MA 5KN1A 4F0BA 3HY2A 5KN0A 1Y6EA 2C4JA 2XHFA 4DEJA 1GP1A 2YJ7A 3QMXA 3TJKA 3KP9A 2F9SA 3HDCA 2MBTA 6GSXA 19GSA 5J9BA 3FRCA 4F2IA 4PUFC 2REMA 1OC8A 3ZMLA 4MJCA 1Z7PA 4IJIA 3F0IA 4NHZA 1U6TA 1UC7A 3IOSA 3TRPA 2R6KA 1B48A 1SD8A 4OD7A 2H73A 1M99A 4Z2RA 2MMNA 4OWYA 4DSQA 3Q74A 1SJZA 5A4VA 6GSWA 5IO2A 4PUAA 5CRHA 4CW9A 1PN9A 4HS1A 3HVSA 2QKEA 4BVYA 1TRUA 2B5EA 2YPMA 2H6YA 1C72A 2A2RA 5J5NA 3OR5A 3ZREA 1LU4A 5CYYA 4ZILA 5DQSA 1J9BA 3DD3A 2A4VA 5DCGA 1QK8A 4V2LA 1YQ1A 4KW6A 2FA8A 2DC5A 3IC8A 4KCAA 5G31A 4YQMA 2WS2A 3QAWA 2YV7A 5E59A 3EWLA 3PGTA 2Z9SA 3BJ5A 3TKQA 2XPEA 2H70A 2AAWA 5IPGA 1NW2A 4NWYA 5H5QA 1OC9B 4NHWA 2LUSA 2RM5A 1UVZA 1J0FA 5ECSA 1A2JA 2GSRA 3V1WA 2B5XA 1V98A 2PN8A 1USBA 4TR0A 2CVDA 1B9XC 1YJ6A 2B3SA 1EGOA 4EO3A 4FIWA 2XPDA 3D6IA 13GSA 1YF1A 2HZFA 4CY8A 1AQWA 2ES7A 4I6XA 5G2ZA 3DVXA 2WULA 2L5OA 2QC7A 5IOWA 2EC4A 5F07A 4L8EA 2I9HA 1MTCA 4YQVA 2VCZA 2VCVA 2KP1A 2LQOA 3US3A 2HI7A 4JE1A 1GSEA 2C3NA 4BPYA 1AUCA 3GKNA 4LL1B 2H6XA 1PQNA 5GAND 4XRDA 3I69A 1GSFA 1RQMA 3QFAC 4F03A 5D73A 3L0HA 4O92A 1V9WA 3GTUA 3TUEA 2FGXA 1TI3A 2YWIA 3G7JA 1ACVA 2LRTA 4K5SA 3VPQA 4XIHA 2JU5A 1XG8A 4ML1A 5AN1A 4E8HA 1G6WA 2P31A 2DMLA 5IPHA 2L5LA 3QDNA 3CYNA 3DMLA 4F0CA 1YKAA 1G0TA 3G7IA 1WMJA 2IPAA 2X8HA 4J56E 5DVBA 1O6JA 1ST9A 1WOUA 5AGYA 1VF3A 2WRTA 3ED3A 1PFOA 4MK3A 4V1Ag 3TJJA 4N11A 4AF2A 3ZLPA 3TOTA 5IO0A 2BJXA 2VD1A 2GLRA 1FAAA 4JR6A 1GSUA 2KLXA 1TK5B 4BVXA 3IAS2 1N8JA 4YAPA 4WF5A 4XTSA 1UN2A 1ZZYA 3K8NA 1HYUA 1BJXA 4I2TA 4XS4B 4HQZA 4CY6A 1OKTA 5LNKe 1SJ6A 3GSSA 4ICYA 3FY7A 1MDKA 2C8UA 5IMAA 5KN3A 1PX6A 4K7NA 2MZCA 1DE1A 2WJUA 3RPNA 2L6DA 4WETA 3ZMKA 3KJYA 1YKCA 2B5YA 4GF0A 4X0XA 4PTSA 1DUGA 5D93A 4HDEA 4EE0A 4K0NA 3UBKA 4HJMA 4KX4A 5DQYA 4IP1A 1K0OA 3C1RA 4BIKA 1U3IA 3M8NA 2MMZA 5L71A 4MH2A 3IRAA 1NM3A 1Q4JA 4G2EA 4IW9A 1F2EA 2GT5A 3MYDA 2HRKA 3L4NA 5GSSA 2GZYA 4GSNA 2R0GA 1R26A 1KBNA 4DSSA 1BEDA 1F6MC 4G0IA 5H5SA 1GL8A 2VIMA 1OAZA 4PQHA 3LGCA 4F82A 5F0GA 3CBUA 4BA7A 3ZFBA 3CMIA 1EOHA 2PUKC 1VRSD 3KCMA 2B7KA 6GSUA 2YV9A 1ZGNA 1K3OA 2FWGA 5J9CA 4POMA 1PSQA 3F3QA 4KUNA 1F3AA 4GQCA 4ECCA 5F05A 3GNJA 3FEUA 3M1GA 3IDVA 3M3MA 4NV5A 2GVPA 5J41A 1A0RP 2H71A 1LJRA 2FA4A 2J23A 3CSIA 3J7Yk 1XW6A 3IA1A 3LYPA 1A8YA 3KXOA 2HRNA 1TRWA 1XWBA 4MCUA 4IQAA 3LG6A 1OE7A 4OO4A 3APSA 4POKA 2AHEA 3WGDA 1NSWA 3ZTLA 5KOWA 4WEYA 2IMEA 3EU4A 2DLXA 5A4UA 4KDUA 1GSYA 12GSA 2VCWA 1XWKA 1K0CA 1YEPA 1OC9A 2DKHA 3FZ9A 1GLPA 5IMCA 4TR3A 3RPPA 5IMDA 1JZDA 2EIRA 1M3IA 1LBKA 1GTIA 3DGQA 4MNNA 22GSA 5BMUA 3LXZA 2KHPA 4LMWA 4YKGA 1F3BA 1VGLA 4TKYA 4OFNA 5G1LA 4L0WA 3A2WA 3P90A 2H0HA 1SU9A 4HOJA 2P5RA 4AJ8A 4GTUA 3CTGA 1JZRA 4RUVA 5CRWA 4IKHA 2WCIA 4G0KA 1GH2A 2QGVA 3KMOA 2YWMA 4TOPA 2TRXA 4EIPA 1T00A 2VO4A 5B6NA 2PERA 3CTFA 4IQ1A 1ERWA 3KMNA 2DJJA 3NIVA 2AYTA 3HHVA 5D9WA 5CREA 2OBIA 3SBCA 3IE3A 4E8EA 3ZIJA 9GSSA 1ZYPA 2C1YA 2ZNMA 1O8WA 2I81A 2F51A 2QA1A 4CDOA 3UVHA 1JHBA 3VK9A 4N0VA 2E0QA 1R5AA 4KDXA 3HJMA 3IAM2 4ISDA 1S3CA 1T3BA 4BWSA 2HYXA 3TJFA 2YWOA 5IMFA 3QD9A 4ULXA 2PVQA 4LA1A 4KDYA 3HVNA 5IM9A 3LORA 3FYGA 2H1GA 3R3EA 3F6FA 2CT6A 1FB0A 2ZCTA 2LS5A 1W89A 2LQQA 2DJKA 1XIYA 2AB6A 3LJRA 3GHAA 2CAQA 1HNCA 5ID2B 4TR1A 2DIZA 4Z2UA 2H30A 4OO5A 1BYEA 3L9UA 3MWHA 4ZB9A 1UA5A 3EPTA 5ECPB 2OBKA 1URMA 3M9KA 3KEBA 4IJ3A 2LNSA 2VL3A 1YDKA 5DJMA 2CQ9A 1BG5A 2ON7A 3KD0A 4MPGA 3ERWA 1R7HA 5HFIA 1GULA 3UOMA 2I4AA 4XS4A 4IN0A 3DRNA 1PMTA 4GCIA 3Q18A 1MEKA 1GLQA 1H75A 2K6VA 3MNGA 3GH6A 5LD0A 5G5EA 1O81A 4DSSB 8GSSA 5D96A 3LXTA 2F8AA 4ECJA 3F4SA 1KEBA 1EP8A 1A2LA 2LRNA 4PURA 2IL3A 3F6DA 2B1KA 4IVFA 2IWTA 2C0GA 1ZL9A 1O8XA 1JZWA 2FUG2 2RUEA 2XBQA 3GL3A 2K18A 4X1UA 3VLNA 4MDCA 1DBYA 4P3YB 1GSDA 3U5RE 2O7KA 5JWQB 3IV4A 2H19A 3EINA 6GSVA 3UVTA 2N5BA 5DBQA 4ZB8A 2MMOA 4EUYA 4KGIA 2GZPA 4FYCA 3H4KA 5LCZA 3LSZA 1ZYQB 1PKWA 3TKRA 2F8FA 5EPFA 2CZ2A 1TK0B 3KTBA 3UJ1A 2HNLA 1K0AA 1BQ7A 1M0UA 3P7XA 2DSAA 1OC3A 4JBBA 1GRXA 1R4WA 2HXKA 3RAZA 3P8WA 1OKDA 5JWRB 4V2NA 1FG4A 3FKFA 4K8MA 1SD9A 4PNFA 3W8JA 3VPTA 3M0FA 3EYTA 3L78A 2B1LA 3F4RA 3LW9A 1T8EB 3GKMA 5C04A 3VWVA 1SL1B 4J2FA 3DIEA 4MF6A 1XVQA 4KF9A 2HSYA 2H72A 1K3YA 1SKRB 1EZKA 2G0FA 5IMVA 1MD4A 4L0UA 4K2XA 3CSJA 20GSA 1R5PA 2YZHA 2YP6A 3R2QA 1PA3A 4PNGA 3D5JA 3MSZA 3VWUA 3GKXA 4EDZA 2IFQB 4IELA 4XS1A 3BCIA 4MZWA 1I5GA 4AGSA 4EDYA 2G2QA 16GSA 1ILOA 4I5QA 2OACA 3TB2A 1OVNA 2FY6A 1WIKA 1TU8A 1XBSA 3H1NA 1EWXA 4GSSA 3GYKA 4FQUA 4RI6A 5FWGA 3RHBA 4K6XA 3QAGA 1WPIA 4K9ZA 5ECRB 3HVVA 1B4QA 3GH9A 4ID0A 1QXHA 1ERVA 2GSQA 2R2JA 2VL2C 2YN1A 1SK0A 4IS0A 1GTUA 3CSHA 2P0GA 3C1SA 4LLRA 4JEDA 1G6YA 3VI7A 4MABA 3GX8A 3IK9A 2IMFA 2V32A 4EF0A 1ZOFA 2IIYA 2X64A 2LJKA 4OFMA 4LL4B 3TCOA 1FB6A 2X99A 1TDIA 1YZXA 4WR5A 5ENUA 2FHEA 2P5QA 1PKZA 5ECNB 2LV3A 2RLIA 1PD21 4PQIA 5JCUA 5ECQB 3EU3A 2PVOC 2X8GA 4GLTA 5D9TA 4TR1B 1GSQA 3GN3A 1RW1A 4N30A 1TP9A 3I6AA 4QQ7A 2IN3A 5FHIA 4WKWA 1S3RA 5EVOA 4YH2A 5DDLA 1AIUA 1BX9A 1HD2A 1MD3A 3D22A 4V1Ap 5GSTA 1OE8A 3PINA 3KTLA 3TKSC 5J3RA 5CRDA 4NPBA 2M80A 3BD2A 2ALBA 1W4VA 2OJLA 1A8LA 2DMMA 1JZOA 5D9VA 2NDOA 1GTAA 3HKRA 2JACA 3LEFA 1WJKA 1MDJA 2H1DA 4IHUA 2N5FA 3HZ8A 3ME8A 4HZ4A 3ZYWA 5IMZA 5ID2A 4POLA 4KB3A 1FOHA 4HZ2A 2VL9A 4QL9A 3MDKA 4ZIJA 3L9SA 4K1FA 5F06A 3CRTA 2C0EA 6GSTA 4O32A 5DCHA 4O5UA 1O73A 4N0ZA 4KCEA 2JZTA 1O7UA 1XVWA 5ECKB 3E9JB 1TKDB 3GV1A 2CV4A 2CAIA 2JADA 3O76A 1WP0A 2KOKA 4GXZA 1K0BA 4ZBDA 2O87A 3FZ5A 4MF5A 5COHA 5ABRA 3FHKA 3LYKA 5EY6A 5HR1A 2FNOA 1SKWB 5DALA 3D4TA 3A5WA 4ZL9A 4HEA2 3ZRDA 3Q19A 1PRXA 3HD5A 2QA2A 1QQ2A 2V6KA 1QUWA 2J9HA 1M2DA 2JZSA 3FMWA 2TRCP 1Z3EA 1JFUA 2HZEB 3I9V2 2JSYA 11GSA 3F4TA 3GKKA 4MLYA 2K8SA 4J57E 2NTOA 4ZBAA 4Z7XA 3L9VA 3VI5A 3IR4A 4HU7A 2XBIA 2YWNA 2JZRA 4AJ6A 2V41A 2GQMA 2O85A 2CX4A 3ZZXA 3F63A 2YJHA 3GMFA 5AISA 2FWHA 2PGTA 2HRAA 4JR4A 1FW1A 3PPUA 1A0FA 3N9JA 3FR6A 1TTZA 4LMVA 2K9FA 4NMUA 3N5OA 4JRRA 1PX7A 2BTOT 3APOA 2PBJA 1FHEA 1TOFA 2IJYA 3C7MA 3EMPA 3O6TA 2M72A 1V2AA 4K7IA 4MJEA 1K3LA 4CHSA 5CNWA 2H01A 2PPTA 2EIOA 4PQ1A 3GRXA 3RHCA 1Z5YE 1XPVA 1XWGA 1PGTA 1X5EA 3FR3A 3GIXA 3IXRA 1IYIA 3UEMA 1ABAA 4RQXA 2PMTA 1TRVA 2I3YA 1JLVA 2CZ3A 2CX3A 2VM1A 1XFLA 4GQFA 3WGEA 4KH7A 2K8VA 2KUCA 5DJLA 1QGVA 2YOIA 2WZ9A 3ZL5A 5ECIB 2R0CA 1XW9A 3ZIVA 2GSTA 3P2AA 1XZOA 1FO5A 2IFQA 4AJ7A 2VCXA 2YNXA 2I1UA 1X9WB 2X8CA 1MDIA 18GSA 1AQVA 4KA0A 1T7PB 2QSIA 3KH9A 4DVCA 3VFIA 2JSZA 5HFGA 4MPFA 5CRGA 10GSA 1K0MA 5ECLB 3GX0A 3QAVA 4I2UA 3ZITA 2VLUA 4XRAA 3EE2A 4GRFA 4GWRA 2HLSA 1A2MA 2H74A 1M2AA 1YY7A 4G19A 4K7OA 3QOUA 2RUFA 1CQGA 5KEJA 4MZBA 1SK2A 4TXOA 1M9AA 2LSTA 4MH3A 1THXA 1SK1A 5KOXA 2VAFA 2R37A 2HT9A 1EEMA 2HSHA 3H93A 1SL0B 1WRYA 2R3XA 3TRXA 1XWAA 1TRSA 5G1KA 3QCPA 4H86A 4OCEA 4POBA 3IHGA 5JWOB 1ZMAA 5A4WA 3CQFA 3LWAA 2WDUA 3VURA 4TN8A 1XXUA 3KIJA 2L6CA 2DBCA 3O3TA 3LFLA 1EEJA 4YKFA 4JU5A 4HQSA 2HE3A 2FWEA 2AUVA 1BAYA 4O7HA 2OE1A 3E0UA
chains in the Genus database with same CATH topology
1V58A 1Z6MA 3FK8A 3GA4A 4MP4A 4EXJA 5F8BA 4FYUA 4V2MA 3UAPA 2H6ZA 4FYBA 4ZBBA 2IMKA 2FLSA 4K5RA 2GTUA 1Z7RA 4L5OA 4D73B 2LJAA 1B9YC 1K0NA 1AQXA 1F37A 2C0FA 5AIXA 1B8XA 5DALB 1EV4A 5AIVA 1EV9A 1G7OA 4TVEA 4YQUA 1SKSB 1VF1A 5ECMB 4IP6A 4OMVA 1TW9A 4MMMA 4QL7A 2CVKA 4PX1A 5FT3A 2C0DA 1B4PA 2ON5A 2O8VB 4EL1A 3WD6A 1NHYA 3HJPA 3NOFA 2NBSA 3ZVJA 3HJOA 1VF2A 2C3TA 3RBTA 4JZQA 1XW5A 4F9ZA 3S9FA 3IHQA 1N2AA 4ECIA 4MZCA 2VUPA 2NPBA 3KGKA 2OKAA 3QPMA 2L4CA 2FCHA 1J08A 2VLTA 2HZEA 1FOVA 5HR3A 4WF4A 5DAKA 3FR9A 3CXGA 4ZL7A 2VLVA 3UARA 5ECHB 4NXIA 1HQOA 2X4AA 3IBHA 2GSSA 4G0LA 2LNTA 4DSRA 4KNDA 1CQHA 2EIQA 4MA9A 4FO5A 1ZYNA 4PGTA 1IYHA 3LQ7A 4WBJA 5HFKA 4KAEA 1GNWA 5HR2A 3I43A 2A2PA 5EL8A 2GGTA 1EP7A 2VD0A 2R5GA 5IQYA 2H0IA 2HSMA 2GDRA 3RDWA 3G9BA 2UZ8A 5GZZB 1AXDA 1AAZA 5B7CA 1DSBA 4EVMA 3GL5A 3QFBC 4MF7A 3H8QA 2FD3A 3WYWA 14GSA 1Z9HA 4HU9A 1OYJA 4WR4A 4KE3A 4O5QA 1A23A 4ECBA 3HCZA 1Z6NA 3KH7A 3HZ4A 2OA7A 1JLWA 3EURA 2VL2A 1EGRA 1NHOA 2CA8A 2GS3A 3F3RA 3VWWA 5INYA 3GUSA 4K2DA 2E2GA 2LKUA 3Q6OA 1X0RA 4EIQA 4TXVA 4XHMA 3ERGA 3IK7A 3HA9A 3C71A 1ZCPA 1F9MA 4TXOB 4HI7A 4ML6A 2LEGA 1ON4A 2YZUA 3KZQA 3EMXA 2LRCA 1HNAA 3TRQA 2V1MA 1TI1A 2WGRA 3FW2A 1DE2A 1M2BA 4XCSA 3DWVA 2H1BA 3ERFA 3C8EA 1E6BA 1GUKA 4I8BA 1S3AA 3BBYA 3VWXA 3TKSA 1XCCA 1QMVA 3EC3A 4RI7A 4X43A 4O5RA 2F3MA 2BMXA 1XWCA 2L57A 2VOCA 3A2VA 5C00A 3A5IA 1FVKA 3D0ZA 2M46A 6GSYA 1X9MB 2E2MA 3GURA 3TJGA 3KM6A 3GFKA 1GUHA 5IIZA 1RK4A 3A2XA 3BOAA 3W6GA 2A4HA 3TKPA 2H76A 1PN0A 5ELGA 1U87A 3CRUA 3F8UA 3FZAA 1HNBA 1AC1A 3TKSE 3H79A 4EKZA 3MIXA 2ZUPA 4BL7A 3TDGA 3DEXA 4YAVA 1YF0A 1SYXA 4KSMA 1QFNA 4Q5QA 3KP8A 1WWJA 4OCFA 2N5AA 17GSA 4MJAA 1FVJA 1XOBA 2IMIA 2JL4A 2RM6A 4D73A 1GWCA 3C73A 4IBPA 2C80A 4RQRA 2R4VA 1GSSA 3DKSA 2H75A 1TK8B 2LJRA 2YANA 4IGJA 4ZL8A 2HRFA 1ML6A 2RIIA 2VCQA 2TIRA 5A5KA 3J7Yb 1TU7A 3HXSA 3UL3A 4BVYB 5G5FA 4NAXA 2NVLA 1I9DA 5DAKB 2OADA 2PU9C 1VF4A 1PL1A 3FZ4A 1GUMA 4ZB6A 1Q98A 2WB9A 2OE3A 5HQPA 1G7EA 2H1AA 2DKIA 1O85A 2B7JA 2L59A 3G7YA 2VCTA 4TR4A 2GT6A 4G9HA 1T4ZA 1A24A 4FH8A 2KP2A 4TW5A 1TJDA 2V2GA 3WT1A 3ZVJD 3GSTA 3UBLA 2YCDA 4G10A 4Z2TA 4WXTA 4N10A 4Q5RA 3DYRA 2R0PA 3JCML 3UIWA 1KNGA 2X49A 2VM2A 1U88A 2XC2A 5GAPD 1SENA 2PWJA 5CAXA 2AV4A 3PR8A 1SYRA 4Q5FA 3M9JA 4ACSA 4Q5NA 4ILFA 4HJ2A 2MMAA 1THOA 1T1VA 1KTEA 2A2SA 3HVXA 3HYPA 2H0GA 3PH9A 5IOXA 2C3QA 4WBRD 5J4UA 4TRXA 1GTBA 1M7TA 2H8LA 5G30A 5D9XA 3IC4A 5JCGA 2GQLA 5H5RA 3ISOA 1SJIA 2FWFA 3A3TA 4HUAA 5B8AA 3GTUB 1H4OA 1X5CA 1S3DA 5CP1A 4PXOA 3NZNA 1GNEA 1TXXA 3APQA 4GSTA 5ELAA 4KSOA 1ERTA 2DJ1A 3DVWA 3TGZA 3DXBA 2MYGA 1Y25A 1U3AA 3QR6A 2GZZA 1M9BA 3TJBA 6GSSA 4ZXGA 1K0DA 5B6MA 3D21A 4XS6A 3E3EA 3ZFLA 3TOUA 4USSA 3EVIA 2GQKA 3WGXA 2MBSA 2WFCA 4K0GA 3SWLA 4L5LA 7GSSA 2V6OA 1ZYEA 3IPZA 2DJ3A 4NV2A 1XOAA 2CVBA 1T4YA 3U6VA 2D2ZA 5BRTA 1EOGA 3F9UA 1PL2A 5CO3A 2IMDA 3W8SA 2OE0A 1V57A 2H66A 4X4JA 1YEXA 4BVXB 1SL2B 1ERUA 2E7PA 1V40A 3UMAA 2DIYA 3BCKA 4MJBA 5B8BA 4A5PA 1E2YA 2DJ2A 4EC0A 2HFDA 5JCWA 3AY8A 5D8IA 4BL7B 5E4WA 1AW9A 3ME7A 2AJQB 4BWQA 1WE0A 1X5DA 3MAKA 2B6MA 2DJ0A 5ECOB 2L4QA 5HR0A 5KN2A 4I97A 2LTKA 1X9SB 4OFTA 2O89A 3WT2A 3D4MA 5KN1A 4F0BA 3HY2A 5KN0A 1Y6EA 2C4JA 2XHFA 4DEJA 1GP1A 2YJ7A 3QMXA 3TJKA 3KP9A 2F9SA 3HDCA 2MBTA 6GSXA 19GSA 5J9BA 3FRCA 4F2IA 4PUFC 2REMA 1OC8A 3ZMLA 4MJCA 1Z7PA 4IJIA 3F0IA 4NHZA 1U6TA 1UC7A 3IOSA 3TRPA 2R6KA 1B48A 1SD8A 4OD7A 2H73A 1M99A 4Z2RA 2MMNA 4OWYA 4DSQA 3Q74A 1SJZA 5A4VA 6GSWA 5IO2A 4PUAA 5CRHA 4CW9A 1PN9A 4HS1A 3HVSA 2QKEA 4BVYA 1TRUA 2B5EA 2YPMA 2H6YA 1C72A 2A2RA 5J5NA 3OR5A 3ZREA 1LU4A 5CYYA 4ZILA 5DQSA 1J9BA 3DD3A 2A4VA 5DCGA 1QK8A 4V2LA 1YQ1A 4KW6A 2FA8A 2DC5A 3IC8A 4KCAA 5G31A 4YQMA 2WS2A 3QAWA 2YV7A 5E59A 3EWLA 3PGTA 2Z9SA 3BJ5A 3TKQA 2XPEA 2H70A 2AAWA 5IPGA 1NW2A 4NWYA 5H5QA 1OC9B 4NHWA 2LUSA 2RM5A 1UVZA 1J0FA 5ECSA 1A2JA 2GSRA 3V1WA 2B5XA 1V98A 2PN8A 1USBA 4TR0A 2CVDA 1B9XC 1YJ6A 2B3SA 1EGOA 4EO3A 4FIWA 2XPDA 3D6IA 13GSA 1YF1A 2HZFA 4CY8A 1AQWA 2ES7A 4I6XA 5G2ZA 3DVXA 2WULA 2L5OA 2QC7A 5IOWA 2EC4A 5F07A 4L8EA 2I9HA 1MTCA 4YQVA 2VCZA 2VCVA 2KP1A 2LQOA 3US3A 2HI7A 4JE1A 1GSEA 2C3NA 4BPYA 1AUCA 3GKNA 4LL1B 2H6XA 1PQNA 5GAND 4XRDA 3I69A 1GSFA 1RQMA 3QFAC 4F03A 5D73A 3L0HA 4O92A 1V9WA 3GTUA 3TUEA 2FGXA 1TI3A 2YWIA 3G7JA 1ACVA 2LRTA 4K5SA 3VPQA 4XIHA 2JU5A 4ML1A 5AN1A 4E8HA 1G6WA 2P31A 2DMLA 5IPHA 2L5LA 3QDNA 3CYNA 3DMLA 4F0CA 1YKAA 1G0TA 3G7IA 1WMJA 2IPAA 2X8HA 4J56E 5DVBA 1O6JA 1ST9A 1WOUA 5AGYA 1VF3A 2WRTA 3ED3A 4MK3A 4V1Ag 3TJJA 4N11A 4AF2A 3ZLPA 3TOTA 5IO0A 2BJXA 2VD1A 2GLRA 1FAAA 4JR6A 1GSUA 2KLXA 1TK5B 4BVXA 3IAS2 1N8JA 4YAPA 4WF5A 4XTSA 1UN2A 1ZZYA 3K8NA 1HYUA 1BJXA 4I2TA 4XS4B 4HQZA 4CY6A 1OKTA 5LNKe 1SJ6A 3GSSA 4ICYA 3FY7A 1MDKA 2C8UA 5IMAA 5KN3A 1PX6A 4K7NA 2MZCA 1DE1A 2WJUA 3RPNA 2L6DA 4WETA 3ZMKA 3KJYA 1YKCA 2B5YA 4GF0A 4X0XA 4PTSA 1DUGA 5D93A 4HDEA 4EE0A 4K0NA 3UBKA 4HJMA 4KX4A 5DQYA 4IP1A 1K0OA 3C1RA 1U3IA 3M8NA 2MMZA 5L71A 4MH2A 3IRAA 1NM3A 1Q4JA 4G2EA 4IW9A 1F2EA 2GT5A 3MYDA 2HRKA 3L4NA 5GSSA 2GZYA 4GSNA 2R0GA 1R26A 1KBNA 4DSSA 1BEDA 1F6MC 4G0IA 5H5SA 1GL8A 2VIMA 1OAZA 4PQHA 3LGCA 4F82A 5F0GA 3CBUA 4BA7A 3ZFBA 3CMIA 1EOHA 2PUKC 1VRSD 3KCMA 2B7KA 6GSUA 2YV9A 1ZGNA 1K3OA 2FWGA 5J9CA 4POMA 1PSQA 3F3QA 4KUNA 1F3AA 4GQCA 4ECCA 5F05A 3GNJA 3FEUA 3M1GA 3IDVA 3M3MA 4NV5A 2GVPA 5J41A 1A0RP 2H71A 1LJRA 2FA4A 2J23A 3CSIA 3J7Yk 1XW6A 3IA1A 3LYPA 1A8YA 3KXOA 2HRNA 1TRWA 1XWBA 4MCUA 4IQAA 3LG6A 1OE7A 4OO4A 3APSA 4POKA 2AHEA 3WGDA 1NSWA 3ZTLA 5KOWA 4WEYA 2IMEA 3EU4A 2DLXA 5A4UA 4KDUA 1GSYA 12GSA 2VCWA 1XWKA 1K0CA 1YEPA 1OC9A 2DKHA 3FZ9A 1GLPA 5IMCA 4TR3A 3RPPA 5IMDA 1JZDA 2EIRA 1LBKA 1GTIA 3DGQA 4MNNA 22GSA 5BMUA 3LXZA 2KHPA 4LMWA 4YKGA 1F3BA 1VGLA 4TKYA 4OFNA 5G1LA 4L0WA 3A2WA 3P90A 2H0HA 1SU9A 4HOJA 2P5RA 4AJ8A 4GTUA 3CTGA 1JZRA 4RUVA 5CRWA 4IKHA 2WCIA 4G0KA 1GH2A 2QGVA 3KMOA 2YWMA 4TOPA 2TRXA 4EIPA 1T00A 2VO4A 5B6NA 2PERA 3CTFA 4IQ1A 1ERWA 3KMNA 2DJJA 3NIVA 2AYTA 3HHVA 5D9WA 5CREA 2OBIA 3SBCA 3IE3A 4E8EA 3ZIJA 9GSSA 1ZYPA 2C1YA 2ZNMA 1O8WA 2I81A 2F51A 2QA1A 4CDOA 3UVHA 1JHBA 3VK9A 4N0VA 2E0QA 1R5AA 4KDXA 3HJMA 3IAM2 4ISDA 1S3CA 1T3BA 4BWSA 2HYXA 3TJFA 2YWOA 5IMFA 3QD9A 4ULXA 2PVQA 4LA1A 4KDYA 5IM9A 3LORA 3FYGA 2H1GA 3R3EA 3F6FA 2CT6A 1FB0A 2ZCTA 2LS5A 1W89A 2LQQA 2DJKA 1XIYA 2AB6A 3LJRA 3GHAA 2CAQA 1HNCA 5ID2B 4TR1A 2DIZA 4Z2UA 2H30A 4OO5A 1BYEA 3L9UA 3MWHA 4ZB9A 1UA5A 3EPTA 5ECPB 2OBKA 1URMA 3M9KA 3KEBA 4IJ3A 2LNSA 2VL3A 1YDKA 5DJMA 2CQ9A 1BG5A 2ON7A 3KD0A 4MPGA 3ERWA 1R7HA 5HFIA 1GULA 3UOMA 2I4AA 4XS4A 4IN0A 3DRNA 1PMTA 4GCIA 3Q18A 1MEKA 1GLQA 1H75A 2K6VA 3MNGA 3GH6A 5LD0A 5G5EA 1O81A 4DSSB 8GSSA 5D96A 3LXTA 2F8AA 4ECJA 3F4SA 1KEBA 1EP8A 1A2LA 2LRNA 4PURA 2IL3A 3F6DA 2B1KA 4IVFA 2IWTA 2C0GA 1ZL9A 1O8XA 1JZWA 2FUG2 2RUEA 2XBQA 3GL3A 2K18A 4X1UA 3VLNA 4MDCA 1DBYA 4P3YB 1GSDA 3U5RE 2O7KA 5JWQB 3IV4A 2H19A 3EINA 6GSVA 3UVTA 2N5BA 5DBQA 4ZB8A 2MMOA 4EUYA 4KGIA 2GZPA 4FYCA 3H4KA 5LCZA 3LSZA 1ZYQB 1PKWA 3TKRA 2F8FA 5EPFA 2CZ2A 1TK0B 3KTBA 3UJ1A 2HNLA 1K0AA 1BQ7A 1M0UA 3P7XA 2DSAA 1OC3A 4JBBA 1GRXA 1R4WA 2HXKA 3RAZA 3P8WA 1OKDA 5JWRB 4V2NA 1FG4A 3FKFA 4K8MA 1SD9A 4PNFA 3W8JA 3VPTA 3M0FA 3EYTA 3L78A 2B1LA 3F4RA 3LW9A 1T8EB 3GKMA 5C04A 3VWVA 1SL1B 4J2FA 3DIEA 4MF6A 1XVQA 4KF9A 2HSYA 2H72A 1K3YA 1SKRB 1EZKA 2G0FA 5IMVA 1MD4A 4L0UA 4K2XA 3CSJA 20GSA 1R5PA 2YZHA 2YP6A 3R2QA 1PA3A 4PNGA 3D5JA 3MSZA 3VWUA 3GKXA 4EDZA 2IFQB 4IELA 4XS1A 3BCIA 4MZWA 1I5GA 4AGSA 4EDYA 2G2QA 16GSA 1ILOA 4I5QA 2OACA 3TB2A 1OVNA 2FY6A 1WIKA 1TU8A 1XBSA 3H1NA 1EWXA 4GSSA 3GYKA 4FQUA 4RI6A 5FWGA 3RHBA 4K6XA 3QAGA 1WPIA 4K9ZA 5ECRB 3HVVA 1B4QA 3GH9A 4ID0A 1QXHA 1ERVA 2GSQA 2R2JA 2VL2C 2YN1A 1SK0A 4IS0A 1GTUA 3CSHA 2P0GA 3C1SA 4LLRA 4JEDA 1G6YA 3VI7A 4MABA 3GX8A 3IK9A 2IMFA 2V32A 4EF0A 1ZOFA 2IIYA 2X64A 2LJKA 4OFMA 4LL4B 3TCOA 1FB6A 2X99A 1TDIA 1YZXA 4WR5A 5ENUA 2FHEA 2P5QA 1PKZA 5ECNB 2LV3A 2RLIA 1PD21 4PQIA 5JCUA 5ECQB 3EU3A 2PVOC 2X8GA 4GLTA 5D9TA 4TR1B 1GSQA 3GN3A 1RW1A 4N30A 1TP9A 3I6AA 4QQ7A 2IN3A 5FHIA 4WKWA 5EVOA 4YH2A 5DDLA 1AIUA 1BX9A 1HD2A 1MD3A 3D22A 4V1Ap 5GSTA 1OE8A 3PINA 3KTLA 3TKSC 5J3RA 5CRDA 4NPBA 2M80A 3BD2A 2ALBA 1W4VA 2OJLA 1A8LA 2DMMA 1JZOA 5D9VA 2NDOA 1GTAA 3HKRA 2JACA 3LEFA 1WJKA 1MDJA 2H1DA 4IHUA 2N5FA 3HZ8A 3ME8A 4HZ4A 3ZYWA 5IMZA 5ID2A 4POLA 4KB3A 1FOHA 4HZ2A 2VL9A 4QL9A 3MDKA 4ZIJA 3L9SA 4K1FA 5F06A 3CRTA 2C0EA 6GSTA 4O32A 5DCHA 4O5UA 1O73A 4N0ZA 4KCEA 2JZTA 1O7UA 1XVWA 5ECKB 3E9JB 1TKDB 3GV1A 2CV4A 2CAIA 2JADA 3O76A 1WP0A 2KOKA 4GXZA 1K0BA 4ZBDA 2O87A 3FZ5A 4MF5A 5COHA 5ABRA 3FHKA 3LYKA 5EY6A 5HR1A 2FNOA 1SKWB 5DALA 3D4TA 3A5WA 4ZL9A 4HEA2 3ZRDA 3Q19A 1PRXA 3HD5A 2QA2A 1QQ2A 2V6KA 1QUWA 2J9HA 1M2DA 2JZSA 3FMWA 2TRCP 1Z3EA 1JFUA 2HZEB 3I9V2 2JSYA 11GSA 3F4TA 3GKKA 4MLYA 2K8SA 4J57E 2NTOA 4ZBAA 4Z7XA 3L9VA 3VI5A 3IR4A 4HU7A 2XBIA 2YWNA 2JZRA 4AJ6A 2V41A 2GQMA 2O85A 2CX4A 3ZZXA 3F63A 2YJHA 3GMFA 5AISA 2FWHA 2PGTA 2HRAA 4JR4A 1FW1A 3PPUA 1A0FA 3N9JA 3FR6A 1TTZA 4LMVA 2K9FA 4NMUA 3N5OA 4JRRA 1PX7A 2BTOT 3APOA 2PBJA 1FHEA 1TOFA 2IJYA 3C7MA 3EMPA 3O6TA 2M72A 1V2AA 4K7IA 4MJEA 1K3LA 4CHSA 5CNWA 2H01A 2PPTA 2EIOA 4PQ1A 3GRXA 3RHCA 1Z5YE 1XPVA 1XWGA 1PGTA 1X5EA 3FR3A 3GIXA 3IXRA 1IYIA 3UEMA 1ABAA 4RQXA 2PMTA 1TRVA 2I3YA 1JLVA 2CZ3A 2CX3A 2VM1A 1XFLA 4GQFA 3WGEA 4KH7A 2K8VA 2KUCA 5DJLA 1QGVA 2YOIA 2WZ9A 3ZL5A 5ECIB 2R0CA 1XW9A 3ZIVA 2GSTA 3P2AA 1XZOA 1FO5A 2IFQA 4AJ7A 2VCXA 2YNXA 2I1UA 1X9WB 2X8CA 1MDIA 18GSA 1AQVA 4KA0A 1T7PB 2QSIA 3KH9A 4DVCA 3VFIA 2JSZA 5HFGA 4MPFA 5CRGA 10GSA 1K0MA 5ECLB 3GX0A 3QAVA 4I2UA 3ZITA 2VLUA 4XRAA 3EE2A 4GRFA 4GWRA 2HLSA 1A2MA 2H74A 1M2AA 1YY7A 4G19A 4K7OA 3QOUA 2RUFA 1CQGA 5KEJA 4MZBA 1SK2A 4TXOA 1M9AA 2LSTA 4MH3A 1THXA 1SK1A 5KOXA 2VAFA 2R37A 2HT9A 1EEMA 2HSHA 3H93A 1SL0B 1WRYA 2R3XA 3TRXA 1XWAA 1TRSA 5G1KA 3QCPA 4H86A 4OCEA 4POBA 3IHGA 5JWOB 1ZMAA 5A4WA 3LWAA 2WDUA 3VURA 4TN8A 1XXUA 3KIJA 2L6CA 2DBCA 3O3TA 3LFLA 1EEJA 4YKFA 4JU5A 4HQSA 2HE3A 2FWEA 2AUVA 1BAYA 4O7HA 2OE1A 3E0UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V58 A;  1Z6M A;  3FK8 A;  3GA4 A;  4MP4 A;  4EXJ A;  5F8B A;  4FYU A;  4V2M A;  3UAP A;  2H6Z A;  4FYB A;  4ZBB A;  2IMK A;  2FLS A;  2GTU A;  1Z7R A;  4L5O A;  4D73 B;  2LJA A;  1B9Y C;  1K0N A;  1AQX A;  1F37 A;  2C0F A;  5AIX A;  1B8X A;  5DAL B;  1EV4 A;  5AIV A;  1EV9 A;  1G7O A;  4TVE A;  4YQU A;  1SKS B;  1VF1 A;  5ECM B;  4IP6 A;  4OMV A;  1TW9 A;  4MMM A;  4QL7 A;  2CVK A;  4PX1 A;  5FT3 A;  2C0D A;  1B4P A;  2ON5 A;  2O8V B;  4EL1 A;  3WD6 A;  1NHY A;  3HJP A;  3NOF A;  2NBS A;  3ZVJ A;  3HJO A;  1VF2 A;  2C3T A;  3RBT A;  4JZQ A;  1XW5 A;  4F9Z A;  3S9F A;  3IHQ A;  1N2A A;  4ECI A;  4MZC A;  2VUP A;  2NPB A;  3KGK A;  2OKA A;  3QPM A;  2L4C A;  2FCH A;  1J08 A;  2VLT A;  2HZE A;  1FOV A;  5HR3 A;  4WF4 A;  5DAK A;  3FR9 A;  3CXG A;  4ZL7 A;  2VLV A;  3UAR A;  5ECH B;  4NXI A;  1HQO A;  3IBH A;  2GSS A;  2LNT A;  4DSR A;  4KND A;  1CQH A;  2EIQ A;  4MA9 A;  4FO5 A;  4PGT A;  1IYH A;  3LQ7 A;  4WBJ A;  5HFK A;  4KAE A;  1GNW A;  5HR2 A;  3I43 A;  5EL8 A;  2GGT A;  1EP7 A;  2VD0 A;  2R5G A;  5IQY A;  2H0I A;  2GDR A;  3RDW A;  3G9B A;  5GZZ B;  1AXD A;  1AAZ A;  5B7C A;  1DSB A;  4EVM A;  3GL5 A;  3QFB C;  4MF7 A;  3H8Q A;  2FD3 A;  3WYW A;  14GS A;  1Z9H A;  4HU9 A;  1OYJ A;  4WR4 A;  4KE3 A;  1A23 A;  4ECB A;  3HCZ A;  1Z6N A;  3KH7 A;  3HZ4 A;  2OA7 A;  1JLW A;  3EUR A;  2VL2 A;  1EGR A;  1NHO A;  2CA8 A;  2GS3 A;  3F3R A;  3VWW A;  5INY A;  3GUS A;  4K2D A;  2E2G A;  2LKU A;  3Q6O A;  1X0R A;  4TXV A;  4XHM A;  3ERG A;  3IK7 A;  3HA9 A;  3C71 A;  1ZCP A;  1F9M A;  4TXO B;  4HI7 A;  4ML6 A;  2LEG A;  1ON4 A;  2YZU A;  3KZQ A;  3EMX A;  2LRC A;  1HNA A;  3TRQ A;  2V1M A;  1TI1 A;  2WGR A;  3FW2 A;  1DE2 A;  1M2B A;  4XCS A;  3DWV A;  2H1B A;  3ERF A;  3C8E A;  1E6B A;  1GUK A;  4I8B A;  1S3A A;  3BBY A;  3VWX A;  3TKS A;  1XCC A;  1QMV A;  3EC3 A;  4RI7 A;  4X43 A;  4O5R A;  2F3M A;  2BMX A;  1XWC A;  2L57 A;  2VOC A;  3A2V A;  5C00 A;  1FVK A;  3D0Z A;  2M46 A;  6GSY A;  1X9M B;  2E2M A;  3GUR A;  3TJG A;  3KM6 A;  3GFK A;  1GUH A;  5IIZ A;  1RK4 A;  3A2X A;  3BOA A;  3W6G A;  3TKP A;  2H76 A;  5ELG A;  1U87 A;  3CRU A;  3F8U A;  3FZA A;  1HNB A;  1AC1 A;  3TKS E;  3H79 A;  4EKZ A;  2ZUP A;  4BL7 A;  3TDG A;  3DEX A;  4YAV A;  1YF0 A;  1SYX A;  4KSM A;  1QFN A;  4Q5Q A;  3KP8 A;  1WWJ A;  4OCF A;  2N5A A;  17GS A;  4MJA A;  1FVJ A;  1XOB A;  2IMI A;  2JL4 A;  2RM6 A;  4D73 A;  1GWC A;  3C73 A;  4IBP A;  2C80 A;  4RQR A;  2R4V A;  1GSS A;  3DKS A;  2H75 A;  1TK8 B;  2LJR A;  2YAN A;  4IGJ A;  4ZL8 A;  2HRF A;  1ML6 A;  2RII A;  2VCQ A;  2TIR A;  5A5K A;  3J7Y b;  1TU7 A;  3HXS A;  3UL3 A;  5G5F A;  4NAX A;  2NVL A;  1I9D A;  5DAK B;  2OAD A;  2PU9 C;  1VF4 A;  1PL1 A;  3FZ4 A;  1GUM A;  4ZB6 A;  1Q98 A;  2WB9 A;  2OE3 A;  5HQP A;  1G7E A;  2H1A A;  1O85 A;  2B7J A;  2L59 A;  3G7Y A;  2VCT A;  4TR4 A;  2GT6 A;  4G9H A;  1T4Z A;  1A24 A;  4FH8 A;  2KP2 A;  4TW5 A;  1TJD A;  2V2G A;  3WT1 A;  3ZVJ D;  3GST A;  3UBL A;  2YCD A;  4G10 A;  4WXT A;  4N10 A;  4Q5R A;  3DYR A;  3JCM L;  3UIW A;  1KNG A;  2VM2 A;  1U88 A;  2XC2 A;  5GAP D;  1SEN A;  2PWJ A;  5CAX A;  2AV4 A;  3PR8 A;  1SYR A;  4Q5F A;  3M9J A;  4ACS A;  4Q5N A;  4ILF A;  4HJ2 A;  2MMA A;  1THO A;  1T1V A;  1KTE A;  2A2S A;  3HVX A;  3HYP A;  2H0G A;  3PH9 A;  5IOX A;  2C3Q A;  4WBR D;  5J4U A;  4TRX A;  1GTB A;  1M7T A;  2H8L A;  5G30 A;  5D9X A;  3IC4 A;  5JCG A;  2GQL A;  5H5R A;  3ISO A;  1SJI A;  2FWF A;  3A3T A;  4HUA A;  5B8A A;  3GTU B;  1H4O A;  1X5C A;  1S3D A;  5CP1 A;  4PXO A;  3NZN A;  1GNE A;  1TXX A;  3APQ A;  4GST A;  5ELA A;  4KSO A;  1ERT A;  2DJ1 A;  3DVW A;  3TGZ A;  3DXB A;  2MYG A;  1Y25 A;  1U3A A;  3QR6 A;  2GZZ A;  1M9B A;  3TJB A;  6GSS A;  4ZXG A;  1K0D A;  5B6M A;  3D21 A;  4XS6 A;  3E3E A;  3ZFL A;  3TOU A;  3EVI A;  2GQK A;  3WGX A;  2MBS A;  2WFC A;  4K0G A;  3SWL A;  4L5L A;  7GSS A;  2V6O A;  1ZYE A;  3IPZ A;  2DJ3 A;  4NV2 A;  1XOA A;  2CVB A;  1T4Y A;  3U6V A;  2D2Z A;  1EOG A;  3F9U A;  1PL2 A;  5CO3 A;  2IMD A;  3W8S A;  2OE0 A;  1V57 A;  2H66 A;  1YEX A;  1SL2 B;  1ERU A;  2E7P A;  1V40 A;  3UMA A;  2DIY A;  3BCK A;  4MJB A;  5B8B A;  1E2Y A;  2DJ2 A;  4EC0 A;  2HFD A;  5JCW A;  3AY8 A;  5D8I A;  5E4W A;  1AW9 A;  3ME7 A;  2AJQ B;  4BWQ A;  1WE0 A;  1X5D A;  3MAK A;  2B6M A;  2DJ0 A;  5ECO B;  2L4Q A;  5HR0 A;  5KN2 A;  4I97 A;  2LTK A;  1X9S B;  4OFT A;  2O89 A;  3WT2 A;  3D4M A;  5KN1 A;  4F0B A;  3HY2 A;  5KN0 A;  1Y6E A;  2C4J A;  2XHF A;  4DEJ A;  1GP1 A;  2YJ7 A;  3QMX A;  3TJK A;  3KP9 A;  2F9S A;  3HDC A;  2MBT A;  6GSX A;  19GS A;  5J9B A;  3FRC A;  4F2I A;  4PUF C;  2REM A;  1OC8 A;  3ZML A;  4MJC A;  1Z7P A;  4IJI A;  3F0I A;  4NHZ A;  1U6T A;  1UC7 A;  3IOS A;  3TRP A;  2R6K A;  1B48 A;  1SD8 A;  4OD7 A;  2H73 A;  1M99 A;  2MMN A;  4OWY A;  4DSQ A;  3Q74 A;  1SJZ A;  5A4V A;  6GSW A;  5IO2 A;  4PUA A;  5CRH A;  4CW9 A;  1PN9 A;  4HS1 A;  3HVS A;  2QKE A;  4BVY A;  1TRU A;  2B5E A;  2YPM A;  2H6Y A;  1C72 A;  2A2R A;  5J5N A;  3OR5 A;  3ZRE A;  1LU4 A;  5CYY A;  4ZIL A;  5DQS A;  1J9B A;  3DD3 A;  2A4V A;  5DCG A;  1QK8 A;  4V2L A;  1YQ1 A;  4KW6 A;  2FA8 A;  2DC5 A;  4KCA A;  5G31 A;  4YQM A;  2WS2 A;  3QAW A;  2YV7 A;  5E59 A;  3EWL A;  3PGT A;  2Z9S A;  3BJ5 A;  3TKQ A;  2XPE A;  2H70 A;  2AAW A;  5IPG A;  1NW2 A;  4NWY A;  5H5Q A;  1OC9 B;  4NHW A;  2LUS A;  2RM5 A;  1UVZ A;  1J0F A;  5ECS A;  1A2J A;  2GSR A;  3V1W A;  2B5X A;  1V98 A;  2PN8 A;  1USB A;  4TR0 A;  2CVD A;  1B9X C;  1YJ6 A;  2B3S A;  1EGO A;  4EO3 A;  4FIW A;  2XPD A;  3D6I A;  13GS A;  1YF1 A;  2HZF A;  1AQW A;  2ES7 A;  4I6X A;  5G2Z A;  3DVX A;  2WUL A;  2L5O A;  2QC7 A;  5IOW A;  2EC4 A;  5F07 A;  4L8E A;  2I9H A;  1MTC A;  4YQV A;  2VCZ A;  2VCV A;  2KP1 A;  2LQO A;  3US3 A;  2HI7 A;  4JE1 A;  1GSE A;  2C3N A;  4BPY A;  1AUC A;  3GKN A;  4LL1 B;  2H6X A;  1PQN A;  5GAN D;  4XRD A;  3I69 A;  1GSF A;  1RQM A;  3QFA C;  4F03 A;  5D73 A;  3L0H A;  4O92 A;  1V9W A;  3GTU A;  3TUE A;  2FGX A;  1TI3 A;  2YWI A;  3G7J A;  1ACV A;  2LRT A;  3VPQ A;  4XIH A;  2JU5 A;  4ML1 A;  5AN1 A;  4E8H A;  1G6W A;  2P31 A;  2DML A;  5IPH A;  2L5L A;  3QDN A;  3CYN A;  3DML A;  4F0C A;  1YKA A;  1G0T A;  3G7I A;  1WMJ A;  2IPA A;  2X8H A;  4J56 E;  5DVB A;  1O6J A;  1ST9 A;  1WOU A;  5AGY A;  1VF3 A;  2WRT A;  3ED3 A;  4MK3 A;  4V1A g;  3TJJ A;  4N11 A;  4AF2 A;  3ZLP A;  3TOT A;  5IO0 A;  2BJX A;  2VD1 A;  2GLR A;  1FAA A;  4JR6 A;  1GSU A;  2KLX A;  1TK5 B;  4BVX A;  3IAS 2;  1N8J A;  4YAP A;  4WF5 A;  4XTS A;  1UN2 A;  1ZZY A;  3K8N A;  1HYU A;  1BJX A;  4I2T A;  4XS4 B;  4HQZ A;  1OKT A;  5LNK e;  1SJ6 A;  3GSS A;  3FY7 A;  1MDK A;  2C8U A;  5IMA A;  5KN3 A;  1PX6 A;  4K7N A;  2MZC A;  1DE1 A;  2WJU A;  3RPN A;  2L6D A;  4WET A;  3ZMK A;  3KJY A;  1YKC A;  2B5Y A;  4GF0 A;  4X0X A;  1DUG A;  5D93 A;  4HDE A;  4EE0 A;  4K0N A;  3UBK A;  4HJM A;  4KX4 A;  5DQY A;  4IP1 A;  1K0O A;  3C1R A;  1U3I A;  3M8N A;  2MMZ A;  5L71 A;  4MH2 A;  3IRA A;  1NM3 A;  1Q4J A;  4G2E A;  4IW9 A;  1F2E A;  2GT5 A;  3L4N A;  5GSS A;  2GZY A;  4GSN A;  1R26 A;  1KBN A;  4DSS A;  1BED A;  1F6M C;  5H5S A;  1GL8 A;  2VIM A;  1OAZ A;  4PQH A;  3LGC A;  4F82 A;  5F0G A;  3CBU A;  4BA7 A;  3ZFB A;  3CMI A;  1EOH A;  2PUK C;  1VRS D;  3KCM A;  2B7K A;  6GSU A;  2YV9 A;  1ZGN A;  1K3O A;  2FWG A;  5J9C A;  4POM A;  1PSQ A;  3F3Q A;  4KUN A;  1F3A A;  4GQC A;  4ECC A;  5F05 A;  3GNJ A;  3FEU A;  3M1G A;  3IDV A;  3M3M A;  4NV5 A;  2GVP A;  5J41 A;  1A0R P;  2H71 A;  1LJR A;  2FA4 A;  2J23 A;  3CSI A;  3J7Y k;  1XW6 A;  3IA1 A;  3LYP A;  1A8Y A;  3KXO A;  2HRN A;  1TRW A;  1XWB A;  4MCU A;  4IQA A;  3LG6 A;  1OE7 A;  4OO4 A;  3APS A;  4POK A;  2AHE A;  3WGD A;  1NSW A;  3ZTL A;  4WEY A;  2IME A;  3EU4 A;  2DLX A;  5A4U A;  4KDU A;  1GSY A;  12GS A;  2VCW A;  1XWK A;  1K0C A;  1YEP A;  1OC9 A;  3FZ9 A;  1GLP A;  5IMC A;  4TR3 A;  3RPP A;  5IMD A;  1JZD A;  2EIR A;  1LBK A;  1GTI A;  3DGQ A;  22GS A;  3LXZ A;  2KHP A;  4LMW A;  1F3B A;  1VGL A;  4TKY A;  4OFN A;  5G1L A;  4L0W A;  3A2W A;  3P90 A;  2H0H A;  1SU9 A;  4HOJ A;  2P5R A;  4AJ8 A;  4GTU A;  3CTG A;  1JZR A;  4RUV A;  5CRW A;  4IKH A;  2WCI A;  1GH2 A;  2QGV A;  3KMO A;  2YWM A;  4TOP A;  2TRX A;  1T00 A;  2VO4 A;  5B6N A;  2PER A;  3CTF A;  4IQ1 A;  1ERW A;  3KMN A;  2DJJ A;  3NIV A;  2AYT A;  3HHV A;  5D9W A;  5CRE A;  2OBI A;  3SBC A;  3IE3 A;  4E8E A;  3ZIJ A;  9GSS A;  2ZNM A;  2C1Y A;  1O8W A;  2I81 A;  2F51 A;  4CDO A;  3UVH A;  1JHB A;  3VK9 A;  4N0V A;  2E0Q A;  1R5A A;  4KDX A;  3HJM A;  3IAM 2;  4ISD A;  1S3C A;  1T3B A;  4BWS A;  2HYX A;  3TJF A;  2YWO A;  5IMF A;  3QD9 A;  4ULX A;  2PVQ A;  4LA1 A;  4KDY A;  5IM9 A;  3LOR A;  3FYG A;  2H1G A;  3F6F A;  2CT6 A;  1FB0 A;  2ZCT A;  2LS5 A;  1W89 A;  2LQQ A;  2DJK A;  1XIY A;  2AB6 A;  3LJR A;  3GHA A;  2CAQ A;  1HNC A;  5ID2 B;  4TR1 A;  2DIZ A;  2H30 A;  4OO5 A;  1BYE A;  3L9U A;  3MWH A;  4ZB9 A;  1UA5 A;  5ECP B;  2OBK A;  1URM A;  3M9K A;  3KEB A;  4IJ3 A;  2LNS A;  2VL3 A;  1YDK A;  5DJM A;  2CQ9 A;  1BG5 A;  2ON7 A;  3KD0 A;  4MPG A;  3ERW A;  1R7H A;  5HFI A;  1GUL A;  3UOM A;  2I4A A;  4XS4 A;  4IN0 A;  3DRN A;  1PMT A;  4GCI A;  3Q18 A;  1MEK A;  1GLQ A;  1H75 A;  2K6V A;  3MNG A;  3GH6 A;  5LD0 A;  5G5E A;  1O81 A;  4DSS B;  8GSS A;  5D96 A;  3LXT A;  2F8A A;  4ECJ A;  3F4S A;  1KEB A;  1EP8 A;  1A2L A;  2LRN A;  4PUR A;  2IL3 A;  3F6D A;  2B1K A;  4IVF A;  2IWT A;  2C0G A;  1ZL9 A;  1O8X A;  1JZW A;  2FUG 2;  2RUE A;  2XBQ A;  3GL3 A;  2K18 A;  4X1U A;  3VLN A;  4MDC A;  1DBY A;  4P3Y B;  1GSD A;  3U5R E;  2O7K A;  5JWQ B;  3IV4 A;  2H19 A;  3EIN A;  6GSV A;  3UVT A;  2N5B A;  5DBQ A;  4ZB8 A;  2MMO A;  4EUY A;  4KGI A;  2GZP A;  4FYC A;  3H4K A;  5LCZ A;  3LSZ A;  1ZYQ B;  1PKW A;  3TKR A;  2F8F A;  5EPF A;  2CZ2 A;  1TK0 B;  3KTB A;  3UJ1 A;  2HNL A;  1K0A A;  1BQ7 A;  1M0U A;  3P7X A;  2DSA A;  1OC3 A;  4JBB A;  1GRX A;  1R4W A;  2HXK A;  3RAZ A;  3P8W A;  1OKD A;  5JWR B;  4V2N A;  1FG4 A;  3FKF A;  4K8M A;  1SD9 A;  4PNF A;  3W8J A;  3VPT A;  3M0F A;  3EYT A;  3L78 A;  2B1L A;  3F4R A;  1T8E B;  3GKM A;  5C04 A;  3VWV A;  1SL1 B;  4J2F A;  3DIE A;  4MF6 A;  1XVQ A;  2HSY A;  2H72 A;  1K3Y A;  1SKR B;  1EZK A;  2G0F A;  5IMV A;  1MD4 A;  4L0U A;  3CSJ A;  20GS A;  1R5P A;  2YZH A;  2YP6 A;  3R2Q A;  1PA3 A;  4PNG A;  3D5J A;  3MSZ A;  3VWU A;  3GKX A;  4EDZ A;  2IFQ B;  4IEL A;  4XS1 A;  3BCI A;  4MZW A;  1I5G A;  4AGS A;  4EDY A;  2G2Q A;  16GS A;  1ILO A;  4I5Q A;  2OAC A;  3TB2 A;  1OVN A;  2FY6 A;  1WIK A;  1TU8 A;  1XBS A;  3H1N A;  1EWX A;  4GSS A;  3GYK A;  5FWG A;  4RI6 A;  3RHB A;  4K6X A;  3QAG A;  1WPI A;  4K9Z A;  5ECR B;  3HVV A;  1B4Q A;  3GH9 A;  4ID0 A;  1QXH A;  1ERV A;  2GSQ A;  2R2J A;  2VL2 C;  2YN1 A;  1SK0 A;  4IS0 A;  1GTU A;  3CSH A;  2P0G A;  3C1S A;  4LLR A;  4JED A;  1G6Y A;  3VI7 A;  4MAB A;  3GX8 A;  3IK9 A;  2IMF A;  2V32 A;  4EF0 A;  1ZOF A;  2IIY A;  2X64 A;  2LJK A;  4OFM A;  4LL4 B;  3TCO A;  1FB6 A;  2X99 A;  1TDI A;  1YZX A;  4WR5 A;  5ENU A;  2FHE A;  2P5Q A;  1PKZ A;  5ECN B;  2LV3 A;  2RLI A;  1PD2 1;  4PQI A;  5JCU A;  5ECQ B;  3EU3 A;  2PVO C;  2X8G A;  4GLT A;  5D9T A;  4TR1 B;  1GSQ A;  3GN3 A;  1RW1 A;  4N30 A;  1TP9 A;  3I6A A;  4QQ7 A;  2IN3 A;  5FHI A;  4WKW A;  5EVO A;  4YH2 A;  5DDL A;  1AIU A;  1BX9 A;  1HD2 A;  1MD3 A;  3D22 A;  4V1A p;  5GST A;  1OE8 A;  3PIN A;  3KTL A;  3TKS C;  5J3R A;  5CRD A;  4NPB A;  2M80 A;  3BD2 A;  2ALB A;  1W4V A;  2OJL A;  1A8L A;  2DMM A;  1JZO A;  5D9V A;  2NDO A;  1GTA A;  3HKR A;  2JAC A;  3LEF A;  1WJK A;  1MDJ A;  2H1D A;  4IHU A;  2N5F A;  3HZ8 A;  3ME8 A;  4HZ4 A;  3ZYW A;  5IMZ A;  5ID2 A;  4POL A;  4KB3 A;  4HZ2 A;  2VL9 A;  4QL9 A;  3MDK A;  4ZIJ A;  3L9S A;  4K1F A;  5F06 A;  3CRT A;  2C0E A;  6GST A;  4O32 A;  5DCH A;  1O73 A;  4N0Z A;  4KCE A;  2JZT A;  1O7U A;  1XVW A;  5ECK B;  3E9J B;  1TKD B;  3GV1 A;  2CV4 A;  2CAI A;  2JAD A;  3O76 A;  1WP0 A;  2KOK A;  4GXZ A;  1K0B A;  4ZBD A;  2O87 A;  3FZ5 A;  4MF5 A;  5COH A;  5ABR A;  3FHK A;  3LYK A;  5EY6 A;  5HR1 A;  2FNO A;  1SKW B;  5DAL A;  3D4T A;  3A5W A;  4ZL9 A;  4HEA 2;  3ZRD A;  3Q19 A;  1PRX A;  3HD5 A;  1QQ2 A;  2V6K A;  1QUW A;  2J9H A;  1M2D A;  2JZS A;  2TRC P;  1Z3E A;  1JFU A;  2HZE B;  3I9V 2;  2JSY A;  11GS A;  3F4T A;  3GKK A;  4MLY A;  2K8S A;  4J57 E;  2NTO A;  4ZBA A;  4Z7X A;  3L9V A;  3VI5 A;  3IR4 A;  4HU7 A;  2XBI A;  2YWN A;  2JZR A;  4AJ6 A;  2V41 A;  2GQM A;  2O85 A;  2CX4 A;  3ZZX A;  3F63 A;  2YJH A;  3GMF A;  5AIS A;  2FWH A;  2PGT A;  4JR4 A;  1FW1 A;  1A0F A;  3N9J A;  3FR6 A;  1TTZ A;  4LMV A;  2K9F A;  4NMU A;  3N5O A;  4JRR A;  1PX7 A;  2BTO T;  3APO A;  2PBJ A;  1FHE A;  1TOF A;  2IJY A;  3C7M A;  3EMP A;  3O6T A;  2M72 A;  1V2A A;  4K7I A;  4MJE A;  1K3L A;  4CHS A;  5CNW A;  2H01 A;  2PPT A;  2EIO A;  4PQ1 A;  3GRX A;  3RHC A;  1Z5Y E;  1XPV A;  1XWG A;  1PGT A;  1X5E A;  3FR3 A;  3GIX A;  3IXR A;  1IYI A;  3UEM A;  1ABA A;  4RQX A;  2PMT A;  1TRV A;  2I3Y A;  1JLV A;  2CZ3 A;  2CX3 A;  2VM1 A;  1XFL A;  4GQF A;  3WGE A;  4KH7 A;  2K8V A;  2KUC A;  5DJL A;  1QGV A;  2YOI A;  2WZ9 A;  3ZL5 A;  5ECI B;  1XW9 A;  3ZIV A;  2GST A;  3P2A A;  1XZO A;  1FO5 A;  2IFQ A;  4AJ7 A;  2VCX A;  2YNX A;  2I1U A;  1X9W B;  2X8C A;  1MDI A;  18GS A;  1AQV A;  4KA0 A;  1T7P B;  2QSI A;  3KH9 A;  4DVC A;  3VFI A;  2JSZ A;  5HFG A;  4MPF A;  5CRG A;  10GS A;  1K0M A;  5ECL B;  3GX0 A;  3QAV A;  4I2U A;  3ZIT A;  2VLU A;  4XRA A;  3EE2 A;  4GRF A;  4GWR A;  2HLS A;  1A2M A;  2H74 A;  1M2A A;  1YY7 A;  4G19 A;  4K7O A;  3QOU A;  2RUF A;  1CQG A;  5KEJ A;  4MZB A;  1SK2 A;  4TXO A;  1M9A A;  2LST A;  4MH3 A;  1THX A;  1SK1 A;  2VAF A;  2R37 A;  2HT9 A;  1EEM A;  2HSH A;  3H93 A;  1SL0 B;  1WRY A;  2R3X A;  3TRX A;  1XWA A;  1TRS A;  5G1K A;  3QCP A;  4H86 A;  4OCE A;  4POB A;  5JWO B;  1ZMA A;  5A4W A;  3LWA A;  2WDU A;  3VUR A;  4TN8 A;  1XXU A;  3KIJ A;  2L6C A;  2DBC A;  3O3T A;  3LFL A;  1EEJ A;  4JU5 A;  4HQS A;  2HE3 A;  2FWE A;  2AUV A;  1BAY A;  4O7H A;  2OE1 A;  3E0U A; 
#chains in the Genus database with same CATH topology
 1V58 A;  1Z6M A;  3FK8 A;  3GA4 A;  4MP4 A;  4EXJ A;  5F8B A;  4FYU A;  4V2M A;  3UAP A;  2H6Z A;  4FYB A;  4ZBB A;  2IMK A;  2FLS A;  4K5R A;  2GTU A;  1Z7R A;  4L5O A;  4D73 B;  2LJA A;  1B9Y C;  1K0N A;  1AQX A;  1F37 A;  2C0F A;  5AIX A;  1B8X A;  5DAL B;  1EV4 A;  1M3J A;  5AIV A;  1EV9 A;  1G7O A;  4TVE A;  4YQU A;  1SKS B;  1VF1 A;  5ECM B;  4IP6 A;  4OMV A;  1TW9 A;  4MMM A;  4QL7 A;  2CVK A;  4PX1 A;  5FT3 A;  2C0D A;  1B4P A;  2ON5 A;  2O8V B;  4EL1 A;  3WD6 A;  1NHY A;  3HJP A;  3NOF A;  2NBS A;  3ZVJ A;  3HJO A;  1VF2 A;  2C3T A;  3RBT A;  4JZQ A;  1XW5 A;  4F9Z A;  3S9F A;  3IHQ A;  1N2A A;  4ECI A;  4MZC A;  2VUP A;  2NPB A;  3KGK A;  2OKA A;  3QPM A;  2L4C A;  2FCH A;  1J08 A;  2VLT A;  2HZE A;  1FOV A;  5HR3 A;  4WF4 A;  5DAK A;  3FR9 A;  3CXG A;  4ZL7 A;  2VLV A;  3UAR A;  5ECH B;  4NXI A;  1HQO A;  2X4A A;  3IBH A;  2GSS A;  4G0L A;  2LNT A;  4DSR A;  4KND A;  1CQH A;  2EIQ A;  4MA9 A;  4FO5 A;  1ZYN A;  4PGT A;  1IYH A;  3LQ7 A;  4WBJ A;  5HFK A;  4KAE A;  1GNW A;  5HR2 A;  3I43 A;  2A2P A;  5EL8 A;  2GGT A;  1EP7 A;  2VD0 A;  2R5G A;  5IQY A;  2H0I A;  2HSM A;  2GDR A;  3RDW A;  3G9B A;  2UZ8 A;  5GZZ B;  1AXD A;  1AAZ A;  5B7C A;  1DSB A;  4EVM A;  3GL5 A;  3QFB C;  4MF7 A;  3H8Q A;  2FD3 A;  3WYW A;  14GS A;  1Z9H A;  4HU9 A;  1OYJ A;  4WR4 A;  4KE3 A;  4O5Q A;  1A23 A;  4ECB A;  3HCZ A;  1Z6N A;  3KH7 A;  3HZ4 A;  2OA7 A;  1JLW A;  3EUR A;  2VL2 A;  1EGR A;  1NHO A;  2CA8 A;  2GS3 A;  3F3R A;  3VWW A;  5INY A;  3GUS A;  4K2D A;  2E2G A;  2LKU A;  4HSC X;  3Q6O A;  1X0R A;  4EIQ A;  4TXV A;  4XHM A;  3ERG A;  3IK7 A;  3HA9 A;  3C71 A;  1ZCP A;  1F9M A;  4TXO B;  4HI7 A;  4ML6 A;  2LEG A;  1ON4 A;  2YZU A;  3KZQ A;  3EMX A;  2LRC A;  1HNA A;  3TRQ A;  2V1M A;  1TI1 A;  2WGR A;  3FW2 A;  1DE2 A;  1M2B A;  4XCS A;  3DWV A;  2H1B A;  3ERF A;  3C8E A;  1E6B A;  1GUK A;  4I8B A;  1S3A A;  3BBY A;  3VWX A;  3TKS A;  1XCC A;  1QMV A;  3EC3 A;  4RI7 A;  4X43 A;  4O5R A;  2F3M A;  2BMX A;  1XWC A;  2L57 A;  2VOC A;  3A2V A;  5C00 A;  3A5I A;  1FVK A;  3D0Z A;  2M46 A;  6GSY A;  1X9M B;  2E2M A;  3GUR A;  3TJG A;  3KM6 A;  3GFK A;  1GUH A;  5IIZ A;  1RK4 A;  3A2X A;  3BOA A;  3W6G A;  2A4H A;  3TKP A;  2H76 A;  1PN0 A;  5ELG A;  1U87 A;  3CRU A;  3F8U A;  3FZA A;  1HNB A;  1AC1 A;  3TKS E;  3H79 A;  4EKZ A;  3MIX A;  2ZUP A;  4BL7 A;  3TDG A;  3DEX A;  4YAV A;  1YF0 A;  1SYX A;  4KSM A;  1QFN A;  4Q5Q A;  3KP8 A;  1WWJ A;  4OCF A;  2N5A A;  17GS A;  4MJA A;  1FVJ A;  1XOB A;  2IMI A;  2JL4 A;  2RM6 A;  4D73 A;  1GWC A;  3C73 A;  4IBP A;  2C80 A;  4RQR A;  2R4V A;  1GSS A;  3DKS A;  2H75 A;  1TK8 B;  2LJR A;  2YAN A;  4IGJ A;  4ZL8 A;  2HRF A;  1ML6 A;  2RII A;  2VCQ A;  2TIR A;  5A5K A;  3J7Y b;  1TU7 A;  3HXS A;  3UL3 A;  4BVY B;  5G5F A;  4NAX A;  2NVL A;  1I9D A;  5DAK B;  2OAD A;  2PU9 C;  1VF4 A;  1PL1 A;  3FZ4 A;  1GUM A;  4ZB6 A;  1Q98 A;  2WB9 A;  2OE3 A;  5HQP A;  1G7E A;  2H1A A;  2DKI A;  1O85 A;  2B7J A;  2L59 A;  3G7Y A;  2VCT A;  4TR4 A;  2GT6 A;  4G9H A;  1T4Z A;  1A24 A;  4FH8 A;  2KP2 A;  4TW5 A;  1TJD A;  2V2G A;  3WT1 A;  3ZVJ D;  3GST A;  3UBL A;  2YCD A;  4G10 A;  4Z2T A;  4WXT A;  4N10 A;  4Q5R A;  3DYR A;  2R0P A;  3JCM L;  3UIW A;  1KNG A;  2X49 A;  2VM2 A;  1U88 A;  2XC2 A;  5GAP D;  1SEN A;  2PWJ A;  5CAX A;  2AV4 A;  3PR8 A;  1SYR A;  4Q5F A;  3M9J A;  4ACS A;  4Q5N A;  4ILF A;  4HJ2 A;  2MMA A;  1THO A;  1T1V A;  1KTE A;  2A2S A;  3HVX A;  3HYP A;  2H0G A;  3PH9 A;  5IOX A;  2C3Q A;  4WBR D;  5J4U A;  4TRX A;  1GTB A;  1M7T A;  2H8L A;  5G30 A;  5D9X A;  3IC4 A;  5JCG A;  2GQL A;  5H5R A;  3ISO A;  1SJI A;  2FWF A;  3A3T A;  4HUA A;  5B8A A;  3GTU B;  1H4O A;  1X5C A;  1S3D A;  5CP1 A;  4PXO A;  3NZN A;  1GNE A;  1TXX A;  3APQ A;  4GST A;  5ELA A;  4KSO A;  1ERT A;  2DJ1 A;  3DVW A;  3TGZ A;  3DXB A;  2MYG A;  1Y25 A;  1U3A A;  3QR6 A;  2GZZ A;  1M9B A;  3TJB A;  6GSS A;  4ZXG A;  1K0D A;  5B6M A;  3D21 A;  4XS6 A;  3E3E A;  3ZFL A;  3TOU A;  4USS A;  3EVI A;  2GQK A;  3WGX A;  2MBS A;  2WFC A;  4K0G A;  3SWL A;  4L5L A;  7GSS A;  2V6O A;  1ZYE A;  3IPZ A;  2DJ3 A;  4NV2 A;  1XOA A;  2CVB A;  1T4Y A;  3U6V A;  2D2Z A;  5BRT A;  1EOG A;  3F9U A;  1PL2 A;  5CO3 A;  2IMD A;  3W8S A;  2OE0 A;  1V57 A;  2H66 A;  4X4J A;  1YEX A;  4BVX B;  1SL2 B;  1ERU A;  2E7P A;  1V40 A;  3UMA A;  2DIY A;  3BCK A;  4MJB A;  5B8B A;  4A5P A;  1E2Y A;  2DJ2 A;  4EC0 A;  2HFD A;  5JCW A;  3AY8 A;  5D8I A;  4BL7 B;  5E4W A;  1AW9 A;  3ME7 A;  2AJQ B;  4BWQ A;  1WE0 A;  1X5D A;  3MAK A;  2B6M A;  2DJ0 A;  5ECO B;  2L4Q A;  5HR0 A;  5KN2 A;  4I97 A;  2LTK A;  1X9S B;  4OFT A;  2O89 A;  3WT2 A;  3D4M A;  5KN1 A;  4F0B A;  3HY2 A;  5KN0 A;  1Y6E A;  2C4J A;  2XHF A;  4DEJ A;  1GP1 A;  2YJ7 A;  3QMX A;  3TJK A;  3KP9 A;  2F9S A;  3HDC A;  2MBT A;  6GSX A;  19GS A;  5J9B A;  3FRC A;  4F2I A;  4PUF C;  2REM A;  1OC8 A;  3ZML A;  4MJC A;  1Z7P A;  4IJI A;  3F0I A;  4NHZ A;  1U6T A;  1UC7 A;  3IOS A;  3TRP A;  2R6K A;  1B48 A;  1SD8 A;  4OD7 A;  2H73 A;  1M99 A;  4Z2R A;  2MMN A;  4OWY A;  4DSQ A;  3Q74 A;  1SJZ A;  5A4V A;  6GSW A;  5IO2 A;  4PUA A;  5CRH A;  4CW9 A;  1PN9 A;  4HS1 A;  3HVS A;  2QKE A;  4BVY A;  1TRU A;  2B5E A;  2YPM A;  2H6Y A;  1C72 A;  2A2R A;  5J5N A;  3OR5 A;  3ZRE A;  1LU4 A;  5CYY A;  4ZIL A;  5DQS A;  1J9B A;  3DD3 A;  2A4V A;  5DCG A;  1QK8 A;  4V2L A;  1YQ1 A;  4KW6 A;  2FA8 A;  2DC5 A;  3IC8 A;  4KCA A;  5G31 A;  4YQM A;  2WS2 A;  3QAW A;  2YV7 A;  5E59 A;  3EWL A;  3PGT A;  2Z9S A;  3BJ5 A;  3TKQ A;  2XPE A;  2H70 A;  2AAW A;  5IPG A;  1NW2 A;  4NWY A;  5H5Q A;  1OC9 B;  4NHW A;  2LUS A;  2RM5 A;  1UVZ A;  1J0F A;  5ECS A;  1A2J A;  2GSR A;  3V1W A;  2B5X A;  1V98 A;  2PN8 A;  1USB A;  4TR0 A;  2CVD A;  1B9X C;  1YJ6 A;  2B3S A;  1EGO A;  4EO3 A;  4FIW A;  2XPD A;  3D6I A;  13GS A;  1YF1 A;  2HZF A;  4CY8 A;  1AQW A;  2ES7 A;  4I6X A;  5G2Z A;  3DVX A;  2WUL A;  2L5O A;  2QC7 A;  5IOW A;  2EC4 A;  5F07 A;  4L8E A;  2I9H A;  1MTC A;  4YQV A;  2VCZ A;  2VCV A;  2KP1 A;  2LQO A;  3US3 A;  2HI7 A;  4JE1 A;  1GSE A;  2C3N A;  4BPY A;  1AUC A;  3GKN A;  4LL1 B;  2H6X A;  1PQN A;  5GAN D;  4XRD A;  3I69 A;  1GSF A;  1RQM A;  3QFA C;  4F03 A;  5D73 A;  3L0H A;  4O92 A;  1V9W A;  3GTU A;  3TUE A;  2FGX A;  1TI3 A;  2YWI A;  3G7J A;  1ACV A;  2LRT A;  4K5S A;  3VPQ A;  4XIH A;  2JU5 A;  1XG8 A;  4ML1 A;  5AN1 A;  4E8H A;  1G6W A;  2P31 A;  2DML A;  5IPH A;  2L5L A;  3QDN A;  3CYN A;  3DML A;  4F0C A;  1YKA A;  1G0T A;  3G7I A;  1WMJ A;  2IPA A;  2X8H A;  4J56 E;  5DVB A;  1O6J A;  1ST9 A;  1WOU A;  5AGY A;  1VF3 A;  2WRT A;  3ED3 A;  1PFO A;  4MK3 A;  4V1A g;  3TJJ A;  4N11 A;  4AF2 A;  3ZLP A;  3TOT A;  5IO0 A;  2BJX A;  2VD1 A;  2GLR A;  1FAA A;  4JR6 A;  1GSU A;  2KLX A;  1TK5 B;  4BVX A;  3IAS 2;  1N8J A;  4YAP A;  4WF5 A;  4XTS A;  1UN2 A;  1ZZY A;  3K8N A;  1HYU A;  1BJX A;  4I2T A;  4XS4 B;  4HQZ A;  4CY6 A;  1OKT A;  5LNK e;  1SJ6 A;  3GSS A;  4ICY A;  3FY7 A;  1MDK A;  2C8U A;  5IMA A;  5KN3 A;  1PX6 A;  4K7N A;  2MZC A;  1DE1 A;  2WJU A;  3RPN A;  2L6D A;  4WET A;  3ZMK A;  3KJY A;  1YKC A;  2B5Y A;  4GF0 A;  4X0X A;  4PTS A;  1DUG A;  5D93 A;  4HDE A;  4EE0 A;  4K0N A;  3UBK A;  4HJM A;  4KX4 A;  5DQY A;  4IP1 A;  1K0O A;  3C1R A;  4BIK A;  1U3I A;  3M8N A;  2MMZ A;  5L71 A;  4MH2 A;  3IRA A;  1NM3 A;  1Q4J A;  4G2E A;  4IW9 A;  1F2E A;  2GT5 A;  3MYD A;  2HRK A;  3L4N A;  5GSS A;  2GZY A;  4GSN A;  2R0G A;  1R26 A;  1KBN A;  4DSS A;  1BED A;  1F6M C;  4G0I A;  5H5S A;  1GL8 A;  2VIM A;  1OAZ A;  4PQH A;  3LGC A;  4F82 A;  5F0G A;  3CBU A;  4BA7 A;  3ZFB A;  3CMI A;  1EOH A;  2PUK C;  1VRS D;  3KCM A;  2B7K A;  6GSU A;  2YV9 A;  1ZGN A;  1K3O A;  2FWG A;  5J9C A;  4POM A;  1PSQ A;  3F3Q A;  4KUN A;  1F3A A;  4GQC A;  4ECC A;  5F05 A;  3GNJ A;  3FEU A;  3M1G A;  3IDV A;  3M3M A;  4NV5 A;  2GVP A;  5J41 A;  1A0R P;  2H71 A;  1LJR A;  2FA4 A;  2J23 A;  3CSI A;  3J7Y k;  1XW6 A;  3IA1 A;  3LYP A;  1A8Y A;  3KXO A;  2HRN A;  1TRW A;  1XWB A;  4MCU A;  4IQA A;  3LG6 A;  1OE7 A;  4OO4 A;  3APS A;  4POK A;  2AHE A;  3WGD A;  1NSW A;  3ZTL A;  5KOW A;  4WEY A;  2IME A;  3EU4 A;  2DLX A;  5A4U A;  4KDU A;  1GSY A;  12GS A;  2VCW A;  1XWK A;  1K0C A;  1YEP A;  1OC9 A;  2DKH A;  3FZ9 A;  1GLP A;  5IMC A;  4TR3 A;  3RPP A;  5IMD A;  1JZD A;  2EIR A;  1M3I A;  1LBK A;  1GTI A;  3DGQ A;  4MNN A;  22GS A;  5BMU A;  3LXZ A;  2KHP A;  4LMW A;  4YKG A;  1F3B A;  1VGL A;  4TKY A;  4OFN A;  5G1L A;  4L0W A;  3A2W A;  3P90 A;  2H0H A;  1SU9 A;  4HOJ A;  2P5R A;  4AJ8 A;  4GTU A;  3CTG A;  1JZR A;  4RUV A;  5CRW A;  4IKH A;  2WCI A;  4G0K A;  1GH2 A;  2QGV A;  3KMO A;  2YWM A;  4TOP A;  2TRX A;  4EIP A;  1T00 A;  2VO4 A;  5B6N A;  2PER A;  3CTF A;  4IQ1 A;  1ERW A;  3KMN A;  2DJJ A;  3NIV A;  2AYT A;  3HHV A;  5D9W A;  5CRE A;  2OBI A;  3SBC A;  3IE3 A;  4E8E A;  3ZIJ A;  9GSS A;  1ZYP A;  2C1Y A;  2ZNM A;  1O8W A;  2I81 A;  2F51 A;  2QA1 A;  4CDO A;  3UVH A;  1JHB A;  3VK9 A;  4N0V A;  2E0Q A;  1R5A A;  4KDX A;  3HJM A;  3IAM 2;  4ISD A;  1S3C A;  1T3B A;  4BWS A;  2HYX A;  3TJF A;  2YWO A;  5IMF A;  3QD9 A;  4ULX A;  2PVQ A;  4LA1 A;  4KDY A;  3HVN A;  5IM9 A;  3LOR A;  3FYG A;  2H1G A;  3R3E A;  3F6F A;  2CT6 A;  1FB0 A;  2ZCT A;  2LS5 A;  1W89 A;  2LQQ A;  2DJK A;  1XIY A;  2AB6 A;  3LJR A;  3GHA A;  2CAQ A;  1HNC A;  5ID2 B;  4TR1 A;  2DIZ A;  4Z2U A;  2H30 A;  4OO5 A;  1BYE A;  3L9U A;  3MWH A;  4ZB9 A;  1UA5 A;  3EPT A;  5ECP B;  2OBK A;  1URM A;  3M9K A;  3KEB A;  4IJ3 A;  2LNS A;  2VL3 A;  1YDK A;  5DJM A;  2CQ9 A;  1BG5 A;  2ON7 A;  3KD0 A;  4MPG A;  3ERW A;  1R7H A;  5HFI A;  1GUL A;  3UOM A;  2I4A A;  4XS4 A;  4IN0 A;  3DRN A;  1PMT A;  4GCI A;  3Q18 A;  1MEK A;  1GLQ A;  1H75 A;  2K6V A;  3MNG A;  3GH6 A;  5LD0 A;  5G5E A;  1O81 A;  4DSS B;  8GSS A;  5D96 A;  3LXT A;  2F8A A;  4ECJ A;  3F4S A;  1KEB A;  1EP8 A;  1A2L A;  2LRN A;  4PUR A;  2IL3 A;  3F6D A;  2B1K A;  4IVF A;  2IWT A;  2C0G A;  1ZL9 A;  1O8X A;  1JZW A;  2FUG 2;  2RUE A;  2XBQ A;  3GL3 A;  2K18 A;  4X1U A;  3VLN A;  4MDC A;  1DBY A;  4P3Y B;  1GSD A;  3U5R E;  2O7K A;  5JWQ B;  3IV4 A;  2H19 A;  3EIN A;  6GSV A;  3UVT A;  2N5B A;  5DBQ A;  4ZB8 A;  2MMO A;  4EUY A;  4KGI A;  2GZP A;  4FYC A;  3H4K A;  5LCZ A;  3LSZ A;  1ZYQ B;  1PKW A;  3TKR A;  2F8F A;  5EPF A;  2CZ2 A;  1TK0 B;  3KTB A;  3UJ1 A;  2HNL A;  1K0A A;  1BQ7 A;  1M0U A;  3P7X A;  2DSA A;  1OC3 A;  4JBB A;  1GRX A;  1R4W A;  2HXK A;  3RAZ A;  3P8W A;  1OKD A;  5JWR B;  4V2N A;  1FG4 A;  3FKF A;  4K8M A;  1SD9 A;  4PNF A;  3W8J A;  3VPT A;  3M0F A;  3EYT A;  3L78 A;  2B1L A;  3F4R A;  3LW9 A;  1T8E B;  3GKM A;  5C04 A;  3VWV A;  1SL1 B;  4J2F A;  3DIE A;  4MF6 A;  1XVQ A;  4KF9 A;  2HSY A;  2H72 A;  1K3Y A;  1SKR B;  1EZK A;  2G0F A;  5IMV A;  1MD4 A;  4L0U A;  4K2X A;  3CSJ A;  20GS A;  1R5P A;  2YZH A;  2YP6 A;  3R2Q A;  1PA3 A;  4PNG A;  3D5J A;  3MSZ A;  3VWU A;  3GKX A;  4EDZ A;  2IFQ B;  4IEL A;  4XS1 A;  3BCI A;  4MZW A;  1I5G A;  4AGS A;  4EDY A;  2G2Q A;  16GS A;  1ILO A;  4I5Q A;  2OAC A;  3TB2 A;  1OVN A;  2FY6 A;  1WIK A;  1TU8 A;  1XBS A;  3H1N A;  1EWX A;  4GSS A;  3GYK A;  4FQU A;  4RI6 A;  5FWG A;  3RHB A;  4K6X A;  3QAG A;  1WPI A;  4K9Z A;  5ECR B;  3HVV A;  1B4Q A;  3GH9 A;  4ID0 A;  1QXH A;  1ERV A;  2GSQ A;  2R2J A;  2VL2 C;  2YN1 A;  1SK0 A;  4IS0 A;  1GTU A;  3CSH A;  2P0G A;  3C1S A;  4LLR A;  4JED A;  1G6Y A;  3VI7 A;  4MAB A;  3GX8 A;  3IK9 A;  2IMF A;  2V32 A;  4EF0 A;  1ZOF A;  2IIY A;  2X64 A;  2LJK A;  4OFM A;  4LL4 B;  3TCO A;  1FB6 A;  2X99 A;  1TDI A;  1YZX A;  4WR5 A;  5ENU A;  2FHE A;  2P5Q A;  1PKZ A;  5ECN B;  2LV3 A;  2RLI A;  1PD2 1;  4PQI A;  5JCU A;  5ECQ B;  3EU3 A;  2PVO C;  2X8G A;  4GLT A;  5D9T A;  4TR1 B;  1GSQ A;  3GN3 A;  1RW1 A;  4N30 A;  1TP9 A;  3I6A A;  4QQ7 A;  2IN3 A;  5FHI A;  4WKW A;  1S3R A;  5EVO A;  4YH2 A;  5DDL A;  1AIU A;  1BX9 A;  1HD2 A;  1MD3 A;  3D22 A;  4V1A p;  5GST A;  1OE8 A;  3PIN A;  3KTL A;  3TKS C;  5J3R A;  5CRD A;  4NPB A;  2M80 A;  3BD2 A;  2ALB A;  1W4V A;  2OJL A;  1A8L A;  2DMM A;  1JZO A;  5D9V A;  2NDO A;  1GTA A;  3HKR A;  2JAC A;  3LEF A;  1WJK A;  1MDJ A;  2H1D A;  4IHU A;  2N5F A;  3HZ8 A;  3ME8 A;  4HZ4 A;  3ZYW A;  5IMZ A;  5ID2 A;  4POL A;  4KB3 A;  1FOH A;  4HZ2 A;  2VL9 A;  4QL9 A;  3MDK A;  4ZIJ A;  3L9S A;  4K1F A;  5F06 A;  3CRT A;  2C0E A;  6GST A;  4O32 A;  5DCH A;  4O5U A;  1O73 A;  4N0Z A;  4KCE A;  2JZT A;  1O7U A;  1XVW A;  5ECK B;  3E9J B;  1TKD B;  3GV1 A;  2CV4 A;  2CAI A;  2JAD A;  3O76 A;  1WP0 A;  2KOK A;  4GXZ A;  1K0B A;  4ZBD A;  2O87 A;  3FZ5 A;  4MF5 A;  5COH A;  5ABR A;  3FHK A;  3LYK A;  5EY6 A;  5HR1 A;  2FNO A;  1SKW B;  5DAL A;  3D4T A;  3A5W A;  4ZL9 A;  4HEA 2;  3ZRD A;  3Q19 A;  1PRX A;  3HD5 A;  2QA2 A;  1QQ2 A;  2V6K A;  1QUW A;  2J9H A;  1M2D A;  2JZS A;  3FMW A;  2TRC P;  1Z3E A;  1JFU A;  2HZE B;  3I9V 2;  2JSY A;  11GS A;  3F4T A;  3GKK A;  4MLY A;  2K8S A;  4J57 E;  2NTO A;  4ZBA A;  4Z7X A;  3L9V A;  3VI5 A;  3IR4 A;  4HU7 A;  2XBI A;  2YWN A;  2JZR A;  4AJ6 A;  2V41 A;  2GQM A;  2O85 A;  2CX4 A;  3ZZX A;  3F63 A;  2YJH A;  3GMF A;  5AIS A;  2FWH A;  2PGT A;  2HRA A;  4JR4 A;  1FW1 A;  3PPU A;  1A0F A;  3N9J A;  3FR6 A;  1TTZ A;  4LMV A;  2K9F A;  4NMU A;  3N5O A;  4JRR A;  1PX7 A;  2BTO T;  3APO A;  2PBJ A;  1FHE A;  1TOF A;  2IJY A;  3C7M A;  3EMP A;  3O6T A;  2M72 A;  1V2A A;  4K7I A;  4MJE A;  1K3L A;  4CHS A;  5CNW A;  2H01 A;  2PPT A;  2EIO A;  4PQ1 A;  3GRX A;  3RHC A;  1Z5Y E;  1XPV A;  1XWG A;  1PGT A;  1X5E A;  3FR3 A;  3GIX A;  3IXR A;  1IYI A;  3UEM A;  1ABA A;  4RQX A;  2PMT A;  1TRV A;  2I3Y A;  1JLV A;  2CZ3 A;  2CX3 A;  2VM1 A;  1XFL A;  4GQF A;  3WGE A;  4KH7 A;  2K8V A;  2KUC A;  5DJL A;  1QGV A;  2YOI A;  2WZ9 A;  3ZL5 A;  5ECI B;  2R0C A;  1XW9 A;  3ZIV A;  2GST A;  3P2A A;  1XZO A;  1FO5 A;  2IFQ A;  4AJ7 A;  2VCX A;  2YNX A;  2I1U A;  1X9W B;  2X8C A;  1MDI A;  18GS A;  1AQV A;  4KA0 A;  1T7P B;  2QSI A;  3KH9 A;  4DVC A;  3VFI A;  2JSZ A;  5HFG A;  4MPF A;  5CRG A;  10GS A;  1K0M A;  5ECL B;  3GX0 A;  3QAV A;  4I2U A;  3ZIT A;  2VLU A;  4XRA A;  3EE2 A;  4GRF A;  4GWR A;  2HLS A;  1A2M A;  2H74 A;  1M2A A;  1YY7 A;  4G19 A;  4K7O A;  3QOU A;  2RUF A;  1CQG A;  5KEJ A;  4MZB A;  1SK2 A;  4TXO A;  1M9A A;  2LST A;  4MH3 A;  1THX A;  1SK1 A;  5KOX A;  2VAF A;  2R37 A;  2HT9 A;  1EEM A;  2HSH A;  3H93 A;  1SL0 B;  1WRY A;  2R3X A;  3TRX A;  1XWA A;  1TRS A;  5G1K A;  3QCP A;  4H86 A;  4OCE A;  4POB A;  3IHG A;  5JWO B;  1ZMA A;  5A4W A;  3CQF A;  3LWA A;  2WDU A;  3VUR A;  4TN8 A;  1XXU A;  3KIJ A;  2L6C A;  2DBC A;  3O3T A;  3LFL A;  1EEJ A;  4YKF A;  4JU5 A;  4HQS A;  2HE3 A;  2FWE A;  2AUV A;  1BAY A;  4O7H A;  2OE1 A;  3E0U A; 
#chains in the Genus database with same CATH homology
 1V58 A;  1Z6M A;  3FK8 A;  3GA4 A;  4MP4 A;  4EXJ A;  5F8B A;  4FYU A;  4V2M A;  3UAP A;  2H6Z A;  4FYB A;  4ZBB A;  2IMK A;  2FLS A;  4K5R A;  2GTU A;  1Z7R A;  4L5O A;  4D73 B;  2LJA A;  1B9Y C;  1K0N A;  1AQX A;  1F37 A;  2C0F A;  5AIX A;  1B8X A;  5DAL B;  1EV4 A;  5AIV A;  1EV9 A;  1G7O A;  4TVE A;  4YQU A;  1SKS B;  1VF1 A;  5ECM B;  4IP6 A;  4OMV A;  1TW9 A;  4MMM A;  4QL7 A;  2CVK A;  4PX1 A;  5FT3 A;  2C0D A;  1B4P A;  2ON5 A;  2O8V B;  4EL1 A;  3WD6 A;  1NHY A;  3HJP A;  3NOF A;  2NBS A;  3ZVJ A;  3HJO A;  1VF2 A;  2C3T A;  3RBT A;  4JZQ A;  1XW5 A;  4F9Z A;  3S9F A;  3IHQ A;  1N2A A;  4ECI A;  4MZC A;  2VUP A;  2NPB A;  3KGK A;  2OKA A;  3QPM A;  2L4C A;  2FCH A;  1J08 A;  2VLT A;  2HZE A;  1FOV A;  5HR3 A;  4WF4 A;  5DAK A;  3FR9 A;  3CXG A;  4ZL7 A;  2VLV A;  3UAR A;  5ECH B;  4NXI A;  1HQO A;  2X4A A;  3IBH A;  2GSS A;  4G0L A;  2LNT A;  4DSR A;  4KND A;  1CQH A;  2EIQ A;  4MA9 A;  4FO5 A;  1ZYN A;  4PGT A;  1IYH A;  3LQ7 A;  4WBJ A;  5HFK A;  4KAE A;  1GNW A;  5HR2 A;  3I43 A;  2A2P A;  5EL8 A;  2GGT A;  1EP7 A;  2VD0 A;  2R5G A;  5IQY A;  2H0I A;  2HSM A;  2GDR A;  3RDW A;  3G9B A;  2UZ8 A;  5GZZ B;  1AXD A;  1AAZ A;  5B7C A;  1DSB A;  4EVM A;  3GL5 A;  3QFB C;  4MF7 A;  3H8Q A;  2FD3 A;  3WYW A;  14GS A;  1Z9H A;  4HU9 A;  1OYJ A;  4WR4 A;  4KE3 A;  4O5Q A;  1A23 A;  4ECB A;  3HCZ A;  1Z6N A;  3KH7 A;  3HZ4 A;  2OA7 A;  1JLW A;  3EUR A;  2VL2 A;  1EGR A;  1NHO A;  2CA8 A;  2GS3 A;  3F3R A;  3VWW A;  5INY A;  3GUS A;  4K2D A;  2E2G A;  2LKU A;  3Q6O A;  1X0R A;  4EIQ A;  4TXV A;  4XHM A;  3ERG A;  3IK7 A;  3HA9 A;  3C71 A;  1ZCP A;  1F9M A;  4TXO B;  4HI7 A;  4ML6 A;  2LEG A;  1ON4 A;  2YZU A;  3KZQ A;  3EMX A;  2LRC A;  1HNA A;  3TRQ A;  2V1M A;  1TI1 A;  2WGR A;  3FW2 A;  1DE2 A;  1M2B A;  4XCS A;  3DWV A;  2H1B A;  3ERF A;  3C8E A;  1E6B A;  1GUK A;  4I8B A;  1S3A A;  3BBY A;  3VWX A;  3TKS A;  1XCC A;  1QMV A;  3EC3 A;  4RI7 A;  4X43 A;  4O5R A;  2F3M A;  2BMX A;  1XWC A;  2L57 A;  2VOC A;  3A2V A;  5C00 A;  3A5I A;  1FVK A;  3D0Z A;  2M46 A;  6GSY A;  1X9M B;  2E2M A;  3GUR A;  3TJG A;  3KM6 A;  3GFK A;  1GUH A;  5IIZ A;  1RK4 A;  3A2X A;  3BOA A;  3W6G A;  2A4H A;  3TKP A;  2H76 A;  1PN0 A;  5ELG A;  1U87 A;  3CRU A;  3F8U A;  3FZA A;  1HNB A;  1AC1 A;  3TKS E;  3H79 A;  4EKZ A;  3MIX A;  2ZUP A;  4BL7 A;  3TDG A;  3DEX A;  4YAV A;  1YF0 A;  1SYX A;  4KSM A;  1QFN A;  4Q5Q A;  3KP8 A;  1WWJ A;  4OCF A;  2N5A A;  17GS A;  4MJA A;  1FVJ A;  1XOB A;  2IMI A;  2JL4 A;  2RM6 A;  4D73 A;  1GWC A;  3C73 A;  4IBP A;  2C80 A;  4RQR A;  2R4V A;  1GSS A;  3DKS A;  2H75 A;  1TK8 B;  2LJR A;  2YAN A;  4IGJ A;  4ZL8 A;  2HRF A;  1ML6 A;  2RII A;  2VCQ A;  2TIR A;  5A5K A;  3J7Y b;  1TU7 A;  3HXS A;  3UL3 A;  4BVY B;  5G5F A;  4NAX A;  2NVL A;  1I9D A;  5DAK B;  2OAD A;  2PU9 C;  1VF4 A;  1PL1 A;  3FZ4 A;  1GUM A;  4ZB6 A;  1Q98 A;  2WB9 A;  2OE3 A;  5HQP A;  1G7E A;  2H1A A;  2DKI A;  1O85 A;  2B7J A;  2L59 A;  3G7Y A;  2VCT A;  4TR4 A;  2GT6 A;  4G9H A;  1T4Z A;  1A24 A;  4FH8 A;  2KP2 A;  4TW5 A;  1TJD A;  2V2G A;  3WT1 A;  3ZVJ D;  3GST A;  3UBL A;  2YCD A;  4G10 A;  4Z2T A;  4WXT A;  4N10 A;  4Q5R A;  3DYR A;  2R0P A;  3JCM L;  3UIW A;  1KNG A;  2X49 A;  2VM2 A;  1U88 A;  2XC2 A;  5GAP D;  1SEN A;  2PWJ A;  5CAX A;  2AV4 A;  3PR8 A;  1SYR A;  4Q5F A;  3M9J A;  4ACS A;  4Q5N A;  4ILF A;  4HJ2 A;  2MMA A;  1THO A;  1T1V A;  1KTE A;  2A2S A;  3HVX A;  3HYP A;  2H0G A;  3PH9 A;  5IOX A;  2C3Q A;  4WBR D;  5J4U A;  4TRX A;  1GTB A;  1M7T A;  2H8L A;  5G30 A;  5D9X A;  3IC4 A;  5JCG A;  2GQL A;  5H5R A;  3ISO A;  1SJI A;  2FWF A;  3A3T A;  4HUA A;  5B8A A;  3GTU B;  1H4O A;  1X5C A;  1S3D A;  5CP1 A;  4PXO A;  3NZN A;  1GNE A;  1TXX A;  3APQ A;  4GST A;  5ELA A;  4KSO A;  1ERT A;  2DJ1 A;  3DVW A;  3TGZ A;  3DXB A;  2MYG A;  1Y25 A;  1U3A A;  3QR6 A;  2GZZ A;  1M9B A;  3TJB A;  6GSS A;  4ZXG A;  1K0D A;  5B6M A;  3D21 A;  4XS6 A;  3E3E A;  3ZFL A;  3TOU A;  4USS A;  3EVI A;  2GQK A;  3WGX A;  2MBS A;  2WFC A;  4K0G A;  3SWL A;  4L5L A;  7GSS A;  2V6O A;  1ZYE A;  3IPZ A;  2DJ3 A;  4NV2 A;  1XOA A;  2CVB A;  1T4Y A;  3U6V A;  2D2Z A;  5BRT A;  1EOG A;  3F9U A;  1PL2 A;  5CO3 A;  2IMD A;  3W8S A;  2OE0 A;  1V57 A;  2H66 A;  4X4J A;  1YEX A;  4BVX B;  1SL2 B;  1ERU A;  2E7P A;  1V40 A;  3UMA A;  2DIY A;  3BCK A;  4MJB A;  5B8B A;  4A5P A;  1E2Y A;  2DJ2 A;  4EC0 A;  2HFD A;  5JCW A;  3AY8 A;  5D8I A;  4BL7 B;  5E4W A;  1AW9 A;  3ME7 A;  2AJQ B;  4BWQ A;  1WE0 A;  1X5D A;  3MAK A;  2B6M A;  2DJ0 A;  5ECO B;  2L4Q A;  5HR0 A;  5KN2 A;  4I97 A;  2LTK A;  1X9S B;  4OFT A;  2O89 A;  3WT2 A;  3D4M A;  5KN1 A;  4F0B A;  3HY2 A;  5KN0 A;  1Y6E A;  2C4J A;  2XHF A;  4DEJ A;  1GP1 A;  2YJ7 A;  3QMX A;  3TJK A;  3KP9 A;  2F9S A;  3HDC A;  2MBT A;  6GSX A;  19GS A;  5J9B A;  3FRC A;  4F2I A;  4PUF C;  2REM A;  1OC8 A;  3ZML A;  4MJC A;  1Z7P A;  4IJI A;  3F0I A;  4NHZ A;  1U6T A;  1UC7 A;  3IOS A;  3TRP A;  2R6K A;  1B48 A;  1SD8 A;  4OD7 A;  2H73 A;  1M99 A;  4Z2R A;  2MMN A;  4OWY A;  4DSQ A;  3Q74 A;  1SJZ A;  5A4V A;  6GSW A;  5IO2 A;  4PUA A;  5CRH A;  4CW9 A;  1PN9 A;  4HS1 A;  3HVS A;  2QKE A;  4BVY A;  1TRU A;  2B5E A;  2YPM A;  2H6Y A;  1C72 A;  2A2R A;  5J5N A;  3OR5 A;  3ZRE A;  1LU4 A;  5CYY A;  4ZIL A;  5DQS A;  1J9B A;  3DD3 A;  2A4V A;  5DCG A;  1QK8 A;  4V2L A;  1YQ1 A;  4KW6 A;  2FA8 A;  2DC5 A;  3IC8 A;  4KCA A;  5G31 A;  4YQM A;  2WS2 A;  3QAW A;  2YV7 A;  5E59 A;  3EWL A;  3PGT A;  2Z9S A;  3BJ5 A;  3TKQ A;  2XPE A;  2H70 A;  2AAW A;  5IPG A;  1NW2 A;  4NWY A;  5H5Q A;  1OC9 B;  4NHW A;  2LUS A;  2RM5 A;  1UVZ A;  1J0F A;  5ECS A;  1A2J A;  2GSR A;  3V1W A;  2B5X A;  1V98 A;  2PN8 A;  1USB A;  4TR0 A;  2CVD A;  1B9X C;  1YJ6 A;  2B3S A;  1EGO A;  4EO3 A;  4FIW A;  2XPD A;  3D6I A;  13GS A;  1YF1 A;  2HZF A;  4CY8 A;  1AQW A;  2ES7 A;  4I6X A;  5G2Z A;  3DVX A;  2WUL A;  2L5O A;  2QC7 A;  5IOW A;  2EC4 A;  5F07 A;  4L8E A;  2I9H A;  1MTC A;  4YQV A;  2VCZ A;  2VCV A;  2KP1 A;  2LQO A;  3US3 A;  2HI7 A;  4JE1 A;  1GSE A;  2C3N A;  4BPY A;  1AUC A;  3GKN A;  4LL1 B;  2H6X A;  1PQN A;  5GAN D;  4XRD A;  3I69 A;  1GSF A;  1RQM A;  3QFA C;  4F03 A;  5D73 A;  3L0H A;  4O92 A;  1V9W A;  3GTU A;  3TUE A;  2FGX A;  1TI3 A;  2YWI A;  3G7J A;  1ACV A;  2LRT A;  4K5S A;  3VPQ A;  4XIH A;  2JU5 A;  4ML1 A;  5AN1 A;  4E8H A;  1G6W A;  2P31 A;  2DML A;  5IPH A;  2L5L A;  3QDN A;  3CYN A;  3DML A;  4F0C A;  1YKA A;  1G0T A;  3G7I A;  1WMJ A;  2IPA A;  2X8H A;  4J56 E;  5DVB A;  1O6J A;  1ST9 A;  1WOU A;  5AGY A;  1VF3 A;  2WRT A;  3ED3 A;  4MK3 A;  4V1A g;  3TJJ A;  4N11 A;  4AF2 A;  3ZLP A;  3TOT A;  5IO0 A;  2BJX A;  2VD1 A;  2GLR A;  1FAA A;  4JR6 A;  1GSU A;  2KLX A;  1TK5 B;  4BVX A;  3IAS 2;  1N8J A;  4YAP A;  4WF5 A;  4XTS A;  1UN2 A;  1ZZY A;  3K8N A;  1HYU A;  1BJX A;  4I2T A;  4XS4 B;  4HQZ A;  4CY6 A;  1OKT A;  5LNK e;  1SJ6 A;  3GSS A;  4ICY A;  3FY7 A;  1MDK A;  2C8U A;  5IMA A;  5KN3 A;  1PX6 A;  4K7N A;  2MZC A;  1DE1 A;  2WJU A;  3RPN A;  2L6D A;  4WET A;  3ZMK A;  3KJY A;  1YKC A;  2B5Y A;  4GF0 A;  4X0X A;  4PTS A;  1DUG A;  5D93 A;  4HDE A;  4EE0 A;  4K0N A;  3UBK A;  4HJM A;  4KX4 A;  5DQY A;  4IP1 A;  1K0O A;  3C1R A;  1U3I A;  3M8N A;  2MMZ A;  5L71 A;  4MH2 A;  3IRA A;  1NM3 A;  1Q4J A;  4G2E A;  4IW9 A;  1F2E A;  2GT5 A;  3MYD A;  2HRK A;  3L4N A;  5GSS A;  2GZY A;  4GSN A;  2R0G A;  1R26 A;  1KBN A;  4DSS A;  1BED A;  1F6M C;  4G0I A;  5H5S A;  1GL8 A;  2VIM A;  1OAZ A;  4PQH A;  3LGC A;  4F82 A;  5F0G A;  3CBU A;  4BA7 A;  3ZFB A;  3CMI A;  1EOH A;  2PUK C;  1VRS D;  3KCM A;  2B7K A;  6GSU A;  2YV9 A;  1ZGN A;  1K3O A;  2FWG A;  5J9C A;  4POM A;  1PSQ A;  3F3Q A;  4KUN A;  1F3A A;  4GQC A;  4ECC A;  5F05 A;  3GNJ A;  3FEU A;  3M1G A;  3IDV A;  3M3M A;  4NV5 A;  2GVP A;  5J41 A;  1A0R P;  2H71 A;  1LJR A;  2FA4 A;  2J23 A;  3CSI A;  3J7Y k;  1XW6 A;  3IA1 A;  3LYP A;  1A8Y A;  3KXO A;  2HRN A;  1TRW A;  1XWB A;  4MCU A;  4IQA A;  3LG6 A;  1OE7 A;  4OO4 A;  3APS A;  4POK A;  2AHE A;  3WGD A;  1NSW A;  3ZTL A;  5KOW A;  4WEY A;  2IME A;  3EU4 A;  2DLX A;  5A4U A;  4KDU A;  1GSY A;  12GS A;  2VCW A;  1XWK A;  1K0C A;  1YEP A;  1OC9 A;  2DKH A;  3FZ9 A;  1GLP A;  5IMC A;  4TR3 A;  3RPP A;  5IMD A;  1JZD A;  2EIR A;  1LBK A;  1GTI A;  3DGQ A;  4MNN A;  22GS A;  5BMU A;  3LXZ A;  2KHP A;  4LMW A;  4YKG A;  1F3B A;  1VGL A;  4TKY A;  4OFN A;  5G1L A;  4L0W A;  3A2W A;  3P90 A;  2H0H A;  1SU9 A;  4HOJ A;  2P5R A;  4AJ8 A;  4GTU A;  3CTG A;  1JZR A;  4RUV A;  5CRW A;  4IKH A;  2WCI A;  4G0K A;  1GH2 A;  2QGV A;  3KMO A;  2YWM A;  4TOP A;  2TRX A;  4EIP A;  1T00 A;  2VO4 A;  5B6N A;  2PER A;  3CTF A;  4IQ1 A;  1ERW A;  3KMN A;  2DJJ A;  3NIV A;  2AYT A;  3HHV A;  5D9W A;  5CRE A;  2OBI A;  3SBC A;  3IE3 A;  4E8E A;  3ZIJ A;  9GSS A;  1ZYP A;  2C1Y A;  2ZNM A;  1O8W A;  2I81 A;  2F51 A;  2QA1 A;  4CDO A;  3UVH A;  1JHB A;  3VK9 A;  4N0V A;  2E0Q A;  1R5A A;  4KDX A;  3HJM A;  3IAM 2;  4ISD A;  1S3C A;  1T3B A;  4BWS A;  2HYX A;  3TJF A;  2YWO A;  5IMF A;  3QD9 A;  4ULX A;  2PVQ A;  4LA1 A;  4KDY A;  5IM9 A;  3LOR A;  3FYG A;  2H1G A;  3R3E A;  3F6F A;  2CT6 A;  1FB0 A;  2ZCT A;  2LS5 A;  1W89 A;  2LQQ A;  2DJK A;  1XIY A;  2AB6 A;  3LJR A;  3GHA A;  2CAQ A;  1HNC A;  5ID2 B;  4TR1 A;  2DIZ A;  4Z2U A;  2H30 A;  4OO5 A;  1BYE A;  3L9U A;  3MWH A;  4ZB9 A;  1UA5 A;  3EPT A;  5ECP B;  2OBK A;  1URM A;  3M9K A;  3KEB A;  4IJ3 A;  2LNS A;  2VL3 A;  1YDK A;  5DJM A;  2CQ9 A;  1BG5 A;  2ON7 A;  3KD0 A;  4MPG A;  3ERW A;  1R7H A;  5HFI A;  1GUL A;  3UOM A;  2I4A A;  4XS4 A;  4IN0 A;  3DRN A;  1PMT A;  4GCI A;  3Q18 A;  1MEK A;  1GLQ A;  1H75 A;  2K6V A;  3MNG A;  3GH6 A;  5LD0 A;  5G5E A;  1O81 A;  4DSS B;  8GSS A;  5D96 A;  3LXT A;  2F8A A;  4ECJ A;  3F4S A;  1KEB A;  1EP8 A;  1A2L A;  2LRN A;  4PUR A;  2IL3 A;  3F6D A;  2B1K A;  4IVF A;  2IWT A;  2C0G A;  1ZL9 A;  1O8X A;  1JZW A;  2FUG 2;  2RUE A;  2XBQ A;  3GL3 A;  2K18 A;  4X1U A;  3VLN A;  4MDC A;  1DBY A;  4P3Y B;  1GSD A;  3U5R E;  2O7K A;  5JWQ B;  3IV4 A;  2H19 A;  3EIN A;  6GSV A;  3UVT A;  2N5B A;  5DBQ A;  4ZB8 A;  2MMO A;  4EUY A;  4KGI A;  2GZP A;  4FYC A;  3H4K A;  5LCZ A;  3LSZ A;  1ZYQ B;  1PKW A;  3TKR A;  2F8F A;  5EPF A;  2CZ2 A;  1TK0 B;  3KTB A;  3UJ1 A;  2HNL A;  1K0A A;  1BQ7 A;  1M0U A;  3P7X A;  2DSA A;  1OC3 A;  4JBB A;  1GRX A;  1R4W A;  2HXK A;  3RAZ A;  3P8W A;  1OKD A;  5JWR B;  4V2N A;  1FG4 A;  3FKF A;  4K8M A;  1SD9 A;  4PNF A;  3W8J A;  3VPT A;  3M0F A;  3EYT A;  3L78 A;  2B1L A;  3F4R A;  3LW9 A;  1T8E B;  3GKM A;  5C04 A;  3VWV A;  1SL1 B;  4J2F A;  3DIE A;  4MF6 A;  1XVQ A;  4KF9 A;  2HSY A;  2H72 A;  1K3Y A;  1SKR B;  1EZK A;  2G0F A;  5IMV A;  1MD4 A;  4L0U A;  4K2X A;  3CSJ A;  20GS A;  1R5P A;  2YZH A;  2YP6 A;  3R2Q A;  1PA3 A;  4PNG A;  3D5J A;  3MSZ A;  3VWU A;  3GKX A;  4EDZ A;  2IFQ B;  4IEL A;  4XS1 A;  3BCI A;  4MZW A;  1I5G A;  4AGS A;  4EDY A;  2G2Q A;  16GS A;  1ILO A;  4I5Q A;  2OAC A;  3TB2 A;  1OVN A;  2FY6 A;  1WIK A;  1TU8 A;  1XBS A;  3H1N A;  1EWX A;  4GSS A;  3GYK A;  4FQU A;  4RI6 A;  5FWG A;  3RHB A;  4K6X A;  3QAG A;  1WPI A;  4K9Z A;  5ECR B;  3HVV A;  1B4Q A;  3GH9 A;  4ID0 A;  1QXH A;  1ERV A;  2GSQ A;  2R2J A;  2VL2 C;  2YN1 A;  1SK0 A;  4IS0 A;  1GTU A;  3CSH A;  2P0G A;  3C1S A;  4LLR A;  4JED A;  1G6Y A;  3VI7 A;  4MAB A;  3GX8 A;  3IK9 A;  2IMF A;  2V32 A;  4EF0 A;  1ZOF A;  2IIY A;  2X64 A;  2LJK A;  4OFM A;  4LL4 B;  3TCO A;  1FB6 A;  2X99 A;  1TDI A;  1YZX A;  4WR5 A;  5ENU A;  2FHE A;  2P5Q A;  1PKZ A;  5ECN B;  2LV3 A;  2RLI A;  1PD2 1;  4PQI A;  5JCU A;  5ECQ B;  3EU3 A;  2PVO C;  2X8G A;  4GLT A;  5D9T A;  4TR1 B;  1GSQ A;  3GN3 A;  1RW1 A;  4N30 A;  1TP9 A;  3I6A A;  4QQ7 A;  2IN3 A;  5FHI A;  4WKW A;  5EVO A;  4YH2 A;  5DDL A;  1AIU A;  1BX9 A;  1HD2 A;  1MD3 A;  3D22 A;  4V1A p;  5GST A;  1OE8 A;  3PIN A;  3KTL A;  3TKS C;  5J3R A;  5CRD A;  4NPB A;  2M80 A;  3BD2 A;  2ALB A;  1W4V A;  2OJL A;  1A8L A;  2DMM A;  1JZO A;  5D9V A;  2NDO A;  1GTA A;  3HKR A;  2JAC A;  3LEF A;  1WJK A;  1MDJ A;  2H1D A;  4IHU A;  2N5F A;  3HZ8 A;  3ME8 A;  4HZ4 A;  3ZYW A;  5IMZ A;  5ID2 A;  4POL A;  4KB3 A;  1FOH A;  4HZ2 A;  2VL9 A;  4QL9 A;  3MDK A;  4ZIJ A;  3L9S A;  4K1F A;  5F06 A;  3CRT A;  2C0E A;  6GST A;  4O32 A;  5DCH A;  4O5U A;  1O73 A;  4N0Z A;  4KCE A;  2JZT A;  1O7U A;  1XVW A;  5ECK B;  3E9J B;  1TKD B;  3GV1 A;  2CV4 A;  2CAI A;  2JAD A;  3O76 A;  1WP0 A;  2KOK A;  4GXZ A;  1K0B A;  4ZBD A;  2O87 A;  3FZ5 A;  4MF5 A;  5COH A;  5ABR A;  3FHK A;  3LYK A;  5EY6 A;  5HR1 A;  2FNO A;  1SKW B;  5DAL A;  3D4T A;  3A5W A;  4ZL9 A;  4HEA 2;  3ZRD A;  3Q19 A;  1PRX A;  3HD5 A;  2QA2 A;  1QQ2 A;  2V6K A;  1QUW A;  2J9H A;  1M2D A;  2JZS A;  3FMW A;  2TRC P;  1Z3E A;  1JFU A;  2HZE B;  3I9V 2;  2JSY A;  11GS A;  3F4T A;  3GKK A;  4MLY A;  2K8S A;  4J57 E;  2NTO A;  4ZBA A;  4Z7X A;  3L9V A;  3VI5 A;  3IR4 A;  4HU7 A;  2XBI A;  2YWN A;  2JZR A;  4AJ6 A;  2V41 A;  2GQM A;  2O85 A;  2CX4 A;  3ZZX A;  3F63 A;  2YJH A;  3GMF A;  5AIS A;  2FWH A;  2PGT A;  2HRA A;  4JR4 A;  1FW1 A;  3PPU A;  1A0F A;  3N9J A;  3FR6 A;  1TTZ A;  4LMV A;  2K9F A;  4NMU A;  3N5O A;  4JRR A;  1PX7 A;  2BTO T;  3APO A;  2PBJ A;  1FHE A;  1TOF A;  2IJY A;  3C7M A;  3EMP A;  3O6T A;  2M72 A;  1V2A A;  4K7I A;  4MJE A;  1K3L A;  4CHS A;  5CNW A;  2H01 A;  2PPT A;  2EIO A;  4PQ1 A;  3GRX A;  3RHC A;  1Z5Y E;  1XPV A;  1XWG A;  1PGT A;  1X5E A;  3FR3 A;  3GIX A;  3IXR A;  1IYI A;  3UEM A;  1ABA A;  4RQX A;  2PMT A;  1TRV A;  2I3Y A;  1JLV A;  2CZ3 A;  2CX3 A;  2VM1 A;  1XFL A;  4GQF A;  3WGE A;  4KH7 A;  2K8V A;  2KUC A;  5DJL A;  1QGV A;  2YOI A;  2WZ9 A;  3ZL5 A;  5ECI B;  2R0C A;  1XW9 A;  3ZIV A;  2GST A;  3P2A A;  1XZO A;  1FO5 A;  2IFQ A;  4AJ7 A;  2VCX A;  2YNX A;  2I1U A;  1X9W B;  2X8C A;  1MDI A;  18GS A;  1AQV A;  4KA0 A;  1T7P B;  2QSI A;  3KH9 A;  4DVC A;  3VFI A;  2JSZ A;  5HFG A;  4MPF A;  5CRG A;  10GS A;  1K0M A;  5ECL B;  3GX0 A;  3QAV A;  4I2U A;  3ZIT A;  2VLU A;  4XRA A;  3EE2 A;  4GRF A;  4GWR A;  2HLS A;  1A2M A;  2H74 A;  1M2A A;  1YY7 A;  4G19 A;  4K7O A;  3QOU A;  2RUF A;  1CQG A;  5KEJ A;  4MZB A;  1SK2 A;  4TXO A;  1M9A A;  2LST A;  4MH3 A;  1THX A;  1SK1 A;  5KOX A;  2VAF A;  2R37 A;  2HT9 A;  1EEM A;  2HSH A;  3H93 A;  1SL0 B;  1WRY A;  2R3X A;  3TRX A;  1XWA A;  1TRS A;  5G1K A;  3QCP A;  4H86 A;  4OCE A;  4POB A;  3IHG A;  5JWO B;  1ZMA A;  5A4W A;  3LWA A;  2WDU A;  3VUR A;  4TN8 A;  1XXU A;  3KIJ A;  2L6C A;  2DBC A;  3O3T A;  3LFL A;  1EEJ A;  4YKF A;  4JU5 A;  4HQS A;  2HE3 A;  2FWE A;  2AUV A;  1BAY A;  4O7H A;  2OE1 A;  3E0U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...