3CZCA

The crystal structure of a putative pts iib(ptxb) from streptococcus mutans
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
93
structure length
93
Chain Sequence
MVKVLTACGNGMGSSMVIKMKVENALRQLGVSDIESASCSVGEAKGLASNYDIVVASNHLIHELDGRTNGKLIGLDNLMDDNEIKTKLEEALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of phosphotransferase system enzymes PtxB (IIB(Asc)) and PtxA (IIA(Asc)) from Streptococcus mutans
pubmed doi rcsb
source organism Streptococcus mutans
molecule tags Transferase
molecule keywords RmpB
total genus 29
structure length 93
sequence length 93
ec nomenclature ec 2.7.1.69: Transferred entry: 2.7.1.191, 2.7.1.192, 2.7.1.193, 2.7.1.194, 2.7.1.195,
pdb deposition date 2008-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02302 PTS_IIB PTS system, Lactose/Cellobiose specific IIB subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3czcA00
1S8NA 1E6LA 2GKGA 5IUNC 5CNIA 1YMVA 1ZDMA 4UHJA 1VPWA 3IP5A 4MLDA 4YCSA 5JNSA 3KSMA 3T38A 1XHFA 4CBVA 3O21A 2MYUA 3OLYA 4IGAA 1KRWA 1YK0A 5JNTA 3D8UA 7ABPA 5ED4A 4YGXB 4JP1A 1R8JA 3C97A 3N75A 1DC7A 3OLXA 3MQ4A 2RGYA 2IPAB 4G0OA 3IPAA 3JPYA 1MVOA 3KJXA 1VRVA 3NNNA 5IC5A 1Z26A 1ZGZA 4MS4B 1LJLA 3O1JC 3OO1A 4WUTA 3OQNA 1P2FA 2VK2A 1Z15A 3K9CA 2E4VA 1ZESA 3KHTA 1ABFA 1D2AA 4JA2A 4ZMSA 3ROTA 2AYXA 4KV7A 4D74A 3H6GA 4O5AA 3DGFC 3EULA 3FFWA 2FVYA 2FEWB 2P9HA 1MB3A 4KZKA 4RY0A 2FW0A 2PUAA 4RK4A 4OLAA 2ZAYA 3FFXA 3KLOA 1HEYA 4LRQA 4W5RA 1Z12A 9ABPA 3H5LA 4YR7A 3RH0A 3JVIA 5BRJA 3OM0A 4O1HA 2R48A 4ML3A 4JASB 2NZUG 2QU7A 2PUCA 1Z13A 5CNJA 2NT3A 2E4UA 1Z17A 2DRIA 3CG4A 3GYBA 4N47A 5HSGA 4M88A 1JHZA 3EODA 5JNRA 4NCBA 4DQDA 1Z2DA 2FMHA 2V0NA 3BRSA 5FWXA 1YS6A 4ETMA 3BREA 3HM9A 3ILHA 1JDPA 4DADA 2PL9A 1NXPA 3QEMB 1U04A 4LZLA 3C3MA 3MM4A 1SXGA 5DCLA 3UK0A 3T6KA 3T8YA 2FEKA 2NZVG 3GBVA 1ISRA 3EAFA 4EUKA 5BQ3A 3SQNA 4F11A 2CHEA 3LUCA 3RVOA 1JYEA 5KQLA 3OQMA 5EWMB 1XWWA 3OLVA 2OQRA 2MYPA 4TN5A 3URMA 4KNYA 1M2EA 2PL1A 4G0ZA 4MQEB 1YK1A 1USIA 4MLCA 1B00A 3LUAA 4TMYA 3MIZA 3A10A 1JYFA 1EWKA 2QV0A 4RU1A 4Y9TA 2JK1A 4RK0A 4QYWA 4IRXA 3N8IA 1WETA 4KPYA 4KK3A 1OXBB 4QYMA 4LX8A 2N9UA 1USKA 1L5YA 1PEYA 3HEBA 4H3KB 5FBKA 4Z0NA 1QO0A 4Z4IA 2QW1A 4XARA 2PAFA 3K4HA 2PKXA 1NXSA 3N6VA 4NV3A 2PE5A 1TM2A 2FLKA 1M5TA 2PUFA 4W5NA 3JVDA 2CD7A 5JS1A 1ZH2A 3GL9A 3IP7A 3CTPA 2GX6A 1PNRA 3O2SB 3IPCA 5FWYB 4MYRA 2NUBA 4H3HB 2JVIA 1ZVVA 3TB6A 1M2FA 4YWHA 1NXTA 1RPJA 1QQBA 2FTKE 1GCAA 3RVPA 3LOPA 1APBA 4EVQA 3KYJB 1YTUA 4MR7B 5KQPA 4Z9BA 2RJOA 3O2QB 3E3MA 4JOQA 2JCGA 4N0QA 3RVNA 4G86A 4PE5B 3LTEA 3GV0A 1LJUA 1NXVA 4MR9A 1F51E 2CHFA 2TMYA 2IPNA 4LDZA 3BILA 4XASA 5KQMA 4KRFA 1A0OA 4MS3A 1LBIA 4PEVA 3OLZA 4LE0A 1PEAA 3Q7RA 1JX6A 2A9RA 1F4VA 3F6CA 1DBPA 3QLUA 2A9PA 4HNRA 2WJAA 2F8SA 1QMPA 3N0WA 5KQGA 3KTOA 2L17A 1U2QA 1FFSA 3RVJA 1SXIA 1Z2EA 2FKAA 4XXHA 5GQSA 3P9YA 1DCKA 4XLTA 4MRMA 4N0PA 1EWTA 1TJYA 1DJMA 5CNMA 3CG0A 1KRXA 3CKMA 2HPHA 3I5AA 4G0XA 5EWMA 5HM6A 4RDCA 2R25B 1JDNA 3I09A 1GUBA 3QX9A 1JF8A 1JH9A 3H1GA 1D1QA 4KQCA 4N76A 1MB0A 1U0SY 2PUEA 3GT7A 1I3CA 2ID7A 5JNWA 4QPJC 3QLVA 2R4QA 4OG2A 3SAJA 3T95A 2NT4A 1QP0A 3SY8A 3DZDA 1NY5A 2YHAA 5FWXB 2LP4Y 1TLFA 3A0UA 1YS7A 3H5OA 3O75A 4EVSA 4S04A 3JPWA 5EWJB 4HNQA 4YP9A 4ZYLA 2FMKA 5D2CA 1KMIY 2JVKA 2VUHB 1CYEA 2Q5CA 3QLVC 5TPWA 4ZJPA 4TLLB 4RS3A 4WXEA 4XAQA 2QR3A 3BBLA 3FGZA 3H6HA 3N0RA 4MQFA 4Z9AA 4NQRA 1KGSA 4Z4CA 3NHZA 1MIHA 1ISSA 1DRJA 1JFVA 4RK5A 4KMRA 1BDHA 3L49A 4OBBA 2WJWA 4RXTA 5CNKA 1JLKA 2IYNA 1EFAA 3LUJA 5DKFA 3R0JA 2FMIA 4LE1A 4OATA 3UUGA 4ZMRA 4RK7A 5C5CA 4OTZA 4MR8B 3ROFA 4H60A 3F73A 3HZHA 1QO0D 2L2QA 2L19A 3RVMA 2PJUA 3EQZA 3VNBA 4KQ9A 4F3TA 5KI6A 3IP9A 1RZRA 1ZAYA 3HXMA 1QPZA 1IIBA 3NHMA 3JS5A 3M9XA 1P6QA 1RNLA 5IUJC 1DC8A 2JRLA 5TPZA 1VKRA 4YLEA 1W9HA 3KYIB 5TE9A 1AB5A 3KLNA 3N0XA 5TQ0A 1DBQA 1D1PA 4LDAA 4WXMA 3FFTA 2A9OA 3E61A 3QK7A 2HJ9A 5T7BA 2OENG 4KVFA 4RY9A 4G0QA 8ABPA 1U8TA 3D02A 4GNRA 5PNTA 2B1JA 1CHNA 4ZPJA 4MRMB 1A2OA 2M98A 3B2NA 2E4XA 4NCAA 4YRZA 1RXIA 3GA5A 2FN9A 1YMUA 1SRRA 1FFGA 3H75A 3O1HB 1GUDA 3Q15C 1ZITA 2B4AA 3HUTA 3ILYA 2HQRA 3LUKA 5CHYA 3HCWA 5TQ2B 1YVUA 4Z4EA 4HNSA 4RKRA 3W9SA 1SXHA 5DTEA 3SM9A 4EGSA 5B3JC 5DLEA 2LBPA 5KC9A 3HVRA 1DRKA 1ABEA 4JAVC 4O1IA 2FN8A 2MSWA 2QVCA 1FQWA 2XDYA 4E7OA 3HV2A 4G97A 2MSLA 5JS2A 4MQFB 4EY3A 4EYKA 4N03A 4ETIA 3HJFA 2KYRA 2X7XA 4RXMA 1EWVA 1YIOA 3DLHA 1SD5A 1MAVA 2VYCA 3CZ5A 2IPMA 4RK1A 1NTRA 4ETNA 3HSYA 2WMYA 3LKBA 5TQ0B 2GBPA 1CEYA 2E4YA 1JL3A 4RWEA 3UKJA 1E2BA 3OMWA 3H5TA 3H5WA 3FDFA 3I45A 3OQOA 1RZRD 3KS9A 4XFKA 5EWLB 3QELA 3LUHA 6CHYA 2CWDA 4PICA 2MSKA 3RVQA 1M5UA 4IMJB 3KKEA 2LUOA 2WY2D 1QP4A 4MR8A 1PNTA 3CNBA 3N53A 1FFWA 3MA0A 3L6UA 2FQXA 4RV5A 2L18A 1L5ZA 4WZZA 3G1WA 3VNAA 5ABPA 2O20A 4WWHA 2IKSA 2M1ZA 3C3KA 3KG2A 3CFYA 3QLTA 3DBIA 3CHYA 1FSPA 1AB6A 2YHBA 5E3JA 3SG0A 5KWSA 3LMKA 2E4ZA 3CLKA 3Q41A 1JBEA 3RVKA 5EWLA 3GRCA 1ZN2A 3CS3A 3RVLA 4G0PA 4B09A 4KREA 4G0MA 5B3JA 1QQAA 3H5VA 3MYYA 3OLWA 5EWJA 5TQJA 2PUGA 2F8TA 4RXUA 1BDJA 2H0AA 1D5WA 1RXEA 4PYRA 5F64A 2RJNA 4JB0A 3RVRA 3LUDA 3NNSA 4Z4FA 1NATA 5FBHA 2WB4A 1EHCA 1TVMA 1ZH4A 2IPLA 1BAPA 3GBPA 4QICA 3S99A 4RSMA 1ZHHA 4RY8A 4MS1A 3CRNA 3EQ2A 3NBMA 3Q7TA 1NXOA 4MR7A 1A04A 1GCGA 5TPZD 2MYNA 2JBAB 3TMYA 3Q7SA 2WWVD 1UDRA 5IX8A 1JFTA 3H1EA 4MS1B 2FXIA 1URPA 2IDMA 3QX8A 2QXYA 1E6KA 4Z4HA 5JNUA 3HO1A 2LPMA 4NICA 5HKOA 3O2JA 3M9WA 3IDOA 3HDGA 4FE7A 4D6YA 5KC8A 3M6MD 3RVSA 2JVJA 1EAYA 1XHEA 3JY6A 2FEPA 2HQOA 3G85A 2FQYA 4MAAA 1DCFA 5TQ2A 2A9QA 3A3KA 4IMIB 2AYZA 2ZWMA 1TMYA 2QVGA 2JB9A 1W25A 3JTEA 1BA2A 4IILA 4EYQA 4IF4A 3F7NA 4LE2A 4Z99A 4Q7EA 4HYEA 3KCNA 1K68A 5TPWB 3A0RB 4N41A 3HUUA 2VUIB 4KK4A 4MQEA 4WT7A 5IUKC 4EYGA 2WRZA 1NXWA 1Z16A 4PZ0A 3HDVA 2FSPA 6ABPA 2PUBA 4RZSA 3F6PA 4MR9B 3TD9A 3QEKA 1U2PA 3SNKA 3FMVA 4YV7A 1OXKB 1P8AA 5BRAA 5HQJA 3LUGA 1Y1LA 1ZY2A 4UHKA 3QELB 4YS6A 1Z25A 2PUDA 3LUFA 4MPTA 4S05A 5IBQA 1QNLA 4F8JA 3I42A 3QEMA 1P6UA 3EJWA 1LBHA 4F06A 5DGCA 5IEJA 2RDMA 3H5IA 2FQWA 1PHRA 5FWYA 3QLUC 4KFCA 2QSJA 1J56A 2J48A 3H1FA 4DN6A 4FB4A 4EYOA 3HK2A 1USGA 3HS3A 2IOYA 4P98A 5T3YA 4G0YA 2MYTA 4L85A 5GOTA 3OM1A 2PMCA 4RK6A 2PLNA 5BR1A 3TX6A 1K66A 4YO7A 1C4WA 1Z18A 1BVHA 2R47A 4W5TA 2E4WA 2GI4A 1C0EA 4GPAA 4L4UA 1H9CA 1QP7A 1PUXA 5I4CA 4D6XA 2HQBA 1BDIA 1T34A 3CU5A 1LK0A 2QZJA 3DGEC 3TO5A 2FLWA 3O74A 4RKQA 2GWRA 3LFTA 4MS3B 1E6MA 3OMXA 2P4UA 3EGCA 5JNVA 4W5QA 2FMFA 3NNDA 1DBWA 3CZCA 3EDCA 4W5OA 4E7PA 3RQIA 2ID9A 4MS4A 3OO0A 5C5EA 1D4ZA 4EVRA 1DCMA 1DZ3A 3MMNA 3C3WA 3IP6A 1DG9A 3DLBA 4MGEA 4P1ZA 1QKKA 3MF4A 1DP4A 3Q9SA 2LIVA 1NXXA 3LKVA 4F12A 4Z4GA 2HSGA 2JBAA 1JWLA 4TLMB 4JB2A 2H3HA 2I6FA 1GLGA 4OLBA 1ZGGA 2BGGA 4Q6WA 5IEBA 4Q6BA 1JFSA 4FE4A 2W42A 3GWGA 3O1IC 3C6QA 3BRQA 5IULC 1VLZA
chains in the Genus database with same CATH superfamily
1EE2A 3AJAA 3VRHA 3IB3A 4E2WA 1QH8A 1BROA 1ZDMA 1TEXA 1M5RA 4HVAA 4EFKA 3Q1LA 4BFYA 4HAZA 4MIYA 4CQMB 1PTKA 3AF0A 4UCFA 5DHUA 3T38A 4QZVA 1B0PA 1OIXA 1XHFA 1UH5A 5KOHB 2VF8A 5FUMA 3DLTA 2QU8A 2QXTA 3LD9A 4IGAA 4MI1A 4ZIRA 5HYVA 2IITA 3CLRC 5K9ZA 3RYFA 4ALMA 2EP7A 4M55A 1I5EA 2YZKA 3PTLA 4N01A 2YWGA 3R6LA 4TZKA 1M2KA 3OO1A 3R2JA 4Y67A 2C7OA 2FJ0A 1L4KA 2H2AA 2RI1A 3AUKA 4LNAA 2B9VA 3FG9A 2G76A 2ZJOA 2G1UA 3I2KA 2WEKA 2G9VA 2NVWA 3FFWA 4KV7A 1QM5A 3B9PA 3E35A 2EKQA 2K5UA 4RETA 5DGDA 4OLAA 2DPMA 2ZYRA 1V1MB 3MAAC 4AZ3B 2WMNB 3Q85A 4F6RB 2RGGA 3KDAA 1IRIA 2JD1A 4LRQA 1W48A 2RHMA 4NDNE 4RD1A 3WRYA 3UVEA 2O8DA 2C3UA 2C9YA 4RAQA 3JVIA 1XF1A 4PFKA 2HPZA 1YGPA 3K09C 4UATA 3G0HA 1U8UA 2EQBA 4TYYA 4JKOA 2X4LA 5CNJA 5HBGA 4Q4HA 4B4OA 3GXBA 1JR6A 1Z17A 3KD3A 5HSGA 5DFAA 3LYUA 1LD3A 1PG2A 4G1BA 1ULAA 1T5HX 4FMDF 3FZEA 4MV9A 3HA2A 2BDUA 5CLFA 4RVOA 1RWMA 4CIDA 2BI7A 2JIPA 1OAOC 1NM5C 4G6ZA 4HDOB 13PKA 5ARCA 5JR3A 3QEMB 1XAJA 4LZLA 1B1AA 1HLFA 1XRPA 4ROSA 1WVGA 3VZCA 1TT7A 5C3UA 3E9NA 3EAFA 2XHEA 3D8HA 3IT1A 5DU2A 2DERA 1K88A 4ZU6X 2OFPA 3I8OA 1CS0B 3M6WA 3KU4A 3S2SA 2O3QA 2NTJA 5FR1A 2QS9A 4D98A 4MJLA 1XJCA 3AI3A 4XD7D 3VTAA 4CEIA 4UFOA 1DHTA 4KPGA 4ADSG 1CW2B 1ULTA 3WYFA 4KNYA 4AZSA 4K6GA 3DL2A 3VHLB 5G53C 5CYPA 4MLCA 4LSZA 4ZI2A 4KX5A 1LDEA 2EHJA 1IUOA 2FF5A 3FETA 3DBRB 4IWYA 4UPVA 4WKNA 3E3AA 1WMSA 4WNCA 3EA4A 3ZE9A 1VJ0A 4XI9A 1LBTA 2I65A 2I6UA 4LX8A 5T3UA 5ALKA 1FFXA 4URHA 3SBDA 4Z4IA 1D8AA 4C6TA 3ENNA 4OJTA 1KYZA 4NCKA 3CB2A 2V58A 4Q47A 3H5RA 1ILWA 1IQRA 4I14A 1T4MA 4FKBA 2D1SA 4QPCA 2G25A 4J2TA 4M8NE 2XH8A 3DHYA 1OXXK 4IGFA 4UNSA 3BOSA 4Q0MA 4HWPA 2J0UB 3SIXA 1CJKC 3WK8A 4B2IA 4F0JA 5B2FA 1PYOA 4I5IA 3ZQ6A 2PRYA 2X2EA 1PR0A 1LA2A 1FNNA 2ZRQA 1NUSA 4ITVA 5FQOA 4D3SA 1TUGA 5K6TA 3UB3A 1EFRA 1F4LA 3T41A 4ZK2A 4DV4B 1IZ9A 4EVQA 1DBSA 2WG0A 3B3QA 1J5EB 2UV8A 2VWHA 1E1NA 3CUTA 1JNXX 3M4JA 4Z9BA 3QKSB 2UZ3A 3PQ8A 4GKAA 2VRNA 1VE1A 1OMOA 2R1VA 2CDAA 3T52A 3L2OB 1WU7A 3OFND 4BTLA 2YYAA 4EHIA 1RMYA 4I50F 4F5EA 3P5SA 3U3OA 4DLRA 1QAOA 3TSAA 2TMYA 4RA6A 1CZOA 1LDGA 2CNKA 2RGXA 1PVOA 1Y6GA 1PR6A 5E9JA 2CLKB 4Z1OA 3SU8A 3X2SA 1NRXA 2QNIA 5G3YA 1NASA 1SKAA 3RUHA 2HDOA 4A8PA 4ZDJA 5K5EA 5BYBA 1L7NA 2NADA 2XMCA 3QLUA 3QVOA 1XZBA 3HXKA 3THWB 4G0WA 2R79A 4E88A 3L06A 1C1DB 1TYZA 2XUZA 1U11A 1G5RA 2FSVC 2YWCA 3DA8A 3GUHA 3HR4A 3NS7A 4DXHA 4AIIA 1Z2EA 3C48A 3OJLA 3CEAA 2J5XA 5B30A 4V24A 2HRRA 4MRAA 2J5BA 5CLGA 1ZEMA 4LJ5A 4EG7A 2XODA 1QH9A 3CF0A 3OEYA 1K5PA 4HDKA 2GM9A 3I2HA 4U2FA 2UYCA 5K0CA 5IABA 2EFEB 3FI9A 3SSNA 1JJBA 2OGSA 2JFZA 4OM8A 4HQ6A 2A1UB 4OXYA 1H2AS 2PSJA 3HDTA 5KNBA 2ORWA 3GT7A 1E9AA 4CG2A 1I3CA 1Y80A 2XTJA 4KXXA 1YA6A 2XYPA 1UZLA 4RD4A 1GTL1 4C4AA 3QXJA 5I9LA 4IQ4A 1KTVA 2QMUA 3K6SA 5F98A 3TFQA 3EZ7A 1P6XA 2GHIA 4DSTA 1YONA 2AZDA 1Q50A 1XR3A 3AYZB 2EG5A 2VPQA 5I4BA 1NA5A 1P9OA 2GA8A 2GFHA 1MEJA 2QV7A 2X0RA 1E2JA 1EX6A 4NNPA 3IULA 1Y9DA 1WDMA 1G7RA 5HKKA 2D2XA 2FG7C 1VSQA 3HL0A 4FGLA 2QTHA 4NZNA 4QFDA 3SS9X 4CMKA 3K1AB 2NGRA 1RM0A 2XUPA 2YDYA 4LECA 4RH0A 1KMIY 1YDWA 3W5HA 1P4JA 4LUCA 3C3CA 4OBEA 3ZHSA 1AKWA 4YAFA 1Q74A 4O4HF 4JB8A 1T8WA 4DLLA 2VJYA 3SJBA 3TTTA 2X42A 4Q9LA 3COZA 3MBIA 1GA4A 4YO8A 5FPYA 3HN6A 1ISSA 4DLTA 4U9HS 4UPEA 1AQIA 3T99A 5JDIA 3GY0A 1PE0A 1TRHA 4CCYA 2IUEA 4DR6B 4U7JA 4GLJA 3LL4A 1DSSG 5JJ5A 1CT9A 3QA9A 2CLLB 1J22A 4D6PA 4QG7A 4ESHA 4QDZA 5C3MA 2IW3A 3ESAA 2NVBA 2GN0A 1LDMA 2IX9A 3Q7PA 4I1YA 1KKMA 4IDHA 3B85A 1DRVA 4TKMA 5LDGA 3K70B 1WSBA 1DJMA 3GFRA 2PJUA 4WY5A 2LTAA 4KQ9A 5IDVA 3S3TA 3O0TA 1R4NB 2NU6B 2B3DA 1R7RA 4GO1A 5LCXA 3WGKA 2ZI4A 3ITNA 5KNLA 3IBFA 3M9XA 2JLYA 2IYLD 4YTEA 3VZDA 5I51A 4ZICA 3RK4A 3X1KA 2JRLA 4CKEA 4G1FA 3GLGA 4J16C 4CM9A 1JKFA 5BSKA 2WZDA 1F0PA 4BAZA 3SC6A 4WE3A 3UGJA 4ED9A 1QVRA 3RWMB 3FFTA 1K27A 4MTCA 3FTEA 2VK4A 3JWGA 3QEJA 1G60A 1XN1A 2QR5A 4WLNA 2G0NA 4A8JA 3RF6A 5K8IA 3QWFA 3PFWO 5H0IA 5J59A 2FWAA 4BMSA 2DH6A 4MRMB 1SG0A 4OXQA 4ZTBA 2BFBB 3EXFA 1I5OA 1IUPA 1C8BA 2WSSA 5JVDB 1PZXA 4XJXA 3HY6A 1HV8A 4R5HA 3TK1A 2O54A 3MS2A 2FN9A 1QIGA 5K8VA 1Z0AA 4YRFA 1JLLA 3BYZA 4GICA 3LT2A 1JQAA 2IGBA 3DAOA 2WSLA 2Q0XA 1P2GA 3QIVA 1D04A 3PVZA 4NECA 1YVUA 4OYRA 4PZZA 1AS3A 4UDOA 2AE2A 2G83A 4L0CA 4YX9A 5JZBA 3PGA1 2CNWD 1MJNA 5CT5A 3IHLA 4XSGA 1XQ1A 3BIXA 3MUOA 3ER6A 4IMRA 4X1KB 4H1WA 3A28A 1ODKA 2JFWA 3W6OA 2VQFB 1AGRA 2ZBRA 5JD5A 4IZHA 4DJDC 3OCVA 1CUJA 1QV9A 2WJYA 2ZI3A 3K9QO 5ED0A 1SELA 2EKZA 1JHRA 4NULA 1I51A 1CERA 3ZV3A 3ZOZA 2JHGA 4BP3A 3WX0A 1B7GO 3ESCA 4ZAGA 4NMLA 3A32A 1S2LA 1KVTA 4PYMA 1E5XA 4DTCA 4LF8B 2QSZA 2GN1A 3DXYA 1NBHA 1WDWB 4D81A 4OYLA 2GBPA 1KR5A 1MT0A 5ALSA 5JRDS 4RIFA 4XWAA 5K8TA 3OZBA 4P83A 3PTAA 4MVJF 1EK1A 3O9MA 1NF8A 1FDIA 4EA9A 3WAKA 3T3GA 1WUYA 4CMAA 1G64A 2Y1EA 5GP1A 1L7PA 1LI4A 1X7GA 3VNRA 6CHYA 5K2OA 3UK7A 5CPBA 3PGLA 4XIFA 4YJ3B 2FEMA 2QA5A 4AUNA 1I2ZA 1EVKA 4BXOA 3DKRA 3EMVA 1FU7A 1TZKA 3QFCA 4CM6A 3TQCA 3KE9A 2RMKA 3U37A 4EGJA 2BL4A 1UOPA 1KI8A 2Z09A 4M83A 5A0TA 3T5DA 3EXIA 1HDXA 5CAEB 4BMXA 1F5NA 4X97A 5JS7A 1RIIA 4JJKA 2O7RA 3AHJA 4J7CA 4MPJA 3K0CC 5TS2A 2YIMA 5K3EA 3MGKA 4Z9FA 3BX1A 4HL6A 4GI2A 2IXEA 4RTQA 2F1KA 4V3BA 2F48A 3P9CA 5AKLA 3C16C 2C83A 2HBQA 4ASUD 1B3RA 3QE9Y 1ZM4A 3JQDA 3CUVA 4C0SA 2DWQA 1QX4A 2ECFA 3PD0A 3ZCXA 1YACA 1WXQA 1FYDA 1W7AA 1MOPA 1ELOA 4CIWA 3O4GA 5KNDH 3WB1A 5G3ZA 2AW3A 2RJNA 5F64A 4DUGD 1EFRD 1GSAA 3WGZA 2ZB4A 2YIJA 5FBHA 1NQOA 2IPLA 2PGDA 4FYVA 2V5AA 3E9YA 2DSNA 3LUPA 4R69A 2YWEA 2FHSA 3EXEB 3HHPA 3LCCA 1VYUA 4MULA 1A82A 1M1YE 4Q3LA 3TBKA 2FEOA 1R4NA 3PDJA 2HU8A 3KVRA 1KJQA 2EC5A 3RO7A 4FGZA 3V80A 2FZGA 2VHUA 5I7WA 2NP6A 1FRNA 3CX6A 3C87A 2EW8A 3AYXB 2F55A 5TMBA 1ZIDA 3DOHA 3IUMA 4DIDA 3KB1A 3GLKA 3A14A 5CEEA 5KC8A 4YP0A 5BQFA 3ZHRA 3ZDCA 1H2XA 3M4XA 3OFNA 2B9EA 2P2DA 3FKSA 4QJ3A 1E1RA 5C51B 3D3WA 4KQKA 3R9WA 1AQYA 1Y6QA 4BFSA 4IMIB 2Q5OA 1AKQA 2G8LA 4GX5A 4PSUA 2ANCA 4F5YA 1XA0A 4PYIA 3BE6A 4NEHB 1QTIA 3CC8A 3KKPA 3OPVA 3KAJA 2XDQB 4AJ9A 4D8UA 1Z0DA 5LDHA 1C9DB 2D06A 4QPNA 3RBVA 1XJWA 2YXPX 1PU2A 3F74A 2XITA 5DB4A 2OYCA 3HKBB 1M6VB 5K03A 1E5LA 1WXEA 5FPTA 5HQTA 1Q1QA 2NQ8A 3BIOA 3L0IB 4V0NA 1E58A 3NOQA 1SQFA 4O2BA 2EL9A 4OHMA 4R40A 5F1KA 3UFXA 3NBQA 1VJ5A 2ZS9A 3P9XA 4FGUA 1JHQA 2GO7A 5SY9A 1TU4A 4KNVA 3A1WA 3SXUA 4XRGA 4V0QA 2IHZA 5THKA 2IYPA 4MAMA 3TZKA 2HQ1A 4UHKA 3FHLA 3RK1A 3KWFA 5IBQA 1SCNE 2PBLA 4FZJA 4HJXA 5AI9A 3G2LA 5FPSA 4F8JA 4CEJB 5DGCA 3DD1A 2Q07A 2PT7A 2RDMA 3AV3A 4PVCA 5TR9A 3C85A 3KZ1E 3O3MB 4JUFA 5EVJA 1FDWA 2P2LA 2QJWA 4JBLA 3H1FA 1EEXB 2F17A 2C07A 2ZIGA 1FTNA 1N9GB 1V6CA 2JIOA 3EVZA 2MDTA 1U4SA 2AG0A 1GL9B 4S2EA 1VKZA 3QUQA 4FIZA 3RM3A 1MA3A 1JFRA 3FPAA 3AG6A 3HDQA 4QHSA 1V5EA 5CM8B 4ER7A 3KVYA 1XK6A 2CCGA 3ETHA 4L85A 2GCEA 2CMDA 5EJGA 3TOSA 4C5AA 3I37X 4BP9A 5FTLA 2BFEB 2PWBA 4EAQA 1GXSB 1PFKA 2QTRA 4LOAA 3DTNA 3GLHB 4E3ZA 3GEMA 4RVSA 2R47A 1BWQA 2ZJ7A 3KPJA 4Q18A 2AEMA 2VXOA 5DLYA 5AVWA 3V4RA 1C1YA 4N6GA 5KKNB 1LZLA 1P73A 1IQUA 2DT8A 3K6RA 2H4FA 2HCRA 3EOBI 4DGSA 4RKQA 2GWRA 4MA5A 3ZR4B 2RHHA 1I32A 3ELYA 3NUQA 5EIOA 3T9AA 1BN6A 3QF4B 1Z37A 3DDUA 3AVVA 3WMFA 1Y63A 3MMXA 4ZYYA 4MGEA 3Q9SA 3ELUA 1ENZA 3WLMA 2CK3A 3GRPA 4TSRA 3K16A 1AV7A 4UUOA 2P1ZA 1HT3A 2UUPA 3B20A 2KB0A 1KDPA 4D02A 1KAQA 2I6FA 1I5RA 3W5IA 1SC4A 1N9ZA 1ENYA 2HSJA 2IC5A 2WUEA 5A0VA 1JFSA 1C7EA 1E2IA 4GOOD 4M46A 5HKAA 2QIOA 2GF0A 4G23A 3TQRA 4D26A 2MYUA 3HJGA 1P9WA 3OLYA 2J0UA 5HQ3B 3BTSA 3DYIA 3SSMA 4Z3OA 3MWLA 1Q92A 4MUBA 4RV4A 5FD8A 2C5EA 3TF5A 2P6MA 2XNDD 4JT8A 2DC1A 3GARA 4TSFA 4U2DA 1DTWA 4TWJA 2BP7A 2QMYA 3EXG1 5M5BA 4NDAA 1KRWA 3IJPA 3M6XA 1YK0A 4B35A 1IULA 2E9SA 2FSHA 1UMDA 1D7OA 1E62A 2AUTA 4QFCA 4RMGA 4D1YA 3A6PC 5BR7A 1Y3AA 1DC7A 1RYEA 2EIXA 2Q27A 3OEEA 5TSDA 3UATA 1PSWA 4N9WA 4BCCA 4ZU3A 2EIHA 1HTTA 1C30A 4JS0A 1RI4A 4PLFA 4AN1A 4BRSA 2VDWA 2JZCA 4WOJA 1YDGA 3R7DA 1W5FA 3UJ7A 5ECYA 3K9CA 4KEAA 3WB2A 5C4IA 2IRWA 2DPLA 1KYIA 1ABFA 5EJ5A 3NW9A 1TPZA 1ISHA 1UXOA 2HSZA 3JASB 3WWPA 3SS8A 4CEIB 4AQDA 5GIOE 1C2TA 3Q10A 3JD1A 5JPIA 3VC7A 1VG0B 1XEXB 1HF3A 3B1KA 1TQDA 4PXYA 3NCHA 1W5TA 4FWIB 2JJ8A 2SNIE 4QARA 4C1NA 1II9A 5MGBA 1MAUA 1KBQA 1WHTA 4F9FA 5BV7A 2AN1A 4JLWA 3MJHA 4LDRA 2A33A 4FWBA 1PUIA 4HSEA 3WLQA 5KYXA 5IH3A 4F4JA 1XTRA 1OQAA 3HBFA 1GRQA 4PHHA 4HB0A 2R1UA 2I3GA 4LBYA 1EXMA 1E0KA 1ZQ1A 3K9WA 2BR5A 3ONEA 1O3YA 3KP1A 3C98A 1OB2A 3O3NB 1XYGA 1K4YA 3WDKA 1YJBA 2GARA 1OA1A 2IPOA 4ZAWA 2CVZA 3BREA 3CCCA 3PIIA 1N5JA 1YZGA 3EOAI 4ID9A 4A6XA 1UPCA 3SOPA 3TLAA 3AEXA 3BKWA 1E4VA 1FVHA 3L04A 4L76A 3ZIAA 2IH2A 5EJMA 5AUNB 1M1YB 1JDZA 4HHEA 3C43A 4RVDA 5K0SA 3ZWYA 3D7NA 1U5BA 1UPFA 3T15A 4CCAA 2B4TO 3HCEA 4FLEA 4MCAA 2MCFA 1E1CB 2WMDA 2OZPA 1BDMA 2QP4A 4J49A 5EJAA 1UBEA 1GQYA 4DA6A 3KQHA 3NBUA 4YXFA 3V2UA 1T5TA 1T36A 1LX7A 3PC7A 4PYOA 4AKSA 1Q91A 5M2QA 2XQIA 3BSSA 1TJ4A 3RC9A 1EQAA 1K86A 2PNJA 3QG5A 1K75A 1SK8A 3O03A 3OZEA 3MUFA 1JDTA 2IL1A 2GFIA 4M0LA 3K32A 5A6SB 1BNCA 2HK6A 4IOMA 3M7IA 1NI4B 1OC4A 4LBWA 3RFXA 1B42A 5JAMA 2PT9A 1QGYA 1MJ5A 1Q3KA 1R4AA 4K6MA 1M33A 5JH7F 1V71A 1C1DA 3MPUA 5AW1A 1ODIA 2B5OA 1P91A 3H1BA 2Q3FA 4UTRA 5EE3A 4ZZ2A 4JYAB 1VL0A 1XZMA 1W46A 4DIEA 4N18A 4G8JA 5SZIA 2V59A 5AM0A 3OQPA 1IEXA 1SY7A 3C3PA 2ZK7A 5ECWA 3WMXA 4BFWA 2B8EA 2DFKB 2ZITA 5JS1A 3DKPA 4LNHA 3FMOB 3H7IA 2R8PA 1IN8A 4M8LA 3GL9A 2VEOA 2CFIA 1XLTC 4QNNA 5AXAA 3I6QA 2WJGA 1IE3A 4LF5B 3QGMA 1K0FA 4WBXC 1FP7A 1NXTA 2P5SA 3TTSA 4REQB 2G3YA 3BWBA 3OPQA 4FYMA 3UUFA 4DEYA 1XQXA 3PFBA 4M37A 3TEMA 3OLQA 2JBHA 2RJOA 2ZKLA 4RABA 2OHHA 1SCQA 2YWRA 2JIDA 3S2EA 1AUVA 1NBOA 1IY8A 1W96A 5HIKA 2Q3MA 1GRVA 3K7EA 3E0XA 2EERA 2ZR0A 2WNIA 1W0KD 2A57A 1ESMA 4LDZA 4EQZA 1YQWA 3BILA 3CZ9A 1XPUA 2QZPA 2P78A 3KWMA 4W9NC 2QT1A 4TKLA 4ZI7F 4BFZA 2BSXA 2BMAA 2ZU6A 3B8EA 3NUGA 4I0WB 3K71B 5HIJA 1H8ED 2HUNA 3E4CA 3EGDB 1O89A 1U2QA 2Z4TA 2ZRCA 1N5KA 4IXWA 4ZVUA 1AJEA 1ZM3A 5LZ4A 3C5VA 1PDOA 3E58A 3TZ6A 3UHFA 2A5LA 3VZSA 2NUAB 1JP7A 1A2KC 4FHFA 2GJ4A 1OW3B 2MSDB 3W0LB 3I9NA 2BMVA 4HQFA 2J30A 3I5AA 4LBVA 4JI3B 4H6PA 2YCLA 3MWDB 1LF0A 5AJTA 3ZDRA 2P3LA 1ISFA 3OZTA 3B1FA 1F9EA 1E9FA 1SVMA 2HGSA 2RI6A 5LQSA 4ER6A 4BNHA 3EARA 3FMFA 3T5GA 2P2CA 2HU2A 3PRJA 4UTXA 1I2MA 1QFYA 1OZGA 1FLVA 1ODFA 2GHQA 2OZVA 3JX9A 4DCVA 2ABWA 5F9HA 2FMUA 3QLVA 4M7PA 2NU8A 4YVFA 4BEJA 3FJ1A 3SQLA 1MNAA 2AH5A 4JDUA 2Z83A 1TU0A 3U3XA 2Q46A 1XZPA 3T1NA 1E1QA 5I9BA 2YKGA 4POOA 1GADO 4CL2A 1Z35A 1HQCA 4L75A 3TQOA 4HNQA 1YR3A 4KHPB 4NBVA 3U60B 3DOOA 5DSZA 3AU8A 2RG1A 1F6DA 3H4TA 2PX2A 3DVLA 1FDRA 3D2AA 5AI0A 2XB4A 2UU9B 3EZ2A 2P79A 2ZANA 3DG9A 3S29A 3OJOA 1XO1A 4DSUA 2EWWA 3RYIA 2I2AA 4IEIA 2QGNA 3EPPA 3ZHVA 1QRUA 2ODNA 3CNNA 4OUDA 3N2EA 3KV3O 4G9BA 4KUEA 1EK0A 4TRMA 3J7AC 1YDMA 4OEHA 3E2MA 1OU0A 1QCYA 3LUJA 4E15A 1T35A 5T4EA 1JVBA 1H3NA 4NH0A 4CEHA 1T36B 4Q03A 2OD7A 3UUGA 3DNPA 3KQLA 1ORWA 4CODB 2BZSA 4UC0A 1X7HA 1Y8RB 2OCIA 2Y1DA 1XP8A 2W6MA 3DOEA 3L4BA 3NWOA 4TVKA 5B2EA 3LL7A 3EQZA 5JV5A 3JV7A 2DAPA 4ZHQB 2JA1A 4FIDA 1ZAYA 1WRBA 4GKVA 4M1OA 4Q4JA 3DM5A 4GWLA 4PBRA 3HV0A 3UK2A 3ZLBA 5E7JA 3ZI7A 5H7XA 4UU8A 2X6RA 4OH7A 1TKAA 4RJLA 3DONA 1KERA 3L8CA 1YZHA 3GLTA 2ECKA 1C3OA 4TTIA 2WTMA 1YR2A 2HHJA 3QV1A 1B93A 3D3EA 2COKA 2V7VA 3NHUA 3WS7A 2O5RA 3C39A 3WTCA 4A82A 3HABA 4IW3B 5A7GA 2B1JA 3IAHA 2JFPA 1AVTA 4YJDA 1A2OA 1H2FA 2M98A 3EK2A 2CUKA 3W8NA 3S2FA 1NVVR 5A4FS 1YQGA 2NXCA 4Y2PA 5BSEA 5F51A 3DEAA 3A37A 3R8FA 2OV6A 1O97D 1PZGA 1XVTA 4TPKA 5CB0A 1Q0TA 3HH8A 3I0MA 1ONOA 3B5EA 2RJ3A 4EY7A 3R74A 4NK4A 1DMRA 1O5TA 4M6WA 3TI9A 2JAWA 1YRBA 1BC5A 1G6KA 1T91A 1A7JA 1UWVA 4PRYA 3UMFA 5AW8A 4UMFA 4EMSA 1YWGO 3QJGA 1V8DA 1ZJ6A 1IRXA 1TKCA 3IKJA 4G97A 4JMPA 4TSKA 4BRUA 4DF3A 1UPUA 2J0QA 3QFFA 2F1IA 4L57A 4RL6A 1L9XA 3RG8A 1L7BA 5AJXA 1J21A 1GCIA 3Q1KA 5JSKA 3FUWA 2CJWA 3QPCA 4AX4A 5CA0B 4FR0A 3ZHYA 5KYYB 4MAFA 2OD9A 3PKJA 2NX2A 4FNMA 5D5QA 4BDTA 4BS9A 5BSHA 3H3FA 4U1RA 1V9LA 4NPCA 4AS1A 2QTNA 3FNBA 3UC9A 1ECJA 4X6YA 2FP4A 4WJKB 1MC8A 4F5DA 4IVQA 3O91A 3PJFA 1NDHA 1RXWA 2V7BA 2WHPB 1DEKA 2VVTA 4QYIA 4ZO4A 3TZBA 5EZYF 4V0LA 2QLBA 2G72A 2NO0A 2V7XA 1L4MA 4R16A 1ZM2A 3UMRA 3P0HA 5IFKA 4RPLA 5FI0B 3H05A 3L8MA 3RVQA 4H16A 1OIVA 4NC9A 1VIVA 1G1MA 2JLAA 3LRTA 3W4KA 5HF8A 1XRMA 2VTBB 2XGJA 3HLKA 2ID4A 1R6XA 2XUJA 4LHYA 3EISA 1P1IA 4X3CA 4WZZA 2W9XA 3PWTA 3AF1A 4V0ME 1MO6A 4P80A 3K4PA 3Q7EA 4E1VA 4EHKA 5BWNA 3CVVA 1Z8FA 2EKDA 2XYGA 1Z2OX 4NLLA 4RTNA 4Z8XA 1BWPA 1U8EA 2NXWA 2WPDA 1DELA 2V1XA 2ZIWB 5AW5A 3Q3VA 3X1MA 3IXLA 2R7KA 1J99A 3O8RA 1QYXA 4IDOA 3D6VA 3PE6A 4TQUS 1KEPA 1SQSA 5BN4B 1RWKA 4BB9A 2UUBB 5I47A 3BG5A 4UXHA 5EWLA 3DJFA 1TC1A 9GPBA 1OXSC 2GAIA 4C2BA 3KNZA 4R8VA 4ZCRA 4EMUA 2WM9B 4GPBA 4K81B 5FV7A 5AKJA 2PYIA 3H99A 2FFJA 3A31A 3KT3A 4ZVOA 5SYAA 4R2XA 2GNAA 2XB6A 4RSRA 1KOLA 2P3QA 5AM3A 3DR5A 2AJCA 4FUTA 1CQWA 3FHOA 2CFRA 1VL2A 1Y3CE 1FRZA 3GGOA 4DWWA 1WY5A 1U3GA 3AK4A 5IJWA 2SBTA 5I9TA 2H0QA 1RWOA 4ZARA 3QITA 4ZCLA 2EQAA 5TPZD 5JJCA 2IODA 1YZNA 4NNJA 3OKCA 4IJWA 1M8FA 1RI1A 2I87A 5SYNA 4QA9A 3ZYZA 1K7YA 3BIWA 3OE5A 4JL5A 2Y0BA 5BSTA 3W9UA 3NALA 1E79D 2OD2A 2P4QA 4P7GA 1Q0LA 1PR1A 1VC2A 1WV0A 3FF1A 1DGQA 2C8LA 3O8LA 2C42A 1E5DA 2HL6A 4RF3A 1N6RA 5AHRA 1FFBA 4HYTA 1SZPA 2WDPA 3I2YX 3NAMA 4XTCS 5BRNA 2OR3A 3LP5A 1RQXA 2VUUA 4FJ0A 5E2AA 1OKKA 1OU4A 3HGQA 3SJUA 4LIPD 1QF7A 1D6SA 1U94A 2RAUA 4NRDA 1GAXA 2H59A 4B34A 2FFBA 2ORYA 3IT3A 1U6IA 5FV4A 3R3VA 2ATCA 3UQYS 2JLBA 3U9TA 2COEA 3R9IA 1RRKA 2FWPA 4NCXA 4NBRA 1K68A 3WYGA 3S2GA 3UMJA 3MJEA 4X60A 1M0EA 4PLGA 1JECA 1T2DA 2RB4A 3AY0A 1SG6A 4S35A 3K0FB 4CLXA 2WFLA 4ATNA 1CQIA 1A1SA 1Y7LA 4IXMA 2DFLA 2F90A 4AW9A 1VCIA 4MR9B 2CLIB 1BE1A 4TMFA 5CFZA 4DRYA 3M6LA 1ECGA 4K5QA 3N87A 4O0LA 4D9GA 3FDJA 1ZU4A 4K40A 3SOZA 1ARZA 1PZNA 5COAA 4GDMA 1U99A 3BHIA 3MOSA 2B0JA 3N8NA 1ITZA 4JITA 3WHLA 4U6SA 2PUDA 1N3YA 1GUZA 3LUFA 4FMBB 2FSVA 4MV6A 2XGMA 3DLCA 3EJWA 4F06A 1FX0B 1UCFA 5J4KA 2E1RA 3DAFA 2I1WA 1PJCA 1P4GA 3BB4A 2WVHA 4INJA 3ZCVA 4KFCA 4KR7A 1IAQA 3M1AA 3R3HA 3UFXB 2BHSA 1V6SA 2DPYA 1XI2A 2IOYA 1E5TA 1HUQA 3GJ7A 4WGGA 1GITA 2YXEA 4DR5B 4BGDA 3VZPA 1QRAA 1SBCA 3GI1A 4J1QA 2CY0A 3J7TA 4KE8A 4GFDA 4YACA 4GVXA 3JD4A 2KBEA 3DH0A 3FIUA 2FR1A 2OG1A 3PTZA 4P8RA 4OX9Y 2CEAA 3QVWA 4PPFA 1GLNA 1FPMA 1JPJA 3ESRA 1M7HA 1JMKC 1DC4A 2CEKA 1C3JA 1EM8B 1XMQB 1G5FA 3PX7A 5U9CA 3GIWA 4HEJA 3WL8A 1JIKA 1NQTA 1EUDA 3FCUB 2VZ8A 2ETXA 4G3XA 3AJDA 2ADMA 4BBJA 4OKSA 2YXBA 4G5OA 3OMXA 1QCZA 2WWIA 3IUYA 5ALNA 4Q9JA 4NARA 4MV7A 4M99A 2QTMA 3SQOA 1KWGA 3UV3A 4L9SA 4DMKA 2C8JA 4L5IA 4EVRA 4YRLA 3RSFA 4OL0A 5KTSA 2PRIA 2QD4A 3OQIA 1PX0A 3DE5X 3MTGA 3K2EA 3CWCA 4OHXA 5DYYA 1YI0A 3A04A 5AW9A 2GJ9A 2BEWB 3DBLB 3KR9A 1M1NA 1J70A 1TB4A 2QVZX 4YV0A 2RHBA 3D1VA 2Y2UA 2R00A 1DEAA 4LZJA 4YRSA 2A3RA 3B1WA 5IEBA 1B8VA 1CDDA 1RAFA 1LDYA 3UGTA 1AK9A 3DLAA 2W42A 3SWWA 1GILA 4EYEA 2BEVA 3B52X 4J0QA 5LBIA 3UWMA 5IUNC 4FU0A 3K8QA 3LZ6A 1JEQB 4GVPA 2ZJ4A 4X7MA 5F5LA 5JNSA 3O90A 4MZDA 3R6GA 2VQDA 1FA9A 1GKYA 3I1JA 1VYVA 4JJ6A 5JQGA 3AETA 3F3SA 3O21A 4R6WA 2A67A 4MB0A 5AJYA 2YWFA 1UBNA 3ZK8A 2C8VA 2INGX 2IY8A 3UK1A 3GJTA 3A70A 3E8XA 4EKGA 2ADOA 1SHUX 5LMNB 1BVRA 5KS2A 1G5QA 1M34B 1PFQA 5EEGA 1KBZA 3DQQA 3QJYA 5BMVF 4KR9A 4ENRA 3DOCA 4OHWA 4F1JA 5KVCA 2OAEA 2VHWA 5ADWA 1PR9A 2XT6A 4AWBA 4MHOA 2YZ7A 4PFSA 2EF0A 4RF5A 2BJWA 2HIMA 3RGWS 2FEWB 4A0HA 2FW7A 5BN3A 4F3TA 2AFRA 2HIGA 5AKIA 3D0KA 1NVVQ 1F48A 3DWEX 2O9JA 2IJGX 3D7KA 4HVLA 3KEMA 1Z0KA 3GP5A 4XGRA 9ABPA 2BFBA 3EXFB 1YQTA 3H5LA 3QW2A 4YR7A 3UF0A 3MHPA 2PNFA 1HFEL 3FVVA 1PJBA 3DMYA 1R0KA 2HZBA 3HKCB 2JFQA 5T5QA 1LU9A 3EUFA 2C7QA 3ZJ4A 4FX5A 1YR7A 4K8RB 5JJKA 1EI9A 1QFXA 2WTAA 4MA4A 5CVUA 1M74A 2H1IA 2VP6A 5FLYA 2BEVB 2WKRA 2EARA 2JJ2A 3GFBA 1KXZA 1UFKA 4OIMA 3ONVA 3L8HA 3H11A 2YYZA 4A0RA 4EGAA 4O2AB 4DADA 3P45A 4H4EA 1CNEA 1RT9A 1BHQ1 1GIAA 1ZQ9A 2HMTA 2I4LA 1U0OC 1ABBA 1SXGA 4F2GA 4OA8A 1R2QA 4IBOA 2BBWA 4IHQA 4UEWA 2YH2A 3M70A 3Q2IA 3ESYA 4IOJA 2H7VA 3ZKAA 4LCEA 4TXLA 5E3HA 2P68A 3INYA 1G6OA 1HYQA 4PC3A 4INOA 4QRIA 5I7AA 3KOXA 1KS9A 4Z7OB 3L0YA 1JYEA 1B76A 4YUXA 1X7YA 3IOCA 4EGCB 4LNUA 5HCIA 3OICA 3TQIA 1AQ6A 3ZK7A 3PI7A 2J6HA 1Y82A 4QDUA 3BZWA 5D51S 4EJSA 2C96A 4TMYA 2F1HA 3GZTB 1N4DA 1YVRA 1KPIA 3IAM6 4DABA 1QR2A 4O4LA 1WETA 3TQTA 1FC0A 3N28A 2QR2A 4BYGA 5JZSA 3UO8B 2NYAA 2XY4A 4QASA 1VZ3A 4XVHA 3PRYA 4LFCB 1GN8A 1WBDA 2WABA 1KTIA 3B89A 2ZQYA 4OJYA 1NVAA 3C14C 1KJWA 3RU3A 3VSDA 2FW6A 2PZEA 4YPFA 2CD7A 2GAJA 3P26A 4TM7A 2RH5A 1OLOA 2I8CA 4A6DA 4QSHA 4AF7A 3ZCTA 5CYFA 4YY3B 5HR5A 1T1GA 4L08A 4MYRA 2W6JD 4FMPA 3EDQA 1JIIA 1F2UB 4QOSA 5JJIA 4C2AA 2HBYA 1T2VA 1CP2A 2A88A 2C5LA 2J3IA 2P6UA 1TCCA 1NBMD 3HYTA 4G67A 5EL0A 3HCAA 3PNBA 5KDOA 2ZUCA 4YDQA 3TL2A 3AW9A 3FVQA 2Z1DA 1J2RA 2OBXA 1CNMA 4HXYA 3UG6A 8ADHA 1ZIYA 3KVNA 2GAAA 4EF4A 5CDTA 4N0QA 4EOGA 1MORA 1JT9A 1UJNA 2Z2YA 1XEWY 1VB5A 4F91B 1VCOA 1LJUA 3KOWA 4MR9A 5FCDA 3U9LA 4QXOA 3PBKA 1ADCA 4X61A 1H0HA 1UUFA 4DIMA 1MD9A 2RAFA 9ATCA 1A0OA 4L28A 1LBIA 1NVKA 4BKPA 2I03A 4TS4A 3MELA 1PEAA 3PT9A 3KYCA 4CFSA 4F86A 2YHIA 2PXCA 2WJAA 4XRRA 1MUUA 1YB1A 1VJDA 1IHXA 3G9ZA 4EA6A 1LQ2A 3WBBA 1G3UA 4HKTA 3WWDA 4AZ0B 1Z3IX 5ALMA 2ZJFA 4IO1A 1EJBA 3RS3A 3RUPA 4RJTA 3U40A 4R7TA 2GRJA 4EW6A 1QOZA 3D6TB 4R2HA 1KRXA 2BGKA 1LUAA 4XFDA 2YV3A 1USUA 3I5XA 1CKEA 1E9VA 3BL6A 2OUIA 4GMGA 1US8A 5F3DA 4ZZ3A 2NVUA 3ZDZB 3FWPA 4E03A 1X77A 5DH9A 1RRVA 2B8NA 3EW9A 1I8TA 1YJQA 3RSLA 3ACDA 3RROA 4IDAA 3QU7A 4ZCMA 4Q4JB 3SAJA 3AY3A 2NT4A 5FHQA 5HZKA 4E5PA 1N6PA 3ZV7A 4D8YA 4IRUB 2NM0A 2YHAA 1MO3A 1XTUA 4DLPA 3TN7A 3DE1X 5IAKA 1YS7A 4H7FA 3SX0A 4YMLA 4ZVPA 1VP9A 2ZYVX 3WLPA 4JP2A 4WBNB 1O96B 1I10A 1XZLA 5IJ0B 2F2TA 5I9MA 2QMEA 4D4KA 1ONBA 1DKOA 2RG7A 4OA5A 4EKDA 1RXSA 5AHXA 1P5FA 2J41A 4HS9A 1ZA1A 1N8KA 2G06A 3PNLA 1TIKA 2IDJA 4UARA 1QRSA 1CB0A 4IIVA 4QXPA 3N0RA 4RPJA 2V9CA 3UAGA 3I73A 1OYVA 3L8ZA 5CW2A 5ELMA 2GVDC 3BDVA 4UVHA 3OIDA 2E5FA 2YIVX 2BFDB 1IPHA 1EFPA 1R10A 1HL7A 1GVHA 4HX9A 2W43A 3H8VA 4UBIA 4EJSB 3BWMA 3OKFA 5EHGA 3SMQA 4MK4A 5DNAA 3BCHA 1Y5NA 3AKDA 4C88A 5JAOA 3ZJUA 4N3GA 1PJ3A 1G8AA 1ES9A 3IUSA 4WINA 1D03A 4XPZA 5CA1F 4UAUA 1TAUA 2LKDA 4BVBA 3I9FA 4HK4A 1R6BX 3BD9A 4H60A 4NPAA 4CQNA 1C8LA 5B57C 4A15A 3NBZC 5AK5A 2VG8A 1UMBB 1TDJA 3IP9A 1BEUB 1V96A 4QVKA 1IL0A 3D64A 1PJ8A 1T8YA 1VFPA 1BCRA 5BYAA 3CVYA 2NU8B 2X14A 3ANMA 4AQ7A 2YHSA 1L4FA 2SHKA 4M0DA 1OA0A 5DCWA 4WZBE 5SZJA 4XVRA 2VNAA 5FUBA 4QYIB 3DLIA 1H85A 1QWOA 1P5JA 4RTOA 1FYFA 2PYZA 3CUWA 3A6DA 3OU6A 1E77A 1XROA 3UAYA 5ARBA 4X71A 4BO6A 1UK7A 3MWDA 1IDOA 1OFIA 4WV3A 4JJ4A 4KVFA 4O2AF 5HA5A 3WI7A 1KDTA 3PXUA 3QMWA 4NU0A 4MVXA 4AROA 4U2GA 2HXSA 3HE3A 2BEKA 1V2HE 4G0QA 1KFEB 5LBUA 5T4FA 4BKQA 4RLHA 4GNRA 4CHTA 5ERYA 5DTQA 621PA 4NNOA 1AU9A 1U2GA 2IT1A 3I04A 1LRJA 1VJCA 3IJEB 2I4IA 3RU7A 3WNDA 8MHTA 2GZMA 3H2GA 1C9JA 5LIPA 4AY6A 1X1CA 2JJMA 3ZZNA 4M1MA 2ZUEA 4IX1A 4TMTA 3H75A 3H9EO 4YJGB 3Q15C 1GUDA 1POWA 3KSZO 4EA7A 4R3UC 1DJNA 4H6WA 1M2VB 4QWMA 3ZDXB 1SXHA 5TQVA 3RADC 3EZLA 3FAKA 4UM9D 1P0CA 1UM9A 2NO7A 5ALDA 5U4QA 3ZI0A 4QVGA 1LX6A 2I6XA 2H1LA 4AUEA 1RI3A 4Q1VA 3VOBA 5KIAA 1QOQB 2Q8PA 1XDUA 5BT9A 4BATA 5CVCA 2GZDA 4KIUA 1N3IA 4IV0A 1SULA 4OQYA 4LHVA 5JS2A 4CQJA 1XL1A 2WICA 2GM3A 3LQFA 4FDVA 4JWKA 4JLMA 3W1WA 1OX4A 2F67A 3UJ6A 3MS4A 2FW1A 5LA6B 4RXMA 2AFIA 3E22A 3VC3A 1B8UA 2ONYA 1SD1A 1XVIA 4I4NA 4JLOA 4KNWA 4LXXA 1TM3E 5ENVA 4CV1A 2ZTVA 3CH6A 4KR0A 5KAPA 3SK0A 3IEXA 4YQYA 3CR8A 4JB3A 2G17A 3D8TA 3LHFA 2UKDA 3DMDA 3UKJA 4GLFA 3VPXA 3S8EA 2ZM6B 2PX6A 2W6JA 4PTLA 1QUEA 4YH1A 3E03A 1HORA 5DCYA 4XFKA 1HGXA 2RK4A 3OECA 4WOPA 4Y6SA 2HMVA 3ZZ0A 1QJ4A 2GO1A 1RC0A 4FINA 3HEAA 5FJIA 4DV1B 4EECA 3DF7A 1TUBB 4TOIA 4PICA 1JDBC 3G79A 1QORA 3OPYI 4XWOA 4LJ4A 2PBRA 2YOGA 1KNQA 3IMFA 4FQ8A 4J8PA 4IDCA 2DLDA 1XZGA 3NHRA 5IMSA 1GDDA 5HG0A 3BERA 2C2BA 3N53A 5BPFA 5TMEA 2OM6A 1VLHA 1H2ZA 4N8EA 2NWQA 3K2IA 5B1DA 5HIAA 4CM1A 2PJZA 1EP9A 1ZLXA 2X1VA 4U0JA 5F73A 1DAEA 3E1KA 1C0KA 1MT3A 4LMAA 5DE3A 4DW8A 4CGYA 2RAPA 1P0MA 1FY2A 4MYDA 2DY1A 3M5WA 4XJSA 1YBFA 1HDCA 1BFUA 1Z2CA 4JU8A 2P2ZA 3F5DA 5C81A 2IW1A 3Q2KA 4A1OA 1HPLA 1U0LA 3Q72A 1D3AA 4KGDA 3E9CA 2G09A 4R05A 1ZMBA 3FCEA 2BJVA 4CKBB 4YUWA 1CY0A 2PSHA 4LGMA 3N8GA 3REQA 2E4ZA 4UUMA 1BU5A 2WM3A 4MW5A 1BS1A 5CB4F 4OI0A 2AC2A 3GRCA 2DBVO 2MMGA 1DTSA 2D8MA 4P82A 4EI8A 2UUCB 4KREA 5EA2A 1VRCA 5C7YA 4OHUA 1L5OA 1V1RB 2R1ZA 3EG9A 3LLUA 4HH3C 3ZYCA 4EYSA 4DMGA 3B1XA 3E9RA 1YRYE 2QQFA 2QY6A 3ZWWA 3FZQA 4OHKA 1RQPA 3NNSA 1MNQA 1KH1A 1RBQA 1ISJA 3WL7A 5IX8A 2XXJA 1HDOA 2AR9A 3DFUA 4ND7A 2PUFA 1SVLA 1G7SA 4ZDWA 4HB4A 4UXJA 3TMYA 1HT0A 5ALUA 4BNKA 1NW5A 5CLJA 1WG8A 2HRCA 1H8EA 3VM6A 2D2VA 2PLFA 4R54A 4CM4B 1NR5A 4O29A 4AMZA 3HRHA 4D43A 1UAGA 2ZULA 4J03A 4DG8A 1KFJB 2OSBA 1RRMA 4R68A 2XMQA 5L6LB 4R5MA 4G5FA 3DDSA 4Y9RA 5CCEA 5HJ5A 3JQFC 4M0KA 1CVRA 4W1RA 4PXAA 4HG2A 1SKBA 2JVJA 2WIDA 3P2JA 3GLIB 1G41A 1PTJA 4CF7A 2HQOA 1KQFA 3ZLJA 2A9QA 2WU0A 1O9GA 2ZWMA 5A9SA 2ZOSA 2JB9A 2W2KA 4IILA 1ATZA 2WV7A 5CDUA 1H05A 2AR0A 2WJZB 1KJIA 2HHLA 1W1WA 4RA9B 4EL5A 5HWSA 5IPFA 1N0VC 2OWEA 1O4WA 3GLHE 3ISVA 3MW8A 5BQPA 2SICE 4GF5A 2D00A 3N2IA 1FS4A 1M8KA 4NPHA 1DTWB 3RVBA 2Q4TA 1JKXA 5FOUA 2J3MA 2P5YA 4NAHA 1MIOB 2QX8A 1ESDA 3AF4A 4OAQA 5TDHA 4DY4A 3PDIA 4CMEA 1L7VC 2GXUA 3ZWXA 3N6RA 5ADHA 1L5SA 1II8B 3H97A 4XWGA 4D41A 2C59A 2Y2VA 3IBTA 5B7GA 5TF0A 4ZMBA 2IXAA 1E3QA 2H4JA 2OXIA 2DPXA 2JFOA 3QELB 2CFOA 2NTVA 3G88A 4FXOA 1Y3FE 2KM1A 4J0FA 3DT8A 1X7ZA 2IWHA 1O6GA 3WY9A 3DBVO 1QX3A 2FQWA 2QPTA 4BKMA 2GSWA 2XMRA 4E09A 1YC2A 1H8HD 3FOBA 4CXMA 2GXAA 2QSJA 1UK8A 4N5NA 5CXQA 4LFBB 5BR4A 3WNVA 3UT5B 1YHYA 4DNOA 4I9UA 4EG0A 4MP6A 2R86A 1RWPA 4NE7A 4K2HA 1PR5A 1SCKA 3L7BA 1QH1B 2BFCA 1TQ8A 3QEBZ 2WUGA 3ESZA 4FGKA 2OMKA 1K66A 2PQ2A 3A9TA 3HUDA 3DTVD 4ODIA 1G8KA 3B53X 1DX4A 1EFVB 5ITZB 5K3CA 3A3PA 4RQBA 3TCXB 5EHNA 3HL4A 1YFZA 2BMDA 2HBZA 1Z9BA 3QTBA 4KBFA 4RENA 3GP8A 2PTHA 4DB4A 3ICOA 3DMTA 4CU2A 5D84A 4D4IA 3ZHZA 1DQZA 2H92A 1TO2E 3O74A 5ALIA 1A9SA 1BE0A 2NLOA 2P4UA 2PWYA 1BO6A 4W5OA 2IS2A 4NU8X 1QHNA 4WBSA 2FWRA 2UAGA 3RQIA 2FGKA 4GI3A 3OO0A 1TVKA 2OFWA 3L84A 3PYMA 3C3WA 4GH5A 4CM5A 2X3YA 4XIJA 3RFUA 4BN4A 1NNEA 1QKKA 1OTYA 3WXBA 2H4HA 2PRZA 2PX5A 3HYLA 3GEGA 1IOLA 1Y3DE 3CWZA 4HX2A 4J29A 4P9NA 3RODA 3CW2A 4WK2B 2RB5A 1PSZA 2ENUA 2HA3A 2YR0A 4PC6A 4R1TA 4F3YA 4HVCA 5GZ3A 1JWBB 1V35A 3EF0A 2I3BA 4R0VA 2ZLBA 2RFLA 5JD3A 1M6NA 5C1BA 4WLEA 1ZD4A 3FBWA 3N70A 1NQWA 1UJCA 3L1JA 5IP5A 4OJQA 2BGTA 4R31A 5E1OA 3GNQA 2QUAA 1IXZA 4O4HA 4WECA 4B3IA 2DTXA 1RHJA 3KR2A 1IWOA 5LMZA 4FUQA 2VJCA 4GP7A 1TU3A 4TQ9A 1V43A 2Q5JA 1QYDA 3FJOA 3TLMA 2XWBF 3R8XA 1QDEA 3A1FA 3LP6A 4G4IA 2IPAB 1OXUA 5KOJA 5EJ9A 1VRVA 1E32A 4URVR 4E4TA 1E9SA 5INTA 1MW9X 3FCYA 4WUTA 1QG0A 2YJ6A 1ZUNA 2MHCA 3EAQA 1BGXT 1E3SA 1THMA 1ZUNB 4ZOQI 2JJYA 2DWPA 2JD2A 2Q7DA 2D7DA 4IDBA 3PLNA 2FVYA 1L3CA 2YW9A 5EMMA 5BNIA 3OJXA 5LLDA 1VA4A 2IELA 2VRCA 4MVCA 4QUGA 3QMVA 4Y1EA 1AT1A 2CNOA 4OXXA 1F8UA 1U80A 2HLDA 2Y1XA 3FKSD 5F23A 2ZWPA 1HEYA 1X39A 3OBIA 4MUMA 1EFVA 3CLTC 5CW1A 2DFTA 1JG6A 3SE7A 3KRTA 1RYYA 3OCWA 4R83A 3EMBA 3AVXA 3O7WA 1VTKA 1U2TA 2AC4A 4W4TA 5JCJA 3IA7A 1JJ7A 4RZUA 2I29A 1KYTA 3MXOA 2NT3A 4LPKA 5LXTB 4EQ6B 2BWJA 4F9TA 1KOJA 5ES4B 3I83A 1FS6A 3BRSA 1T9HA 3JQAA 2C2KA 3CWQA 1P0QA 3J81k 3DULA 4KR3A 3L7AA 7MDHA 2R5NA 3NJ8A 4HC4A 1S8FA 3U48A 2AS0A 2I7XA 1DAOA 1KR2A 2I8LA 3IIKA 4MGIR 1P74A 2YFHA 3MZ0A 5BV1A 1GTSA 1DEXA 1PZMA 1QCCA 2VLBA 3NAZA 3PFIA 5EP1A 4RTSA 1IN5A 1CEXA 2IH4A 4K0KB 5KVQA 1OXTA 2GEFA 3P4XA 1L9KA 3COSA 3M89A 2DTDA 1R5OA 2VJBA 2VP5A 4LV6A 1Y8RA 1JDSA 1MZVA 5JASA 1TJ3A 2WILA 4UQOA 4YJ2A 2DU8A 5DM70 1WCIA 5EC8A 2V9PA 3FA2A 4TT3D 2XAUA 2OBNA 2JC3A 1VI5A 3EIXA 1B2RA 2ZWVA 3MBOA 3URMA 4B8ZA 5AIBA 4B7UA 2ZBFA 1M7BA 2W71A 2RGRA 1O54A 1G3IA 4J16A 2J46A 3VSEA 1CR1A 1GQFA 1QS0B 2XWSA 3EMKA 5B12A 3GN1A 1CLUA 2W98A 1HC7A 1NZJA 1GFIA 4QYWA 2IEDA 2AJ8A 1Z2AA 4WL0A 1X0XA 5H70A 4QU8A 4KK3A 1JQ5A 3T06B 2QRJA 2FPSA 3GLHA 3CPSA 2BJHA 2VWQA 1LSOA 3BJRA 4H3KB 4Z6KA 2FZCA 1E3JA 4X93A 5JW6A 4I9NA 2X3FA 4KO3S 2I33A 2XIJA 4P08A 4AU1A 3WGVA 4BCDA 2I3DA 4DSZA 2O8EA 2PE5A 4F45A 4CI9A 3AH8A 1IC6A 5F2EA 3K9HA 4Z51A 1XHLA 3A7DA 1NXQA 4GLOA 4PY2A 4U5QA 4M1YA 4EO7A 2BTQA 1DWOA 1FZQA 2FPKA 1JQ3A 1D2HA 1A3CA 1OZHA 1V3VA 2CL0X 2H1FA 1K7CA 4UEQA 4EHNA 3LX8A 4KN6A 3GMTA 1OX4B 4BTEA 3F6BX 3LOPA 3LVRE 3TSCA 1ZVJA 5LQKA 3ZHUA 2IBTA 4KIFA 4YMIA 4FGSA 1B6SA 2XGSA 3E3MA 3HPRA 3L7KA 5IRCD 3V55A 3SVLA 5C0OE 5JYBA 4CWAA 3OTGA 1D4AA 2VP9A 4NU6A 2E0IA 4KCGA 3S28A 4ARVA 1B41A 4B44A 1U7WA 2RGEA 4FE3A 5ALFA 5A3RA 5JWRA 2KLBA 3FOZA 3X1JA 3ROMA 1B16A 2ASVA 4BE9A 5KNCA 2AG1A 2CYCA 5B4TA 4JI8B 3AP3A 3LOUA 3PFFA 5E6RA 4HDSA 4JU9A 5I4KA 3O8QA 5AI5A 1CTQA 1Y6RA 2F8SA 4YFVA 3LE8A 4OFXA 3K0AA 1Q7EA 1UOEA 3RVJA 2C3YA 3IUJA 2X9GA 2W2KB 4LJLA 3F5MA 4DC1A 2CL7X 2RGWA 2VKQA 2JZNA 2O4CA 3CE9A 3P9YA 4IDPA 4QSMA 3IMGA 4EHFA 1TJYA 4ZWNA 3SYRA 3VR6H 4B3XA 4C9BA 2ZWAA 4D99A 3F5SA 2WSYB 4XM2A 2HXYA 1KC1A 1L4NA 3OZFA 3RFFA 2VC2B 2DTEA 4FI3F 4G4GA 1G98A 5GOZA 4CPDA 3G2OA 4C0AC 3DO8A 2PZLA 4ZEMA 1VSTA 4DCCA 4IS3A 3U7FB 1XLTA 1H6DA 1RQRA 1A9PA 1XA3A 2WIBA 3UHOA 3UWOA 4DCUA 3IOYA 4MEJA 4DM7A 1Q20A 4B5LA 3BXOA 1FMJA 1LVHA 1XBTA 3BWYA 3PE3A 3S2IA 2W11A 1JIXA 1VHJA 5AUOB 1ODTC 1VL8A 2GLTA 3KU1A 5B7PA 5JAZA 5B1YA 1I7SB 1C4XA 4Q3EA 3UHAA 2IFTA 3OFJA 3ED1A 1GCOA 1DJPA 4I55A 4MQ6A 1TC2A 4LJKA 5BUZA 1ST2A 1XDDA 1NY5A 1G6Q1 4KFRA 7ADHA 1DX9A 3KAKA 1JKIA 2TMDA 2A0WA 4PGMA 4ZO9A 4ESVA 3OQ1A 3U3KA 1RKUA 3H5OA 3O75A 1J1IA 1OWLA 4BEWA 4QNMA 5JEEA 2WF6A 3GWZA 2NUTB 1AS0A 2ACVA 3CA8A 3EGIA 5JPCA 5K0TA 1YBVA 4PLZA 3Q7IA 3T9CA 3CKKA 4DDTA 2VUHB 2KI5A 1QFMA 4J94A 2REQA 4YC7A 4RW0A 3RTGA 4DKJA 1HNNA 2C4KA 1Q1NA 1I4LD 5D8DA 5C46F 2XCRB 4GPD1 4ZDIA 3I58A 4MDEA 1GARA 4X8LA 4UHHA 1J2EA 3ELBA 3CBGA 4L95C 3QVTA 4OQXA 2AN4A 1JLKA 1GAEO 2QAGA 4ALNA 2ZIAA 1GT91 3B3JA 5JAPA 3U4DA 3FUUA 4LVUA 2ODAA 3ENWA 1WXHA 1O8BA 1RWQA 4IXNA 1Z6QA 4PNHA 4DHEA 2D6FA 1RWWA 3TLGB 4HLDA 1UBOS 2PZGA 1IEWA 4N6OA 1QO0D 1E6WA 4CETA 4MRNA 2C77A 4QUIA 4K9RA 3L7JA 1NFFA 1H9AA 2PR7A 3FSJX 3PHIA 4O3FA 4JA0A 3NP9A 4OQMA 4O4JF 2NZYA 4HV4A 1EKXA 3SVTA 3SJ7A 2WOOA 1FTQA 5HTOA 3LT1A 1BYUA 1J1UA 2W6CX 3LYHA 1UZAA 3GDFA 3REOA 3BB1A 4XM1A 4GKJB 3VMMA 1RM4A 2P75A 3ABRB 4NBKA 4D80A 4UZEA 4QL3A 3ZV4A 4BLSA 2FMTA 4JI7B 1NPDA 2AL7A 2ZRNA 2HJ9A 1EK2A 2DOKA 2J08A 2G63A 1PT6A 1IJEA 4EI9A 3L92A 3N2ZB 4QT0A 5IT9A 1EVEA 4E5VA 3D02A 4WDRA 3WMEA 3RRNA 2Y1KA 3U9SA 5F7OA 1W581 2O7VA 1V4NA 4AJ1A 4MA0A 2QD3A 2H2WA 1J9GA 4WY2A 1G4AE 4JVOA 4KO2S 1PJZA 3EEOA 2ACWA 1YZUA 5D3QA 3EDRA 5CHYA 1UF9A 1WP4A 5C7IO 3X43A 2JCBA 3OPXA 3IQDB 4B3HA 2YV5A 2HJHA 3LLMA 3HZZA 1JAIA 2BD0A 3IQFA 3PFHA 3DMGA 1QR6A 4HPJB 2ZS7A 2FUG6 3IMKA 3JQ9A 3SQMA 2QVCA 3ZCQA 2AOTA 2UVDA 3HR8A 4DRZA 2O0HA 3BE8A 1FQWA 2G77B 2Q3EA 3QZUA 4B79A 4R2KA 5J58A 5C8VA 2G9NA 1NPYA 3EIWA 4KQIA 1L4UA 4DLSA 2QP3A 1CY7A 5DYGA 4EHHA 5BSVA 3FUTA 4E21A 1UMDB 4FDMA 5KJCA 1VMEA 5CYGA 1HDYA 3SXPA 4KQEA 3LLCA 3PHLA 4O4LF 4CQLB 4GYJA 3ULKA 5IWAB 4XW2A 3REFA 4Z1MD 1WY7A 3R3UA 1H22A 5GONB 3G9QA 2HBRA 3A4YA 3PNPA 2OLKA 3QSGA 4ZYZA 7REQB 4XSHA 2X0NA 3FLAA 2QTGA 2C7VA 2V9ZA 2ZJ3A 2QI9C 1VBNA 2W0SA 3OUZA 1CUZA 1TF2A 1UP7A 1IJBA 3JQCA 4HDMA 4OHBA 3F5QA 1N2IA 1T4BA 4R1OA 1G21B 2EGUA 4GRDA 1RZRD 4LV5B 5CH5A 4WBNA 5EWLB 1UKBA 4BGVA 1DINA 5HCNA 4G1CA 4R6XA 3VR6D 4CDGA 2IZ0A 3V2IA 1E66A 1SPBS 3F8TA 3TJRA 1MF7A 1KZ6A 2IUTA 3E5MA 4TV8A 5CVJA 1JHAA 1R5JA 5ADUS 4KB5A 1NVTA 5CUQA 3MHTA 3F3MA 2VH1A 3ZCRA 2ZI6A 2FUEA 3HDHA 3KJHA 3KQPA 3U7RA 5LWHA 4ZQHA 1M2NA 2K4MA 4GMHA 5HUHA 3L0PA 3AIKA 4B80A 1QLWA 1ISPA 2OBLA 1FUIA 3ZHQA 1E8MA 1NF2A 4BRWA 1B6GA 3LUBA 3ODPA 2XCIA 1KJYA 2ON6A 2Z2JA 1RJWA 2GESA 1E2HA 3VOTA 4HEA1 4P6VF 2HYDA 3Q41A 2HOQA 2VHVA 4HWGA 4ZQFA 3ADCA 3CRMA 1QIJA 1XV5A 4AP9A 3GVIA 2VPZA 4H1VA 1GY8A 1BVUA 1CB7A 1ENOA 3H5VA 1XL0A 4J4BA 4G24A 4RXUA 3C8HA 4R1NA 2EW2A 5FNVB 5KINB 1Z56C 1R5NA 2P0AA 2PUTA 2VDKB 3BFVA 1PHPA 1U0HC 2Q29A 2WKPA 3IH5A 4MPRA 3UMBA 4F2WA 1E98A 1YIAA 3FCCA 3SR4A 3PZBA 1KFCB 3C3AA 4Q05A 4E1BA 2C9OA 1QHXA 4YRBA 2PD4A 3PUKA 3VKUA 3Q3JB 2ILTA 1NXOA 1GYQA 5AVKA 2BUAA 4UOZA 1Q2XA 1OBCA 4C3OB 4L22A 3DFKA 1G3RA 3A2MA 2Q8QA 2R7NA 1LDNA 2BLNA 2FLVA 2Q5QA 3G0IA 4H77A 4MUYA 4Z4HA 1GKKA 1OI7A 2PS9A 4P7KA 4B7AA 4QQNA 1YL7A 5CFMA 4NICA 3CW8X 3IDOA 3G6WA 1X80B 4LYYA 2VYVA 3IP3A 4GM0A 4N5DA 4OO3A 5LN1A 4JBHA 1EAYA 4HOYA 3JY6A 1I3NA 2E87A 1SBYA 1U3DA 5C8YA 3LQYA 1IZ7A 1G5HA 5EJIA 2FPMA 1EMDA 1Y37A 2GZ2A 1Z75A 1BX1A 1KHTA 2CW5A 3W4IA 3I6BA 4C4ZA 4WNAB 3IVRA 3ETGA 3VNQA 5AD1A 2NO9A 2ODEA 4IF4A 1KNXA 3SQWA 3KOUA 4C06A 3DW1X 3MTAA 1MLDA 4EKIA 3WLLA 4ZIRB 5TPWB 3V1YA 4NYMR 5L40A 2XVXA 4AJJA 1G8PA 1UIRA 3KQTA 4WT7A 3S1AA 4LNUB 2NUTA 5KBYA 4PZ0A 1SU4A 2RGUA 2C4HA 2PQMA 2W6ID 3BE5A 6ABPA 4LY9A 4WXHA 4D25A 3G89A 4MV0A 2HEIA 2GHTA 4GI7A 3FMVA 4YV7A 1L8QA 2J0EA 3DTTA 2QQGA 2B2CA 4P58A 1P75A 4HATA 1FIUA 1UAAA 5HQJA 5WRFA 1AUXA 2WAOA 1RWNA 2I4MA 3AW8A 4I50A 2A35A 4C0LA 4CNQA 1GGKA 1AX9A 4BQPA 3EPKA 5SYMA 3SHVA 3OSUA 3VKGA 2V97A 4H0NA 5H80A 3FMPB 5JS8A 1YCHA 4ZOLA 1PL6A 2W70A 2J48A 1P2DA 1VHQA 3HXPA 3M34A 4GHWA 5G41A 2AJLI 2C2WA 4YAOA 1SAYA 5HPYB 3HK2A 3PA8A 4G0YA 3FW1A 1SOAA 3IHKA 3HM2A 3UPUA 2XXAA 5ESDA 2E89A 1GZSA 1BIFA 1UDAA 4B7ZA 4DDMA 1U0BB 5JCXA 3L5OA 1U7XA 3BULA 5CGQB 2HUPA 5FUWA 2IV2X 3TRDA 3A4LA 1XVAA 5EMJA 4FFWA 4M7RA 1VHLA 1Z07A 1G9SA 3QSYA 1W5SA 2NACA 3C6KA 3GRUA 4ZQBA 4G5QA 1WDKA 2GAFA 1N8SA 2UXBB 5LNK1 1D6JA 3FNQA 4XZ3A 4D6XA 2EZ9A 4LRXA 2FLWA 4N9QA 4OY3A 3UMYA 5AT1A 2PJDA 2Y99A 2JCSA 1DWPA 1Z0IA 4J9UE 2UVPA 3DBHA 3QI2A 5HBRA 1DT5A 2Y0EA 4GAEA 3VR2A 1LJ8A 1DCMA 2HF7A 2AJBA 2WHXA 3OI7A 2X5KO 1XRLA 4I99A 4PYQA 3SXJA 4D79A 1B23P 5ECGC 5BN5A 4YJ3A 5AFSA 1BQ3A 2FMXA 2Y4NA 1VB3A 4K6KA 4GMDA 4WN3A 5BN1A 4BNDA 2XNSA 1EGMB 3ZXSA 4TLMB 5C52B 4XFJA 4ZAZA 3W2GA 2GEJA 2X0DA 4JVSB 5AKHA 2RCYA 2O48X 4RGYA 4D4LA 3T0FA 2FFAA 3KZNA 3WGTA 2LV8A 4C7OA 3O1IC 3C24A 1ZP6A 2FPLA 1Z2NX 4Z3KA 5IULC 2JGDB 2I7CA 4K28A 1ML3A 1PEDA 2BFPA 2X13A 3ITDA 4TN1A 3GGJA 3LHDA 3FLBA 1HTBA 1EP2B 2FPUA 1Y7PA 4KR2A 3M1IA 3QOWA 5JBNA 1SBQA 1IAVA 2D5CA 4B33A 4ZQCB 4C4XA 3L40A 2B21A 1GUAA 2ZIEA 3F4LA 3IQZA 5DXJA 4FDUA 1W1IA 1W87A 2HB6A 5JNTA 3N2GA 7ABPA 2ST1A 2BEWA 2A92A 3FKQA 3LO5A 4KMOA 3JW8A 1K8ZB 3KKOA 3G59A 4ND5A 1AKUA 1DIHA 3UHPA 4EPYA 3SHWA 1RWBA 1Q17A 3RAPR 3SYLA 3T34A 2J8ZA 3L0OA 3QXCA 5C4GB 5E6RB 2QTWB 2QTBA 3JALA 5CTJA 3ECAA 5C1OA 3OQNA 1ZESA 4JHXA 2KSQA 3MOGA 4C30A 4V38A 1GFWA 4ZMSA 5EIHA 1ESNA 1GEGA 2X7HA 3DGFC 2YUIA 3EULA 4IZ6A 5JXWA 3MUEA 1A77A 2VAXA 1HOTA 2FXVA 3KB2A 5AJHA 4NS1A 5GV8A 3W34A 1HBJA 2BMJA 3KELA 3UHJA 3OPYA 4EBFA 4XWYA 5J2TA 1QTRA 3BIJA 1IVSA 1JG1A 3DB2A 1WCWA 3OM0A 4IJQA 3AETB 2IHTA 3OKAA 3IQEA 4S24A 1VLQA 1L7RA 4CM9D 3DZIA 3CG4A 1HG1A 1Z28A 3QKRA 3X2EA 4NMWA 2JH3A 3CSUA 3TNFA 1E92A 1A5BB 1P31A 2G5GX 3JQ8A 4C20A 2XE7A 4GSYA 5JNRA 3RRBA 2WYOA 1RKBA 2R1TA 4NBTA 4YPOA 1Z62A 1F2TB 3O8NA 4DLZA 2ZAOA 4DV5B 3T6KA 4HFMA 4YIKA 2Q99A 1NT2A 4FFMA 1WMEA 4EW3A 1Z63A 1U8AA 1YL6A 2VKTA 3OQIB 1D2EA 2N46A 3FCOA 2AT1A 3WSVA 4D9FA 1O5OA 4R2WA 4D8VA 5KVSA 4F11A 2XUKA 2XCOA 3D43A 2CHEA 4YCDA 3LUCA 1RLUA 2DP4E 1PSDA 3G2QA 2JIBA 3LXMA 5I9SA 2H7CA 1E18A 3LU1A 3CNQS 4LYHA 5EWMB 3OLVA 1G20A 2E18A 1GGFA 2MYPA 4L6AA 4OBWA 2JIZD 3Q8MA 3IUBA 1YU6A 4BJ3A 5HW0A 3LWBA 2AN9A 5THXA 2IHYA 3QV2A 4HWOA 3TM5A 3MIZA 3A10A 3RNOA 5MFPA 2P9GA 4RK0A 5KMGA 4UDYX 3H83A 4DIUA 2GR9A 3LI2A 3VI4B 1ZL0A 1DAMA 3KX2A 4WNAA 2JGKA 4WAUA 2PA0A 4DILA 4DMHA 1GRNA 2QW1A 4XARA 4UPDA 5LOVA 4IYRA 3BF7A 2V6FA 2ZIZA 3LCVB 3OF5A 1Z39A 3ICEA 3P2YA 1NMYA 1EFKA 1UC5B 2O07A 3HKEB 3BCSA 4ZDKA 1SCJA 5IZCA 3LSTA 4CZ2A 3ZIDA 4EP1A 1OYYA 3V1KA 3D59A 1KYXA 4HYYA 3QOFA 4JUAA 3UOAB 3IVAA 3KVVA 1FUKA 1IWBB 3DYVA 4UHDA 5CVEA 4G56A 1MHPA 5CFRA 1ZVVA 1I6MA 3TVTA 1QTQA 3HWSA 4PLCA 4FMCB 1YKGA 2KBFA 4US0R 4XCXA 5JFOA 4PZYA 2QF7A 3NHBA 3AFIA 5KTKA 4ZCQA 4AJ4A 5DX8A 2JANA 2TRSB 4UKDA 3E70C 2JA2A 4AJIA 4BN0A 1R0XA 1HE2A 2X4IA 1OAOA 1SHTX 4B3MB 1PWZA 2VBGA 3F71A 3LTEA 4H7PA 1KYVA 2OXTA 4E6EA 2P7HA 2M1XA 3QE0A 3TWOA 3ZBQA 3KOZA 2H0RA 3YASA 3NG1A 1CQIB 3WE7A 3TKLA 3MS7A 1KK2A 3OLZA 1ZOIA 1TA0A 1IDN1 5D3MB 4G26A 3AVYA 1T6XA 4IFIA 4PG7A 1L5MA 3HO8A 1Q22A 4HLQB 1A7UA 3GFQA 1FFSA 2V6GA 1EGVB 1E0DA 4L4XA 1Q0ZA 3KZVA 5EINA 2OGZA 4Z7JA 1DCKA 4DJTA 3IIMA 2PUVA 2DFPA 3SFZA 1SUAA 3V7YA 5I5EA 2GJ8A 4UHCA 3UENA 3CKMA 3LPMA 2YY6A 3N8HA 3HHEA 2JAUA 4DG5A 2F62A 3OOHA 3VR4H 4DJ5X 1WCIB 4CKZA 1DEOA 1XRRA 1SBNE 1Q5PA 1BHO1 1P45A 2ZGVA 3EVNA 4QFMA 1JH9A 2H8KA 1FDUA 1YKFA 2BW0A 5DWVA 2P2NA 1HQDA 2OHGA 1L4YA 4HY3A 3EIHA 5J5CA 5JNWA 1THTA 1HE5A 3QBDA 3RCBA 4IQGA 4D56A 1TE2A 3WYNA 1QU3A 2X8LA 1KJZA 1ZKMA 2J7PD 4GEGA 2PGOA 2IU6A 5FTKA 4HNUA 2TS1A 3Q3GE 5EZ6B 4UM9B 3TEJA 3PT5A 4MZXA 5FWXB 3R6WA 1ILEA 3GAZA 1PR3A 1TLFA 1TLLA 4MRSA 3CW9A 4ABYA 3ZDDA 5A4KA 5GVSA 5LXTA 2G5PA 4TLBA 5ICEA 5GADl 3OJEA 3AVUA 4YP9A 1BYIA 1P2SA 3LQRA 3GAAA 3CX3A 3TNLA 2BH2A 2BFNA 4XCQA 3GR6A 4IIXA 2VXBA 4MMYB 1Z4PX 1RZUA 4DJAA 4MVJI 4G1UC 3K05A 2OYRA 3V34A 4PX5A 3BM5A 2E7ZA 2QW0X 1MJGA 2P2GA 4E5DA 3FSGA 4NQRA 3LRPA 3WJ2A 4BLQA 3PRKE 3N0VA 4DCPA 1H1TA 4CLRA 3TR6A 5B1HA 1FBNA 1OAKA 4CCWA 1E9RA 5B6JA 1Z5OA 2PPVA 3AJ8A 1C7IA 2AZXA 5K3FB 5EE1A 1Z0SA 5F3WB 2YASA 2FMIA 3ZW9A 3E7FA 5CDYA 3EEIA 1KEKA 3V3KA 3H9GA 3BMOB 3ZE8A 5IVKA 3HZRA 2G4CA 3JVUA 3QXXA 2EBUA 1DOAA 2IYZA 3PGMA 1UJ2A 2IU3A 3NLLA 4IV5A 4RS4A 3VNBA 1FMLA 1AGXA 1WD7A 4URZR 1A4UA 1NT4A 1L7EA 2DGDA 5GY7A 4WZAA 1ZFNA 3WADA 4HUJA 4PWZA 2UZAA 4L0QA 4OHOA 1M0TA 3F49S 3O84A 3PFKA 3H16A 2H4WA 4OJKA 5U4XA 3LDAA 3LCRA 3TUZC 3VXKA 3TRHA 3TD2A 1Y7HA 3N5KA 4Q93A 5G2OA 4D9NA 2ACKA 4CGZA 1LTKA 1VKNA 3LECA 1RABA 1XC7A 1ZU5A 4XYEA 4P0QB 4BUCA 2A9OA 2JNWA 1W4RA 5KNBD 1YHNA 1IVYA 3O92A 5AKZA 5DHPA 3TZLA 4NATA 1PGOA 3GMDA 1ZK4A 1F12A 1OYWA 3EN0A 3A4MA 2E37A 5EIWA 2P6NA 4C0KA 1L1EA 4DE5A 2PLAA 1OD6A 4FD3A 4FXPA 2JI6A 1OPRA 1OZFA 2BGJA 4JLVA 1RXIA 4KRGA 4YRZA 8ATCA 3TTWA 3O3CA 4Y9DA 3RQSA 1BTOA 3OP4A 1C1XB 1CX9B 5ARDA 3S27A 4ZGGA 1SURA 4B76A 5EGSA 3RI3A 2VPTA 3F73A 4LAFA 3NHFA 1L8LA 2AWNA 3PNYA 2FUNB 2NO4A 5FOSA 3SD7A 1V7QA 2C20A 4PV7A 4G1VA 1P1FA 3FPCA 2Q4RA 4LYDA 4DQUA 3WNZA 3NPAA 2B37A 3LDUA 3IR7A 1LS6A 4JOCA 3WQBA 3QLJA 2Z3VA 4F46A 1XTKA 3D8RA 4LJYA 1KOGA 4E7OA 1Y3BE 1G9TA 3VZQA 4AWXA 2XCLA 4F1KA 5BW4A 4QWWA 4M1EA 1HZJA 1DKQA 1T0JB 2ODQA 3U17A 4MWEA 2GJKA 1K8XB 2NVOA 4J0HA 1SKYE 2EJBA 3K0BA 1TD9A 2FSGA 4AJOA 4ZYXA 3RU2A 2Q2VA 1FLDA 1V5IA 2D4HA 4Q16A 1VGRA 5E4FA 5CDHA 2VRBA 4KI7A 4RK1A 2H48A 4URFA 4K8OA 4CN9A <