3CZCA

The crystal structure of a putative pts iib(ptxb) from streptococcus mutans
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
93
structure length
93
Chain Sequence
MVKVLTACGNGMGSSMVIKMKVENALRQLGVSDIESASCSVGEAKGLASNYDIVVASNHLIHELDGRTNGKLIGLDNLMDDNEIKTKLEEALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of phosphotransferase system enzymes PtxB (IIB(Asc)) and PtxA (IIA(Asc)) from Streptococcus mutans
pubmed doi rcsb
source organism Streptococcus mutans
molecule tags Transferase
molecule keywords RmpB
total genus 29
structure length 93
sequence length 93
ec nomenclature ec 2.7.1.69: Transferred entry: 2.7.1.191, 2.7.1.192, 2.7.1.193, 2.7.1.194, 2.7.1.195,
pdb deposition date 2008-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02302 PTS_IIB PTS system, Lactose/Cellobiose specific IIB subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3czcA00
1ZESA 4GPAA 1BVHA 3OQOA 1U04A 4PYRA 1BDIA 3Q7RA 1Z13A 1BAPA 1U0SY 3KCNA 4ZMSA 3GBPA 4JOQA 4LE2A 4RY9A 3F6PA 2FW0A 3JVIA 5TQ0A 4EVQA 1T34A 2IPNA 4ZMRA 2M1ZA 4XFKA 5CNIA 4OLAA 4RXUA 4WXMA 3N6VA 4TLLB 3CG0A 3GYBA 3LUHA 5BR1A 4HNSA 3LUFA 4OG2A 4F3TA 1Z12A 3H5TA 1SRRA 1YMVA 2RJOA 3LTEA 4YRZA 2QSJA 5TQ2A 4KV7A 4MLCA 3E3MA 8ABPA 2WWVD 1SXGA 1M5TA 2E4YA 3C3KA 1PEYA 3URMA 5GQSA 4XARA 2IDMA 3LUGA 1Z2EA 3DZDA 1RNLA 2M98A 5F64A 2QU7A 3QX9A 5EWMA 1GUDA 2L18A 1P2FA 2NZUG 3NHMA 1JX6A 3HJFA 5CHYA 1GUBA 2GWRA 3OLVA 4MR7A 2L17A 4RK1A 3KLOA 2WY2D 4LDAA 3OQMA 1LJLA 5FBKA 3LKVA 2ZWMA 4KMRA 1D2AA 4W5RA 4MQFA 3H5VA 4G0MA 2JBAB 1XWWA 3OO1A 3NNDA 4O1HA 1ZH4A 1NXTA 3EGCA 5JNRA 1VLZA 1MVOA 3HUUA 4M88A 4Z9BA 3TB6A 1USGA 4TMYA 5FBHA 3C6QA 3QX8A 1MB3A 3OM0A 1JLKA 5D2CA 4G0OA 4MS1A 3HV2A 3HVRA 1CYEA 4PICA 4KZKA 1USIA 5EWJA 5FWYA 1USKA 3FGZA 1ABFA 3KS9A 3QELB 3H1GA 4L4UA 4P1ZA 5CNMA 4F12A 3HK2A 1KRWA 4WT7A 5I4CA 5KQLA 1NTRA 2LBPA 1Z2DA 2H0AA 4XAQA 4N41A 3O1JC 4E7OA 1Z18A 3CTPA 3LUDA 3FFXA 4RXMA 1P8AA 3UK0A 4QYMA 1NATA 2FMFA 5JNWA 1JDPA 5CNKA 3KYJB 1B00A 4PZ0A 3FFWA 5TPWA 1L5YA 4ETMA 1JDNA 3L6UA 4MS1B 3EQZA 2MYPA 1ZITA 2R4QA 2PL9A 5IBQA 2YHBA 5FWYB 4ZJPA 1Y1LA 4RDCA 4Y9TA 4Z4EA 2AYZA 4RY0A 3DLBA 1RPJA 3H1FA 1Z16A 4JB2A 3ROTA 1QMPA 1RZRA 1CEYA 3OO0A 4LX8A 4W5OA 4G86A 4F8JA 3P9YA 4N0PA 1M2EA 1QKKA 3DGFC 4ZYLA 2PE5A 4Z4HA 2QV0A 2BGGA 4O5AA 4N0QA 4IRXA 3EAFA 1YS7A 1ISRA 4N47A 4EYQA 3JPYA 4Q6WA 2QR3A 4LZLA 2E4VA 4YV7A 4W5QA 2HJ9A 3O21A 1WETA 3JTEA 5IEBA 4KRFA 1MB0A 1YIOA 1YK1A 5KQGA 1DBPA 2X7XA 3CLKA 3HSYA 1RZRD 1BA2A 2FEKA 2IPLA 3EDCA 4CBVA 3RVKA 1E6MA 3UKJA 3GV0A 3B2NA 3H75A 4MS3A 1C0EA 2MSWA 4NCBA 2O20A 2NUBA 4JB0A 3S99A 1TVMA 4MAAA 1D5WA 2JVKA 1E2BA 1NY5A 3D8UA 1JFSA 3KYIB 3Q15C 1DC8A 1PNRA 2QVCA 3UUGA 4MPTA 1ZHHA 3H6GA 4F11A 3IP7A 1EWTA 1URPA 2VUHB 2GBPA 4MGEA 1DZ3A 3KLNA 5IUKC 4MLDA 2GX6A 1Z17A 1J56A 3QLUC 5IC5A 3H5OA 1JL3A 2FEWB 5IUNC 1FSPA 3T6KA 4MQEA 3I45A 4EUKA 1Z26A 3CNBA 3MMNA 4LDZA 1F4VA 3A0UA 4S04A 3G85A 6ABPA 4YP9A 3EULA 1U8TA 2L19A 2MYTA 4ML3A 3CKMA 2FN8A 1JWLA 5JNUA 1TM2A 4WUTA 1IIBA 5HKOA 4KNYA 2E4WA 1A2OA 4FB4A 2AYXA 2CHFA 4YR7A 2HQOA 4RU1A 1L5ZA 3H1EA 1W9HA 1D1QA 2FEPA 5KQPA 3A0RB 2NT4A 3BRQA 1VKRA 2ZAYA 5EWJB 3KHTA 5EWLA 2E4UA 2IPMA 3GBVA 4MR7B 2JCGA 2FQWA 5DTEA 3JPWA 1DBWA 3OLYA 4EVSA 5T3YA 3FFTA 3RVQA 3H5IA 1R8JA 3F7NA 3HM9A 2VUIB 4G0QA 3N0XA 1JYFA 3I09A 2LPMA 3KSMA 3RVSA 5DKFA 4ETNA 1AB5A 3O74A 3RVNA 2PAFA 4MR8A 1NXVA 4RZSA 4Z4IA 2F8TA 4MR9A 4KQ9A 3T95A 1SD5A 1GCGA 3QLVC 1FFSA 1SXHA 5C5CA 3GL9A 1EWKA 3HEBA 5TE9A 1P6UA 3O1IC 2FXIA 3OLWA 2ID7A 3NNSA 3G1WA 1LBIA 1TMYA 1OXBB 4RV5A 4ZPJA 2HSGA 4MS4A 3K9CA 1EWVA 3MA0A 1ZGGA 2MYNA 1UDRA 3QLTA 1VPWA 4G0XA 5TPZA 3VNBA 2PJUA 5B3JA 5BRJA 3HXMA 1YMUA 2HPHA 3O75A 4N03A 3QLUA 2QW1A 1LBHA 3O2SB 5FWXB 1I3CA 1JH9A 7ABPA 3BREA 1QQBA 4MR8B 3MYYA 2FQXA 3IPCA 4MR9B 5PNTA 3LMKA 2P9HA 1OXKB 2W42A 2PUAA 2JVJA 3A3KA 2LP4Y 3LKBA 2FMHA 4HNQA 2IPAB 4H60A 4NCAA 3CG4A 3MIZA 5TQ0B 4D6YA 3OM1A 4H3HB 5KC8A 1K68A 1K66A 3TX6A 1NXPA 4E7PA 2CD7A 1DCFA 2J48A 3Q7SA 2IYNA 3SY8A 3BILA 4FE7A 1DRJA 1JBEA 1A0OA 1HEYA 5TQ2B 1XHFA 2WJWA 4P98A 4QYWA 1Z15A 3H6HA 2FVYA 5HQJA 1DJMA 1LJUA 3N0RA 3OMXA 4G97A 4LE0A 1TJYA 3BRSA 4B09A 3DLHA 3N8IA 2IKSA 4IILA 1M5UA 3NHZA 1PEAA 1QO0D 1BDHA 3KG2A 4XLTA 4YWHA 2FLKA 1YTUA 3OMWA 2PUCA 4TN5A 4RKQA 4OTZA 5JS1A 2MSKA 4NQRA 3K4HA 4FE4A 3RVLA 3T38A 4IF4A 5BQ3A 4JP1A 1U2PA 2FQYA 1SXIA 2QXYA 2QZJA 4HYEA 1ZGZA 1QO0A 2RJNA 4LE1A 4YLEA 4MRMB 2PUFA 3IDOA 2DRIA 4OBBA 5JS2A 1PNTA 2XDYA 2PUEA 4RY8A 5JNSA 2JRLA 3CZ5A 3N0WA 2FLWA 4RKRA 3C3MA 2A9PA 4UHKA 3E61A 4D6XA 3O1HB 5IEJA 1JFVA 2R47A 4HNRA 4F06A 3SQNA 2PMCA 3W9SA 4ETIA 4G0ZA 4YGXB 1GCAA 1JYEA 2OENG 3LOPA 4EVRA 2B1JA 4YS6A 3GA5A 4RK0A 4JA2A 2GI4A 3C97A 3VNAA 2LUOA 2FSPA 4D74A 4DQDA 5IULC 1FFWA 3LUCA 5IX8A 1KRXA 5TPZD 5JNVA 3N53A 5BRAA 1C4WA 5ED4A 4MQEB 4OATA 4NICA 1DBQA 3IP6A 3OLXA 3HDVA 3QELA 1D1PA 1FFGA 4EYKA 1PHRA 3HUTA 4Z9AA 3HZHA 2FMIA 2A9QA 3ILYA 1DCKA 2JVIA 4WXEA 1DG9A 1P6QA 3EODA 2E4XA 2PLNA 3CU5A 4QPJC 4KK3A 4RXTA 2H3HA 2JB9A 3I42A 3LUKA 1MIHA 4Q7EA 1ZY2A 4MS4B 1DRKA 2NZVG 9ABPA 2E4ZA 2JK1A 3OLZA 4DN6A 5FWXA 5TQJA 2VK2A 2TMYA 4KREA 3NBMA 3T8YA 4EYGA 4NV3A 4G0YA 4JASB 1JHZA 3FDFA 2FN9A 5T7BA 4TLMB 2MYUA 3CS3A 3HDGA 4H3KB 4Z4GA 4YO7A 2WRZA 2R48A 3QEKA 4PE5B 2A9RA 3CFYA 3QEMA 5KQMA 4OLBA 4Z4FA 2F8SA 2P4UA 1ZH2A 1M2FA 2YHAA 4UHJA 1E6LA 3HCWA 3MQ4A 5ABPA 2PUBA 3D02A 3JVDA 3BBLA 3NNNA 1KMIY 3MM4A 1JF8A 5JNTA 3CZCA 5EWMB 3H5LA 3KJXA 1ZAYA 3R0JA 1EAYA 3F6CA 2CWDA 4Z0NA 1ISSA 4MYRA 3RQIA 5HM6A 4PEVA 4YCSA 1ZN2A 5B3JC 1XHEA 1EFAA 3TO5A 4IMJB 2N9UA 1BDJA 3KTOA 3Q9SA 1GLGA 4KQCA 4Z99A 3QEMB 3TD9A 4W5NA 1VRVA 1DP4A 2KYRA 3GWGA 4MQFB 1FQWA 2LIVA 3GRCA 3F73A 2JBAA 4WWHA 2IOYA 4EY3A 3DGEC 2NT3A 3TMYA 4WZZA 1QQAA 2QVGA 4L85A 1ABEA 3RVRA 3C3WA 4Q6BA 5IUJC 4S05A 2B4AA 2ID9A 4EGSA 1QP4A 1Z25A 1DCMA 1U2QA 3ROFA 4RK6A 4MRMA 4RWEA 3QK7A 4KPYA 2R25B 1YS6A 1QPZA 3GT7A 3SAJA 5KI6A 5GOTA 3LUAA 1QNLA 4JAVC 3CHYA 4IMIB 2L2QA 3M9XA 1S8NA 1RXEA 2PUGA 2A9OA 4LRQA 2VYCA 4RK7A 1MAVA 3H5WA 2GKGA 3Q41A 3RVOA 5DGCA 1JFTA 2RGYA 5CNJA 1YVUA 2CHEA 3L49A 5KWSA 1QP7A 5EWLB 2WJAA 3Q7TA 4KK4A 5TPWB 4KVFA 2FMKA 4Z4CA 4IGAA 5C5EA 1KGSA 3HS3A 4RS3A 3JY6A 1DC7A 3LFTA 4O1IA 1NXXA 3RVMA 2HQBA 4W5TA 1LK0A 3SG0A 3O2JA 2FKAA 3IP5A 4G0PA 4RK4A 3SM9A 6CHYA 1QP0A 1AB6A 1F51E 5HSGA 3OQNA 3N75A 3HO1A 1W25A 3EJWA 3QLVA 3RVJA 3ILHA 5DCLA 3IPAA 2V0NA 1APBA 1EHCA 3MF4A 1H9CA 1ZDMA 4RK5A 3KKEA 4QICA 1NXWA 4EYOA 1NXOA 4KFCA 3DBIA 3A10A 2PL1A 2OQRA 3IP9A 3RH0A 2WB4A 4N76A 3JS5A 4RSMA 4DADA 2PKXA 3FMVA 1CHNA 1D4ZA 2I6FA 1E6KA 2MSLA 3SNKA 4XXHA 3RVPA 2Q5CA 2RDMA 3O2QB 5DLEA 1PUXA 1RXIA 3LUJA 1ZVVA 2PUDA 1YK0A 3M6MD 1A04A 2WMYA 1TLFA 4MS3B 2FTKE 4GNRA 5E3JA 2HQRA 3CRNA 3EQ2A 3I5AA 3M9WA 5KC9A 4XASA 1NXSA
chains in the Genus database with same CATH superfamily
1VL8A 3BBPA 2ZBGA 1U04A 2HKIA 2X8JB 1EDOA 4DLSA 3S0JA 4DCUA 2PSHA 1D0SA 1YQEA 5ALJA 1QLJA 1K75A 4LE2A 4N8SA 1CUXA 1FF9A 1IHXA 2MTBA 2MR5A 1F2UA 2WP0A 3ZK7A 3N6VA 4IJVA 2AUMA 4UREA 4WKPA 4WVLA 1T6BY 4EG8A 5BR1A 3A1FA 3I3SR 4QFCA 3NYIA 1MV8A 4S1PA 1SRRA 3PGLA 1QGOA 2ID8A 1SCIA 3R9KA 1OBVA 2WD8A 2OBFA 3USES 4BP8A 4H7PA 4V1CI 3O91A 1DADA 4N9WA 3QFTA 4CG2A 3HJTA 4OHOA 2A9FA 4HPXB 4BZWA 4Q3CA 1ESEA 1ZP6A 4QU8A 3KOMA 4H1VA 5FA6A 4HNAA 2H1WA 5F7OA 3R7WB 1CZUA 3TQSA 4E5DA 5TSDA 3I0NA 3X1MA 2QU7A 5K8LA 5TXGA 3IE1A 5K4HA 4AU1A 2BGRA 5AYVA 3SIXA 4Z7NB 2CLSA 2SCUB 2MOKA 3DE5X 4HAYA 4ILKA 3UMRA 4QQKA 5E4FA 3H17A 1KY3A 4HQKA 1KC3A 2RMKA 5EVCA 2UV8A 4KODA 2W43A 3GVIA 4K9OA 2V03A 3DB1A 5AHWA 4QVKA 5FT9A 4MV8A 3VU0A 4YCMA 2ZIXA 2AZXA 3KOXA 3OI7A 4JI2B 3MJEA 1LSOA 3LKVA 2XITA 3AW9A 1SBNE 3WJ1A 1U7TA 1D2AA 4M0FA 1FBTA 5J2UF 2O59A 4C2TA 3LHSA 5AVYA 1JP7A 2WF6A 4FKZA 1MJNA 4ZYWA 4FC7A 1NP6A 3D6FA 5U1PA 4X62B 3U44A 1M0EA 2I8CA 2Q3DA 4J7XA 2FUEA 5DF1A 2QWXA 3K0FA 5A3SA 5IF9A 1YNOA 3H2JA 3T0GA 1M1XB 3ZWWA 4M88A 2YN0A 3CWQA 3HMQA 5AJTA 3RYTC 1ZNXA 3JZFA 1GO2A 3SZLA 4E11A 3EWSA 3F4KA 3O90A 4LHZA 3THRA 3U4AA 3J7AC 2D0IA 2PBFA 5DHUA 4CFZA 1Q84A 1DKNA 4BU1A 1FU7A 3OCCA 2GD2A 1GQQA 3OT4A 2GLXA 4OUDB 3AR6A 4R9VA 3FZQA 3L6CA 1H8HA 1GXSA 3N2LA 4Y1FA 3TQOA 4G8CA 1ABFA 4P1ZA 4F12A 1WW2A 3AFNA 2PZEA 1NMYA 4CCSA 3W9UA 2NSYA 2VQ3A 1Z2DA 3BE8A 2RHDA 1QX4A 1Z3IX 4TLAA 2D00A 2PFGA 1U2SA 2CCKA 1IULA 2GA8A 4OGFA 4ZYTA 3A2MA 3MTIA 4YUXA 2GN9A 2NO6A 1JDPA 3A4MA 1IBCA 221PA 13PKA 2IXDA 2PK3A 3HMKA 4QEDA 2RD2A 1XCJA 4AJ1A 1SXJA 5TPWA 1L5YA 1YT5A 2H2HA 1VSBA 2QVZX 3B8HA 5DEIA 4RY2A 2OBBA 1BX0A 2AI2A 1II9A 4Z5XA 2YHBA 3EA0A 2Q3CA 4BECA 4FYXA 4GUDA 1KY5A 4HN4B 5UKDA 4YT2A 3L7CA 4FT4A 1JLRA 3K5WA 3M8KA 4OXQA 4EZEA 1SXJE 4QXQA 2BH2A 1R16A 3OO0A 4QPCA 5IT0A 1G38A 2DR3A 4K3VA 4LRWA 1V95A 2OB2A 1YB7A 4FJ1A 5JYCA 4GMDA 3G6WA 2ZWAA 1OSNA 4BV2A 3BKWA 1AA9A 2X8JA 3ADCA 4B73A 5B7NA 4N9QA 2BZ0A 4DV2B 4LZNA 3COZA 3AHJA 821PA 2JFUA 3ZI7A 1H2EA 1F60A 3R44A 2WWWA 2YWBA 2NYVA 3HKDA 3IXLA 3O21A 3P4UA 3RV4A 5IAAA 4GP9A 1SZJG 2A78A 3T7TA 4DREA 4MRSA 2OO5C 3L05A 3OFSA 2VUUA 1AU9A 1G8SA 2X7XA 2QF7A 5TR9A 2O06A 3WV5A 3IAHA 3RLFA 2PBZA 5J23A 4YV0A 3RRZA 4RTNA 1EK0A 4U7FA 3SZOA 1NC1A 1Q7BA 2NVWA 3U37A 4L2IA 3SC2A 1DAIA 4KYVA 4PX5A 4R1NA 3S99A 5AVVA 4DCJA 4PLGA 1XUOA 1B0AA 3LNTA 2DAPA 3FCAA 5EFOA 3QW2A 1E69A 4M55A 5KNLA 3UKOA 1I1HA 3WP1B 1Y7TA 4CU5A 4R0NA 3FDZB 3UUGA 3IQIX 4MPTA 2HJGA 4F96A 5CFZA 2OAQ1 3H6GA 4GEKA 4NYJQ 1P4AA 4UDOA 4WOJA 4B3SB 3JW8A 3OSZA 1CRQA 3VRHA 1Y1SA 3F6BX 4RZQA 4IDNA 1GZ6A 2ALJA 1UBGA 1Z17A 4DCNA 4D9IA 2BZSA 1V8BA 4GOXA 2X3UA 5GVRA 1ZH8A 2P68A 4UFPA 3A4NA 1H4TA 3ZDEA 3QG5A 5I48A 2JFPA 4CM9A 2OOSA 3DTTA 4NV0A 5IG2A 1RJDA 1E4EB 2YIVX 4KDFA 1JKXA 4RM3A 5JU6A 1U8FO 3A6GA 4ODIA 3M70A 1N2SA 1MO6A 1D04A 4YAWA 4JGGA 4EW2A 4YR7A 4W8GA 1O5TA 3ZIDA 2H18A 4X90A 5BWLA 1SA0A 3CSSA 1JDTA 1TK2A 1POXA 2FXVA 4CL3A 2DPXA 1JJAA 3DV0A 4PZZA 2G6TA 5F2KA 3T5CA 4D0NA 4J1TC 4IV5A 1XTZA 4X41A 1T5HX 5G0UA 3ZHRA 1K4KA 2QTBA 3UHJA 1LZLA 4XEUA 3VPAA 4G5HA 1QFZA 2QUJA 3BZWA 4HDMA 4BQEA 3WVNA 2V8OA 1ZI6A 1OBOA 1Z0UA 2XE7A 2WTNA 3E9EA 3OIWA 1SJ9A 3TINA 3L84A 3SR0A 2R6JA 5E6UA 4IBOA 3O47A 3EZFA 4OB7A 1FDUA 4HBGA 4IOJA 1ZL2A 3HYTA 3VTFA 3N2IA 4GMKA 3HJGA 1ICEA 2PS1A 2Q3BA 3A14A 2GM3A 2V7VA 4JLBA 2IDJA 3QLVC 4A2CA 3EA5A 1E1LA 2RARA 4WZAA 2Q6LA 2KWIA 1XEFA 4RVNA 3R8XA 1TD9A 1ZJYA 2C7GA 1OILA 2HK9A 2M2IA 3TR0A 1EPUA 3W4KA 4CKCA 1VG8A 1W581 4H3VA 1GPMA 4Q4JB 3DDCA 3VH2A 1P1HA 2VFAA 1UINA 5EE5B 4E1BA 4RV9A 3DT9A 5D3QA 3WGOA 1EK5A 1JEEA 1Q92A 1SMKA 1P1KA 2F1IA 4LI3X 4HTFA 4BMCA 4B76A 3P27A 3ZH9B 3A37A 5KEIA 1TF5A 1L8OA 2OUIA 5CB8A 3TIFA 2EJWA 3RG8A 1XLWA 1BMTA 4B8WA 3F6RA 1UKYA 1W29A 1Q3HA 1CJBA 1UR5A 4GU5A 2OLJA 3C43A 1YI0A 2B36A 4IEEA 4XFJA 1P5HA 1KDPA 2O0LA 1W48A 4I9FA 3JQFA 5EQJB 3S2ZA 3UM9A 4IWXA 1NJFA 3LKBA 2IYQA 5JCJA 1AX9A 3RUIA 4WX2B 5I8WA 1WO8A 1NUPA 5KSYA 3REQA 3VSDA 2ZIUB 3DLPX 3RFFA 2IS6A 4CPDA 2HTEA 3SY8A 4KTTE 3WL8A 1YJ8A 3H8VA 4M8KA 4DFDA 1MABA 2GLUA 3N2GA 1XHFA 3KFLA 4TV9B 2IHBA 4F3NA 4JL5A 2AG0A 2HI0A 3SC2B 4G97A 1TJYA 4XUCA 3V1UA 2IHVA 4HLCA 4OQMA 4L07A 3VR4A 1X1EA 1LCIA 3KT8A 5KSWB 2WJYA 3VBEA 3C6YA 2CYAA 4XLTA 5BV8A 5HQTA 5HP4A 4UUMA 5CW2A 1HYEA 4ROTA 4G1VA 4PSVA 1M10A 3HN7A 3QIAA 5IFKA 1C0LA 1ZKMA 5DLYA 4NPHA 4MV9A 3TL3A 3F4LA 2O6LA 3M6LA 4IHJB 3ZX4A 4ENQA 3W04A 3NLLA 1Y81A 3EEQA 3H9JA 2PMEA 3V80A 1YU6A 3N70A 3R6DA 1W4ZA 3MGGA 1VLLA 4ZICA 5KOYA 4B3BA 1SUFA 4FMCB 2R0QC 3FGOA 3AGQA 2XYRA 4M8LA 4Y9UA 4OQYA 3H11B 3ZQ6A 2X0DA 2DKFA 3GAZA 1DKOA 1LTQA 1W36C 3BSFA 1VPEA 3ROMA 1CWUA 1U0FA 4RWZA 2I5PO 3RFTA 3RHTA 3FOZA 3DXXA 1DPFA 2P2YA 5C0OE 1GCAA 1WMFA 4HFNA 1GUAA 3NPMA 3OBBA 2IGTA 1IN8A 2GCIA 3AUUA 3ITNA 1USWA 4EJMA 3GA5A 4PYIA 3FHCB 4NBRA 3T3MB 1TZJA 2WI8A 1HV8A 4YH1A 1UK6A 2FHSA 4XDZA 5FL3A 5FRDA 2BELA 1MJFA 2KI5A 1VQ1A 1N6PA 3A25A 1OI7A 1JIUA 2CZCA 1C3OB 3AY7A 3LGSA 1LF0A 3OCVA 2Q5LA 1CIPA 4P4GA 4W82A 3ZNNA 3ZWKA 5BRAA 4NICA 4CM5A 3IP6A 3K9HA 4G0VA 2XRYA 2JEZA 3HYCA 4IJQA 3TW0A 1JEOA 1U7ZA 3BWVA 2GPJA 2JD0A 1FMFA 1Z5WA 3OHPA 3UBTA 2V74B 5T8KC 4ZMBA 4LCBA 5AK4A 3ZGNA 1GCUA 1T26A 4HQNA 1AO0A 4MRNA 3C85A 2ZPTX 3CU5A 3PUXA 1SN7A 3K1JA 2BTOA 3HXKA 4JU8A 2P11A 4RYDA 1ZCZA 4ZO7A 1BRTA 2JGEA 1YCDA 1A9TA 4DBLE 2WZBA 3ABQB 4GXNA 3IAXA 3P20A 4TWRA 3VOTA 3CH6A 1VLQA 2GT1A 5EEGA 5K3AA 5CVEA 1G8GA 1QQ5A 4G5SA 4RGYA 4ASUA 2O2IA 3IUMA 4O8CA 5AKEA 2BKVA 4EHBA 1EWYA 2GO1A 3PNYA 3I9MA 4RD4A 5CGZA 1P2SA 2YYYA 2DERA 1EVEA 1E3MA 1R66A 4GW3A 4A5OA 1VE1A 2C83A 4CF5A 4U02A 3PTAA 3D8NA 3RQSA 4JX8A 3T5GA 2W58A 3WL3A 1RXVA 1DAGA 4CMBA 2B94A 2Z3VA 2EG5A 2VJMA 2BGLA 2GS9A 2ZB8A 5DV9A 3CFYA 4ZV4A 2DR2A 3N7UA 1HBJA 4QFMA 1FLDA 2GN0A 3MJVA 4UHCA 1L0BA 3AVUA 4OQFA 1JQAA 4G0WA 1KQNA 3GDHA 3H0EA 3KRTA 2F1OA 3HCWA 4EAAA 4B6PA 1I3OA 4O08A 3AZQA 4EO9A 5ABPA 1SQSA 3KZOA 2XT0A 4WZBA 1M1YE 2IHZA 5BOSB 2DWPA 2ZI7A 3CR8A 3CZCA 2L69A 4WXPA 4C6TA 3G8CA 5KCMA 3ZKWA 1EFPB 1CRLA 2PYIA 2BTQB 2FZVA 5KYVA 3RK1A 1NAHA 4L73A 2CJPA 5KREA 4WD3A 4OHKA 3TLGB 5LMNB 4TS9A 3NAGA 1T5DX 4TQAA 4RTLA 2Q4TA 5ESRA 2OHVA 1S4MA 1Y6RA 2BCEA 2VAVA 3QWHA 5H4GA 4R83A 1DP4A 2KYRA 4RTQA 2QG6A 3B1YA 3OWXA 4F97A 1MMFB 3GRCA 4DCCA 1E2HA 1X70A 3AEUB 4NYIR 4CNQA 3H7IA 3A8TA 2FSVA 3F6YA 3IUSA 4L85A 4B4OA 4U7GA 4DIDA 1DTSA 4GQIA 3C6KA 1Z56C 4DS3A 2CXTA 2GILA 3EC1A 3QYJA 1UQUA 4AO8A 2ZRKA 1K8QA 3GH1A 1U2QA 1VHQA 2C9ZA 4CIDA 1Z6YA 5L3VA 3TFWA 1E1MA 3LFUA 2PLRA 1EUCB 4MWEA 4Z4QA 2IDKA 2YNMA 1BE1A 3E23A 1R6AA 3ETJA 4PG4A 5F51A 5T4BA 5BMVA 5JQWA 5DHRA 4B3IA 1X7YB 2SECE 4LA4A 5D00A 1S8NA 4I4NA 5HGJA 2AZDA 5PGMA 4RPCA 3Q8KA 1JT2A 4D3SA 2APJA 4CM1A 2R6R1 4JB3A 2JEOA 3CX4A 1KFEB 2F48A 2ZBEA 4OQ4A 1BMDA 1DOHA 1M8KA 3P0FA 4FLEA 4RTPA 3KAKA 2AMJA 1P0MA 4XLZA 4ZVMA 1T1RA 1Y98A 3FXAA 4WCFB 4MRAA 1I1QB 3IB3A 4HPJB 4RFSB 2ZM6B 4N0MA 2P7HA 4OA8A 4LFAB 3ZY6A 2H85A 1Y89A 3CYFA 3QNMA 3WV4A 1J06A 2QYHA 2OCKA 4RANA 5EY5B 4AX4A 5L51A 3GLHA 4O4LB 3TUIC 1Q3KA 4HD8A 3A04A 3OQJA 3GNSA 3EEFA 1VLJA 1KO7A 5TGTA 1ZISA 3AKZA 1DUSA 3RRXA 3MSCA 1Y63A 3CKLA 2DTXA 1RJ9B 2C9CA 4PSCA 1PEDA 2LWIA 1WKCA 2G0TA 2J33A 1AB6A 2J3EA 2Y0BA 4TTSA 5BW8A 4RL4A 4DMGA 1LSUA 5IXSA 4NYMR 1IOLA 3OCXA 1MX5A 2V6JA 3UANA 3G7UA 2ILTA 1J23A 2XUIA 1KMNA 3KTAA 5DM2A 3KXDA 4PZPA 3KKEA 3WXBA 4G89A 4M0KA 3ZYZA 3VISA 3OIVA 1OX4B 2FI1A 3SBDA 1GYQA 4TXMA 1TGYA 4X3CA 3FNEA 5GM2A 4OHYA 3T7JA 3OFJA 5ESXA 5H68A 4MHOA 1DT5A 1HZJA 3DOEA 3OEEA 5AMXA 2IZ1A 3SCZA 5JNLA 5LNK1 4CQNA 1YACA 2I6FA 2CNWA 3ZTTA 3OJOA 4IOKA 3I5UA 2A0UA 1A2QA 2VHXA 4X85A 3SX0A 3A11A 4EB6A 5DLEA 5BVHA 5IT4A 4D4JA 2AXPA 5BWOA 5LMUB 4GS5A 1JLLA 3R8FA 3VNUA 3MB5A 3WAKA 2QE7D 2FTKE 5KC9A 4FCCA 2HQRA 1TQHA 4JVMA 3RI3A 1FTNA 5B53A 1OREA 5JR3A 1U3GA 1NXSA 2F3SA 4UE6A 1U1DA 3HEAA 1RXWA 4X5OA 4FZJA 1X9IA 5BOSA 1PTJA 1RM5A 4H6WA 1R6VA 3GD7A 4N3AA 1UMDB 1PS8A 2PMFA 3WMFA 1A4XA 1V5EA 4AZ0B 4D9MA 1G5HA 2IFTA 1WR8A 2E48A 4YASA 1GGFA 2P78A 2C5HA 4Q7LA 1HUQA 4R1LA 3RYIB 3ER9A 2PVCA 1L4LA 4HNSA 4TXHA 4M3NA 3FN4A 4CHGA 3IQEA 4N7JA 2OILA 3BL8A 1NBMA 4LV5B 8ABPA 1I32A 4EZIA 2HU7A 4L9WA 1XZNA 4R51A 2PL5A 3UC5A 2ATIA 2DWUA 1JFFA 2WVJA 3DBHB 3GIWA 3M89A 4URZR 5FR1A 2DUMA 2MINB 2Q4EA 3WTBA 4DIUA 3D7NA 3T3GA 3DW3X 2BR3A 2VRCA 2PHZA 3JQAD 1K2WA 3N8GA 2C94A 1QO9A 4C3ZA 2YMQA 4KJXA 5DT9A 1JPVA 4P7GA 3GR6A 1QGZA 1QYWA 3QMVA 5ALEA 5IKOA 1KDYA 2I6SA 1ENOA 3BQ9A 1W76A 3BHJA 2FF5A 4ZAGA 1XK7A 3EMBA 3GPBA 2BJHA 4UM9B 1B42A 1D1SA 2CVFA 2IDZA 3WNCA 3FB4A 3LCMA 3OD1A 4TRRA 1JT9A 4DVGA 1P29A 1TA0A 3BMQB 4LDAA 5HKKD 1Q77A 3K31A 1CY0A 4Z7OB 4LQ4A 3E81A 3DPSA 3K1ZA 4X3PA 5TLSA 1HDZA 4YV1A 4H16A 4MCIA 5E6RB 1W4RA 3GOQA 2XZTA 3OZFA 3PTZA 5DP1A 2O1WA 2BE7A 3LYLA 2R84A 1T5OA 3QFSA 5ESWA 2NXWA 3T41A 1AM4D 3ZR4B 4X97A 3GLGE 1F17A 4HYQA 1B8UA 2WHXA 2W6CX 4O4HA 3STYA 1BX3A 4I9NA 4XE5A 1VLZA 3AXSA 4K28A 5HCUA 3G2HA 4UCXA 5EXSA 3KEMA 4KXWA 4HR7A 2VZEA 4LMPA 4GMHA 1J1IA 4BYGA 1B16A 4G5FA 3RKSA 2P69A 4TKLA 4GI7A 4UEQA 4NG5A 3S29A 4H6XA 4DHWA 2I4MA 1JHRA 3W3AA 4X93A 3ZE2B 2R00A 2W2LA 4Q39A 4ZO4A 3C45A 5AI6A 5AKKA 3TPFA 4ZTUB 1FP1D 3EXHC 3R7SA 2Q2OA 1EP1B 3KR2A 5I4CA 2BFDB 1IG0A 1R6UA 1ORVA 2XUHA 3WIEA 5HKLA 3WYNA 1SH7A 2P0YA 1Z18A 4D3DA 2TECE 4H0CA 4BRZA 4YQFA 3JWGA 3KTAB 4X20A 5BPFA 4ACAA 4C04A 2CVOA 1LZKA 1QS0B 3QUQA 1JDNA 6REQB 2FDCA 4ZAVA 5B2ZA 1G6KA 1OZHA 2C00A 2D62A 1M72A 1ZD8A 4RHXA 4DV3B 2R4QA 2PL9A 3HGTA 5IBQA 1H5UA 2FX3A 3OEHD 1L4UA 4JB2A 1FTSA 4E12A 2QJOA 3P9IA 4HEA6 4C4SA 1GITA 5EZYF 1NN3A 3HA3A 1A9SA 1V11B 2VTDA 3DZCA 3S2EA 3CLSD 3KEQA 1BEEA 5F4BA 3CH7A 1E66A 3RRJA 3R23A 3KV3O 4MYUA 5CU7A 1QHYA 1T4GA 2OESA 1VFPA 3A2LA 3M9LA 3MPUA 4LOLA 1JB1A 4IRXA 3RIYA 1CEXA 4Q9HA 1K3FA 4KXVA 1NZDA 4Q6WA 4DMCA 2FN3A 1K7YA 1BKDR 1L8QA 1U3UA 1KI3A 1GDHA 2IELA 5EVJA 3T4UA 1IEQA 5CT9A 2JGMA 3ROZA 2NYUA 4B3DA 4F04A 1IQRA 5J5CA 2YWEA 3EQ9A 5KTMA 1ADBA 4IOMA 5DU2A 3R7DA 3VYTB 3AYZB 3QBJA 1EFPA 4M0PA 5AHXA 2JFXA 3WGNA 2IPLA 5LXTA 4BCDA 1Q16A 1JQ3A 3CNLA 4RQAA 3SR3A 3VC3A 1EUQA 4BTLA 4TWJA 5AQEA 5BQFA 5JO0A 3T1YB 2XE6A 4RTJA 1JPUA 1DTWA 4AW9A 4DLKA 1NOKA 1PR6A 5LVAA 1T3LA 2HA5A 2KJQA 1D5WA 3OEHA 1XZFA 2VSXA 2FR8A 2GZAA 2GQ0A 3BM5A 3D8UA 3KWJA 3IR6A 2RK6A 4KQFA 5AXAA 2WKRA 3IXQA 2FFRA 5HX7A 1DXHA 3LHIA 1EBUA 2DSTA 3DEZA 1OUMA 1DKMA 3PQ4A 3CPSA 4CL0A 3RHFA 4DWJA 1ZCBA 3UVEA 5LZ9A 4DB4A 1R8QA 1DQSA 4MGEA 2QEQA 2PQ6A 1Q91A 1YVEI 5CG2A 3U4QA 1J56A 4FZ3A 3QG1A 1Q1QA 3KU4A 4P3KA 2JK0A 2QQFA 2AN3A 5A0FA 2IUFA 4A03A 4BE7B 2P91A 4UBLA 3VI4B 4DLLA 1ZJWA 2BFOA 2PBRA 3IMEA 4YP9A 3FOWA 2H3EA 3I6QA 1Z4PX 3DMRA 3BHMA 3FTFA 5C1OA 3OEED 2XNDA 3M6UA 4F2HA 5A1TA 5HKOA 2E4WA 1EXWA 2HC9A 4NCXA 4W7HA 4Y2XA 1QCZA 3DBRB 4LEIA 4EF4A 3ANNA 5IKMA 3K9BA 3N39C 4IPTA 4JFAA 4UUNA 1LY1A 5CDTA 2NT4A 3FM9A 4AWBA 4ZYZA 3UAYA 3KSZO 2KLHA 1XX6A 1WVGA 2V9ZA 1PGOA 3Q9LA 4PFJA 4UZSA 3VGJA 4COOA 4DDHA 1LC3A 3JPWA 2HCTA 1OFUA 3COSA 4JP5A 5DGIA 1H23A 4AO6A 4RJJA 3SGLA 3DDHA 1H0RA 4QX6A 2E85A 2A5LA 2PZKA 3MMZA 5FLYA 5AK0A 4HAZA 4ZOAA 5KHAA 1JYFA 3LCJA 1J2TA 5JFTA 4C0XA 3U44B 3I4CA 3EGVA 2FGJA 2WNSA 3O74A 4OJYA 1N7HA 1R4ZA 1JHAA 3CMMA 2WFAA 4WXRA 5K0SA 5C52B 1KZ4A 1WL8A 1E7RA 4G1MB 2GPWA 2K2WA 3NHSA 4GLFA 4ZEOA 4DLRA 1NIPA 3VAAA 1N2OA 1CR4A 4KDEA 3ZCXA 1EVYA 4I8XA 3TZEA 1WBBA 2OV1A 5HOEA 4ARCA 1HURA 4GFDA 1L6IA 1AHNA 4GGPA 4H31A 5BSTA 1OXXK 1XGKA 1MDFA 2VO1A 4X8OA 2EG9A 5E6SB 2AFHE 4XWTA 2QW1A 4OYYA 3LP8A 3O2SB 3HNPA 5DBOA 4X6UA 2PX8A 3FVVA 4MWGA 1A82A 3IHWA 7ABPA 2XOKD 1KK2A 4MR9B 5BPHA 5T4FA 3TOVA 3C16C 2V0GA 2Z08A 2XUAA 3EIXA 3FNFA 3IELA 4L4YA 4UHHA 5GADl 2EU8A 3D2AA 1E5LA 1GG5A 2V4MA 2A4KA 1DKQA 2AN5A 3L07A 1KU6A 3FOAA 1V3QE 4GM0A 3E3AA 3EHEA 1KYTA 4EMSA 1SBCA 3HCFA 4QBTA 1K68A 1GQOA 2NV0A 2XQKA 4JLMA 1ZSNA 3HXLA 1HQKA 4J16C 3D3WB 3VSAA 2G1PA 3I5XA 1MO5A 1D4FA 3TB4A 4IYJA 4EMBA 1I2CA 4UULA 5T6MA 4K1XA 4WOCA 4N6NA 3RYIA 1H2HA 1TCAA 3QBEA 2QX4A 5LPNA 2O6HA 3T1OA 1KY4A 1Z47A 4UQPA 1PFVA 2QAIA 4JD5A 1NYQA 4EQZA 1JHMA 1GNVA 1SBTA 4EY6A 2Y27A 3T5MA 2O50A 2RSLA 3DQZA 1UPAA 2WHYA 2QQ5A 4MA5A 1BDHA 3ZZTA 3JWIA 3RJZA 3LDAA 5I7WA 5K01A 2PIAA 2GESA 1TO2E 2IXFA 3BTOA 3G5LA 3GG2A 3ORFA 4UOEA 3IAFA 3HKDB 2WKWA 1WF6A 2R11A 1NBAA 1TZKA 3P5SA 1R7RA 4CQJA 3VOBA 4F5DA 3DFZA 1TFRA 3K4HA 3SXUA 2J0QA 4P53A 1R0ZA 4MDEA 3QOFA 2FQYA 2W70A 2ZYRA 3A6FA 3G89A 1YE3A 3SQMA 4BQSA 1NKSA 2I2WA 4JODA 5BW5A 4F72A 2I54A 1CZKA 3ZBUA 1K6MA 4MUJA 2C4MA 4LWOA 5CT8A 5IMSA 1H2AS 5KZMB 1HQDA 3H4IA 1MIOA 3GDGA 2E2WA 2VF7A 3AUAA 4LHSA 4UFNA 4ZOLA 3C3MA 4JSRA 4KRGA 5ALZA 3RWOA 3VJLA 4EGJA 1CNEA 1V3VA 3EXG2 4JUBA 2CDRA 1U0NA 2QD1A 3IURA 3ZXUB 4DNOA 4ETIA 1KL7A 2CNKA 4NEHB 2OENG 5C2JB 2J32A 4XVQA 3DMYA 3WL5A 2HL6A 3CCCA 1KKLA 3CNNA 1IN4A 4PINA 1SKMA 1CJMA 2HT6A 2LUOA 3CWCA 3VR6A 4V24A 1NIJA 3KVOA 1JMKC 3T5BA 1J9EA 3WLLA 4A8JB 4DV1B 4EWLA 2B7LA 2FPKA 2Y1DA 4A16A 2JIZD 4B9AA 2VP6A 4OATA 2BEWB 3WZ2A 3SR4A 5IDWA 1OFUX 1E2EA 2XHEA 4QRDA 2P40A 3QELA 1H69A 4YAUA 2V7QD 1FMCA 3MK31 1E4EA 3U3RA 3GFPA 4BPRA 2GOYA 3ILYA 1TT5A 3MUFA 3PUVA 4LHWA 4E03A 5LLDA 1D6NA 2CDBA 3LYUA 3NHJA 3QTTA 4LDPA 4UD6A 1F1BA 4XIYA 1SQ5A 4MMXB 5KYGA 3DNPA 4GOND 2XTJA 3K6KA 3OESA 1J2UA 2PG3A 2GJKA 4FBLA 4HQ0A 3I42A 4RIHA 2UXCB 3L1UA 1YZFA 5CD9A 4S1WA 2QG4A 4OAOA 4G6ZA 5K3EA 1CDDA 1RI1A 5G40A 1QMGA 2I62A 2JK1A 2HQ1A 2JH8A 1AXRA 2OQIA 2W4QA 3NANA 4MVJE 1KAEA 2ZETA 4CM6A 1JI3A 4QU5A 1HDXA 5TQJA 1KYXA 1A7JA 3IKVA 3M1AA 4FHEA 4G0YA 3T99A 2NU7B 4BMZA 3ILXA 1EBBA 1CIJA 4BV9A 1NA5A 3CS3A 1G3MA 1X13A 2YOGA 1AZWA 5FUBA 3W9BA 4YIHA 5CFRA 2A9KA 1GNQA 4RHTA 4PPQA 1VG1A 4PBRA 1WOYA 4R4JA 3Q3EA 3V3TA 4FDMA 1GGVA 5B7PA 4CGZA 2YHAA 4JGBA 2WKQA 4UHJA 2NAFA 3MQ4A 3U0VA 3GRZA 1OA0A 2DWOA 3PDJA 5H4HA 1UBTS 5HKAA 4FE3A 1Z2PX 4XWAA 2EYQA 1KMHB 4DUPA 2ZK7A 2XUKA 4E4TA 3LQ1A 2RGDA 3M1IA 5EWMB 3IDZA 1ZAYA 1ISGA 3Q8WA 3R0JA 1E18A 4J1NA 5F3RA 4A0GA 2QW0X 2FN4A 4EKEA 5FH9A 1TYDE 5H9WA 4ALJA 1GEEA 4LY3A 1EFAA 3LX5A 1TZCA 4ND1A 1IQ0A 2LRHA 2PJDA 4YJGB 2XF2A 3HDTA 4YRAA 2A8YA 2PWYA 3IHTA 2W8ZA 3I52A 2HUNA 3TMYA 5J59A 5F1OA 5A3QA 3ZWDA 4J3JA 2QVGA 4QXAA 2IHNA 3P1JA 3F96A 2SNIE 1Y37A 2GYWA 1A97A 2A5GA 2D2FA 1DCMA 3SJAA 3FCXA 4R1MA 2D3WA 1ZH6A 1L2TA 2IU3A 1OAAA 1JIJA 2YX1A 1OC4A 1RE1A 1ESCA 1YS6A 2NPIA 2R25B 2ZYUX 3DE7X 3CR7A 1Y7PA 3D4OA 3PIDA 3QLEA 3KPUA 3QSGA 4A8HA 3LUAA 4R1QA 4F2WA 1DAPA 2R85A 1KI6A 4IMIB 4P0QB 2XCSB 2P4HX 3A58B 4P3NA 2WEKA 3PHJA 4KDCA 2PUGA 2WSMA 4HV4A 2VC2B 3KJZA 3ZW7A 4Q4DA 3KB8A 2OLEA 4B3JA 3FKSD 4QBHA 2HPAA 1U9IC 2B61A 2F1JA 1MO2A 4PGFA 5FBLB 1FNMA 1MOZA 4QTXA 4W9MC 1JJBA 2OZEA 1EFDN 4D0LB 1ODSA 4L3WA 1LSSA 3FYUA 1WWKA 1CUSA 3PQ3A 3Q7TA 3J81A 4N01A 2WVAA 3LS2A 1YZKA 4Q7QA 3ADDA 3IA2A 1NF3A 2CXXA 1C9NA 4IGAA 2BEWA 3E9ZA 4W5JA 3JQDA 4P4SA 1JVBA 3D2CA 4MV6A 3MT0A 1OX6A 4K87A 4QJBA 2Q3JA 5AP9A 1UANA 1N8NA 3G8DA 3W90A 1JKIA 1QP0A 3I37X 1ECBA 2C5LA 3GAMA 4NU6A 3I6BA 1KJYA 2AHOA 3GRVA 4UBOA 1Y8AA 1RJWA 2B1IA 3EJWA 5ALWA 3C6BA 3G1TA 5FNVA 5IASA 4AS1A 1PZFA 3L7MA 3D3KA 4Q1CA 3K9FC 1AZTA 1APBA 2C7VA 3T1QA 4BRSA 1YQUA 3WA7A 1MORA 3SDBA 5G53C 2P5TB 3DBIA 5FTKA 3P4XA 3C0KA 3GN2A 1M8JA 1Z2CA 4EDHA 4YUYA 1SIWA 1P75A 1SAYA 1HF3A 2CHUA 3U4DA 3KL2A 4WCVA 3RUCA 1I36A 1CFJA 3HGMA 4LWPA 5BSMA 4ITVA 3CKYA 1NVKA 3L1VA 2XYPA 3O2QB 4OJTA 2P3LA 2IP2A 1E5VA 1H8ED 4YRKA 2D5CA 3K53A 4RH1A 1MW9X 4EX6A 2PR7A 4US0R 3IIJA 3DNFA 2IUTA 4FMDB 1GARA 2AZTA 4GLOA 5E7MA 3RGWS 1VKHA 3RU3A 2GZHA 2W4MA 4YJ2B 3AK4A 1IPEA 4U00A 4UNQA 4QDTA 2ASEA 2VI5A 4N8DA 1R4MB 4D3FA 4HNAB 4TTTS 1AQYA 1ZGHA 2RHGB 4GDFA 4AWXA 5JBIA 1T0PA 1J99A 3I2KA 2WIFA 5DYWA 3BSWA 1EX9A 2FW0A 1DKRA 4TOIA 3SJ7A 3I61A 1X2EA 3Q2OA 1UP6A 4IAOA 2FV8A 2VAMA 4TZKA 4CKZA 3R9XA 3OPMA 2AK2A 2JLBA 2P3QA 4OLAA 4UPDA 4Q3KA 5CJJA 3U17A 3BULA 1Y5LA 4DMHA 1BG6A 4YRZA 1R10A 2BTEA 1T5IA 5KMGB 4YJHB 4KV7A 2X5NA 3WFJA 1XLTA 1GSIA 4RQTA 1XROA 3V2IA 3ZDZB 4AIIA 5MGNA 5CH8A 4P0PB 1X0XA 2GZ1A 5GQSA 1N0VC 3VHQA 4ZKDA 4F2GA 4ZZ1A 2IZ6A 1R4AA 3G5AA 2ZSJA 3JWEA 3M6IA 5JSKA 1RC1A 1TVKA 1EK6A 3EPLA 4BFTA 1EP3B 3SQDA 2ID4A 2M98A 4HHEA 4I3HA 4FNOA 4G1EB 4BQQA 3LHFA 4Q1VA 1E59A 4RORA 2RGEA 2IU0A 1JDZA 1E2PA 2C2WA 3ENWA 1Q21A 2EFEB 1GUBA 3R20A 1ZOLA 3R3JA 3OQ1A 4TWIA 2J6CA 2D0OB 3EZ6A 3D4LA 3QYFA 4JCCA 4YC7A 1DS6A 4MWDA 5BSUA 3PI7A 6PFKA 2HWXA 4MDFA 3GFGA 4Q24A 1SBQA 2B35A 5HVNA 1E7YA 5DI3B 4OX9Y 3RBZA 2WIAA 1YQGA 1RM0A 1RD4A 3V5NA 1WCIB 1IHYA 2X0KA 2B1QA 2EZTA 3EGCA 3MJHA 4H4EA 4FMDF 4MUMA 4MA4A 4KR6A 3DE4X 3HXOA 4DW8A 3TB6A 4WNIA 3SJCA 5E4YA 1NZFA 3HJUA 4BBZA 2HGZA 1TYBE 2VLIA 5D2CA 1JLKA 2FGKA 4O2AF 2ZRIA 5EHNA 2RBGA 2YOFA 4FSHA 4E2ZA 1YZYA 4F4CA 3MTBA 3I28A 3T12A 1KMCA 1COWD 1UPXA 1QRSA 2PD6A 3QZUA 3FRHA 2YDXA 3HCPA 1ENYA 1JAZA 3BYZA 1RYZA 2ORED 3CGWA 4F38A 1P7PA 1ZR2A 1KI9A 1P17A 3ABIA 4BE4A 1W93A 1SVUA 1PJLA 2OWEA 4TM8A 4Q9JA 2WD9A 2OCLA 1M1NB 1DE0A 2VPTA 2B6NA 2YMMA 4XIGS 4WSOA 4YT8A 2EV9A 3F46A 4J0JA 2PX2A 2AYYA 4QBKA 3RARA 3RR2A 3W1EA 2OBYA 5JY1A 1R37A 3KJEA 3I9V6 1GTSA 3VU9A 3AVXA 1R8YA 5EQFA 4BV3A 2RCYA 1ESDA 3ZHZA 2ZJ5A 4JI1B 3WBKA 3GEDA 3HU5A 1VPTA 5JBQA 3P4YA 5NULA 4AUNA 3NC4A 3SFVA 3F6EX 4OUDA 4OK3A 1NQTA 2FPIA 2HU5A 3DOCA 3ZLJA 1RE0A 2JFWA 2RC5A 3UHPA 1RXYA 5ICCA 1K5DA 2JBHA 1P5JA 1RPJA 5ERYA 5FV4A 1ELOA 1RP1A 3F2IA 5EIBD 4BIIA 1Y42X 5H3HA 3BH7A 1NMQA 3HM2A 3BB3A 2FMXA 2NU6B 4TVOA 5DFAA 7GPBA 4KQ2A 3C3CA 1LK7A 1GPDG 2J67A 2OE2A 4ZYLA 4M8SA 2HMWA 5BO5A 3UC9A 1OBHA 3FLAA 3U4CA 1XT6A 1MEOA 3A1SA 4K9SA 1G5IA 1MENA 1WBJB 4FZRA 1P72A 1QQ6A 1CRWG 4NBUA 3C3DA 3OY2A 1P0CA 3RK4A 1ZJ5A 1BXGA 2CLHB 1WETA 2CXQA 4QRIA 4LSZA 1T9GS 2PKQP 3JQCA 3LF1A 2HCFA 1ZUNB 2B0JA 3DCNA 4KW7A 1U2DC 1ZM7A 3ANMA 3DTVB 1JQJC 4L7QA 3I0ZA 1C7RA 4NBKA 5FXMA 4ZC8A 5BQOA 5I8ZA 3FH0A 4F9FA 3B1VA 4DLZA 1IZ0A 1FNSA 2MSWA 5K6RA 5IN4A 3DO5A 2PS9A 3RV3A 5B6IA 1TVMA 2JVKA 5HIJA 1VIAA 1MV5A 1MEJA 2AJDA 2C1EA 3OA2A 2I6GA 4I99A 5AVJA 1YDHA 2VZLA 3Q0EA 4BJHB 2EWVA 4AT1A 4BNXA 4BEWA 3GP8A 3ID6C 4U3JB 2UKDA 3V48A 1W2WB 1ZOSA 2O48X 2JGLA 3L02A 1IEXA 2V3VA 3L06A 3FCUB 1URPA 3FPEA 3ODPA 4QODA 2ZQYA 5L4NA 4PW0A 2FZ5A 4JZYA 3WLIA 5AUOB 2VDNB 1YASA 4M8IA 4U5XA 4PIPA 5BSVA 2R1TB 1NNLA 1IN1A 1L5OA 5EUQB 3IOYA 2OLKA 4EMTA 4GMGA 3GNTA 4GX0A 3V7FA 4EMUA 1NLUA 1IY8A 2DZDA 1KOLA 5BN5B 2B5VA 2HXYA 3C3YA 5T5QA 2W90A 6ABPA 1Y8ZA 1G63A 1X7DA 2AS0A 2W2VA 5ECYA 4A0SA 2I67A 5LMZA 5F9FA 1DB3A 1EVQA 1YBHA 3L0ZA 4QLOA 4GLLA 4PHHA 2PUHA 3O7MA 4HDKB 4RVSA 4EFNA 1M9NA 3KT0A 4KNYA 1EFRA 2HY7A 3UMMA 3SX2A 2AYXA 3KJNA 3CUSA 4DBZA 3ZCRA 3SSMA 1GPKA 5EERA 4NECA 1I13A 4TVKA 3KZXA 1I0IA 4EJFA 2ZAYA 1IK4A 1H0HA 3GUZA 3SYTA 3TIXB 4KEAA 1B74A 4V1CA 4V38A 2JCGA 3ZN2A 1OWLA 3LP5A 2I3GA 3GRAA 4D9HA 4RGQA 1ADCA 4TXLA 1RRKA 4ATNA 3EW7A 4P5DA 5JAZA 4MH0R 4F5EA 2Z6UA 3Q7IA 4GF5A 1DAEA 4U2EA 3G0GA 2GASA 1Q7RA 3JZDA 4KGVA 1DJPA 3R5JA 3CM0A 4Z0HO 4ETNA 4IWNA 1AB5A 4LF7B 4IIYA 5FPSA 4AMYA 4M1YA 2PAFA 4D7AA 1WMDA 3SEZA 1GZ3A 3UEOA 4DJ5X 2CYCA 2RHCA 3DOHA 3W5VA 3NHAA 2FR8C 3FGNA 4LJ9A 4JXZA 3M1YA 5HDQA 4J2TA 1OJLA 4QJ3A 3NNSA 2WPDA 2R6HA 5CURA 1U3WA 4LVOA 1TUEA 2N46A 3MMPA 3ND9A 1EWVA 3BD8A 2I33A 2XMDA 4PVDA 4U2CA 3LVQE 1TVCA 2HF9A 1OBFO 1XZAA 2ERCA 4L5AA 4BIMA 1WUHS 4F85A 4Z8YA 3RS4A 5BRJA 4Q37A 3CJTA 3D3JA 1ST3A 2NXEA 3HA5A 3K8ZA 3DM5A 5LZ5A 3LQ2A 4DKJA 2ZRAA 3ED5A 4UHFA 2KHZA 1L7RA 4FZVA 5FADA 4HS9A 2B69A 3IDAA 4C4XA 3RFUA 1Z0ZA 1E3DA 2GTPA 4TM7A 2OBNA 4F0JA 5HIAA 5HRUA 5H5JA 3VSEA 4DLBA 4DSTA 1IPHA 3VKUA 3I1YA 4JT4A 4FR5A 3VFDA 4F4FA 4HNQA 1DEOA 2ECKA 4C6SA 3LY7A 1U11A 2FRXA 1BXGB 2UZ3A 3DVLA 1B6SA 1J8FA 3OM1A 4G9EA 2R66A 4GE3A 3EIHA 1O97C 5T4EA 4G2NA 4IXMA 4BN0A 1Q50A 1JEQB 1PJ2A 4DDMA 3TG8A 1XCGB 1T5LA 3W78A 3EXEB 4H1WA 3FX2A 1NZJA 1QIIA 1HK7A 2BE9A 2WU3A 5IWAB 3QI7A 2X6QA 2FPOA 3TNLA 3BWYA 3JSAA 3TTVA 4B7AA 3FPFA 2GNPA 1I3NA 2Z43A 4B09A 4KACA 3NDJA 1IN6A 3AEQA 1PEAA 3UJ9A 4FCTA 3ZDCA 1JR3A 3OFVA 2ZB2A 3C8MA 1PW7A 4GT1A 3GJXC 5EMLA 1ARZA 2EEZA 4AB1A 1KEPA 4AKIA 2XUJA 4PX9A 1EXNA 5JDCA 2GN4A 4RKQA 2ZATA 4JS0A 4NQRA 4ZHSA 1QFXA 4I4TA 3W6PA 3EPKA 3L8CA 1J1UA 3D4BA 1FXSA 1S4QA 3UQZA 1P39A 3TAXA 4QNNA 2G4CA 3IDOA 5EL0A 3IO3A 3L0BA 4DJEC 2Q2WA 4UXJA 5JS2A 1PNTA 1XFDA 3B20A 3DKVA 4K26A 1Z6TA 5THQA 2PUEA 3F6SA 3RUHA 2QTFA 1PQWA 1ORWA 1FW8A 1CR1A 1G5PA 5EJIA 4DSZA 1P1RA 1PKXA 1NNI1 2F3RA 2JFZA 4KPGA 3O1HB 5DI3A 3W5AA 2O8EA 1LTHR 2QQEA 3D81A 3W9SA 3LFHA 1ZO8A 4J0QA 4YGXB 1U7DA 5GONB 3FWKA 4W1PA 3FPLA 4MUKA 4OL0A 1GQRA 3F1KA 1UJNA 4AP5A 4DAOA 1PJCA 3JVVA 4JA2A 4LXQA 4KGXA 4IHJA 2CE7A 5IAKA 3U4GA 2GPAA 4R8SA 4E94A 3MAJA 1Q74A 1W5FA 3NDRA 3W1VA 1BSVA 4LXXA 3FFAA 5ED4A 4KR7A 1XTBA 4JBYA 4MCHA 4LQDA 2XA2A 1QCYA 2HPZA 2OWDA 2PNFA 1XZGA 3D7LA 3N2YA 3OIFA 3T7AA 4Z51A 3FWNA 3OQVA 4EYKA 5HUQA 1X80A 3URKA 3AXTA 3HI6A 1W4LA 1PFKA 2ET6A 1UPBA 1DUVG 4FFBA 4IICA 1N2IA 3HZHA 4UXIA 1F6DA 2A9QA 5HF6A 2Q9AA 4WXEA 5EZ6B 4CDGA 4B6FA 1U3TA 3DBRA 3DZHA 3QEJA 3HRHA 1VSUA 1M6WA 2FG6C 4LSMA 4RXTA 1SXQA 1XZKA 4B5KA 5GJBA 3QPWA 3TEMA 2ZSEA 2Z4RA 3TRJA 3EXIB 1JIKA 4NC9A 4UUBA 4XCQA 2R9VA 5JVDA 1AK9A 4CM7A 5H7XA 4EKDA 5JTUA 1NASA 4MVWA 1EXVA 3VKGA 4FFVA 3OLZA 3PLAE 3QPAA 4ZQEA 2FW6A 3ONEA 2W22A 3CW8X 4KREA 3DMHA 3L8MA 4JBHA 1Y5NA 1WY5A 3WJ2A 1T91A 2AG1A 2BRUA 3X1DA 3WWZA 2QXUA 3PP8A 5J2UB 1SKBA 3DOIA 2HREA 4ACBA 1GRVA 1Z0DA 3AJRA 1X1DA 4QGHA 5ADWA 2HIHA 4MYCA 3KHSA 3MTGA 4DLXA 5FJJA 3WB1A 5CFNA 1KMIY 5JI3E 3CBQA 1Q0RA 1U8YA 1Y5MA 4ZT2A 1W5EA 4OJMX 3S28A 5AVWA 2V5UA 3GJ0A 1RYEA 3CO0S 2XWSA 4EHIA 1VHJA 3DEAA 1VXOA 5CUQA 1AZSC 2Y0DA 1YZLA 2ZRMA 3RQIA 3V8NA 3V1KA 3HRIA 4I6JA 4J0GA 4YP0A 4A7PA 5G0TA 5I7UA 3AMVA 4JI5B 2JA1A 5EIOA 1K27A 4XDGA 3DA8A 3A6PC 3AEQB 1UFQA 1DLIA 3FPCA 2WWRA 3ILSA 1Z28A 1NAIA 2DKNA 2E18A 3NALA 4GKAA 1G7TA 4RDHA 5AHRA 4HLUA 1MW8X 2QMYA 5ULLA 6NULA 3RSHA 1VL0A 3OBIA 4GVLA 1QQAA 1VZ2A 3K2BA 5L45A 5E9WA 1UBEA 3ETNA 4YDHB 1O6CA 4F4IA 4AO7A 3G5UA 4EGSA 4I36A 5EP1A 4W5NA 4GPBA 4URXR 3GLUA 3PVZA 2VA8A 4RK6A 1I80A 4MRMA 2H2FA 2QNIA 3EG9A 4LPKA 3O1LA 4JLVA 4ZXPA 1N9GB 2IJGX 1F9EA 2LDBA 3DDNA 4RPHA 3A1VA 3TRFA 2LDXA 2XE8A 1V5GA 2B1RA 3CW9A 5EJ8A 3NHLA 4UM5A 2XKJE 1KA9H 3CLRD 3TECE 1HQYE 4DM7A 2FDRA 1IWBB 3AG6A 3HUFA 2RH4A 3WFZA 1A8HA 1HE5A 1NLMA 2A9OA 5M29A 3COWA 2JGDB 4JHLA 4LF8B 3EVAA 3N28A 3Q41A 1HT3A 3KB6A 5DGCA 4FVTA 5LQDA 3ENZA 2VHQA 4FMPA 4BS9A 4BMYA 1FL9A 3KQQA 4ZQHA 5ETJA 3LIIA 1BH6A 4P86A 3BDAA 1XEWY 4PC2A 1EUCA 1T1EA 4RCZA 5L95A 3O4FA 1C4XA 3FBWA 4I3GA 4EZBA 2DY1A 2IOQA 1V8PA 1VP3A 2A58A 2VWHA 2Z5VA 4L57A 4YFYA 3SE7A 4EKGA 3ZWOA 5D7BA 1PYOA 2N47A 4RETA 1GZDA 4C1NA 3ZWCA 1EH5A 1NR7A 2W9XA 4IGIA 1P7ZA 2DECA 1PUJA 3OQNA 1ECLA 1ODKA 5F1KA 1EXDA 1M1YB 2ODNA 1LPOA 2OPBA 3OTGA 1WVMA 2PFSA 3MD9A 3W5DA 1AKEA 1OZAA 3CLUC 3OIUA 2V0NA 4IFIA 2SICE 1QGED 1XMJA 4AL4A 2FZ4A 3DXFA 4CDMA 3A10A 1CY6A 1P44A 4M1SA 3RH0A 4QDZA 2NZ2A 4YCAA 1UKZA 1OLSB 5A9SA 2C1ZA 2GEFA 4XQ9A 5CAEB 2OAP1 3HO8A 1C3LA 3I6IA 4QASA 1ACJA 4M9XA 2PGDA 3QKTA 3TIVA 4WIAA 2XMZA 1Y3HA 3WOVA 5CTAA 3U81A 1TT5B 2A88A 3TTXA 5KNDH 3GMDA 1CUIA 1ML3A 2ZIWB 1TM4E 1OASA 1KAGA 1QBKC 1R88A 1YJCA 3A7EA 5E3JA 1U5AA 1JDBB 4J76A 5SZJA 3VHXA 3W2TA 4B5LA 1U3CA 1QVRA 4WI1A 1Y3AA 2QTVB 3BIWA 1CZRA 2MINA 4RVOA 1Q44A 3HJBA 3G7SA 1IZYA 1H1TA 1IVNA 1KVRA 1ZRHA 1P4RA 2P9GA 2QSZA 1U1FA 2AJBA 1EE2A 1BGXT 1X1RA 3JZMA 4XX0B 1CULC 3FDZA 3LHDA 3UGTA 1WBDA 1UT8A 2OBXA 4L8VA 5KVSA 1M2VB 1GPAA 3I76A 1DOZA 5DHAA 2HD4A 2II6A 4WUVA 3EZXA 1IWPB 3IODA 2BM1A 1DXQA 1LQUA 2VRCD 5LL6P 2JI8A 3VPFA 1G16A 3KLMX 3WIDA 5KHOC 3Q3JB 4UCFA 4KPEC 3ZPXA 1OH6A 4MMYB 1LPPA 4Z0TA 4AS2A 2E4YA 1A7KA 2MSCB 3C3KA 1IU9A 5GGXA 2G9VA 3B52X 1B1AA 2VPIA 5IXJA 2GKOA 2GSDA 4O2BF 1PTKA 1II8B 5JCOC 4INOA 1HNWB 3WLTA 2D1SA 1TIPA 3OJLA 5ALVA 1PCXA 4GP7A 2N75A 1Z36A 1X14A 4JLAA 3SVTA 3O95A 1L3BA 4ND4A 2X15A 1RW4A 1C9YA 2V55B 4KE7A 4X94A 5BWMA 2YCBA 2QAJA 3D54D 2QM8A 2I1QA 4K3UA 3F49S 4FU0A 1V47A 2QTCA 3KQHA 1G55A 4CMCA 1JWBB 4MVJM 2JAXA 1SUPA 2AD1A 3KLOA 4DDWA 2F3QA 3T1HB 3RFXA 3WB9A 3ERCA 1IJFA 2XVMA 3TM4A 3TFOA 5K8VA 5J63A 4W5RA 3PDIA 1UJBA 3CEAA 3JD0A 4H7IA 4G01B 3CVXA 2JGDA 2R79A 2VYND 4MITA 4M7PA 3ZY4A 3L7DA 1P61B 2FPPB 1K63A 1Q20A 4KQJA 2AR9A 4XQ0A 1VPDA 2VF8A 4IGEA 4RTSA 4OIFA 1CJTC 3ICWA 1GZHB 2CK3A 2Z2XA 3AUTA 3OF3A 3TZLA 3X1XA 4DT1B 4RESA 3O38A 3PXCX 3T06B 2ZOSA 4Q01A 1RC0A 2R62A 1HE3A 4Q00A 4DY6A 2Z9BA 3VO2A 2ZRQA 1TQ4A 2HFJA 3HJAA 4NFSA 4EY5A 1JSCA 1SRQA 2O0JA 2OXRA 1UBUS 1O57A 4Q47A 1VA4A 4BY9E 4Q02A 3KXKA 1Q83A 4OP3A 4EJ6A 3ZU2A 5ALPA 1UKBA 3R40A 4JBLA 4PVCA 2DWQA 1N25A 3M6XA 4HNGA 1G8KA 3PYLA 1ISMA 4IJ6A 1NTRA 5JASA 3FJOA 1NI4A 2R8PA 5CYGA 5JEEA 1Y8RB 4N41A 1M1YA 4R7TA 1D2GA 3OCUA 1MRSA 1UC8A 2Z30A 4TKVA 4IKOA 5ENDA 3ZJUA 3OQHA 1NV8A 3H13A 3K30A 2FMFA 3MILA 1JHUA 5AIAA 1UJMA 4QNMA 3UK0A 3TTUA 2ABWA 2IVZA 1ZA2A 4W99A 4YJFA 4F45A 4S3MA 3C98A 3OIGA 5IVDA 2J4DA 2G25A 5EJEA 1XE3A 4NNOA 3WZMA 2H6EA 1HRKA 4Z7QB 1NY6A 3GB9A 1IONA 1H0KA 1U7UA 5CXXA 5KQSA 2B98A 2DQKA 1Y1LA 2W2QA 2CHGA 3BFPA 5HZGA 4FBMA 1DJQA 3Q12A 4BVFA 1YVRA 4C43A 5A7FA 1CEYA 2NG1A 4RS4A 3FMPB 1T4DA 4PWZA 3IJPA 3ST7A 3BJZA 1V71A 5LXTB 2Y68A 2J09A 4FHFA 3FNGA 5KVAA 5AVRA 2D2EA 2WP8J 4YRNA 5HS6A 1E3EA 5J2UA 2PRYA 4YK7A 2BGGA 1DHTA 3G5MA 1LLCA 5LCXA 2JAOA 1ZU5A 1DOAA 3EAFA 3IOBA 4EYQA 2R44A 5CPBA 3PC6A 3DEFA 4LZLA 4TT3A 4C1BA 4XGKA 5CM2Z 4CMEA 3BMXA 3MGCA 2CKMA 1WULS 1YC5A 2YFYA 3HO6A 2R2GA 1YB2A 4MVJP 1K88A 2R8YA 5IEBA 2NACA 1KH1A 3W2IA 4F9EA 4NFLA 2VSYA 1QE5A 1QK3A 2FX2A 2FEKA 1V11A 1AA6A 5ICGA 4LRUA 1VKOA 3K92A 3GJ6A 1Y6ZA 4IS3A 1G19A 4BFCA 3EGWA 2CZQA 2QORA 1IMJA 4MS3A 2Y0CA 4LOIA 2Q9UA 3NP7A 4OXRA 3ROGA 3WYAA 1CBUA 1A71A 2ZP1A 1MTOA 1YR2A 4CR7A 1C4KA 2PY6A 1PWXA 4TL9A 4JJ8A 1IXSB 1JFSA 1RHQA 2WMNB 2VVTA 1YUBA 3O8LA 1D1TA 1ZXBA 3MSXA 1N2CB 1ISPA 3AJAA 5TS2A 3NHKA 5C4IA 4F11A 4IWYA 2YL2A 3VHRA 4HS4A 2DBQA 3KLNA 3OPXA 4IUDS 3HKCB 2XEDA 1GPJA 1QYCA 3KLPX 3VR1A 1JZSA 1VYUA 1E9EA 1EVZA 2OV2A 2Q6VA 1A77A 2Z2KA 3P32A 4HH3C 4LY6A 5CLHA 1CYDA 1PJSA 3GK3A 3QJYA 3QVUA 4IQ4A 4QKQA 4JR2A 1J9ZA 1TZ2A 1X8JA 4HATA 3JZIA 4RPJA 4TTIA 1NN0A 2JFFA 1RYHA 4IQ0A 1XLTC 4RYLA 2Q1SA 4B0OA 4OFBA 1EQAA 2VN8A 4QBFA 4X7MA 2VSQA 3ESYA 4LCJA 1T2AA 3NUZA 2I4IA 4HQLA 5A5EA 1Y3IA 1FXWF 1G41A 4LRXA 1ZC4A 4TLEA 1F7UA 1KO1A 2ES4A 4B6OA 1RKBA 4BE9A 4D0SA 4KQ1A 3CEJA 4ARVA 4OH7A 1D03A 1T2VA 1EJ6A 1YI1A 5DTEA 2B21A 4KQWA 3L0DA 5CXQA 4CIYA 2X4IA 4QOJA 3U0BA 1TC2A 4GR4A 1EM8B 3ZTWA 1KETA 3F7NA 4IFBA 4WK2B 1L7QA 3PPYA 1QDLB 2NU8B 1XA0A 1IWOA 2WTXA 4LOHA 4NPAA 1Z39A 3ZWNA 3DZIA 3PHCA 4HQFA 3A9TA 3ZNQA 4A0HA 1G42A 1JDBC 1KR5A 4Q66C 4BNNA 3ZWAA 1SD5A 1C1DB 1KI2A 2AF4C 3FUUA 2XNKA 4MUAA 3BIFA 4P4NA 5TE9A 2I3ZA 1CR0A 5IMBA 2W2XA 5ALRA 5G0VA 3TQQA 5EE1A 1PJQA 3KKPA 3S2UA 4KC0A 3G1WA 3DXZA 1OAKA 1QR6A 3HB9A 4RV5A 3MA0A 4ITRC 1B8VA 3W7AA 3F3MA 4NHEA 2Y3IA 4OHZA 4I55A 3P26A 2FWJA 3K70B 1RJEA 3G0HA 1FRZA 1QCCA 2OXEA 3UMJA 3N6XA 4C7KA 1OV4A 7REQA 3BL6A 4AULA 1A5TA 3A70A 4JSYA 4OM8A 4AXXA 2QR5A 3IPCA 1VRWA 2OGSA 3LE8A 4UUOA 4OP2A 3RU7A 2YY6A 5LLTA 3DBLA 3IB6A 2XR1A 2IBSA 4TZ0A 1FK8A 4IIUA 1T9HA 3DE0X 1FTGA 3FCEA 4NCAA 4K9NA 2YINC 3CZAA 1SU4A 2WK1A 4GOMD 1MRNA 1U1CA 4KRXA 4GXTA 4KXFB 1EZZA 3VKHA 1LPBB 3DV9A 4GI1A 2VJPA 3GCWA 3RGGA 3NHBA 1DRJA 1BE8A 1SWWA 2ZVJA 3D6UA 4JJGA 5EJFA 2D1FA 2W2MA 5DYGA 3S3TA 5KTOA 3ZXIA 3MLEA 3H6HA 2D1QA 3IUBA 1P2DA 3V8EA 3ZHCA 4C7JA 1GQYA 3OJWA 5DNEA 3DEKA 1Q0SA 3BPSA 3C8DA 5BYBA 5IKPA 1ODFA 4JELA 3BCHA 4ZOLB 1TQ6A 1ID1A 1F0NA 4F2DA 3JARB 2BC9A 3OMWA 3H9BA 3SVLA 3BWCA 3R0VA 4MINA 1A5BB 1NV9A 2PUCA 1ZQ1A 4PFQA 4PO9A 1NKVA 4A73A 4YPFA 4LW8A 3T38A 4BNLA 4E4YA 1RWNA 3H2HA 3NM6B 4DRZA 1DEKA 1OXSC 1EM6A 4C5CA 3L7OA 2GD1O 3PX7A 2UDPA 4JA0A 4FYHA 4MIYA 4L3VA 1TXGA 2QMOA 2W98A 3K32A 3PK0A 2P30A 1KAQA 4GSLA 4MQMA 4RMGA 4ZAZA 4B81A 3AUJB 2WF7A 2E87A 3TTWA 2RG1A 2ZJ8A 1SQFA 4JXJA 4BFWA 1KPHA 1RFGE 5JNSA 5CVTA 2FLWA 4V0MA 3NO4A 1HZZC 1P7WA 3MEQA 1JHOA 1LRLA 1OJ7A 3ADKA 1TTHA 3GT3A 1QRRA 4O4LF 3AYXB 4REQB 3REGA 4B44A 2UYGA 3O8QA 2AOXA 5CX1A 4CZ2A 1E96A 2P1RA 2ERYA 3EB9A 5JDIC 4EECA 3U1BA 1GP2A 1KJ8A 1U65A 3IAAA 1UBSB 1AK1A 3SXUB 4ZVVA 4E22A 3E3LA 6LDHA 2IY9A 4PAWA 4KAJA 5AESA 4YIKA 2F17A 2YN2A 3T94A 1JJVA 4L6CA 2Q1YA 3GN1A 4TVSA 2O8BB 3UTCA 3ASUA 3GGSA 4WK0B 4IIJB 2FFBA 4FI3F 1L5RA 4BLTA 1VGVA 4IDEA 3RF7A 3PSHA 1ZHFA 1FFGA 3WR5A 2C1XA 1NBME 1SQ6A 2JIPA 3I9V1 4N18A 4BJ5A 2EJTA 3CXUA 3HNOA 4Z3OA 1C5KA 1V6CA 2HK8A 1Y8RA 2R97A 1TM5E 2Y71A 5AW2A 5L9AA 2E4XA 2B9VA 1Z0KA 2R3SA 3ZU4A 5FI1B 2QN6A 2VDVE 3GLKA 3L46A 1FFCA 2ZYDA 2LVBA 2IITA 3E2PA 1Q15A 3E3OA 3HR8A 3LO8A 4FPXA 1I2ZA 2YFHA 1ZY2A 1IHOA 2CE2X 2WJ3A 1BGWA 2QVXX 4A8JA 3RDPA 2NVUB 1BC5A 4LZWA 3RKUA 3WGKA 4DA8A 4WERA 5E0KB 4M38A 3FRJA 5FLEX 4DN6A 2NUAA 1XTSA 2TMYA 5BORA 4EYGA 1IM8A 2JJ8A 3KPYA 2ZJ2A 2E49A 2ZUWA 3FPHA 2RHWA 5ED0A 1PYDA 2V7EA 3L0OA 4PF1A 3PQ5A 2DUNA 4LBZA 2BKUA 4B2IA 2OKGA 2I1WA 2ODQA 2PWPA 5IK2A 4DUGA 4R3WA 1ODCA 5K8TA 1UP4A 3HBLA 2EERA 4Z4FA 1TTTA 3GVXA 3OA0A 2QRUA 4OKSA 4PC6A 4X7PA 5E95A 2HHCA 1M2FA 1IY0A 5TX7A 1W5BA 2JAPA 4AMVA 2PUBA 3ZD7A 3HKEA 2GETA 4XSGA 1YR3A 2X2PA 3RG2A 1J00A 3S5JA 1WQ1R 5BXYA 2IOHA 4K9QA 3H5LA 1QFYA 2OFFA 3E5MA 1VIVA 2K7ZA 5CCEA 3P2EA 2MSNA 4C3VA 3P9QA 3ONNA 4Q05A 2ZB7A 5C4MA 1RQ7A 3JQ6A 3UJPA 1N5OX 3L1JA 4QIHA 3PE3A 5EIFA 1PJZA 3VDRA 3W3ZB 4A2PA 5KIAA 1COZA 4AJPA 3G17A 3KTDA 2HZBA 3HU3A 4H4CA 1W36B 3D1LA 1BVYF 2FNAA 3A6KA 4O4JF 4IIXA 3DP7A 1KKUA 4QUEA 5LQMA 3K15A 2HEGA 5EHZA 2ISSD 4B40A 4HWOA 1OWOA 1C7QA 1X3SA 1N2CA 2Q49A 2ZI6A 1Z25A 1SG0A 1XCOA 2QRGA 1PKEA 3QFRA 4X54A 2XTNA 5EIAA 3W1WA 4P35A 2O54A 4M9UA 5TGZA 1IDN1 1H05A 2GPYA 1TJPB 4POOA 3MTEA 1OH7A 1WDTA 2D1RA 3IALA 3KM0A 1NNEA 1QNLA 2FZEA 3PR3A 3I2JA 4CLDA 5H9VA 2GERA 3DEHA 4NSNA 4YCLA 3NAQA 4HSEA 4WGGA 2IEAA 2ETXA 3DEJA 3LT4A 2O8VA 2YR0A 4RK7A 2C98A 4H7JA 3H1AA 4O2AA 3TCNA 1BA3A 5ITSA 2HA7A 4JLOA 2G80A 1TEXA 4Y6RA 1N3LA 3OLQA 4DARA 2FRDA 2QQ0A 1QP7A 1JLHA 1IHDA 1MBZA 1US8B 3L01A 5TGDA 5ALFA 2O8BA 3E6AA 2GF9A 2J5QA 3GDWA 2H4FA 1PL0A 4FFMA 1NXXA 4BMVA 3O03A 4JJAA 3QFHA 4O4JA 1ZCFA 2GTHA 3RU2A 3P2KA 4YACA 5BVGB 3PUWA 4G4GA 5D6OA 4LYFA 5E8JA 1U63A 2JIMA 1FJHA 4JITA 3V4RA 3OZVA 1JJ7A 1RJFA 4OU4A 4FOOA 2IK8A 3C4JA 1HPLA 2OZVA 2WOOA 3KFVA 2P41A 5AK5A 2BGKA 5DCLA 4GBGA 3ZWBA 1EHCA 1NNSA 2D0PB 3D1VA 1YULA 1WA5A 2ASVA 1M34E 5KKNB 5FBQB 2WM9B 4OFZA 4CW7A 1G6HA 1QV6A 3U3MA 4C0BA 4KUGA 1LLFA 2VQDA 3EE6A 1DC5A 2Y6VA 1KDVA 4CV1A 4D5EA 1JR2A 1OR8A 2OQRA 4P4SB 2C7BA 1YDWA 1YZ3A 2QL7A 2WAOA 3JS5A 1I9CA 5E3IA 2I0FA 2QLMA 2JCBA 1JSZA 4FOTA 1PQYA 2I1VB 2ONZA 3WI7A 4B3FX 5C53B 1CDOA 2RC6A 5B58T 5JROA 3ACDA 2V65A 3W6ZA 3WP0A 1FFXB 5DJ5A 2ACEA 4MI6A 3ZE6A 5IJ9B 3TW8A 4WLFA 2VEDA 2WW8A 4KN6A 3I2FA 4LJLA 4MO9A 3H5AA 4NJOA 4BKOA 5C4GB 1R5BA 4E33A 3KKLA 1DTWB 3WQRA 3UW1A 4KLAA 2ONCA 4KWEA 2I1LA 3BGSA 4HNUA 1BVHA 1XNQB 2V96A 4CQMB 1E0JA 3Q7RA 3GP3A 3LY9A 5K0EA 5FFMA 2I7CA 3GBPA 4LX0A 2VAXA 3S4YA 1J8MF 2BFMA 7YASA 1A8QA 1CVIA 4RL6A 2FPUA 1IN5A 4ZDIA 5AJHA 2EKLA 4N40A 4C76A 1QH1A 2XW6A 4I5GA 1H9AA 1GL3A 1NVDA 4ZJYA 4BDSA 4QYIA 1UMCB 1VIMA 5DN6D 3EEIA 5KDLA 3UJCA 4WBNF 2ZSKA 1PS0A 2WWVD 2IRWA 3AONB 3ITEA 4N8EA 1PEYA 4P92A 3LI2A 4PIVA 2H7VA 4ZAFA 3B13B 5THKA 4C0KA 5KTRA 1JDJA 1GV0A 3ZBPA 4Z9FA 3TR5A 5FWAA 1QQ7A 3BOSA 3ZVRA 2P67A 4N3BA 2FWPA 1THGA 1Q1ZA 3PXAA 4YXWD 1RNLA 2FJ0A 4V02A 3F71A 4TQ9A 3L9WA 4RJTA 3ZLBA 2ERXA 2G28A 2MR6A 2VSFA 1BQ4A 3BCUA 1A95A 2V0CA 5GVSA 3HDQA 3UXEA 5JJKA 3STUA 4YYZA 2IWHA 1P5FA 3FVRA 3MOGA 2GWRA 3G2PA 3TQRA 4Q1FA 4CM4A 2OFOA 2YDYA 4Q3LA 4QDOA 1ILEA 4OY3A 2PVSA 3UWSA 2JLSA 4BRUA 2HHJA 1G291 3H11A 3G0IA 1NX9A 4KMRA 2NZJA 1DX4A 4BO2A 1E1CB 1VG9B 2PM8A 2QPOA 2WDPA 1NDHA 4IV8A 3OZUA 1IZ9A 1ZNQO 4Q4AA 1NXTA 2UVDA 5JSUA 1IE3A 2VPXA 4GMFA 1K4MA 4C3UA 4CTNA 2QTWB 3EPRA 2OC9A 2A57A 4DA0A 1DRUA 4CTMA 5KNDA 3VU9B 2G70A 3C6QA 3SX4A 4AC9A 1U80A 4JI8B 1E9SA 3MS2A 1XEAA 5I3ZA 1JZQA 5IU6A 1B8PA 4ENSA 5DX1A 3CINA 1FNBA 4Y8VA 2W71A 3AX6A 1I0LA 1JH8A 1O08A 3HK2A 1GZ7A 4LTMA 2LV8A 1CP2A 2SBTA 1G2PA 2CXNA 4CIWA 1DNPA 3IILA 4UARA 4TV8F 5I5EA 1FYXA 2VP9A 3EARA 4Q0MA 1PL8A 1U28A 1LV8A 1VLMA 2VYNA 3N6RA 1A9YA 1H2XA 3JX9A 4QPNA 4ND5A 5IW8A 2R6DA 2VNKA 1C0PA 3UH1A 3OZAA 2YWCA 2BUAA 4QT4A 5ICMA 1HSZA 2CT8A 5DGTA 3ZDRA 3S1SA 1PZMA 4UEWA 3BK1A 2HEIA 4LYJA 2ENUA 2H0QA 4PONA 4KYTA 3BEOA 1W7AA 1CVRA 2IGBA 4Q7MB 4D8VA 1ZITA 1RPNA 1N6IA 2GCOB 2YW9A 3GZNB 3NBAA 1L1RA 4Z4EA 1ODLA 4QGFA 4WFKA 4N5MA 4ZVLA 1I2AA 1Z16A 3ZCVA 4DV6B 1QMPA 3GLQA 1NBOA 1OYWA 1SR8A 2WOJA 1YBVA 2ZJFA 5F2EA 2QYSA 3NEJA 3U39A 4KGDA 1T9CA 1WCYA 1MCZA 1Y9AA 2H9IA 3BFJA 3FZYA 3I2YX 3VQTA 1F0YA 4RF5A 1VKZA 4C4TA 2ZRDA 1LDGA 1Z2NX 2B5WA 2Y4NA 3A3OA 3ENKA 3FSRA 1PRYA 3DYVA 4ALIA 1GIAA 5AKHA 3LKDA 1AUVA 1YJBA 2FUG6 2NXJA 3UV3A 3DL4A 3LLUA 4E88A 3U16A 2C5SA 4QC2A 5DHTA 4E46A 3I04A 4FDLA 1RWQA 1QH1B 4L6AA 4EG6A 2J4FA 4BCCA 4DMLA 4URVR 3TLGA 2EF0A 4NTZA 4JLKA 2FOIA 2W6IA 3HSYA 5CM8B 1FXUA 3TS1A 4PLCA 5EKXA 1WKVA 3O9VA 4QVIA 3GLFB 4Y6GB 1U8CB 3T0IA 1XG5A 1MQ8B 3TLZA 1FS4A 3L6RA 4OOEA 4TKUA 1X8KA 2PUWA 4Q4CA 1PHPA 2QL5A 4MVJG 4JUCA 5KYUB 4HDAA 1K0FA 2J0UA 2J31A 1RWOA 5HR5A 3KWMA 4ERXA 3U60B 4MW0A 3WWPA 1XYYA 4HAIA 2PQ2A 3D8BA 1C41A 1QHNA 2QY9A 4FNMA 4L4XA 4W5HA 4U9UA 2WJVA 5H70A 3RSZA 4UHEA 2DFTA 3ZC3A 1A5AB 2UYQA 4GR5A 4MW1A 1NLFA 5ENVA 3TYXA 2RE8A 1KJQA 3CONA 1VRCA 5IUKC 5FPHA 3H87A 4KX5A 1QR2A 1TAHA 3UFXB 3GLIB 4V1CB 4LNUB 2C4TA 4GOLD 3SS9X 1P33A 5EJ4A 3V46A 3T6KA 4MQEA 3B3AA 2X1VA 3JQBC 1AMUA 2QX7A 3O6VA 1NQXA 3OTHA 3B8EA 3H18A 4KGZA 1YVPA 4PCUA 2W2OA 2L19A 2Z6QA 4DR4B 4LDJA 2ZJ6A 3R9WA 3W5UA 1TE2A 1EUDA 3NOVA 1PSDA 1F2VA 1P0QA 3L0IB 1IJEA 5ALSA 2BFFB 2V4ZA 2AIRA 3H1EA 3ONDA 5C1IA 3QVOA 3N3BC 2ONJA 4BFSA 4OB8A 1YA4A 3SK0A 1KYZA 5BSHA 4O4LA 4CN9A 2R1TA 5FORA 3GLVA 4IXDA 4M46A 1NF2A 4Y2YA 4E3WA 4R0MA 2PRIA 4D9CA 2ZDHA 5EMJA 3H5IA 1GDTA 1RYFA 1KC1A 1UC9A 2HCJB 3NVAA 1CHDA 1NMSA 3NW9A 3QW4B 4X64B 3W9YA 5K8CA 5HRCA 1E7QA 5GIOE 4YY3B 1ULSA 4MI9A 1ZSYA 1L9XA 2DHQA 1UODA 2ZS7A 2VQEB 2O4CA 2GXUA 3KX2A 3MJTA 1V7QA 3BE6A 1GDDA 5F5NA 1V43A 4HH4A 5LA6B 4CLXA 1ULZA 1XQXA 1EEHA 1WP4A 1T0JB 4KRYA 5DYTA 3VTAA 1W5TA 1G3IA 3HEBA 4HOYA 1RRGA 4ZV9A 4ZHQB 2UUAB 2OCPA 3DEYX 1HTWA 2ZAIA 1KZHA 4D9EA 4KFTA 1H3NA 1W9MA 1EFLA 5JRDS 4ZPJA 4AZTA 5JMTA 1WCV1 2YQ5A 3QRWA 1N6HA 3V32A 1RXCA 4WJKB 1EFKA 2TSYB 4B4VA 4YJ3B 5IZCA 5JCJD 1UAAA 1XLUA 1Q14A 2WQ6A 3ZDAA 2QD5A 3EDQA 3G7NA 1OGJA 3R1IA 4IRMA 4DQDA 1XALA 1I6WA 3NJ4A 2JLXA 3KQYA 4XGRA 4MR8B 4M9ZA 1JQDA 2IODA 1DELA 3V2UA 1UM9A 1ZM2A 2CUKA 2G76A 1J0XO 4MWBA 3FDXA 2YC4C 4DLUA 1M67A 4G85A 1CDEA 1OXUA 4BX2A 2VBCA 2H4ZA 2VDWB 3RE1A 2CXHA 3KBBA 2BIFA 1R8XA 3MWEA 1J90A 4X63A <