3CZCA

The crystal structure of a putative pts iib(ptxb) from streptococcus mutans
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
93
structure length
93
Chain Sequence
MVKVLTACGNGMGSSMVIKMKVENALRQLGVSDIESASCSVGEAKGLASNYDIVVASNHLIHELDGRTNGKLIGLDNLMDDNEIKTKLEEALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of phosphotransferase system enzymes PtxB (IIB(Asc)) and PtxA (IIA(Asc)) from Streptococcus mutans
pubmed doi rcsb
source organism Streptococcus mutans
molecule tags Transferase
molecule keywords RmpB
total genus 29
structure length 93
sequence length 93
ec nomenclature ec 2.7.1.69: Transferred entry: 2.7.1.191, 2.7.1.192, 2.7.1.193, 2.7.1.194, 2.7.1.195,
pdb deposition date 2008-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02302 PTS_IIB PTS system, Lactose/Cellobiose specific IIB subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3czcA00
2GKGA 1DCFA 4YLEA 2FSPA 2VK2A 1LBHA 2VYCA 2R25B 2PMCA 4ZYLA 4EYKA 4N76A 3T6KA 4LE1A 3Q7RA 3EDCA 4JB0A 2NT3A 1EWVA 4MRMA 5JNVA 3KYJB 1CYEA 2NUBA 1JFVA 3G1WA 4MS1B 5IBQA 2PUEA 1EWKA 3O2QB 4RZSA 2OQRA 5KQLA 1EWTA 4IGAA 5F64A 4L85A 3GA5A 4F8JA 5HQJA 3RVRA 1QPZA 4W5RA 3HV2A 3N0RA 5DKFA 3QLVC 5JS2A 1MAVA 2HSGA 3IP6A 4JB2A 1PHRA 2FVYA 2BGGA 3JPYA 1L5ZA 2RGYA 2QSJA 4Q6WA 1YK0A 2FLWA 2AYZA 3ROFA 5HSGA 2JVKA 2PL9A 1QQAA 3GBVA 3RVMA 3FFXA 2XDYA 1ZGGA 1E6MA 3EULA 1JHZA 4EY3A 3CG4A 3GL9A 2B1JA 3O75A 4GPAA 4FB4A 3JVDA 1A0OA 5FWXB 4RS3A 4Z9BA 3H1EA 3E3MA 1PUXA 4ML3A 1NTRA 5JNTA 5FBKA 5EWLB 1ZESA 1B00A 1MIHA 1NXTA 5CNIA 2QVCA 4RY8A 3HSYA 3H1GA 3O74A 3QEMB 4RU1A 1EAYA 3LUCA 2JBAB 5CHYA 3BRQA 1RNLA 3GYBA 4G97A 1W9HA 4RY9A 1TJYA 1JYFA 4HNSA 5GQSA 1QP0A 1XWWA 1D1QA 2E4UA 3OO0A 3KKEA 4MR8B 3HO1A 1KRXA 2FXIA 1ISSA 2WJWA 5T7BA 3QX9A 6ABPA 4MR9A 1YS6A 4FE7A 4IMIB 1CEYA 1ABFA 3TD9A 3IP5A 3LTEA 1JLKA 4F12A 6CHYA 2HQOA 2JRLA 3HDGA 4Z99A 4DADA 3C3WA 4N47A 4UHJA 2CWDA 1Z16A 3SNKA 5KC9A 4NCBA 3GWGA 1U2QA 4MS3B 1DCKA 1OXKB 3DLBA 1OXBB 1YMVA 4QICA 4W5NA 4N41A 3GT7A 3TX6A 4EGSA 4KZKA 3DLHA 3H5WA 3LMKA 3T8YA 4OLBA 3OLYA 1A04A 3KYIB 3N0WA 1M2FA 2W42A 4KK3A 5ABPA 1JDPA 4RK4A 1JFTA 1NXXA 1NY5A 2PAFA 5IUNC 3CKMA 2Q5CA 5FWXA 2FLKA 3M9WA 2R4QA 1ZDMA 4JP1A 1A2OA 4MR8A 3N0XA 1BAPA 3CS3A 2GI4A 2WB4A 4OTZA 3Q41A 3NHMA 4FE4A 4YO7A 1NXVA 1YIOA 4Z4CA 4RV5A 3CRNA 5I4CA 3NNDA 2HJ9A 1U2PA 5KI6A 3ILHA 3JPWA 4RY0A 1QP4A 1DCMA 3L49A 1BVHA 1R8JA 2N9UA 2QZJA 3Q9SA 4W5OA 1M2EA 2AYXA 3QLUC 2ID7A 2YHBA 3M6MD 3EODA 3QLTA 2FMIA 3C3MA 4RXUA 2QXYA 4JOQA 5DCLA 4XLTA 3H5IA 4LE2A 4Z4HA 3A3KA 3OMXA 4XXHA 1P8AA 3RVQA 4YR7A 4EVQA 2IKSA 3O1HB 5EWMB 2MSWA 4KMRA 3NHZA 4ETMA 4ZJPA 3QELA 4WXEA 4MQEA 1RZRA 3F73A 5JS1A 3CZ5A 5TQJA 4WT7A 1K68A 4D6YA 1ZGZA 3H5VA 3OLZA 1BDIA 3QLVA 5TE9A 3OQMA 5EWJB 2V0NA 4WZZA 3RQIA 1S8NA 2FEPA 3O2JA 2FQYA 4ZPJA 1VRVA 1U8TA 1Z12A 4KFCA 3IDOA 1AB6A 4TLMB 4M88A 2E4VA 1JWLA 5DTEA 2HQRA 4IF4A 5KQMA 2YHAA 4F3TA 3VNBA 5TPZD 3MYYA 4ETNA 5JNSA 2I6FA 3N75A 3FFWA 4Z0NA 1DRJA 3B2NA 1USGA 4OLAA 3CU5A 3W9SA 2FEKA 2WY2D 1JH9A 5TPZA 3GBPA 4OBBA 4MLCA 1VPWA 3BILA 4G0OA 5IEBA 3D8UA 4G86A 4TN5A 3OLWA 4QYWA 4WUTA 4RXMA 1TM2A 1KGSA 1P6QA 5E3JA 2RJOA 3CZCA 5PNTA 4MRMB 1USKA 1Z13A 4N0PA 2FKAA 1RXEA 1TMYA 3I09A 3KJXA 3HVRA 5TPWB 4NICA 3JY6A 4MS1A 1E2BA 3RVNA 3LUDA 2VUHB 3FDFA 2M1ZA 3OM0A 4RK0A 5ED4A 3O2SB 5TQ2A 4EVSA 4YS6A 1GUDA 4O5AA 5BR1A 2JVJA 4KVFA 3RVKA 1K66A 1EHCA 5DLEA 2JK1A 3DGEC 4LE0A 5IUJC 4RSMA 5CNMA 1CHNA 3IPAA 1NATA 1SD5A 2A9PA 2P9HA 3CNBA 3F6CA 3UKJA 4KNYA 5KQGA 1P2FA 3I45A 4LZLA 4RK7A 2ID9A 1JF8A 1SXHA 1XHEA 4Y9TA 4S04A 1APBA 3K9CA 1USIA 3E61A 3H6HA 2GBPA 3BREA 1DC8A 2HPHA 3Q7TA 3QEMA 2PKXA 1LK0A 4LDAA 3Q15C 2PUBA 3L6UA 2JB9A 1KMIY 2MSKA 3N6VA 4RK5A 5EWMA 4S05A 4Z4GA 1E6KA 3DZDA 1FSPA 4JAVC 1VKRA 3KLOA 4MQEB 1U04A 3LUAA 1QO0D 2A9RA 2FW0A 4RK6A 2IDMA 3H5LA 2IPNA 5BRAA 1QP7A 2L17A 4YV7A 3RVLA 2B4AA 4E7PA 4UHKA 4YCSA 3O1JC 1GLGA 2IPMA 3TB6A 2A9QA 4ZMRA 1NXOA 1Z2DA 3HEBA 4DN6A 2H0AA 2FMKA 1JL3A 3ILYA 3QX8A 2MYNA 4L4UA 5D2CA 1EFAA 1DC7A 4B09A 1TLFA 3OLVA 5FWYA 1FFWA 4NQRA 3MQ4A 4O1IA 1FFGA 4XARA 4KK4A 1DG9A 1ZH2A 3A10A 5HM6A 5KC8A 1ZN2A 3C3KA 3LUKA 3OM1A 3QEKA 3MF4A 5GOTA 3RH0A 1E6LA 2LP4Y 3KSMA 4F06A 2L2QA 2P4UA 3KS9A 5JNRA 2ZAYA 1W25A 2E4XA 4GNRA 1MB0A 3DGFC 4IILA 3SG0A 4LDZA 3C97A 1GCAA 1SRRA 1FFSA 4WWHA 4E7OA 2E4ZA 3VNAA 1DBWA 1TVMA 2VUIB 3HXMA 4XASA 3H5TA 4G0XA 3G85A 4LRQA 3H6GA 1MVOA 4MPTA 5BQ3A 1PNTA 1PNRA 2H3HA 3O21A 3ROTA 2IPAB 3T95A 2LIVA 3FMVA 3SY8A 1DBQA 3I42A 3JS5A 3KG2A 3LUFA 2L18A 7ABPA 5TPWA 4ETIA 1IIBA 2E4YA 1LJUA 4MQFB 4RKQA 1F4VA 2PLNA 1QMPA 2MSLA 1JFSA 1J56A 3HZHA 2IOYA 4RK1A 1DJMA 5TQ0A 3OLXA 1M5TA 3KTOA 2FN9A 2QVGA 2PUCA 3Q7SA 5EWJA 2GWRA 3K4HA 4RKRA 4YWHA 3EQZA 3HUTA 1SXGA 2CD7A 3N8IA 1QO0A 5B3JA 1JX6A 4QYMA 5IUKC 2MYPA 3I5AA 1WETA 3HJFA 1Z2EA 5KWSA 3OO1A 2FEWB 2MYUA 3LKVA 2PUGA 3LUGA 1Z15A 3MM4A 1JYEA 1SXIA 2PL1A 4H3KB 1Z18A 4EYGA 1KRWA 4KQCA 3CG0A 3RVOA 3T38A 2PUDA 2PUAA 4PICA 2LBPA 3JVIA 2A9OA 2CHEA 4Q6BA 2QR3A 1UDRA 4KPYA 3R0JA 3CLKA 4Z4EA 4KRFA 4MQFA 1U0SY 4YGXB 5IULC 3EGCA 3RVSA 5BRJA 1QQBA 4KREA 2WJAA 2R47A 4MR7A 3NNNA 2CHFA 1DZ3A 3DBIA 4Q7EA 4TMYA 2LUOA 2J48A 1AB5A 3FFTA 3H5OA 4RWEA 3RVPA 4F11A 4H3HB 2HQBA 1YTUA 3A0UA 3LUJA 3CHYA 1FQWA 2PUFA 2F8TA 2M98A 2OENG 1JDNA 3HDVA 1HEYA 1BA2A 2FTKE 2ZWMA 4EUKA 3P9YA 3HCWA 4D6XA 4LX8A 4DQDA 4P1ZA 4MGEA 2TMYA 3CFYA 3F7NA 4PZ0A 4EYQA 5CNKA 4W5QA 4HNRA 1QNLA 3GV0A 4ZMSA 1YK1A 1YVUA 3EAFA 2RDMA 1QKKA 2FQWA 2QV0A 3LFTA 1RXIA 4WXMA 4NCAA 3QLUA 5IX8A 4G0PA 4H60A 4Z4FA 2L19A 1GUBA 1C0EA 5IC5A 3HUUA 1DP4A 5C5EA 3HK2A 3H75A 2NZVG 3SAJA 1Z26A 5HKOA 2WRZA 3LKBA 3KHTA 5JNWA 2QU7A 1C4WA 3IP9A 2F8SA 4N0QA 4MS3A 2JBAA 1NXSA 1P6UA 3FGZA 2O20A 2QW1A 2LPMA 3F6PA 1ZVVA 1NXPA 2MYTA 5TQ2B 5C5CA 3KCNA 1ZITA 4XAQA 1PEYA 1ZAYA 4OATA 2PJUA 4HNQA 4EVRA 1LJLA 3GRCA 1T34A 2IPLA 4JASB 5CNJA 2PE5A 3M9XA 2JCGA 1YMUA 3A0RB 1GCGA 4MR7B 3RVJA 2DRIA 3MIZA 1D5WA 4YP9A 5JNUA 2NZUG 5DGCA 3URMA 5B3JC 3QK7A 3OQOA 3LOPA 4MYRA 4P98A 1H9CA 5KQPA 4NV3A 1F51E 2FN8A 4CBVA 1Z17A 4W5TA 3C6QA 3CTPA 4KQ9A 1YS7A 4MR9B 3TMYA 1D2AA 3NNSA 4G0MA 3OQNA 1BDJA 4OG2A 5FWYB 3EQ2A 3UK0A 5EWLA 3D02A 8ABPA 3SM9A 3IPCA 1D4ZA 1RZRD 1BDHA 1ZHHA 3TO5A 3LUHA 1ZH4A 3H1FA 3JTEA 4G0YA 4XFKA 3O1IC 1NXWA 4TLLB 4MS4A 2NT4A 2FQXA 2RJNA 3MA0A 4Z4IA 4MAAA 1LBIA 1Z25A 3N53A 4G0ZA 1ABEA 5T3YA 4MLDA 3QELB 1DRKA 1D1PA 1M5UA 4IRXA 3OMWA 4EYOA 4IMJB 3IP7A 1Y1LA 1DBPA 1RPJA 4QPJC 2FMHA 4PYRA 3HM9A 2FMFA 2JVIA 1PEAA 2WMYA 2R48A 5TQ0B 4PEVA 4D74A 3EJWA 4KV7A 3SQNA 4PE5B 5FBHA 4G0QA 3KLNA 4Z9AA 1JBEA 4O1HA 3BBLA 4YRZA 4HYEA 1L5YA 1URPA 1XHFA 3UUGA 2GX6A 1I3CA 4RDCA 3HS3A 1MB3A 2WWVD 2IYNA 3NBMA 2X7XA 5IEJA 3MMNA 4N03A 3BRSA 3S99A 9ABPA 4JA2A 4RXTA 1VLZA 2E4WA 4MS4B 1ISRA 2KYRA 1ZY2A
chains in the Genus database with same CATH superfamily
3B3GA 5PGMA 4LNAA 1E6CA 2BFEB 4C1BA 3IE1A 3HEMA 1E5TA 2DECA 4LE1A 2BR3A 2EFHB 1EWVA 2W4MA 5F1YA 3V33A 2QTGA 1JFVA 2XVYA 5BN5A 4LBZA 5C8YB 2X0RA 4O4IF 5D1NA 2I6TA 2FPMA 3AI7A 4RD6A 1ODSA 3SHFA 2PUEA 1RZUA 1K7SN 2D5BA 3U4GA 4NYMQ 4X6LA 1R0CA 3PTZA 3N3AC 4FINA 4IXTA 2CJWA 3A6EA 3TVYA 3LYAA 1E58A 5DHAA 2FEMA 2JH3A 5KS2A 3VFDA 3CJRA 4INJA 2VDKB 2YV2A 2BZSA 1FMJA 1XJWA 1V2GA 2FVYA 2X7HA 3KKPA 2EJVA 2RGYA 1R6VA 4IGIA 4YRFA 2IUUA 3C5HA 1DC6A 1D4FA 4P80A 4W63A 2SKCA 3EG5A 4XDZA 2IK8A 2R7KA 2QBYB 3CX7A 2C2WA 1NVWQ 3MJRA 4UPVA 3ED1A 4OBXA 4RFVA 4D92A 1AY0A 3A9RA 3NONA 1X80A 3G8YA 3GCXA 5P8WA 2BV3A 4QBGB 121PA 4BX8A 4B3RB 3R1IA 4OM8A 3ZWXA 3PR3A 1I2BA 4C29A 1RBMA 3CG4A 4AJ4A 2IDZA 1KZ1A 4UASA 4IEEA 4L07A 5DNVA 2BZ1A 3ZCQA 4LNUA 5F5LA 2CMFA 2B9EA 2Z3WA 4HN9A 2QB5A 3HR8A 3K09A 1EPUA 1PQ4A 3L4BC 1L8XA 4KSCA 3QMVA 4CVNA 4WBNA 1KFKB 1NP7A 1GTMA 4NCIA 2JAXA 3HCNA 3RIHA 1DTWA 2AOUB 2R66A 4QTXA 3AERA 4ZAFA 2XHZA 2ZRAA 2CFCA 3IRUA 2X9GA 4M8KA 3RS2A 3WLNA 2G1UA 4EUSA 3PNOA 4BBAA 2VAWA 1WV0A 5ITZB 4D9GA 5E9JA 3IUSA 1I10A 4QZVA 2FPPA 2J0EA 4D8UA 2QTLA 5GZ6A 5IJXA 1IUPA 1THMA 4NZMA 5KYKA 5LKAA 4V39A 1FU8A 1Y63A 1YI1A 1HDXA 2Y4NA 5C46F 5TXGA 1Q0RA 5HTKA 1YR2A 2RGCA 2Z4TA 2V98A 2QNIA 2DBVO 3MEQA 1AF7A 2Q8NA 4QUEA 3ZWQA 1I14A 3HY3A 3IP8A 4K7JA 1VLMA 3G79A 4OM7A 5TT0A 4QYIA 5JD5A 3T1HB 1G8HA 2X4GA 5U4QA 2ILVA 2QI9F 3ESRA 4N47A 4O25A 5A06A 3DDZX 1MH9A 2ZE8A 3IEUA 3P5SA 5AVTA 4ATNA 1VE7A 1VA4A 1ZM3A 2K4MA 3HU1A 3N7TA 4JL6A 5EQJB 2Z0MA 1U2QA 2V1UA 1F2TA 5MDHA 5L4SA 2NZJA 4DUPA 5E7QA 1XP8A 2FZ5A 4N5IX 3UWSA 2B1GA 3NVAA 1RYZA 2YXPX 2XWSA 1YUNA 2IU4A 1TQ8A 3A2MA 3RGWS 4BCBA 1NM5C 1SCDA 1ZU4A 1ZJ4A 3OZIA 3KSZO 1BHQ1 4LGYA 5FV7A 4B4KA 1F5SA 4QGHA 2R96A 4K9SA 2RGRA 3OIYA 1JKJA 1MLDA 5EPEA 1MEOA 4LXUA 5IT0A 1H2WA 2NYVA 3HNRA 5G4KA 1KXZA 3FKQA 1OBFO 2PKWA 4JVLA 2A5JA 2PAFA 3E7DA 5HKBA 1VE1A 3VM6A 4R05A 3EVBA 4BZQA 1W19A 4DBVO 4O02B 1YQUA 3UMSA 4MIOA 2QLLA 4DCVA 2QLFA 3N28A 1WR8A 3B7WA 5B30A 4D8WA 3CCCA 3DH0A 3TW8B 1I7LA 1QMGA 5LYYA 4QUHA 1TEHA 1UIMA 1DAEA 1BWQA 2OV6A 4LBYA 5A9SB 2Q5JA 1FDRA 2JCBA 2CB0A 1BVHA 4R1QA 4I36A 5FCDA 3HRIA 1GTZA 3ZJVA 3K9QO 4JDUA 1Z6QA 4KP7A 1LDGA 4L6IA 3RHTA 2WKSA 3WL5A 3RKRA 4LF8B 4XQ0A 1FIUA 5DHTA 3IO3A 4D9BA 3UAGA 2ZSUA 3RVQA 1GPJA 5A7HA 1CS0A 4A6XA 2ZIWB 1CP3A 2JZNA 1AK9A 4JUAA 4OHRA 3KXLA 1GRQA 5HS6A 4WNAA 5ALGA 2RHDA 4IWNA 3FN4A 3T12A 3UHJA 3ZUPA 1XLWA 2FH5B 1RKQA 2ONYA 2ZU6A 3CZ5A 4V3BA 1CB7A 1XRNA 4ERXA 4AMZA 1I9GA 4D6YA 1QUFA 3I32A 1QHGA 1BDMA 2FDXA 2HREA 5EWJB 3DHVA 3F0TA 3IXQA 1E9SA 2IYAA 3NOOA 3PEUA 3RQIA 4D4IA 2LKDA 1QHIA 2Z8ZA 2FQYA 2JIZA 3Q9NA 4IGFA 4QBFA 5A9RA 5GV8A 5BW6B 1ZPDA 1VJCA 2J9GA 3CH7A 1E1KA 3GAFA 2PSHA 1JWLA 1XROA 4DLWA 5L4LA 4X9XA 2OD7A 5GM1A 3GH3A 4DGQA 1W93A 1UF9A 3I5UA 3RJ5A 5DEIA 5BWMA 4H4DA 4MWEA 3OU2A 1DRJA 1P3JA 2FPXA 3CKYA 4DYVA 3GNSA 3V4VB 1JXMA 1NC1A 5IAOA 5ICSA 4Q48A 4YROA 4ZVRA 4MLCA 4NBSA 5J2UA 3RLIA 5A7FA 4QQKA 4NR0A 5F51A 4J0JA 3OLWA 4QYWA 5CLLA 4CUKA 3GP3A 3MWDB 4LQLA 2RJOA 5JH7B 3BA6A 1XC7A 3ENQA 1D2GA 1E9FA 3C7KA 3MNFA 1D2EA 1TMYA 3OOYA 1GGEA 4MVJE 5CK4A 3A4YA 5DLQC 4ED9A 3PUXA 3EWAA 1HORA 3I53A 4D3DA 4KG7A 2HRQA 4KPUA 3VU9B 1Y1QA 3VQTA 4CF6A 5ED4A 2ADOA 4HAIA 4AS1A 3CE6A 3H6KA 1JU4A 4J1QA 4F2DA 1E8MA 4GDMA 5ENVA 2DP4E 1C81A 1CQJA 3CJTA 1IN7A 4RSMA 3TSWA 1A2QA 4LNUB 3CNBA 4JNKA 2DSNA 4WKNA 5KPJA 2UYYA 3G9ZA 1R3UA 2G8NA 3NYWA 4UTVA 1DKRA 2PRSA 2B2XA 3ADOA 2OO7A 3MB8A 1IZ7A 2PKCA 4DJFC 3GZNA 3L7IA 5HM8A 2CHQA 4AZ3B 2IKQA 4ZJZA 1K7EB 3CRMA 4R8SA 1YXMA 4MA0A 4MGKR 1RQRA 4Y3UA 1NVVQ 3QW4B 2GM4A 4FCVA 4MI1A 5JI2E 3D2LA 1N5KA 2QPAA 2AOWA 3A7DA 4HWRA 4PFSA 1CR1A 1DIRA 4YP0A 1EA5A 1Z08A 1I6MA 1ZBDA 4O2LA 5AYVA 1QK5A 1VE3A 2K87A 5FKJA 5LB4A 4B6RA 1U04A 3C7CB 3BTUA 1ODKA 1R8QA 4NNPA 5CM8B 1ECJA 4J1TA 4OKNA 2CE7A 4R2XA 3V3TA 3T9CA 2AMFA 4QX6A 1YRQA 1TM5E 2VBFA 4TSFA 3F71A 3GRFA 2AN1A 4DMLA 2XMZA 4CM6A 3IP3A 3O5AA 1Z2DA 1X8KA 3G0DA 2BJVA 3R5SA 1O95A 5DBHX 3BZWA 5SZIA 3U4HA 2UYOA 1PR2A 3KJNA 4HFRA 4EX6A 3LGSA 3ILYA 1ENPA 4RHXA 4CYMA 1N1EA 1W4AA 4OHUA 3QE2A 1CT9A 5DP1A 3RF6A 3UJ7A 4C4OA 1RYNA 1E69A 1U2DC 4MB2A 4OH7A 3QVLA 4XPZA 2WTAA 3UWOA 3BMCB 2Q4EA 1F48A 4UVIA 4GPZA 4EB6A 4PNEA 2HEIA 5K0CA 1GG5A 2EW8A 4GMFA 4FDTA 5HM6A 3BYZA 3RH0A 4JC0A 3SHWA 2Q5OA 4S2UA 4P9NA 3STVA 3KSMA 3QKIA 4BQFA 4HQRA 2X0DA 1LTQA 3IAEA 4ZP1A 1QH8A 5JNRA 5EHGA 5J43A 2W6NA 2I4LA 1EZZA 3DE0X 4LHSA 3SG0A 4B3FX 1QE0A 1DTSA 1XEXA 2VHQA 3HP1A 4KTTE 2PZMA 4CKCB 3TFWA 4DQUA 1GPH1 1SBZA 2O7NA 4K6OA 4JI1B 1F3OA 5DOZA 2YFKA 3OCCA 2O1XA 1K5GA 2XR1A 1SA0B 1ZW6A 5IG2A 1QX4A 5A0TA 2OILA 1DCTA 1M34E 2NTNA 2ZJ4A 1Q7GA 3LPLA 1CUJA 1KZ4A 5T57A 3DQZA 3QYFA 1MP0A 2WT9A 4QFMA 2WAAA 1GSOA 3K1JA 3T3OA 4JL5A 3AGQA 3FYSA 3SY8A 3RYIB 3A37A 3EXFA 2LCQA 5LKRA 5E7JA 2ZITA 3DOUA 3N70A 1HURA 1AQIA 1VGVA 5TPWA 4GM4A 2B4QA 2E21A 4U6NA 1JQKA 3Q10A 3IX7A 5CX1B 1DMSA 1ZCFA 5AKJA 1SUBA 3KUKA 5IAKA 5AVSA 3AP2A 1TUBA 4ZAVA 2XECA 2COUA 4ZVQA 1N2JA 4AS2A 1ZIOA 3KT8A 2BLLA 4GKKB 3S1SA 4OHVA 1OHHA 5AH0A 5A7GA 4TL7A 6YASA 1AURA 4N8SA 4NCHA 1EWYA 2B8WA 5DSTA 1QO0A 1UDBA 2DKOA 2QQEA 4OAOA 4BEBA 5K8VA 2AT1A 3OKAA 1TYZA 2R00A 3QJ5A 2UVPB 2JFPA 3LWZA 2Q3EA 2QE6A 2A0XA 3SX4A 3WL7A 3CLSD 1TX4B 1IXZA 1DZIA 1KI3A 1U8XX 1OILA 2AR7A 3ESBA 3IVGA 4QOFA 3U3ZA 2HMVA 1GSHA 3T38A 2HU8A 2QN9A 1TYBE 5JS8A 5MN6A 3UJHA 8OHMA 2ZYGA 3EPLA 2BWJA 3JASA 4H17A 4WXRA 4AN1A 3DOCA 3B9QA 2GN0A 2J6IA 3NJ8A 3PDCA 3BMNB 4HQFA 3R9XA 4JP8A 2OC4A 1K6MA 3T41A 1RYBA 4WCFC 4RVSA 3V7FA 3SZRA 4B3SB 4S1PA 1D3AA 4L3OA 4AG5A 3EGCA 5DHQA 1KJ8A 3GEBA 4DKJA 2BHRA 1WDKA 3FVWA 1T25A 3QXGA 5C1OA 4I3FA 2UZ0A 4FC7A 1L4NA 2ISCA 2UZAA 1J1UA 3GRUA 3NEYA 3VZPA 1OY1A 1OB2A 2QVYX 3D7NA 3T7CA 5HUJA 4OYLA 3PTAA 3PC2A 3PV0A 2WZDA 3NM5A 4M1OA 2OBBA 1ZXXA 4NSNA 4YFVA 3LPNA 1YNOA 2D0PB 4C2UA 1JRLA 4IRUB 4JITA 521PA 3VYUB 3YASA 2BH2A 4BWVA 5E38A 2M98A 3K5WA 2P7HA 3WNDA 2ZWMA 1X7YA 4NS1A 4ER5A 2IYZA 3R8XA 5JAPA 5LYJB 3DNMA 2B61A 4K9LA 2XXAA 4YDQA 2Q45A 1BW9A 2WHEA 3GV0A 1W9MA 1YK1A 4DTCA 2O0MA 1SXPA 2YZKA 1WBDA 1O95C 2X5OA 3PXXA 1WZNA 2FQWA 2RDMA 3MB5A 5EINA 2P9FA 4HVAA 1SUCA 4HMPA 1F8UA 4H60A 4M87A 4MROA 2HDOA 2YN2A 2OCGA 4R5MA 4UMDA 2O2GA 1ECFA 2GZRA 2UZ1B 3MMXA 4GRDA 5CX1A 5ESRA 3E4CA 4B7AA 5K6TA 1T13A 4RF2A 1CZKA 3OEHD 4MKGA 3AVVA 5TIIA 4PYOA 2HWUA 1VL0A 2Z04A 3F6PA 3FCSB 2DTXA 3JQGB 3LBNA 3UTDA 4NJMA 5TQ2B 4G3XA 1LDYA 1LPNA 3QE3A 2JAUA 4XAQA 3I8XA 2VHYA 1LZKA 3PB3A 1Y3IA 1O3YA 1CJVC 4EBFA 1RLMA 2X77A 2DFDA 2FPIB 1BX1A 3EBLA 3NGLA 3KZOA 2EAUA 3U13A 1C1XB 4JASB 2I8AA 4A82A 4QXAA 3SDSA 3AW8A 5JO9A 1NVXQ 2BGNA 1IEQA 4MTLA 4N0EA 1Q83A 2A58A 5G0WA 1L5NA 2COKA 2IYXA 5AT1A 4RL6A 4CZ2A 2QIOA 1O94C 5KNBA 3U3KA 2VTKA 1YZ3A 4OB7A 3E5NA 5K7SA 3VX4A 2D13A 2NO9A 2JJMA 3OM8A 2AOVA 4J6FA 1FP6A 4QSMA 4W5TA 4MQLA 3OPYI 1HR0B 4RF5A 3UKDA 4DA4A 4C30A 1COWD 2PYDA 1Z7BA 2G72A 4M0PA 4UOZA 4G1FA 2JLYA 9GPBA 3WQQA 1AS3A 2X5JO 3WK6A 4MUFA 4UUMA 4LY0A 3EQ2A 3IUYA 1WG8A 3WP0A 3L6DA 3WK8A 3E9ZA 1RE0A 4YRTA 2ONKA 4BRSA 1GITA 1XB2A 5FWAA 2A6PA 4MI3A 621PA 1PRYA 2DPXA 1FVXA 1N0VC 2BEUA 2VNKA 2Q0QA 1TECE 1GAWA 2RBKA 2RJNA 2OLJA 3ISJA 5CXXA 3SDBA 2BF4A 4JLPA 3VH1A 3VOBA 1XTIA 1GKLA 3BFXA 1LSUA 2FP4B 2WD7A 1E2MA 5AW8A 5AVOA 1LBIA 3IT1A 4HTAA 4HWKA 2J3MA 5K3AA 1U0JA 1VJ1A 5A4IS 5JCXA 4DQLA 1E3WB 4DC1A 2NO4A 2VTEA 4Q3EA 3ROKA 3KT0A 3QFCA 1C5KA 1RPJA 3BJZA 4L5JA 3I76A 3EQ7A 1WB5A 3TMAA 2FMFA 2H17A 4ZHQB 4WAUA 1Z0AA 1TUBB 2Y8EA 1VI5A 4X90A 4PM4A 2WA1A 5BNWA 5CPFA 4UARA 3QQ5A 4AKGA 2XW6A 3P9KA 4QUGA 5FTLA 1L5HB 1YJQA 4MUGA 1QO7A 1PQYA 3JQCA 4I46A 3R8FA 3I2IA 3CUEF 1K06A 1URPA 3K5PA 3NHYA 5DRYA 3FGOA 4WDRA 2A4KA 1WUIS 2PBRA 5A3SA 4D8XA 1VJTA 2XKAA 1F14A 2WWVD 1KEUA 4EELA 1IVSA 3PR2B 1KORA 1P9LA 4TTIA 2PFKA 3LPAA 1NSFA 1Z7GA 4Z9YA 4KQGA 1QF6A 3RV4A 1ZK3A 3V46A 4DIKA 1G7TA 4RF3A 4WX2B 2C5HA 2WVGA 3G9UA 4L16A 4W8OA 4C7OA 1N78A 3ESYA 3DD1A 5AXCA 3TM5A 1LBHA 1UK6A 2FZVA 2R25B 4YCNA 1INLA 5DO9A 2FSVC 1K27A 1PS9A 2Y92A 5TR9A 5H80A 5JH7A 3EIWA 3CCFA 1FQKA 4S3MA 2Q2NA 3RAFC 5LNK6 5DPMA 4YB8A 5GGXA 3HPRA 2DLNA 2NUBA 1WE2A 2HUNA 2CVFA 4OLJA 4BGIA 4E5NA 3DEZA 3HFGA 1GPUA 3N2GA 4FM9A 1KZ6A 3FLAA 3PJFA 4RQAA 1GFSA 1UADA 4WFJA 1EWTA 4WKPA 3VUEA 5K8TA 5AXDA 2OORC 2ZGVA 2ZUSA 3ZIDA 3DUFB 3UB2A 1QPZA 7REQA 3RSOA 1WUJS 1V3VA 3AP3A 4BWFB 4JQYA 5FWNA 3RT1A 1C8LA 5IM4F 1U7DA 3DBHA 3SYRA 1Q0PA 3MGCA 1W85B 2XEXA 4V0LA 1J9ZA 3VZQA 3ON5A 4ER3A 2FUNB 3DO6A 4K2HA 3H0CA 3SJZA 1OXXK 3CEPB 1GNTA 1YV9A 2GQ0A 5BN4B 3ZGNA 2AC4A 4ALIA 2NM0A 4XX0A 1JQDA 1NJ2A 4DLRA 2C3UA 4LBWA 5EGNA 5IF3A 1ZGGA 4I9GA 3U19A 3TBHA 3UG7A 3ETEA 1Q1AA 4GE0A 5CX4A 2ZWIA 5JWHA 4CKYA 1AOXA 4XR4A 1R5BA 4FB4A 2NXJA 1UXOA 3BHNA 4KLCA 4I81A 4ZQCB 3UCFA 3MMPA 3FPAA 3IV7A 3LCJA 3DKKA 2ZRPA 3OUZA 2AMYA 4M98A 3C45A 3QJYA 2WP0A 3LVBA 3PJEA 1T8WA 1YJAA 4JQCA 5I6DA 1R27A 5FLEX 1FOEB 4D1YA 5JNTA 5AP9A 2R65A 4YJDA 3GN2A 4E21A 1ZA2A 2WF9A 5CNIA 1T8TA 4MW4A 2MU1A 4HMQA 3B1YA 1EAYA 1TK2A 3CO0S 4L8YA 1UFRA 2QL7A 3HH8A 1BWPA 1X74A 1BXZA 4ROSA 2B3DA 4DCMA 3NBZC 1KEEB 3DVLA 3ENKA 3F90A 2NUTB 4B3XA 3FPBA 1Z6TA 3U31A 5LMZA 2AJDA 4D57A 4PINA 1VIVA 5F3DA 2YJ6A 1DTEA 2Q5LA 3SM3A 3WBFA 4BWGA 2IXBA 3HA5A 4M1TA 4MR9A 3D4IA 3BOSA 1CEYA 2VJPA 5DHFA 1C1XA 1CY2A 3BIXA 4O2AF 5FP0A 1YQEA 4D0SA 4Y6GB 1WB6A 3DS8A 4U9IS 5DN6A 5KVVA 2PMDA 3U44A 4ARIA 3A1SA 2C4UA 4GG1A 4GQIA 4IIUA 1BFUA 3CVOA 4M7OA 4RELA 2O23A 4MS3B 1UPTA 4LZAA 4CGYA 1C3OA 1X7ZA 5GIOE 2PBFA 1QHFA 3X1XA 3W5BA 3WRYA 2ZS9A 1S7CA 2BEWB 1SVIA 3GZJA 4DQKA 1RVV1 3O94A 2UXCB 3CPEA 4HK4A 1UPUA 3L8EA 1KQGA 3ONDA 3NIGB 3DDHA 1CY6A 1XAHA 1D7AA 3PXDA 4PZLA 3DFUA 3A6ZA 5ALLA 5L9AA 4ECAA 4HB4A 5L3QB 4NENB 5ILOA 4R31A 3Q8KA 1Z4KA 1BCSB 1ADYA 2B69A 5HBRA 2P4QA 5FO1A 4DR3B 4IXMA 4HTFA 5I7UA 2XH8A 2WNHA 5G1OA 2I2FA 2WV9A 2ZRLA 2WTXA 2ID4A 3O7WA 5LZ4A 3PI7A 2WKPA 1VHDA 4KC0A 5G3ZA 3JQ7B 1A2OA 4WJZA 5F7ZA 2J4DA 1TT5A 4DGSA 5M3BA 4AYXA 1BAPA 4IIYA 2LD4A 2RD2A 2JH8A 2XRZA 4RTJA 3N8HA 1DJNA 4TLAA 5K0NA 2ZIGA 3OQIB 1Y1TA 3SJAA 3GLGE 5J63A 1ZI6A 3ROGA 2IZZA 5D01A 2QW0X 3EH2A 1Q57A 3IAS6 1WUTA 2D5AA 1N3YA 2O0HA 2XX3A 4L8WB 4E32A 1IONA 1ZEJA 1W4LA 4XJSA 5J23A 2HPZA 1UEIA 4YMSA 4ZQGA 4X66B 5AM0A 5JWOA 4IG9A 3EXHC 2FPLA 5IN4A 4N6OA 1WSWA 4C2TA 2ZWVA 3SDZA 3OX2A 4B9EA 1DI0A 4PGGA 3HL0A 4YJ3B 1NGSA 4OHZA 4H1WA 1DEKA 1SG0A 2HF7A 3A70A 3KJQA 3BA1A 1VLQA 4ETMA 3LXUX 2TMKA 3DOIA 1NIPA 2H8GA 1KSJA 4Q3OA 2BL4A 3LHKA 2PWPA 4MVYA 4CKZA 4TV9A 1LCIA 4JBGA 2UXBB 1L1FA 3OQMA 4IAOA 1T5IA 4LYGA 4PPNA 5LSAA 4RFSB 3FNFA 1ORWA 4JMPA 1ZD9A 3RFCA 5C31A 5CDUA 3V80A 5DI9A 5CEFA 1U8TA 3PUKA 5CVTA 4ZDKA 1KR5A 1LPOA 3F6BX 2JG3A 1PGNA 3TD6A 5KQMA 3HYRA 2HHJA 3HEAA 4EG4A 5DMXA 2H4WA 3HN2A 3R4CA 2AN5A 1T8YA 4WMLA 4JT9A 3CUUA 3PGLA 5CH5A 1FS4A 5CFLA 4IICA 2B21A 1KA9H 1C3OB 4G5GA 2OHXA 4MW6A 2CYBA 4QU8A 4I5FA 1K86A 2GLTA 2X4DA 5GPBA 3TRHA 4H7KA 4LGMA 2OVBA 2WFAA 4PO8A 2QD5A 4D25A 4FFRA 5MFZA 2H2HA 5E3JA 3UNXA 4YLYA 3CZCA 1MKYA 2NVBA 2CL5A 3CNLA 3GJ0A 3O8OB 4WKOA 5TJHA 1KMCA 4Y2VA 2N47A 5TPWB 1G21B 2OYSA 3CONA 2FEXA 1H0HA 5CYPA 1XK6A 4MPDA 1HKHA 1VA5A 1VPTA 1Z5PA 4UTXA 2YVAA 3E15A 3OEHA 5FT9A 1D6NA 1V1RA 2Q0HA 1C0KA 1FRZA 2FCRA 3JRXA 3KYDA 4O5AA 3UC5A 4KVFA 4ESOA 2R6JA 4G8BA 4R0MA 2X2FA 5IM5A 1JEOA 2QMOA 5IUJC 3RU2A 1LU9A 2Z2KA 2WC1A 3T4EA 1CZOA 3R76A 2QMEA 3WLMA 5LQCA 3S2GA 4TWJA 2PRKA 4PG7A 4D4MA 1BN6A 4RPCA 2GO1A 2LV8A 3AG5A 3DDCA 2DPYA 3ROQA 1QBGA 2JHPA 3RYFA 4JP2A 3WK9A 4BGEA 4D96A 5DNCA 1JF8A 1M2OA 3FYDA 1WPRA 5F7JA 4XM2A 2ODAA 1UBSB 2VKTA 3PQEA 1RYEA 1LSOA 1SOUA 1ULUA 1G2IA 1WW3A 1USIA 3G0IA 3EXG1 4Q9DA 4E13A 3N2LA 4IM7A 3MWFA 2PKXA 1HC7A 1BN7A 3RIXA 1E2KA 3SVTA 1RTTA 5ALFA 4P38A 4RK5A 4F60A 1KXJA 2ZSDA 1Y4DE 1RAFA 4YA6A 4RJKA 3SE7A 3BT7A 3BMNA 1E3LA 3ZW7A 4XYBA 1L3BA 4MITA 3KLOA 3KU4A 1TADA 4KFTA 4V0KA 1QGUB 2A9RA 5AM5A 3AL0C 4KE8A 3W3AA 4MMYB 2X9VA 3WYFA 2V9CA 3OKCA 1H93A 5KVSA 1GLGA 1U9JA 3IT0A 1N1DA 4FBGA 2ENUA 3OAAA 3G0HA 4KO1S 1M2JA 3QX8A 2I4IA 2MYNA 4DIEA 1PT5A 3OPVA 5CR9A 4X1IA 3D31A 1GV1A 4P2GA 1O96B 3OHMA 4TKVB 4UFNA 3C48A 4EW3A 5K45A 2JCXA 3EZFA 1FFGA 2G1JA 3A9TA 3LCMA 1L4MA 4PLFA 4RLFA 5CVEA 5EA2A 3U4QA 1EM8A 2RAUA 2GF9A 4CMHA 3I6IA 5FFMA 3EXHA 2EERA 3NVDA 3LGXA 1VKNA 2AJLI 4DLUA 1YDGA 4JIMA 2D8MA 2HHAA 2BKAA 3VRHA 4L4ZA 4XM1A 3ZDRA 4D6PA 1NJGA 3L6RA 4F84A 1WL8A 2XZTA 1UM9B 3KE9A 4LTNA 4NCNA 4ZK6A 5EKDA 2DTDA 4WWHA 3A1VA 3U4AA 3OTHA 1XYVA 3NKVA 2I4MA 1TK3A 1IEXA 3KYDB 2B35A 3AP1A 1GHTA 1E2EA 3Q6IA 4KAJA 3BMQB 2G25A 3DHEA 3L93A 4JOCA 4LW8A 1D2NA 3G85A 3IKJA 3T06B 1UUFA 1C7IA 1KS2A 4NJMB 4V02A 3ANSA 2H3HA 1CY7A 3RTDA 4ACBA 4EPRA 1MA3A 2GCNA 3Q7IA 4D0GA 1A72A 4CLOB 1J5XA 3OSZA 1HEIA 3BUSA 3PQ3A 2ORIA 5FOWA 1QTNA 1GQSA 3BCRA 3SJUA 3ZGVA 1O1YA 1WF6A 4GFDA 2PX5A 4BV8A 1JJAA 3VOTA 4EMBA 4K6HA 1ZS9A 4PS0A 2JAQA 1G8KA 1RRFA 5G0TA 2ATIA 4EM6A 1N9KA 1DJMA 2HSJA 3PFIA 4QBHA 3ZU3A 3NGXA 2CJPA 4KOEC 2V8OA 2FVXA 2E3JA 3DL0A 2EIXA 2BMFA 4AZ0B 1UBCA 4QLOA 1JEYA 4FQ7A 1C0LA 3SS8A 3SYNA 3AUJB 4PIVA 5DHSA 1D04A 5IUKC 4XUCA 3ETHA 2G40A 4G9BA 2XUFA 1JWAB 3K0SA 2ZAOA 1CY8A 2PUGA 2I9KA 1Z15A 4BMNA 3PR1A 3E9EA 1BZYA 3PDIA 1IPFA 1WWKA 5B58C 3G8CA 5A4FS 5C52B 4EO7A 1G20A 1U1IA 1Y3HA 4IDHA 2D4AA 5J4LA 3MT9A 1U5BA 4X1KA 1KAOA 3FIUA 3HXTA 3R3YA 4K28A 3HQ4O 4QTYA 3PWTA 5KDDA 2I9PA 1N3LA 1OVGA 2GFHA 1ESMA 5DK6A 2IP4A 4C4TA 4J0HA 1U0SY 1NVTA 1CWUA 3PRJA 5T64A 4RENA 1IDOA 1DMRA 5H7XA 1U7PA 1QKIA 3B36A 2B8NA 2PZGA 2BGKA 4BJ1A 2JGAA 2JLSA 1WDWB 2AFIB 2X13A 3DBIA 3E9CA 1IMJA 4Q7EA 3KWMA 1Y3CE 2GPNA 2RKBA 2ZBUA 4RYLA 5FTKA 4TVSA 2P67A 3WG9A 3FH0A 4RORA 5JARA 1L5VA 1T4CB 3R5XA 3TB4A 3WWEA 1FS6A 3QF4A 4U7WA 4ENSA 2NUAA 1PEDA 4DR6B 2N3ZA 1DBSA 4EHIA 2F8LA 3WFIA 4PPFA 2L0XA 1VHLA 3UHAA 1R4ZA 1EB9A 1HEYA 2B9VA 3HUEA 1XCJA 1L7BA 2H2DA 1OA1A 2MR5A 2CMHA 3AXTA 3BXPA 1LGYA 1BOFA 1I30A 1JEAA 4FCWA 4X97A 2I6GA 5DSZA 4B33A 3VPDA 3F6EX 4US2R 5BWBA 3CT6A 2Z83A 3DCIA 1E9DA 2GZAA 5SYMA 1YR3A 3AVTA 3RRNA 2ZIAA 1KI2A 4OQQA 5AW3A 1M34A 4DNXA 1U9YA 3FUWA 1EUCB 3DCNA 5B2ZA 3H75A 2OA0A 1VGQA 3PKZA 3BIOA 1VDZA 1NG1A 4LQDA 4CM1A 4DCOA 1SBYA 3OICA 5AW7A 5JCZA 4I2VA 2ZEJA 3VU8A 3C3PA 4NJOA 3X2FA 4P0PB 2X2EA 3TCNA 4FKBA 2GGSA 4OAPA 4MS3A 4FFMA 1WABA 2OEPA 3COYA 4H9GA 2Z98A 3KETA 4HNHA 1XX6A 1XZIA 2CNWD 4LVOA 3ZN2A 4CCSA 5LQUA 3F2VA 2B82A 4JJGA 2H4ZA 2CFSA 1ZAYA 2PA3A 5DH9A 4B43A 1U8FO 1EQ2A 3WLKX 4CM5A 4FN5A 2TS1A 3VSDA 1N8KA 3ZH2A 2P2NA 1U0LA 2PKYX 2O2XA 3IQDB 4FFPA 2PE5A 4B87A 3N0TA 4Q9KA 2Z5VA 5L3SB 1AKNA 3FG9A 2B83A 2G1AA 3AKYA 1P31A 1NT2A 2QYOA 2Y67A 1EFTA 3GLRA 4AKTA 4O4HF 2AXEA 2HLPA 4CDGA 1Q2UA 4PC2A 1ZH0A 1Z8NA 4TUYF 1CRPA 5EJEA 1H9CA 3VUFA 4CBVA 1Z17A 3MUOA 2HPVA 4LJYA 4F9EA 3OKPA 1ORRA 2YYSA 4RPIA 3TS1A 3A2KA 1G5HA 1HDYA 1G41A 1BQ3A 1DDOA 1XUOA 3RS7A 1DLIA 1MD9A 1ORDA 3I04A 3ZWNA 3RC8A 5I7OA 4XVHA 2JI6A 16PKA 4O2BA 1V7QA 2NLOA 4TV8A 3H1FA 1J1ZA 3RUAA 3W5HA 3O1IC 2JIBA 1UQUA 3PHIA 4QC2A 1JG3A 1PR4A 1Z5WA 2B1QA 2P9TA 3LIIA 3M7IA 4FFOA 1DBIA 4B6QA 1CR6A 4V0SA 3ZE9A 3WFJA 3LHDA 4AP9A 1VTKA 5M29A 3TW8A 5FV4A 3CRZA 1OBCA 2Q1YA 2FG7C 5GVRA 4EG0A 1WKBA 1C4KA 4BXOB 3DAGA 1T0IA 2GTHA 2Y27A 3NAGA 4UCQA 4YUAA 3TZQA 2UU9B 4IMJB 3CM0A 1DBPA 1LSJA 4R69A 3N6RA 2REXB 2BEVB 2Z3ZA 3REQB 2D7DA 2BP7B 1PEAA 2FFHA 1Z0JA 4QEZA 4OI0A 4A4DA 2KS6A 5FLKA 2I1QA 5IVHA 3PX3A 1H6CA 1U3UA 4QPNA 3GY0A 4PC1A 2GYYA 1XNJA 1XHFA 3F1LA 3U3XA 4ALLA 4C0BA 3EEFA 3LKZA 3INNA 2JEOA 1IL0A 4DBLE 1FW6A 3TAHA 3S99A 3ZLBA 1W5SA 1K63A 1P8JA 2JIQA 1E1CA 3HR4A 1VZ2A 1Z6AA 4G4SP 3WIBA 1A27A 1YOBA 2DPGA 2GKGA 1YVRA 4CW7A 1XU9A 2FSPA 2VK2A 2VYCA 1F0YA 1MAAA 3HJUA 1FTNA 2FW1A 4KLRA 4ITUA 4CLRB 4TYWA 3T6KA 1NIJA 4PYJA 1Y3FE 1F20A 1SUWA 4JCCA 1AF4A 3KKQA 1K8ZB 2FOIA 3KIPA 1X7DA 4R1NA 4ZAZA 5K3CA 5CA1B 1SKMA 1E2UA 4K6CA 4C4XA 4R71A 3TJZA 4KMSA 1D7OA 1F9EA 3L0BA 5IDVA 2NVUA 1AZTA 1U7OA 3GJYA 2OXCA 2OHHA 2V9ZA 2AUNA 3JQ9A 3LVFO 4I4NA 1GZHB 2NPIA 3C4VA 1FDTA 3GPCA 1M1YA 1QH1B 2F1KA 3T3GA 1JJ7A 4RYDA 4TX1A 3OT1A 1AUXA 1CDDA 2YMQA 3KEOA 3L1KA 4LK3A 3TR5A 1PHRA 1WZUA 5SYNA 1KQPA 1ZOPA 4D7AA 1PQPA 2E18A 3DMHA 3MLEA 2P9QA 3I30X 4NHEA 1L9KA 5C80A 4Q4AA 1JKXA 2H65A 4NH4A 5FO0A 1YZQA 3A6DA 4TXMA 3C14C 3WLJA 3BMOB 3ABSB 3TKLA 3ICCA 3OPQA 4GKBA 8AT1A 3FZNA 1L1QA 1FRFS 3QOXA 2IA5A 5DX0A 3TTWA 1SC6A 2O1EA 5EYPA 4DCNA 5CA0F 2HZBA 1T5TA 3KOWA 4KI7A 2EGGA 2HMSA 3LY5A 4JLAA 3RHFA 2NAPA 4X8LA 2ZJZA 3GRRA 5A71A 3FJOA 3GMSA 4RABA 1IHPA 3PQ7A 1P60A 1XZFA 3EZXA 4DLTA 2HRCA 4MRVA 4PX5A 5BY2A 1XCLA 3VSAA 3OLQA 4JSTA 4YQZA 4NRDA 4QUDA 1GL3A 4UXHA 2I4NA 5EE5B 3I2JA 2W22A 3RS0A 3L6BA 1DAPA 4I4IA 4AUEA 2WTUA 1UC8A 2QQ0A 3GVIA 5C1DA 2JBAB 2OB1A 3TSOA 5CHYA 1E9EA 2QIPA 2R9VA 4WQMA 4FGJA 4Z4QA 4XQCA 5HGXA 1HFJA 1MFPA 4L72A 3SKYA 1CX9B 1PR6A 1XWWA 2E4UA 2W6MA 3KKZA 3ND6A 4RQBA 4URVR 3UG6A 3QX9A 3THYB 3IULA 4FT2A 3ZTTA 3IP5A 3HO8A 3H8WA 1QCYA 2JRLA 6LDHA 3EWNA 1S2OA 1R0WA 2ZFUA 2JFOA 4OSOA 4QFCA 4RE5A 5KJEA 3VHXA 3ZZMA 1N6PA 3GWGA 3KVVA 1OLSA 1TL7C 4J1NA 4LJ9A 4N82A 3VPGA 4PHGA 1VYHA 1ZWKA 4ZO9A 2BUCA 1YQWA 2PEZA 4C5AA 5L45A 2XQGA 4BBJA 3T1YB 1EGAA 4XJXA 2A92A 3VC1A 1CC1S 4ND7A 2X15A 5LDGA 3TX6A 4R5HA 4W1PA 3HKDA 5F77A 4EGSA 3HVIA 3CXRA 3GLIB 2GCEA 4G26A 3SBOA 1SWWA 1E61A 2SECE 1FJHA 3BGOS 1E89A 3KR2A 3KYIB 3L7MA 2PLFA 1G2OA 3LA8A 4G5QA 2KBFA 5D84A 2D1YA 2LVBA 4AZ3A 2CUNA 3KQSA 1YZLA 1GKYA 3VNQA 1C30B 2WWFA 3PHLA 3UV3A 3ZY3A 2D7JA 2Q5CA 2X8WA 4FGWA 2AZXA 3UGQA 2AIRA 5DHRA 5EIFA 1ONBA 1CQIB 2JS7A 2V5VA 1P74A 3H1BA 2EG5A 1U2TA 1NQ5A 1EIZA 2Z4RA 4G9GA 5EP2A 2ATVA 3OX1A 3W1EA 4YO7A 4EPWA 2DCMA 2YW2A 1Z4QA 3EVNA 1D2CA 1NUAA 3K1ZA 3FBWA 4PVDA 3B9PA 1SHTX 3ZV7A 3ZX4A 3L18A 1ZFNA 3PXBA 2ZDGA 2DOKA 3H2YA 1UKEA 4BMOB 4ACAA 1O5IA 3JWHA 4MPRA 2JLZA 2N9UA 3T3HA 4HZUB 3VJRA 3ZBPA 4FYIA 3M6MD 4I5DA 4CKWB 5I7VA 4J91A 2DYKA 5KBYA 5BUCA 4GKJB 3EVCA 1V71A 4YR7A 2HWWA 1J25A 3HKBA 3MRTA 3ZDAA 4ENUA 1EFKA 3D1JA 4GZ3A 1EZ4A 5ANRB 3CSDA 1LVGA 1GV0A 3P7MA 3QY9A 1CZLA 4KIWA 1T5SA 4NPCA 1HBJA 1B15A 3WL6A 4F6LA 4WXEA 1JDVA 2PG3A 5D3KA 5ALZA 3RUEA 5B12A 1A5AB 3HP4A 3GFRA 1BE1A 3R3HA 1ZUHA 1ZGZA 2BJHA 4MVJA 3TOVA 3WDMA 5DM0A 4KBFA 3A3PA 4AAYA 3INGA 2GWHA 1MW8X 3EDQA 3K8YA 1JU9A 3D4BA 4F9TA 1H0KA 2OKCA 1E3IA 3DO8A 2WT4A 1GQFA 5CH3A 3JWEA 4KR9A 1PWEA 1ZIYA 4B0OA 4IDDA 1RACA 1L7NA 2Q5HA 5DK4A 5BOSB 5D3QA 2ZRGA 3JRNA 4HWTA 4LQ4A 6REQB 3WQRA 4MQBA 1RABA 1WCYA 4EY6A 4BKRA 3L7YA 1P0IA 1SQFA 4ZTZB 2JI9A 2EF0A 4Z0NA 4ZVOA 3EF0A 2V7EA 3L8GA 1KK1A 3N8GA 3V4SA 1O97D 1QH0A 1G6Q1 2X9LA 3W1WA 4P4SB 3TLXA 1O0CA 3CU5A 4ZI2A 3L05A 2WY2D 3IDZA 3DM9B 1EVJA 2OOSA 4ZI7F 3VR6A 2V7QD 2C5LA 3HFJA 4X20B 4KFRA 2YDXA 4G86A 4RAOA 3WLSA 3TCKA 3M34A 5H5JA 4EJMA 1FBTA 1CRZA 4HDRB 3VR1A 3SX2A 1QC5A 5AW0A 3MUEA 1RXEA 4G9EA 2Y0BA 3I09A 3UXHA 2IV7A 2VO1A 1CQPA 1YVEI 3T7RA 4II7A 2BFFB 4ZT6A 4DNOA 2Z1NA 1N5JA 3OQ1A 4RK0A 2AJBA 1Y6JA 2E87A 3PIDA 4JBIA 1NDUA 4L3VA 3W8EA 3JXEA 3SN6A 1SXJC 1PZHA 4INAA 4OHFA 1L8QA 3MGGA 4OL9A 4OHPA 5ELMA 1XKTA 2WIKA 1K66A 1EHCA 3HNOA 1GDDA 1XYYA 1EJ2A 1LF0A 2IW3A 4MYDA 1MO2A 3VZBA 1D6JA 1CHNA 3IPAA 1T2NA 4LY9A 4ZZ1A 3LY7A 2SBTA 4DWWA 1QHEA 1VKHA 2Q4OA 3R5FA 4D97A 2FPOA 3LWNA 4XGIA 1E4OA 1S3GA 1SELA 2FK8A 1KR2A 4IQ4A 1J42A 1PNOA 4COOA 5TEVA 1QCZA 1DG1G 4F85A 4URWR 1V0JA 3HYNA 1FB5A 1M8PA 4Y9TA 4OK3A 1P6XA 3CWCA 3TL6A 4ALKA 1QFZA 3H6HA 3T99A 5IZCA 2H1IA 3BFVA 2O3RA 1GOTA 2AD1A 2FGKA 4LDAA 1XT6A 4UTZA 4X1KB 4ES6A 3L6UA 4CLDA 1YUMA 2MSKA 4GQBA 4WLFA 4HMOA 3W5DA 1SEVA 1V7CA 1KU0A 1GDTA 2FKNA 2WTMA 4W5JA 2A5GA 4G41A 2IODA 1BO6A 4P31A 1U63A 2IDMA 1JSZA 3KR1A 3S4YA 4C89A 4DV5B 2OV4A 4GXRA 4LJKA 2F9MA 1GZUA 4LRSB 4IFEA 5E8RA 4IIJF 3MTEA 3PC8A 4JI5B 3JZFA 2NYRA 3W3ZB 3HXOA 2QY6A 2ZUTA 4DRYA 2A94A 3W2EA 3ZCTA 3C3EA 3NWPA 5I7HA 2I2BA 6NULA 3D3WB 2ACKA 1A96A 1IRXA 3H83A 4NATA 3GROA 3TMKA 1GUFA 2IEBA 3C7DB 3OQPA 5T4FA 5HZKA 1M33A 4JJZA 4O0MA 4Y9RA 1EFAA 4F8EA 4JBYA 1KOLA 2BKLA 3M4ZA 1NA5A 3KRTA 4YT2A 4AY4A 4JUFA 3CUYA 4Y6RA 5A3VA 2DQKA 4XARA 3X1YA 3U37A 4LHXA 2QAJA 3QEKA 1ZN9A 5MN4A 1NN1A 3MZ0A 5E0KB 5E6UB 5DTJA 3R6WA 3HUFA 2VI5A 5KYYB 2PH5A 2IYVA 4HBZA 2BHNA 1H2ZA 1N5DA 1T0HB 1YCFA 2Q6TA 3EGIA 2BFMA 3F78A 5HKKA 5JTUA 4AKIA 1ONOA 4TQUS 2EG9A 2REBA 2Q9BA 4O4HA 3WAJA 1YOVA 3KJGA 3PCTA 1L7XA 1B26A 1MU0A 5MF6A 2IHUA 1KP2A 1T1RA 2E4ZA 3DTTA 3GJXC 3DF9A 4Y18A 1EFVB 3LWBA 4DVJA 3N8NA 5ALTA 4BLRA 2E1PA 2REQA 2K2QB 4AMBA 1XLVA 2DY1A 5DDIP 3SQXA 2BT4A 3UMGA 1GR1A 1E8NA 1Z06A 1EDOA 4JLWA 4EF5A 5E4YA 5BQ3A 3VR0A 1VXRA 3K6JA 4YJGB 5DHUA 1MV8A 1YUBA 2XUAA 3GEGA 2R1VA 2ES4A 4YJHA 4KR6A 2O07A 2CBZA 1OXVA 2X3FA 3FMVA 3G7NA 3KG2A 4HGOA 4JVNA 3ESDA 3DEJA 2OECA 4PWYA 3R40A 2YL2A 1HNNA 2O48X 3QWFA 4RKQA 2XDQA 1YQXA 1OB5A 1U99A 2PTGA 2VTDA 3GLIE 1W6RA 1MO5A 1NBEA 3JD2A 1PW5A 1J56A 3HZHA 3OVMA 5HK8A 4HGYA 1M76A 1E2NA 5JI3E 1D2MA 1OGIA 2GCOB 3DVRX 3LL4A 4BZPA 4E30A 2V6MA 5KJCA 3VPHA 4HRAA 2WJGA 4JJ4A 4O2RA 5LXTF 4JC5A 4F5DA 1OH7A 4G5FA 1UT6A 4JU8A 1UMKA 2AMJA 2WE7A 4KOAA 3UK6A 1C3JA 1TYEB 2QN1A 3A1DA 3NHFA 5A6VA 1HA3A 4BY9E 2CY0A 3A1CA 3AB8A 1P91A 4C5BA 1QAQA 3NBQA 4MYHA 2VH1A 3SSAA 1P29A 1MN6A 1UXKA 2B2CA 1JDBB 2V1XA 5JLAA 3ULKA 4EB6B 2ONZA 1YR9A 3OX3A 2H1SA 1WXFA 2W8BB 3QVGB 3Q6MA 2YWRA 4GUDA 4EQZA 1Y8AA 2G9RA 1JPJA 3K1TA 4F2HA 1E2HA 1RRCA 1AN0A 1CDZA 5CJ2A 3JARB 1D4AA 3RK1A 1QAMA 1G291 3B6KA 4QLAA 4J7CA 2QN3A 3WRXC 4AX8A 4LYDA 4M1SA 4OGWA 5LZ2A 1CK4A 3O82A 4GOXA 4O4JB 2C5FA 2QTNA 1ACLA 2G4VA 4AULA 2RH8A 2KE5A 2WMDA 5EMMA 1E0SA 4ZOLA 4CCAA 4HSEA 4A36A 2OCXA 2PSSA 1NN0A 2F43B 5D86A 3PQDA 2W2LA 1KBZA 3HWRA 4C87A 1B7GO 2AN3A 2RGAA 2XOKA 4DXHA 1U7HA 2XAUA 3B70A 4A15A 3ZWDA 2FG6C 3KUUA 3OJLA 2G17A 1RT9A 4XVRA 1YB7A 1H1DA 4BBPA 2H2AA 1YTUA 3SMQA 3CLTC 3CMCO 1M74A 4KDFA 4IEIA 2AUMA 1K4YA 4DY4A 5LP1A 1ODJA 3W04A 1AQUA 1KZ9A 4JXXA 4PONA 1Q7EA 2R6AA 3JWIA 1OA0A 4IZ6A 4Y1FA 5F2EA 4TXNA 2IW1A 2QWXA 4WIAA 3A6HA 2FYTA 4WN9B 4EYSA 3JAMA 2QMQA 2J09A 3U80A 4QO8A 2XCRB 4Q1VA 1V95A 1A77A 1WKVA 1JSCA 4Z4FA 4D3XA 3MJSA 1GUBA 1DKMA 3LXMA 1MGOA 1DP4A 4GMGA 1DXOA 1EAMA 1FFBA 1E5DA 1Z4JA 2FWMX 2WSLA 2XDQB 2IWHA 4CG2A 4PQFA 4X3CA 2IL1A 1R00A 4KAFA 4TROA 3A1FA 5JE8A 5JDIA 1MF7A 5DZSA 2ZJBA 3K96A 2JDID 5JCJD 2P2LA 1US8A 1KE2A 3O8RA 2XD9A 3ES9A 1MJGA 5BN1A 2P75A 1EUDB 2GXQA 3RSCA 1TEZA 3KFVA 2HF9A 2QMHA 3KCNA 3WMRA 3ZU2A 1P7PA 3P27A 4KXQA 5DIZA 4N65A 5KJ6A 3NAMA 5I47A 3OPXA 3CZMA 2HFKA 2QY9A 4ZO8A 4BNLA 1BRMA 4QELA 1LJLA 4PLCA 1DFHA 3ETGA 2NZXA 1SBHA 1YB5A 3D7RA 3VKFA 3DV9A 5D5PA 3ESZA 3BXFA 1MBZA 1O9HA 1ZMXA 5JISA 1NF8A 2D1RA 1SOMA 2ATCA 2RI6A 5CB6A 1EK6A 2ZZNA 1TT7A 1VECA 2IHVA 2EKDA 2W2VA 1Y37A 4DF3A 3C7AA 5EP4A 1W0JD 3FWZA 3OC0A 3V4PB 5BMVF 1K0FA 4YUWA 1AKVA 1W75A 4M7PA 2YS6A 2YHUA 1WXIA 1Z3CA 1EM6A 2AC2A 1K5HA 1PV2A 2JJ1A 2QHXA 2W2XA 2YIVX 4KQ9A 2C9OA 4YALA 5CA0A 3SGLA 4BJ3A 3W34A 5CJPA 1G4AE 1F0NA 2XE4A 5BQOA 3H05A 4OG2A 3ZNNA 3I9MA 5JZMA 1ZJ6A 7AT1A 4N4AA 3D02A 1FX0A 3D59A 1JPVA 2HRZA 3O4RA 4H31A 1XU7A 4XFKA 4Q05A 1LK5A 1YR7A 1V2HE 2PMFA 1CS0B 1X1DA 2D1SA 2FQXA 4EVIA 2ALJA 4PLHA 1RWPA 2WK1A 2VZ0A 1SH7A 3T0GA 1EJ0A 3WKAA 1XN4A 3RUFA 1ABEA 5CCBA 2Y1CA 1CE8A 2JHAA 3I5MA 3DLPX 4OP3A 5IFKA 2DCUA 4EGJA 3U9LA 5DCUA 5FPTA 1VLVA 4PYRA 1A8QA 2C88A 1I1NA 4OHBA 3HYLA 3V7NA 2FZKA 2FG5A 1E5LA 1I51A 2IITA 3E9YA 4D74A 2WUFA 4X92A 1F2TB 1Z4LA 5DN6D 5JZSA 1PFKA 4UTRA 3GFTA 3C15C 2ZSFA 4G6ZA 3QWHA 2FSVA 4IJ5A 2PRJA 3SZ3A 2XNDA 4QDJA 5ALXA 3IH5A 3DFFA 3UJ3X 1UZUA 1N2EA 1ZA1A 2DWUA 5DM70 1YASA 3OM9A 1MJFA 3T52A 2E4WA 1XQ1A 2ZI7A 2X0KA 4B45A 4MKXA 1H1LB 2ODWA 1T9GS 4V2IA 2Z3VA 4QODA 1C41A 2XD4A 4KWEA 1GFWA 1S5PA 5HOQA 2PUHA 1A5TA 1TCAA 1M2VA 3D6MA 1I33A 4UU0A 3RE1A 3UQZA 1UK8A 1YHZA 2DQSA 4HAYA 1J24A 4TQGA 5JEDA 5JS7A 2ZBFA 4S0XA 3IQZA 3O2QB 1OZHA 4JX9A 2HA3A 4FWIB 2WU8A 3GVHA 4BEJA 4IDCA 3G5AA 4Q3NA 3PVZA 4REQB 4KMMA 4W5RA 5TX7A 1G7SA 2VNAA 4I50A 4J1SA 4FK8A 3FOFC 4ADSG 5JS2A 4DWOA 2IHYA 2WDZA 3KALA 3QUAA 5B5SA 1JB9A 5IASA 3ORHA 4RPGA 1SCNE 4BRUA 5J4KA 2DKNA 3AF0A 5HFJA 3B5EA 5E4JA 1TT5B 1J70A 3U7HB 3EZLA 2QSJA 3VKWA 5CG2A 3TZKA 2H18A 2IYRA 5FBZA 1JBKA 4CI0B 5HQ3A 4KQHA 3C3DA 1BIFA 2X4IA 2XDYA 2YASA 3TQRA 4DY6A 2AWNA 1SOWA 2FOLA 1JTVA 2VHXA 3OFND 4EA6A 4ZDIA 4MXDA 2PHZA 4XGRA 2ZZKA 3W79A 4CLXA 1HYEA 4H1UA 1YE8A 4B71A 1B73A 1NV8A 1VRCA 1ZVKA 1G9TA 1RQ2A 2ZU0C 3ZHCA 2XB2A 2OYCA 4I1YA 4PAMA 3DFIA 2B6HA 4ON9A 3NLLA 5E2BA 1ESZA 3CF6R 2V6BA 4BC1A 4LCEA 3BKWA 5EESA 4I4TB 4B32A 3OZGA 2QE7A 2BMJA 4P7GA 2AOXA 3IPXA 3VU1A 4EO4A 2P8SA 1NW9B 2YWBA 5JQGF 2Q2WA 2QVCA 4IIDA 2CB9A 1M75A 4RY8A 4F9GA 4UAGA 5DM2A 1VI6A 1FYXA 4LKOA 4Y0VA 1LA2A 1LDMA 3FVQA 2JAPA 4IFIA 2ZT8A 4IX9A 1OU4A 1KI8A 3L8ZA 4ZZIA 2WM9B 2YIJA 1QIIA 4FDMA 1JDUA 2OGWA 4JH0A 3KUDA 4CG1A 3KOOA 2C5GA 1YS6A 3EMDA 2CYAA 4J8PA 4JLMA 1ZJJA 4K3VA 4OXYA 1JLKA 4H4CA 4QFDA 3GWZA 2ZI9A 4TLBA 1ML3A 1I2CA 1P61B 3SSOA 3AHHA 3U81A 4DOMA 3ETDA 5KMGB 5BV2P 4N3BA 1E1NA 1GZSA 4MH0R 2VG8A 2VCEA 4KPUB 3VU9A 1H1LA 1SPXA 5KOJA 1IBKB 3O93A 2WSBA 4WKGA 5C35A 1OXKB 1YRWA 3OE7A 3AFNA 4RULA 3A3YA 2O2IA 1W5EA 3FYHA 1QK4A 2AJCA 2Q6IA 3FDZA 3RAGA 4AQ7A 4DM7A 1KSHA 1Q11A 2ZIXA 1JDBC 1P1HA 1T0JB 1N75A 2ZBPA 4I08A 4IBOA 1KY4A 2VR1A 5J2TA 3WV5A 3R5KA 2B36A 4P3KA 5EUQB 3TZBA 2PJRA 3UOAB 4B3BA 1NY5A 1WV1A 1ZVMA 3FSEA 3ZXYA 2D5IA 2FLKA 1K8RA 1HLGA 4GOMD 4J3JA 1PK7A 1XA4A 4ZD6A 4UM9B 1O6CA 1X2BA 1UOPA 4HGPA 4OTZA 2ZRNA 4FE4A 2ZETA 1V96A 2WHXA 3EIEA 3LDHA 5I4CA 1WXHA 1T2UA 2R6R1 2H3EA 4K87A 1DCMA 3VX3A 1JPNA 1GADO 3GGCA 1KOFA 2RH4A 3AG6A 1OW3B 3B60A 3ZVMA 2CFIA 2OE2A 4A1FA 4XIJA 3AUFA 3QLUC 1BQEA 1AV7A 1XDDA 2FMIA 3G02A 3H2JA 1SUFA 4G5RA 3ZEIA 1C7RA 1OWMA 3DL2A 3E22B 2FZCA 4LG1A 4NBUA 2BGWA 4LE2A 1NR1A 2A0WA 2JD0A 3A3KA 3DCYA 3FRIA 1P8AA 3L06A 5T3UA 4B2PA 4DWJA 3LX8A 2QPLA 4EY8A 5K0GA 1J6UA 2B20A 2F64A 2ZB3A 2WIDA 3QBJA 3W2TA 4B5KA 2D3WA 5EHZA 5BSTA 1A7KA 1M83A 2JGEA 3KUCA 3NC0C 4RFLA 4P7BA 1DNPA 1QRDA 4OYYA 1POXA 1K8XB 4OSPA 2PPVA 3EEYA 3O0TA 4RD2A 4V24A 4A5SA 4QJ3A 5A03A 5AW5A 3FBGA 4OGLA 5TMBA 1R2QA 3UWKA 1M5RA 1RI1A 3OPYA 1JIXA 3EEOA 3ER6A 1EESA 3Q1KA 1EK2A 2DHCA 3IJEB 2ZWPA 4DLBA 2FJPA 3PEWA 4TL8A 5JNLA 4XWYA 1LEHA 4MX8A 3OWXA 1E79A 1TA0A 1T3GA 2C2YA 1H2RS 1PZFA 2OXEA 4QUBA 4BVEA 4QEKA 4BNIA 3DPSA 3TKAA 3KQHA 4F3TA 4JJFA 3TLKA 9LDBA 3ANXA 2WUDA 1JDSA 1K3UB 4HTFB 2D0DA 4EUFA 5B4UA 1EJBA 5BWNA 3B2NA 3GNTA 3B53X 4KBYA 1CKEA 4Q34A 5JLJA 1RMQA 3Q9UA 5I4IA 1KYYA 2NUPB 5EKTA 4BNXA 5L53A 1E20A 1C2TA 3DDOA 2IEDA 2ZYUX 4IVPA 1SXJD 4JR1A 2SICE 3T1OA 1PEKE 3OQJA 5CLJA 3HADA 3AESA 1P6QA 1RWBA 5IT5A 1X86B 4MRMB 2RBGA 1Z13A 1N7IA 2VJCA 5HKKD 4KGDA 1NMSA 2Z2ZA 4MUYA 1P5JA 2HF8A 2D2VA 4GZ6A 4MS1A 4P53A 1VYUA 3A26A 4M1KA 2XCQA 1I3OA 1NULA 3ZY6A 4P7FA 1V5GA 4WN9A 3DXFA 1RAIA 5EZYF 2GCOA 4YMIA 4PU0A 4I3HA 5L4NA 3KEFA 2VP3A 3LT5A 5ALSA 4X6XA 4EECA 4HGZA 1SD5A 2P9HA 4QE3A 3OAAD 1OT5A 1QE3A 2DUNA 3I45A 4OXXA 3VTZA 3OP4A 1RHJA 1TTPB 1T36A 3ECSA 3HM2A 5D51S 5K0JA 3BJIC 1KH3A 1CZUA 1F60A 2IE0A 3DYBA 3O8DA 3V6MA 4K8OA 5AUOB 1E62A 5J4VA 1XRMA 5E6RA 4S04A 1F7UA 5E6SA 4LRXA 1GRRA 2EQ5A 4E6PA 3BREA 5MHTA 5C7IO 1XVLA 2AQKA 2HMWA 4CI9A 3TKYA 5LJIA 3HCDA 4P58A 3Q8LA 4S05A 3D8BA 4DV4B 3IEVA 1WMBA 4D44A 2HNBA 3IHLA 4Z2YA 5BYKA 2F1HA 3LBYA 2W6JD 3D81A 3QKWA 1AXGA 1P4SA 1VKRA 2QJOA 1MAUA 3Q3VA 5DN9A 3S2YA 3U39A 3AM4A 3GDHA 3E53A 4D0RA 2NO1A 3OESA 4J29A 1FYVA 2VYNA 5IJ9A 3IAXA 1PJLA 5CB8A 3EIOA 1G18A 4EPTA 4INOA 4Y9SA 3RODA 4ZOLF 1JLRA 2YJGA 3QLEA 3WGVA 1R16A 5FI5A 5FL7A 1QBKC 1U5BB 2FR8A 2E1RA 4RM2A 3USES 4UUQA 2OCDA 5C51B 2F2TA 1FX1A 3GZNB 1Y1SA 3EXIB 5GJVC 2X0FA 4IDGA 3X1JA 1XD9A 1WTAA 2IEAA 2PX3A 3DMDA 5E1OA 2DQ4A 1Z68A 2QMYA 3G2JA 4NBNA 1TGYA 3R6TA 1IPEA 4KSYA 1JQBA 3TK1A 4IR7A 3RUCA 3PFBA 5TT1A 2VDJA 1AS2A 1J8FA 4PFJA 1ATZA 4BP3A 4NULA 2VJMA 1Z0ZA 3WK4A 2LP4Y 3BF7A 3SBEA 3AOEC 1CUZA 3LU1A 4KJXA 3AWIA 4BQRA 4CV3A 1U81A 3QNUA 1MB0A 5A4AA 5CFPA 1VMDA 3Q8MA 3JR7A 3LP5A 4Q47A 5L6LB 3W8NA 4U7DA 1LW7A 1AGXA 1J23A 1T9KA 2HJHA 3G68A 3K73O 3K70D 2XAAA 2P68A 1GCAA 3DMPA 3PDJA 5EP3A 4CDRA 1C3XA 1P17A 3VR6D 4PRKA 4OP1A 2ZRIA 3LCUA 2ZTSA 1G6KA 1RLTA 4G37A 5BPHA 3TZCA 4V1CA 3ZCPA 2XVAA 1XCGB 5B1HA 1OH6A 3CWZA 3DNFA 2Q6VA 3CWQA 1JJFA 3O21A 1B8NA 2FUEA 5F1KA 3KEQA 4BNUA 3NDIA 2CWWA 2LIVA 3DMRA 1RM4A 3T95A 4IJKA 5HF9A 4WZ6A 3G0CA 4ZT4A 3WICA 3BMCA 3Q40A 3LBFA 4FEYA 3ZIAA 1IH8A 3OP1A 2VJAA 1F4VA 5FORA 3I9LA 1Z0IA 4J7UA 2D62A 5EZ5A 3WOVA 5KJFA 2BGJA 2PA0A 3SC4A 4LMRA 2QV7A 1ZX1A 5HJ2A 1NW4A 1HT0A 1P5HA 3KC2A 3GUHA 1PSWA 4PAGA 1LTHR 1FLVA 2XMQA 2GAFA 1IK6A 1GYRA 3ILXA 4CIXA 4FYYA 1LD3A 5U9CA 3LLMA 2VF2A 3GJQA 3HJCA 3LXXA 1IN8A 3CZ9A 1TO6A 3O8OA 2NPFA 4P8RA 4BV9A 4N6NA 1NOKA 3P4XA 3DPIA 4RTPA 3SFTA 4XOIA 3T61A 5JRZA 3L8CA 2WIJA 4TL6A 1DX9A 4H3KB 4YVFA 1X7YB 3MG9A 1ZNWA 1GAJA 3OZEA 4FGKA 4GX2A 2ZRHA 4K9QA 1DPGA 1JMYA 1H2XA 2HN9A 2I54A 2VF5X 2X2PA 4P5DA 5BV7A 1I13A 1VE6A 3BXHA 2WKRA 3U1VA 1G66A 1P5ZB 2VWPA 2J9YB 1PDVA 4XIYA 5CA1A 2GBGA 1ADCA 2VYVD 3RADC 2I34A 1BMQA 3OUTA 1X13A 4WH0A 3INRA 5BRNA 1ZUNB 4M0FA 5DTQA 3E1GA 1N3BA 2F62A 3O7MA 3ONNA 3QU4A 1O58A 3H1AA 2YWCA 3ZWVA 2I3ZA 3D0RA 4A16A 4TV8B 1KMHB 5KX5F 3NWJA 1EBFA 1UDCA 2OZLA 3ORYA 2CXNA 2LUOA 4GGOA 4TMYA 4YHHB 4OJYA 3A4MA 3QXJA 3KJHA 3ZHVA 3V2UA 3DOHA 2VHVA 2G3YA 2FF7A 5F5XA 4D80A 1JH8A 2HQBA 2CLFB 3NG1A 2GXUA 4ZCMA 3M8KA 2V58A 5SY9A 4A3SA 1A1SA 1GPBA 1UODA 3C3YA 1ZLYA 1EH5A 1ECBA 1A9OA 5ALJA 4JV5B 3X44A 3TOSA 2DPHA 4B81A 4I9HA 4V0QA 3I1JA 5BUQA 5CBPA 4LX8A 2OZEA 4PZ0A 2WJVA 2OCIA 4EFKA 3O2NA 3LCCA 2VS1A 3Q12A 5L95A 4ZMSA 4DANA 5LVAA 4AZ0A 1JEYB 4P4SA 2JFUA 1U8EA 3EAFA 1RPAA 3FLBA 4OF4A 1D0IA 2G67A 2IYLD 4URFA 4FMBB 4L6AA 4TWIA 5HNKA 4UZSA 4JVSB 1NVAA 3UA3A 3FPGA 3DULA 5FF9A 3EDYA 3HUUA 2WM3A 4I1RA 4PO9A 5ELXA 2AW5A 2NNWB 2NZVG 1TKCA 4FNGA 4XTRA 1V6SA 1H42A 1KYQA 1M72A 2AXNA 2BSAA 3KEGA 3PQ5A 4K2AA 4ZIRB 3F8SA 3TRFA 5JJBA 2XUZA 1JBQA 1E7MA 1RXUA 3I6ZA 4P4UA 3ZI0A 3DOEA 1BXKA 1TVEA 1G8AA 4MI9A 5A0FA 2FSSA 1BH6A 2M32A 3A9CA 4F6RB 4BNTA 1HFWA 1DX4A 2QNRA 1IZ9A 4GICA 2AQ8A 4IKPA 3D43A 1TI7A 3Q7EA 5BNFA 3UXYA 3U60B 2UZ3A 1CULC 4ZTBA 5I7FA 4MVJI 1ZC3A 4E0BA 1ACMA 3KL2A 2NXWA 3TTSA 2H9YA 3S0JA 2JLAA 2HHHB 2P11A 4CN9A 3Q7QA 2R2AA 4C3UA 1PHPA 2IU0A 1FDWA 4TQ9A 1FW8A 2VHJA 4YP9A 4PG8A 5JNUA 1SD2A 1CQXA 4O1MA 1N2IA 1SM4A 4HXEB 2IXFA 4RM3A 4LOJA 1ENYA 3RF7A 3O4HA 3UICA 3F98A 4BNMA 2XOXA 4TT3A 5CVUA 4Y0AA 2JCSA 2OHFA 4XYMA 1NWHA 2C1EA 3TRJA 1XDSA 3WGKA 5CITA 2I8CA 1ZUNA 4XB2A 3NWBA 5AI5A 3I6BA 4P2BA 1PYDA 3ACBA 2FSUA 1UBEA 3RTAA 4JXJA 2GN2A 3SEFA 1KYZA 4P81A 4Z1MA 1J8YF 1HTWA 5BV0A 3B6EA 4C7XA 1M2HA 1NDHA 3TM4A 5CUQA 4CPDA 1R6DA 4YCBA 1I6WA 2OV8A 4US0R 3IOCA 1OLXA 1Z45A 4Q4HB 3KVRA 4EEKA 1MOSA 1P9OA 1K89A 5F21A 2QAIA 4HPJB 1KDPA 3CF2A 3KXDA 2Q3FA 3S1LA 1SJ9A 5DXAA 1F6WA 1WBJB 1JG2A 5SV2A 3QENA 3RSHA 1UKAA 3X1KA 1T4BA 5D00A 4AMVA 1JZSA 3VSBA 1A9QA 5J9FA 4RHUA 4TZ6A 3TG8A 1T5LA 3AR3A 4FE3A 3JZIA 2FGJA 3U48A 1VSVA 1W85A 5JDCC 3BIWA 1JFRA 1OZAA 1VPLA 3B13B 4BIIA 5KZMB 2XT0A 1EXMA 2HA6A 2XWQA 2Y6VA 3BK1A 4O4LA 1RDFA 4RLHA 4KXYA 3F46A 4YTEA 1V16A 4DUYB 3BXXA 3IERA 2R7MA 2ZXFA 4YRGA 5FUMA 2AG0A 1QB8A 4N03A 1YOVB 3CJQA 3HJTA 3DWFA 5FNVA 1OGJA 4DZRA 5J2TB 3IBFA 1N7HA 4UJ5A 1V1JA 3ZK7A 3V34A 4IW3B 4MS4B 2GKOA 4HAOA 2IY8A 4O4IB 3SXUB 3V1MA 3QHAA 2PMCA 2AW3A 4GXTA 1XZGA 3CW8X 1H69A 1PS0A 3NYQA 3BKXA 3FNEA 4N8DA 2NT3A 3KR9A 2AR0A 4MW0A 4F2PA 3T9BA 5FD8A 1NNI1 2Y1LA 1GKKA 1T4CA 2VDPB 2JLVA 3ELBA 3RU7A 3HDHA 4G5YA 1SHJA 1N92A 2R44A 2UAGA 2ZPTX 3Q6NA 3GUVA 3AETB 3JZMA 2PZKA 5J4YA 1TLTA 4ZI7B 2PCJA 1RC8A 3RVRA 4NZOA 2EZ4A 1CYDA 3HV2A 1MQSA 3N0RA 3PJRA 1DQZA 2H1CA 5CLFA 3DKIA 2X5XA 2QG6A 1ZINA 5KCZA 4Y8VA 4HQ0A 4J16A 4B7ZA 3GRZA 4NG4A 2OZLB 4JB2A 2XJ4A 1BS2A 1UJCA 2EWMA 2E7ZA 4GNKA 4MLZA 4PVCA 3VAYA 2RB4A 1OX5A 4OJKA 1TQ2A 1DDGA 5DGHA 3MK31 3WVNA 4DXAA 5AJYA 4KNVA 1PR5A 4CM9A 1NJSA 1T6XA 2N0SA 3A06A 3GBVA 3GGJA 2B1RA 4XZ3A 2VQDA 1RYMA 2QSZA 3FFXA 4WGGA 5I9BA 4C9BA 5AM4A 3G5TA 4EDFA 3B1XA 2FSFA 5H0IA 3RVDA 1U3CA 1QTRA 2C7OA 3AR2A 4JZKA 1OC2A 4U02A 5DX8A 2RHLA 2Q46A 1ST2A 1XCMA 2C0PA 5AK5A 2XBMA 4LXHA 3JARA 3OU6A 2V74B 3QIAA 1Y6GA 4BNVA 1PUXA 3ITKA 3AVPA 3G6WA 1C9YA 1NMYA 1NRXA 5BVGA 3A9UA 4PIPA 1N6LA 1C7JA 3HXLA 3ZE6A 2BFPA 2F00A 4OAQA 3WIUA 4CU2A 4AF7A 1PIWA 3ZEAA 4NAHA 2C9CA 1IHUA 2Q8PA 3LD9A 3E23A 4CLRA 4UOQA 3OG9A 4FOPA 1WXDA 3R3VA 4UM5A 4YAJA 1N36B 2PR7A 2C3OA 3FYCA 2JGMA 3W3AH 1FZQA 2G28A 3Q8XB 5FTWA 3ZGOA 3MERA 5I48A 1USVA 1XMJA 5JSFA 4Q12A 5LXTB 4JLNA 4FE7A 5FNVB 2SKDA 1E64A 1WCIB 2OFPA 2P0AA 2W2QA 4MK4A 2GK7A 6CHYA 5FOSA 4F91B 3KUXA 1Q0LA 3VV3A 4LC1A 1NOIA 1P7ZA 2CWDA 4UD6A 3BWCA 4BBZA 4NCBA 2FX3A 1NE7A 3UIEA 3SHOA 1Y1PA 2YYYA 3MTAA 5IYZB 4JJAA 1ORIA 2CNKA 3ZZTA 3L8MA 3UKOA 2UZ4A 4UEKA 3AJDA 2OHJA 2QENA 1OXBB 2YZNA 4W5NA 1U8YA 1YA8A 5L51A 3FZQA 3PFWO 2HWYA 1PJ3A 1LLFA 2IYYA 1O4WA 2UYQA 3EFOB 3IPYA 5CDGA 2NZ8A 5FBVB 2PKQO 1LX6A 1N8NA 3AKZA 2DFTA 3K1YA 1VIMA 4R98A 5LQJA 4O4JF 4E2XA 2DJ5A 3NM4A 1NPYA 4NFLA 4PZPA 5HOEA 2HPAA 4BFTA 2BP7A 3ZU5A 3UCXA 1Q14A 4NBTA 1A76A 2Q4DA 2JANA 1BJKA 4M9XA 3THXA 4QU5A 4BECA 5JFGA 1BVUA 1J8VA 1K6IA 4NYIR 2R8RA 3CS3A 5WRFA 3DBOB 4YASA 1DADA 1HT2E 2NV0A 3NHMA 5FA6A 1YBAA 3CX6A 3FKSA 4D46A 1O9BA 1VZ3A 4CKBB 4EF4A 3U3DA 4Z6KA 1KEPA 3W4JA 1GP2A 1EK1A 3C2QA 5DNYB 4ARSA 3VU3A 3MVEA 5JCOC 3NBUA 4CM8A 4XR9A 3FOZA 2VYFA 1P4GA 1QUEA 5DB4A 2PD3A 5AHKA 2R1ZA 3T3MB 3UUWA 1WCWA 1DPFA 3A9VA 1XXHB 1YZHA 2POCA 3CPJB 4GOND 1ADBA 2AG5A 3DB1A 5JRJA 2VJQA 3KT6A 1WRBA 1LQ2A 3WE7A 1XBTA 2NAFA 4RWZA 3U4MA 1IRIA 3V1KA 1XJQA 2NP6A 4L50A 3OLZA 3TD2A 4J0DA 4C14A 4US1R 3FZEA 1AQYA 4WZZA 4NFHA 3QVWA 4G8JA 4WFQA 1XTJA 1EJ6A 1QG2A 3AEKB 2O2DA 8LDHA 4MRAA 3RYIA 4N0MA 2X0EA 1L7RA 3ITEA 1PWYE 5T4EA 4U63A 3IVMA 1KS9A 4Y2RA 2A86A 1ORVA 5G4KB 2YOHA 1EVQA 4ZK2A 2PQ6A 1OV6A 3SYTA 1M67A 4UQLA 3TLGB 1CUIA 4D9MA 3TXXA 2H59A 4M86A 4KR7A 2C1XA 1T2FA 4PGMA 3VR4A 4ZKDA 5LZ9A 1W35A 5COAA 2C31A 3I8SA 3QRWA 4KE7A 1WZIA 4QXMA 4UBIA 4J2HA 1KI6A 3ICVA 3TDNA 3W1VA 4ZAYA 4KO2S 4IHAA 2NADA 2EZ9A 4D9FA 4PYLA 3MSCA 5IH7A 2Y3IA 3GBSA 4FONA 5KJ1A 1A8IA 3C3AA 2CMDA 1L5QA 1J2TA 1YKSA 2C20A 1ULTA 2OCYC 1U02A 3URKA 5K3FA 3HWWA 3KBOA 4AMGA 3N2KB 4D2IA 5GONA 1E2BA 3LX6A 1HWYA 2QD1A 3FHLA 3PFHA 3KQLA 1JR3D 2PWZA 4AXBA 2OP1A 1T2DA 3ANMA 2YN0A 4ZARA 2W58A 2AKEA 3K0AA 1J09A 2PZ8A 3O4GA 2QGNA 1DE0A 2WQZA 3O3NB 5HEKA 2H31A 4LX0A 4M9CA 3WGUA 1MT0A 4BFSA 2IEZA 4XUDA 3PE4A 5KQGA 1VBFA 4EENA 1E9RA 3EGDA 3TLEA 1G4UR 3IOYA 3ZHZA 2ID9A 3AUXA 1C7FA 1DXHA 2JFWA 4ZGWA 3TBFA 3KQKA 1KMQA 3DTNA 2C94A 4HCJA 2B3TA 4WKBA 1T6NA 4UFOA 2C5EA 2PS3A 4JKYA 5FULA 2J1LA 4ZU3A 2JH9A 4WN3A 2X1HA 3MMZA 2ZDHA 1F12A 2UZIR 3V1LA 1X8LA 1H0SA 3N6VA 3IOMA 1Z34A 1MQAA 1VBNA 4KYIB <