3CZCA

The crystal structure of a putative pts iib(ptxb) from streptococcus mutans
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
93
structure length
93
Chain Sequence
b'MVKVLTACGNGMGSSMVIKMKVENALRQLGVSDIESASCSVGEAKGLASNYDIVVASNHLIHELDGRTNGKLIGLDNLMDDNEIKTKLEEALK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RmpB
publication title Crystal structures of phosphotransferase system enzymes PtxB (IIB(Asc)) and PtxA (IIA(Asc)) from Streptococcus mutans
pubmed doi rcsb
source organism Streptococcus mutans
molecule tags Transferase
total genus 29
structure length 93
sequence length 93
ec nomenclature ec 2.7.1.69: Transferred entry: 2.7.1.191, 2.7.1.192, 2.7.1.193, 2.7.1.194, 2.7.1.195,
pdb deposition date 2008-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02302 PTS_IIB PTS system, Lactose/Cellobiose specific IIB subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3czcA00
2RDMA 4ML3A 4O5AA 4RK1A 1PEAA 2L17A 2CD7A 1D2AA 1R8JA 2GKGA 2IYNA 1BDJA 1USKA 2PUFA 2PUGA 5IUJC 4KK3A 4LX8A 2CWDA 4FE7A 6ABPA 4XARA 4QYWA 5DGCA 4MQFB 3CZ5A 1ZN2A 3R0JA 3SG0A 2OQRA 1ZVVA 4KPYA 2E4ZA 2MYTA 3O1HB 4RXTA 1E2BA 2QZJA 3JVDA 2NT3A 3QELB 5KWSA 1JBEA 4DADA 4DN6A 5KQLA 3RVLA 1JFTA 2HJ9A 1DCKA 3GWGA 2A9QA 4G97A 3GL9A 1GCAA 4EGSA 5FWYA 3QLVC 4EY3A 4Z9AA 3BBLA 2IDMA 4EYOA 3HV2A 4MYRA 1ZESA 3A10A 3CU5A 3H6GA 4MQEB 4UHJA 2PMCA 4RDCA 3RVMA 4Z4CA 1A04A 2L18A 4NV3A 1PNTA 1ISRA 5JNWA 3EODA 4LE1A 4WXMA 3DLHA 3MYYA 1CHNA 4O1IA 2PUDA 3Q41A 5E3JA 4MQFA 3N0RA 1F4VA 4H3HB 4N03A 3C6QA 1F51E 4MR9B 5CNKA 2FEKA 3QELA 1NXTA 2A9OA 3OLXA 4S05A 1USIA 2P4UA 4Z4HA 3JS5A 4M88A 5B3JC 1DJMA 1J56A 2PAFA 1EWKA 2HSGA 2JBAB 2YHBA 3C3KA 1FFWA 1XHFA 4G0QA 4LRQA 3UKJA 1MB3A 4Z4IA 2QV0A 4RV5A 2QVCA 3F6PA 4Q6WA 4P1ZA 1YK0A 2E4XA 2JVIA 3G1WA 2WWVD 4MQEA 7ABPA 4RXUA 1Z2DA 3NNSA 3ROFA 1DG9A 1NY5A 3S99A 4W5OA 4HNRA 5C5CA 1M5TA 1W9HA 4ZJPA 5IC5A 3FFTA 1GCGA 4MR9A 9ABPA 4HNSA 2F8TA 1L5ZA 3KLNA 4MGEA 4ETMA 2IPAB 1TLFA 3KG2A 4PE5B 2HQRA 2FMIA 1QP4A 3SQNA 1BDIA 5KC9A 1Z26A 2JBAA 2N9UA 3I42A 1DC8A 2YHAA 5CNMA 2PL9A 4L4UA 1APBA 1KGSA 3E3MA 5GQSA 2LPMA 5TQ0B 1DZ3A 3CRNA 1Z12A 3TX6A 2JB9A 4YR7A 4IGAA 3O2QB 3NHZA 1SXIA 3HM9A 3FDFA 3DLBA 3LTEA 4HYEA 3FMVA 3H5IA 2IPMA 5HSGA 2IPNA 3QX9A 3H1FA 4G0YA 2MYUA 4EYGA 4ZMRA 5IULC 2WY2D 2ZWMA 3SM9A 4WZZA 2NZUG 5C5EA 5CNJA 3LOPA 4KQ9A 4EUKA 2E4WA 3JPYA 3OQMA 3OMWA 4G0XA 3QX8A 1LBHA 5JNTA 1L5YA 3H1GA 1QMPA 2MSKA 5DLEA 1KRXA 1IIBA 1DRKA 3QEKA 5IUKC 4RK6A 3QLVA 4FE4A 3TO5A 1FFSA 5TQ0A 4PEVA 4KNYA 2Q5CA 4ZPJA 2GBPA 3RVSA 3H5LA 4P98A 2QSJA 3I09A 4EVSA 1QP7A 8ABPA 2A9PA 1XWWA 4JB2A 2NUBA 2FKAA 4MS4B 1QP0A 1P2FA 1Z18A 1PUXA 3EULA 3KYIB 1USGA 1ZITA 5JS1A 1DBWA 1DCMA 2E4VA 4YLEA 3LMKA 4RKRA 3H6HA 1D1PA 4Z9BA 3GYBA 3M9XA 4W5TA 2GI4A 4KK4A 3HO1A 1Z17A 3Q7RA 4DQDA 3L6UA 2OENG 2R47A 3RH0A 1TMYA 1LBIA 4RU1A 5B3JA 1DRJA 2FN9A 3CS3A 1OXKB 3DBIA 1QQBA 2HPHA 1ZGZA 3LUKA 3N53A 2W42A 3CTPA 3HS3A 5EWLB 5BRAA 1ISSA 4E7PA 3MM4A 5TQ2B 3TMYA 4Z4EA 3LKVA 3N0WA 3ROTA 3FFXA 1YMUA 3NBMA 2L19A 1Z2EA 1U04A 1D5WA 3N8IA 4MS4A 1JYFA 3HCWA 4RXMA 2WRZA 1I3CA 3F73A 1NATA 3VNBA 2NZVG 4XXHA 3RVNA 5JNVA 3GBPA 3D02A 2CHFA 3RVRA 4YO7A 4GNRA 5KQPA 2F8SA 3QLUA 2WB4A 4YWHA 1P8AA 4G0MA 2XDYA 3I5AA 3M6MD 4MLCA 4D6YA 2FW0A 4Q7EA 1JX6A 4D6XA 5EWLA 5IEBA 4EVQA 5IUNC 3OO1A 2V0NA 1QPZA 1W25A 3JTEA 3N0XA 2VUIB 3EJWA 4W5RA 1MB0A 1GLGA 2B1JA 4YCSA 1D4ZA 1Z25A 4S04A 4TN5A 1B00A 1E6LA 2FQXA 3IDOA 4MPTA 5DKFA 4G0PA 1ABFA 4NCBA 5IX8A 3H5WA 1ZY2A 3O21A 3H5OA 2FLWA 4MLDA 4N76A 1NXVA 4WWHA 4PICA 1CEYA 2QU7A 3BREA 3N75A 4IMIB 4EVRA 3IP6A 1ZH2A 1E6KA 3O74A 3GV0A 4N0PA 4RK0A 3Q9SA 4OATA 5DCLA 5KQMA 2RJNA 1ZGGA 3BRQA 4D74A 3OQNA 4OLBA 5BRJA 2CHEA 4E7OA 1RXIA 2FQWA 3O1JC 1QQAA 1JFVA 2IOYA 3N6VA 2VYCA 4JASB 3RVJA 4MS3B 4N47A 2PUAA 3LUHA 5TPZA 2M1ZA 2BGGA 2E4UA 4F11A 2R4QA 3F7NA 1Z15A 1ZH4A 3HZHA 5T7BA 1DCFA 4RS3A 4W5QA 2JVJA 2JVKA 3C3WA 4H60A 2LIVA 2LUOA 4F06A 1EWTA 2ID9A 3SAJA 1P6UA 2B4AA 3TD9A 1CYEA 2FEPA 1T34A 3LUGA 4ETIA 4MS1B 3H1EA 4JAVC 2H0AA 3DGFC 4XLTA 3M9WA 4JB0A 1D1QA 1K66A 1TJYA 5TPWB 4KFCA 3IPCA 3NNNA 3UK0A 1A2OA 3CKMA 3GA5A 4RK5A 4Z4GA 1LJLA 3IP9A 3HJFA 1YK1A 4IRXA 4MS3A 5ED4A 5KC8A 1JWLA 4KMRA 3OLYA 1QKKA 1ZHHA 3RVPA 1TVMA 4W5NA 2MSWA 1Z16A 3CLKA 1U2PA 4MR8B 4RKQA 4YGXB 1C0EA 3C97A 1JL3A 4OTZA 4LDZA 1YTUA 5TPZD 5FWXB 3EQZA 2VUHB 1VRVA 2FXIA 3C3MA 4CBVA 3HK2A 3DZDA 3CNBA 4MS1A 4XASA 1YIOA 3HVRA 4LDAA 2NT4A 3LKBA 3D8UA 3HSYA 3Q7SA 4NCAA 2IKSA 5KQGA 4QICA 2PE5A 1YMVA 1DP4A 2JK1A 5IBQA 5TPWA 4O1HA 1AB5A 2AYXA 1AB6A 2FMFA 3OM0A 2FMHA 3JY6A 2R48A 3K4HA 1FFGA 1VKRA 1JF8A 5DTEA 5JNRA 4EYKA 3T38A 1C4WA 3UUGA 1LK0A 1M5UA 5BR1A 1SXHA 3B2NA 2MSLA 3H75A 1P6QA 2IPLA 3BILA 4G86A 2ZAYA 1EFAA 4F3TA 3O2JA 3JPWA 4LZLA 4MR8A 1ZAYA 1GUDA 4OLAA 1URPA 2DRIA 4NQRA 5FWXA 3MQ4A 3T6KA 3OM1A 1JYEA 2E4YA 5I4CA 4YV7A 6CHYA 2ID7A 4OBBA 5GOTA 3RVOA 2LBPA 4Z0NA 4IILA 5EWMB 3KLOA 4MRMB 5EWJB 3LUDA 4MAAA 5HM6A 4JOQA 3T95A 4KV7A 1BDHA 1E6MA 3LUCA 3LUJA 1JHZA 2PJUA 3O1IC 1BVHA 3FFWA 1JLKA 1U2QA 1RZRD 4N41A 1JDPA 1NXSA 2MYNA 5FBHA 4Z4FA 1NXOA 1OXBB 5TE9A 3KCNA 1FQWA 2L2QA 1MIHA 2O20A 2WJAA 1VLZA 3A0UA 3ILHA 5IEJA 2FMKA 2QXYA 2TMYA 3NNDA 1FSPA 1U8TA 1ZDMA 4GPAA 4KREA 2RJOA 3FGZA 5D2CA 1WETA 3Q7TA 5TQ2A 1EHCA 2FSPA 2PUCA 3OLZA 3HUUA 3BRSA 3GT7A 4LE2A 4ZYLA 1UDRA 3KJXA 1JFSA 4RY8A 3SY8A 1GUBA 4QYMA 3KS9A 5EWMA 4MRMA 5EWJA 3L49A 4G0ZA 1QO0A 1BAPA 3CZCA 3HUTA 4TLLB 2KYRA 3RQIA 4QPJC 4RY0A 3KKEA 1YVUA 4XFKA 3K9CA 1XHEA 3OMXA 4F12A 3OQOA 1LJUA 3NHMA 2R25B 1NXXA 3A3KA 4XAQA 2WJWA 2FVYA 3CFYA 3HDVA 4IF4A 2PUEA 1YS6A 3HDGA 4KVFA 3TB6A 2HQOA 1BA2A 3MF4A 2MYPA 3I45A 5FBKA 4EYQA 2AYZA 4N0QA 3OLWA 2A9RA 3HXMA 1DBPA 1DC7A 2FN8A 3KYJB 1RNLA 3OO0A 3IP5A 3GRCA 3URMA 4UHKA 3LUAA 4MR7B 4WT7A 4Z99A 2VK2A 1SRRA 2GX6A 4TLMB 5HQJA 3LUFA 3P9YA 4PYRA 5JS2A 4WXEA 1RXEA 3DGEC 3CG4A 3KTOA 1K68A 3GBVA 4G0OA 4JA2A 4RY9A 1Y1LA 5HKOA 4PZ0A 3RVKA 2JCGA 1S8NA 1TM2A 5CNIA 4B09A 1QO0D 3H5VA 3T8YA 1JH9A 4JP1A 2RGYA 1VPWA 1SD5A 1H9CA 3RVQA 5JNUA 3IP7A 4LE0A 1SXGA 1PNRA 2H3HA 5CHYA 3ILYA 4RK4A 3IPAA 3QLUC 2X7XA 1PHRA 2HQBA 3A0RB 3QK7A 5PNTA 4ZMSA 4MR7A 2QW1A 3MIZA 4IMJB 5BQ3A 4TMYA 3MA0A 4NICA 1EWVA 3OLVA 2P9HA 5T3YA 4KQCA 4YS6A 3EDCA 1KRWA 2FEWB 3QLTA 2PLNA 3EGCA 4F8JA 1MVOA 1M2FA 3EAFA 3SNKA 3H5TA 2LP4Y 2QR3A 2WMYA 3LFTA 4KZKA 4L85A 4ETNA 2PUBA 4KRFA 3G85A 4WUTA 4Y9TA 4YRZA 3QEMB 1M2EA 2PKXA 4HNQA 2JRLA 4YP9A 1DBQA 3HEBA 1RZRA 1A0OA 3VNAA 5ABPA 1ABEA 3O75A 1JDNA 3KSMA 1RPJA 2J48A 4H3KB 1NXWA 2M98A 1NTRA 2FTKE 1PEYA 3KHTA 4RSMA 2GWRA 3O2SB 4RWEA 5F64A 3F6CA 5JNSA 4RK7A 1QNLA 1NXPA 5KI6A 1YS7A 4OG2A 3CG0A 3W9SA 3EQ2A 4FB4A 3CHYA 1MAVA 2QVGA 2PL1A 3MMNA 3E61A 3Q15C 4Q6BA 4RZSA 5TQJA 2I6FA 3QEMA 1U0SY 2FQYA 1HEYA 2FLKA 5FWYB 1Z13A 1KMIY 3JVIA 1EAYA
chains in the Genus database with same CATH superfamily
3OKAA 4ML3A 3PEUA 5FPYA 1JA0A 1JE1A 2CD7A 2H1VA 1TD1A 3I2YX 2EZ8A 3AHCA 3NH6A 1E2HA 2FOIA 1QYWA 1V48A 2FFQA 3CC8A 3V33A 6AT1A 2HM7A 5IPFA 1AUVA 1EX9A 1O95A 4GMDA 4LECA 4YX9A 4DJAA 3C24A 2OG2A 4MQFB 2FXVA 3R0JA 1G17A 4M6WB 3PYXA 1VGQA 3TD6A 3D6VA 3NQ41 4CUZA 3EXEB 4X1YB 4D7AA 4RSGA 4P3NA 1KS2A 5HZHA 1CR0A 1V5EA 4UDYX 1G6Q1 4LYYA 5KQLA 2ECFA 2HJ9A 2V7GA 5HJEA 4Z4QA 4IIUA 1BKDR 2DVMA 4INJA 4PO8A 2Q27A 4KPUA 3W5SA 3QLVC 4GI2A 1IQPA 2PRYA 3MTEA 4X20A 3DE3X 5JBNA 2HT1A 5EVCA 3UV6A 1XFAA 3RVMA 2O1EA 1Y5RA 3TDNA 2YRXA 3DF7A 4IIVA 4WXMA 5F7OA 4ENSA 4L50A 4REOA 3U62A 1H0KA 1QF7A 8AT1A 3BTVA 2XR1A 4O1MA 5ER6A 2I7CA 4IEFB 3AP2A 5KU1A 2ZIZA 4Q7MB 2QMHA 3QU2A 4DOMA 1TC2A 3OT1A 4NYIR 1V5FA 4G2NA 1QR6A 3NGLA 4WAUA 4BRZA 3JYOA 3H7AA 3WLEA 1E9CA 2YWEA 2WHRA 1D7OA 2FP3A 2YHIA 5JRDS 3S1AB 5HWSA 2NPIA 1JG6A 2G1UA 1Q3TA 3NS7A 3W78A 2C04A 4DBZA 3SKVA 3BN3A 1VRWA 2NYRA 2MHCA 3Q4GA 3D0RA 3D7SA 4H3SA 3C2QA 3V8MA 4EFMA 4P1ZA 1YK0A 2C2ZA 5FOSA 1SKBA 3EB9A 3SHVA 2PRSA 4S1PA 5K0JA 2P62A 1NKTA 2BZ0A 3G9ZA 4D3YA 5GZ3A 2PWBA 2G1KA 3FUCA 4R4JA 1QSGA 4E1AA 1SUEA 5F35A 4NJOA 3H3FA 5IWCA 1PK9A 2WMOB 3HJAA 4QPZA 4ENPA 4ZHQA 2FG7C 9ABPA 3GQBA 4XDYA 3TVYA 1XQVA 2DFNA 2VF4X 2OGWA 1GL3A 2XUKA 3A4MA 5ESDA 3L0BA 1SCKA 4FLMA 4UATA 3QP9A 3TNFA 2DPXA 3EEFA 4PC3A 3BWXA 5KC9A 2P77A 4ZGGA 4FX5A 1OC4A 4EHBA 2YHAA 1A5AB 1AA9A 3I04M 2P6PA 2QBYB 1PFKA 2IHZA 2SICE 3C74A 1JAHA 3OZ7A 3MZ0A 3PC8A 4AJLA 1X3SA 2FX3A 5TQ0B 3QE2A 3KAQA 3O95A 3KRTA 1BXRB 1T9KA 5JXIA 4NZPA 3ABRB 3WAGA 1N2EA 2H5IA 4LHYA 1L7OA 4HLDA 5FYDA 3TN7A 3WY9A 3FDFA 4NCAA 1BWRA 2NSJA 5M5BA 4XD2A 3EPHA 3KELA 3HU1A 2JIZD 3WMXA 1IBSA 2YYSA 1SKYB 2ZE5A 2ZVDA 5FTMA 4PAQA 3PSAA 5TGZA 3MMZA 3OZEA 2HV9A 1UXIA 5DWQA 3EWIA 3ODPA 1GVHA 3MWKA 3R09A 2ZRPA 1EQUA 3CZAA 1C29B 2CBGA 1YDHA 2WSSA 3C8UA 1YA8A 4UAJA 1AKEA 4R2IA 3SJZA 3KTAB 4QUHA 2OAGA 4Q7JB 5HKAA 2O7RA 2XDWA 4OAOA 3BMCB 2HBZA 4JMPA 1Q16A 4E15A 1JQLB 2CE2X 3C6BA 4C20A 1KYTA 2JIOA 3EXAA 1OXTA 3PLRA 2ZR8A 3OEWA 2GBPA 1Z6ZA 3EISA 1XMXA 1XAHA 1EG7A 2QIOA 5BSUA 4JBYA 1XWWA 2CUZA 3U2QA 2NUBA 4CKCA 3E9RA 1IN8A 2X4GA 3JWJA 3OCZA 4MS4B 1P2FA 4W7HA 4QYSA 4TTSA 3TMKA 3H4TA 1M6EX 4DCOA 3USZA 5UKDA 4FSDA 4DLNA 5D3ZA 1TM5E 1XVUA 2AJCA 4AP9A 4LXHA 2QTHA 3ZEIA 4B71A 1OBVA 1WVMA 1I94B 1TMYA 3E9ZA 4P7KA 1TC1A 4OXYA 3PQDA 3PJEA 3DBIA 4HQ0A 4H18A 4RM3A 1CQXA 1ULAA 3KSUA 5J47A 1NMSA 1XAIA 3DV2A 2H4HA 3QQ5A 4Q37A 5DB4A 4OD0A 1QZXA 5BRAA 2EF1A 1LBTA 3MYRA 5C0OE 3RJ9A 2W37A 4PF1A 7MDHA 5J58A 1CVLA 4GRAA 4ZWNA 1QIIA 3LKVA 4NY1A 3UTCA 2ZYIA 1ZAYA 2OP1A 4I4TF 4ZCPA 5C1BA 4M36A 3I4LA 3T54A 1OVMA 1YWGO 4U8GA 3F4BA 2WRZA 3ZH9B 1PJBA 1K92A 3KQQA 3VYVA 1XU4A 3NT4A 4XVUA 1G98A 3GLGA 1JJBA 4PLYA 3TNYA 3ZQ6A 1IUNA 2PYZA 4GC5A 2MIIA 1M8KA 1QHGA 2FJ0A 1GZ6A 3HQ4O 3LDFA 3R4VA 1DTEA 5AHRA 4XYBA 4R1PA 2VOEA 1CQZA 4WEOA 1RPNA 2VK8A 1Z74A 3E2MA 4R6XA 4YAWA 4DCVA 5DM60 4F4CA 1V6CA 3U7QB 2FMUA 4E2ZA 2ZQYA 3R23A 5CDUA 1JHXA 4IVQA 1JYSA 1FMCA 4JX9A 4TN5A 1SKAA 4OGLA 4Q19A 4AROA 3NC0C 2JJ1D 4BU0A 1KVQA 4AJIA 4CR7A 1E89A 1K8YB 3GA7A 4M83A 4WNIA 4AG3A 4GE3A 5ICEA 3GFQA 1J2EA 4I6JA 3AOEC 3NBZC 1JAZA 4YASA 3SVZA 5KHLB 3O3MB 4EF4A 1Z0SA 2PJZA 5D7NA 4QGGA 4U9UA 1GUYA 3C1TA 2W6JD 1YRYE 3UHOA 3GJ6A 4CU5A 1HM5A 4P3XA 4UM9D 1NI5A 2RG1A 3BFKA 4JL8A 4MVCA 2ZJFA 3HE3A 1X6VA 4K6CA 1F14A 4RK0A 4Y9SA 4YJFB 5KYGA 1N32B 3Q40A 1KS9A 1V7QA 2XCUA 4FUTA 5DSZA 2C59A 4Q0MA 1L4LA 2B7BA 2AK2A 1NVMB 1OU4A 1EFUA 2GZAA 1ENYA 2P3LA 3JYPA 2JFOA 3L1VA 3R6GA 3JRNA 4FXOA 4IX9A 2EERA 1XRRA 3VR1A 1JFRA 4W82A 3GVHA 5ILGA 1SBHA 2HZ7A 4G9BA 2KSQA 2ZS8A 3B5EA 2PLFA 4PRZA 5AK3A 3GROA 4P4LA 2I76A 1KYZA 3Q8MA 1GHTA 1BQ3A 4YCJA 5LWQA 2VP9A 2UVQA 3VGJA 1DCFA 3D5EA 4J0IA 4J4TA 4EHLA 5JZVA 2Z1MA 2LIVA 1V3QE 1PZEA 3QVTA 3EGEA 3TD9A 1GAQA 2C5LA 4KPEC 1EA7A 4IMPA 1XTIA 1QGUB 3KUDA 3ILVA 2WYIA 3F3SA 4C21A 5BXQC 1Z7EA 1MF7A 2N47A 3JV7A 4CTOA 5B1SA 1C5KA 3GVPA 4JOSA 4D0LB 1SAYA 3IMKA 3KZCA 2Q0XA 3E35A 1DSSG 3OT5A 4P86A 4EB0A 3SYRA 3WDSA 3AVVA 3GZJA 4I1VA 1NMEA 2HYIC 1GNVA 2O2EA 5ED4A 4X8MA 3WFJA 4AYTA 3DMNA 5CVVA 5F2NA 1F7VA 4B1FA 4P08A 1NW6A 1VXRA 2P35A 4R3UC 5EERA 5JJBA 2LV8A 1MTZA 1E79A 3USCS 1NF2A 1AQUA 3VR4D 3TVTA 1PVOA 1ZRMA 3D3WA 4BTLA 4E5PA 3LPDA 4NMHA 1G8SA 2AVDA 1UUFA 1OW3B 2NN3C 4IOJA 2WKSA 4ZO9A 4NPHA 4B43A 3MRVA 3JQ7A 1YIOA 3NHBA 4LZNA 5JVDB 2F48A 3HVRA 3H2SA 2VAPA 5D3MA 3HSYA 3T5GA 5KQGA 2I2BA 3SR0A 2JANA 2W8BB 3U81A 4O1HA 1L5QA 1YOBA 2CMDA 4LC9A 2FMHA 3R0XA 4L9SA 3KJGA 5AXCA 3RB8A 4B2IA 5CX1A 1P2TA 4U7WA 2AMVA 2WKQA 2QD4A 4C7MA 4OJQA 2AKAB 1M3SA 1EFAA 4U3JA 3RADC 1TUBB 3BA1A 4GLJA 5AOAA 3WLOA 1UDXA 1CUEA 4YAEA 4QDJA 1UZUA 2C4KA 4NAHA 1ISIA 1YB6A 3AVTA 5DXJA 2C2KA 5ELXA 2XKAA 4RTMA 3G5TA 3GRUA 1WDMA 2HA6A 3JWHA 3PNKA 4Q48A 1SELA 5JXGA 4R71A 2FPPA 2JFUA 1E0DA 3BL8A 4IILA 3VPSA 4DDVA 1EVJA 1GA4A 2BMAA 2PX2A 2AOTA 3B8HA 1J5XA 4YV2A 1PG5A 1NBIA 1UDCA 2CE7A 4YRPA 3K6RA 2Q5OA 3O1IC 4CM9D 1L4BA 1ZNWA 4HRYA 1DRUA 1XTSA 1JDPA 2AZDA 4FHGA 2XB4A 3FNIA 4Q9HA 3VZQA 1VMAA 5E6SB 3N0VA 4KWCA 4MPPA 1YRHA 4PIMA 2EHJA 5K0GA 3SQXA 2ET6A 3RGGA 3EXFB 5EHZA 2DTDA 3DM9B 3V6MA 5IFLA 1FSPA 2VNSA 1H1DA 4DCNA 3JZFA 4UU8A 4N01A 4RVUA 4TMVA 5A1TA 5B4TA 1C2YA 3FGZA 4QOGA 1Q77A 1QK4A 4GMKA 4B87A 1KJZA 3C3PA 2CNLA 4XM2A 1RJ9A 4L0MA 4RKEA 3OTGA 3GN2A 3WL3A 4PG8A 4OSEA 3KJXA 4D98A 5FTLA 4QJBA 1EUZA 1SVWA 1NZDA 1O96A 1SULA 2OSVA 2BZ1A 1YQXA 4QPJC 4DWWA 2CT8A 1YVUA 2WFLB 4D81A 2UDPA 3I5YA 2PX6A 4XEUA 5CW1A 2DHDA 1J0CA 3UJPA 1ND6A 2WLSA 4B81A 4H7EA 1AHPA 4KQEA 3P9PA 4RELA 1Y80A 4CLHA 1JAYA 4UVHA 4Q5IA 2WHQA 3DHNA 3FUVA 4OYYA 1DC4A 4K3VA 5JFTA 1IN4A 2JCBA 2MYPA 4JBGA 1SHJA 2VSYA 3ABZA 4L5CA 3MUOA 3UEOA 4RH3A 3B3JA 3A7DA 2ZQZA 2GX6A 4Z8XA 4YMTA 121PA 3NV9A 5SZJA 1MENA 1UFQA 2AMJA 2CJWB 1DO0A 2RBGA 3WWPA 1E1RD 1X70A 3PQ2A 3DOCA 4OXNA 3ZIDA 2XBMA 4P4SA 4ZT7A 1CPYA 4YVFA 1I5OA 3DLTA 4IIHA 3TRFA 3BG5A 4NLLA 4EG4A 2NUTA 1K4MA 2XGJA 3ZTWA 4N3NA 3D8TA 2JKYA 4H9GA 2GBLC 4J43A 2ZZMA 1H9CA 2GN0A 4GXTA 3HV0A 1N9GB 4PPQA 1OLXA 1JIJA 1A8QA 1VL5A 1TVKA 3LPLA 2G08A 1A98A 2K2WA 1QC5B 4GMXA 4NCXA 3RC7A 1UC9A 1SK9A 2H5LA 3AFNA 2ZIGA 4X90A 5M04A 2H16A 2O6HA 2AW3A 3OU7A 4U7GA 4GL2A 5L45A 4EF6A 4PLVA 4NFSA 1I3NA 4CPDA 3V8NA 3QPAA 4O63O 1NBOA 2QZPA 3EASA 4NHOA 1G6OA 1KFEB 2XSZD 4XGKA 2ZWOA 4KQWA 5G4KA 3N7UA 5AI4A 5FUWA 3O8LA 4ZP1A 1NRIA 5L6MB 3ETGA 4XGQA 4P3OA 1G8GA 3SS7X 3FYUA 1UJ5A 1H2XA 1LVGA 2VHZA 2FF5A 4JFRA 1GXSB 2RHDA 3NDJA 3NHSA 2XTZA 4ZU3A 3SLKA 4DLXA 3FFBA 1B0PA 3LVQE 4R2WA 1N33B 2JRLA 3G7SA 1E0JA 1HI9A 2F64A 1VYTA 2AOUA 4QGBA 2WKPA 1RZRA 3DNMA 1I6WA 2A9VA 4BFLA 2J9FB 1X14A 4EW1A 4XFDA 2O0HA 4JLUA 4YRBA 1CF4A 3B3GA 3TKYA 5KJCA 4OGFA 1G63A 4RCZA 4K9OA 4NTZA 8OHMA 4M9RA 2DX7A 1Y5IA 3OZDA 5F5NA 4QG7A 4ZJZA 2DERA 4AURA 4MHSA 1PEYA 5JNSA 3TLKA 1MO2A 4KAAA 2HPVA 1KGDA 2G8LA 4AKTA 2YY5A 1OX4B 1ZI6A 1E2KA 4BAGA 3P0RA 4D57A 3W8FA 3KXKA 4H0NA 2WD7B 1INLA 1G64A 2IZOA 2X2OA 2IX9A 1W2WB 3VR5A 1SCAA 4WBNA 2GZ1A 3DMRA 3EIEA 2DKNA 4PPGA 2KW5A 1I4WA 3BULA 4F5WA 3MMNA 4Q9JA 1K7SN 1Z3IX 1PT9A 1SQSA 3IP1A 4O4JB 5F2EA 5HK9A 1A4IA 3SMQA 3QF7A 4DR2B 3IHWA 1II9A 3T3MB 1IN1A 5GGYA 4U4AA 3TE6A 5KSPA 4KBFA 1Y4DE 3PFHA 1VXOA 3VI3B 4BYGA 5JHGB 2VDKB 1D2AA 1R8JA 4BN5A 1A5TA 1SMKA 4J0FA 4N0EA 4MWEA 4FMDB 2CLOB 3WIVA 1TIPA 3GN1A 4NVRA 2ZULA 2W2OA 7MHTA 1W5FA 4ZREA 4ZT5A 5K3DA 1B73A 1N6PA 1DCTA 4WFQA 2W98A 3FWPA 2EZ4A 4QYWA 3LP5A 5L3VA 2DR3A 4LHWA 5KHAA 3AL2A 3PUJA 3A2MA 1X42A 3W8EA 4A0HA 4KCGA 4YCMA 3K70D 4PYMA 3WSWA 5IAOA 1QFSA 2IDKA 3BIXA 3GGDA 1YQ9A 2O50A 3JVDA 1BVRA 4Q03A 2Q1UA 3IOMA 4B3GA 4OHYA 2VNHA 2VSXA 1TKCA 2C9CA 1NQ5A 1VGRA 4UNPA 3AUSA 3OZCA 4BMZA 5IT9A 1A7UA 3BJIC 3EQ9A 1G291 1SC9A 4A0RA 4JB8A 3ONFA 3E9NA 5CPBA 5CFZA 5FQOA 2IZ1A 2GNAA 2ZUWA 1SCIA 4EYOA 4O4LF 2E6UX 2IHNA 3CLSD 5FFMA 4E4YA 3A1UA 4REQA 1YBFA 1GGFA 2IIQA 3AI1A 1C14A 1F4PA 3EWNA 5KAMA 3ZU4A 3DZKA 2OXIA 4MOWA 1A8UA 4PHHA 1DPFA 4K0RA 2O7SA 2GARA 5AOBA 5REQB 2PX8A 2ZT7A 4LRWA 5FNVB 1QK3A 2X42A 4FFDA 4IS3A 2C5HA 3N39C 2B8NA 3NTLA 1XPOA 2GZSA 5GIPE 3GEIA 2XGOA 3MJCA 5KPJA 1V1RB 1GGHA 1O95D 3COWA 4P93A 2OWDA 4A82A 4NAVA 3VO9A 2YFKA 3P5BA 5BPFA 3BZBA 4Q3AA 4P5DA 3OY7A 2FSIA 2PZEA 3V48A 3ZWVA 3BZUA 3WOVA 1Y33E 3TIXB 1LLQA 2JCSA 4AY3A 2QTGA 5H82A 3ZU5A 4BNNA 4HQNA 2NUAB 1X7GA 2I6QA 4HDNA 2E4XA 3G1WA 5I7WA 2ZB4A 3WLFA 4G5GA 4YUWA 1O0CA 2YXDA 2AS0A 2GDZA 1BS2A 2V6IA 1QIDA 1QZ3A 1ZIXA 2ORED 1NUTA 1UBLS 1CUSA 1XCJA 3M82A 4Y98A 1H1TA 1ZJ4A 1NAIA 1DELA 2IIVA 2XEDA 5A4AA 2UYHA 2KLBA 2R8OA 3O8CA 2E18A 1GCGA 2NIPA 3G79A 4NE2A 4HGZA 3O5AA 3UFBA 1JLMA 4DZRA 3LDUA 4ETMA 1EB9A 2I67A 4GMHA 4EO9A 1PJ4A 5IZ4A 4G4SP 5AHKA 3V42A 1QS0B 4BP1A 5FBQB 4H6XA 4JLNA 1USUA 4AMGA 1UXOA 3FTEA 3MSXA 1L2TA 2WWFA 3KYCA 2PZLA 5B3AA 3VTZA 2G36A 2CXXA 5JEEA 4LYJA 1G5RA 2SKDA 4BLOA 2C4VA 4U7PB 2DY0A 2IOFA 4X85A 1N1EA 4HF7A 4IOKA 5JQGB 1KO5A 1ZO8A 3FWYA 3KVNA 1RXVA 3LWDA 1I4DD 3QXGA 4IY1A 2BP7B 4K9SA 1ULHA 3X2FA 1XZQA 1J0XO 2P5SA 1C7EA 4GWLA 1MNAA 3CVJA 3GW8A 4O08A 4N9WA 3IAS1 4OK3A 1P0CA 4EUKA 1KK2A 3BCRA 4DSZA 4HWPA 2HNAA 3OMWA 1U7UA 5AVQA 3QX8A 3OF2A 1J42A 3TZBA 4QQNA 3K15A 2VP3A 1IIBA 1YDMA 2PR7A 3AVWA 1AK1A 3LGXA 1DRKA 1NU8A 4G67A 2OT3B 2EFCB 4MWCA 3QLVA 4E88A 5D7BA 4XQEA 2CLFB 2E1RA 4Z0HO 2IL1A 3R7WB 3TOVA 4PSKA 1U2EA 4S0XA 1N92A 2RH9B 5E2IA 2OQVA 3RVSA 4ALIA 4JC0A 5JMPA 4A7PA 3B2QA 1T0IA 1CE8A 3A4TA 4PBSA 4JBNA 1NYTA 2FZGA 1KFKB 5FCDA 3PQ3A 4H0CA 4GPD1 4OLHA 3WGHA 4RE5A 3AX6A 3HEAA 4QBIA 4LF5B 4RPGA 2IZ6A 1BO6A 1X8JA 2X6QA 2XT0A 2O7NA 2Y6VA 1WCWA 5F9MA 1F48A 1LBIA 3KAJA 4F1WA 2E48A 4P5EA 1WMEA 3A9UA 1J25A 4UCQA 4YDSA 5DGXA 1P1KA 3DHEA 5ITZB 3TRJA 2XJ4A 2WSSD 3LVRE 3CPSA 3N8GA 3U3ZA 4ZI7B 5LA6A 3WHKA 4EB6A 3OTHA 1UQUA 4GRIA 3TMYA 2BWJA 1WXQA 1V6AA 4MK4A 2WE7A 2WU3A 2CFOA 2ZSFA 2IUYA 1RWKA 3DHVA 1O58A 5DK6A 1XRNA 1HG0A 2ZCVA 4O0MA 1U04A 5ALYA 1D5WA 3TTUA 3WB9A 4UTOA 5BSRA 2C4WA 2GCOA 1HWYA 2Z57A 3D4PA 3NALA 2F59A 3ZHBA 1X7DA 1UT6A 2Q49A 4E4RA 3THXB 3UJNA 3E81A 1E0KA 4KYIB 3OC6A 1SOUA 5T41A 5E0KB 4PZAA 4L2IA 4QEKA 2QAGB 1AMNA 2VOJA 5F5LA 1EP2B 2B8EA 1TT5A 3QLUA 1SUIA 1M72A 1LSOA 1N8TA 1RQNA 1LW7A 3DZHA 5CLFA 4XH9B 3N8HA 4D6YA 1J22A 1BYUA 1HT0A 4DMHA 4QASA 3G8AA 3N3BC 3R40A 1QGAA 1NC1A 3VOSA 4BHTA 4D3SA 2E2WA 5BURA 2J0VA 3PIDA 4R2MA 4CF4A 2FW6A 3MUEA 4M21A 5HGJA 4EITA 5GZ1A 4HGPA 5KU7A 3QXSA 2X5JO 1D4ZA 3COZA 3G0BA 1JIXA 1DC6A 2FWAA 2HZBA 1V96A 2H9IA 2X0FA 1ABFA 2QW8A 1JH8A 1S2NA 3O21A 3OPYB 4FVTA 1I2BA 5AUOB 3MK31 4BJ3A 3CX6A 4JCOA 4XYLA 5KSZA 1NJ1A 2JCXA 1GRQA 5IJ9A 4ESEA 4ZVLA 1EGMB 4I66A 2Q0SA 4U63A 3UGQA 1KZ4A 3LT5A 3N8NA 3MTBA 4LVNA 4B3IA 1THTA 5AD1A 1RQPA 1QH9A 3MWDA 3FH0A 1EE9A 4BDTA 3ZN2A 1SCUB 2XIJA 3ZEAA 2RJNA 4V3BA 2OHIA 4NZNA 2JHFA 5MFZA 4OLBA 2RKWA 5BRJA 2J08A 5AKEA 2VK1A 4H0FA 2PNJA 3VZDA 2OO7A 1QIEA 4LTMA 1YVRA 3GP8A 1GNTA 2WT8A 2VWGA 4FTWA 2DFVA 1G7RA 2H2GA 2O5VA 1SQ0A 4IKPA 3G17A 2IQ5A 5IVIA 3E9CA 3KNZA 3SHQA 2FE1A 4WY2A 4KR3A 4YQYA 5B2EA 1GFSA 2FVXA 2D2VA 2QTZA 4II3A 5D01A 1TA4A 3S4YA 3WWCA 5CPFA 1EJ0A 2EIXA 2D1YA 2ZTUA 1L4YA 3LT0A 2PX0A 3SE0A 4WI1A 1NR5A 1N0WA 5H68A 3G7UA 5CA0F 2DPMA 2NP7A 4XYGA 1PGPA 3HFSA 1WEKA 2VLBA 3N5CA 1ZL2A 1VMDA 3BDIA 4ND3A 4KFCA 3IJPA 3UK0A 4YJ3A 2Q1SA 2QMZA 4DHWA 2AKEA 1H6AA 3VPFA 1GTMA 3CCFA 2BI7A 4CODB 1CXZA 4D0SA 1P2SA 1Q19A 2IKQA 1AY0A 1KEEB 1BG6A 1CUFA 3AKYA 4KXFB 4K6KA 5BT9A 3RU2A 5TT1A 1WE2A 4EJSA 1A4XA 5A71A 3DKKA 3U31A 3CJRA 1AK9A 1PJCA 3KUCA 4Q9IA 2FXIA 3C3MA 3GJ3A 1MAAA 4NOJA 4MS1A 4YMSA 4F96A 1F2UA 2VUSA 1Z62A 3SMVA 4CV2A 2PXXA 1ODJA 1T2DA 1Z5ZA 3GLHE 2DZDA 2OILA 3HCOA 1SC4A 4HATA 4N5HX 3MS2A 4WFKA 2H9AA 2C82A 4MQLA 1P1JA 3GLSA 4ZZ3A 3G59A 1IJBA 1TAHA 2DPYA 3HMQA 2EFGA 2HO5A 3L7IA 1Z7GA 3MS4A 4Q01A 1YRLA 4OHPA 1M2WA 2I1WA 1AIPA 3C4QA 3O2JA 2GJSA 3R2JA 3AOEA 1RYZA 3Q1KA 5ERYA 2B9EA 1GUDA 4E12A 3ZNNA 5K9ZA 3S70A 1XRLA 2P2LA 2X4LA 3C3XA 1F0YA 3D1VA 4X6XA 5TXGA 3S8EA 5I4CA 1C1XA 4JZYA 3FNBA 3HWRA 4NNJA 1GPLA 3WGUA 3JARA 1RRVA 1TFUA 2AXPA 2QQ0A 5AW4A 3K73O 2O5CA 5E2BA 1I7QB 2NSHA 3E6AA 1Q2UA 1H93A 4BV3A 4FIDA 3V1YA 2E1PA 2HWKA 1RKUA 2OUKA 4KQMA 2EBFX 5DLYA 1B0ZA 2QYTA 1QF9A 4N41A 3ZLJA 2RK3A 4CEIA 1L7RA 1IK6A 1WOYA 4Z4FA 1XWIA 3NATA 3R3XA 2Z6VA 1G18A 2ENUA 4IQFA 3GJYA 1N78A 5FAKA 2PX4A 2QMUA 3SFVA 2E9SA 4UAGA 3B1XA 2AFHB 1U8TA 1WQ4A 1YTLA 3L8FA 1OAOC 1IVSA 1RMYA 1ZNZA 3QM1A 3H0EA 2VJMB 1VPEA 3EZ6A 4EPVA 1ORVA 3ASUA 3PEFA 3SYLA 4RZUA 1DDGA 1XD8A 5LLSA 5L8VA 3QHPA 2Y3IA 4ZQFA 1GZ3A 2X0EA 1YKGA 4RF3A 4RM2A 3ZGXA 3EDMA 1V39A 5EWJA 4G89A 4NV1A 4G0ZA 1WKCA 1Z5WA 5JE8A 1NLYA 2C8KA 2GZ3A 4YMVA 5FIUA 3S81A 2OOKA 1YE3A 3GRKA 1LJUA 1K0UA 2QRLA 3J7TA 4JR2A 3UBMA 1ZCJA 3EUEA 1YACA 3HDGA 1A2QA 4Y2SA 5IFKA 5KTRA 4PG6A 5JH7A 1H2RS 4R9RA 2JLBA 4KO2S 3C6KA 3L02A 3AM3A 5DV9A 4PYOA 2J87A 2YXBA 3H9CA 3HRKA 3PFWO 1R0LA 3GCGA 3VC3A 3CRW1 3ORSA 4NULA 8MHTA 1KR2A 3D0OA 3ZBQA 3GRCA 4HXEB 4M9CA 5U1PA 1D9ZA 3CX8A 3UMBA 4A26A 2SKEA 2QLMA 3K0EA 3OFVA 1DS6A 2R1TB 4QM6A 4N0MA 4OF4A 3IPXA 4R7TA 1FVOA 1K3UB 1LH0A 2IYRA 3QSYA 3MQ2A 3RREA 1RXEA 4ZCLA 3W8NA 4BKMA 4Z9XA 1IATA 3JQAB 1RC8A 2BSXA 2C4MA 4C14A 1PKXA 3I4CA 1HO3A 5E3IA 1BD3A 4JJ7A 2RHTA 3HRIA 4ZRNA 3L4BC 3OF3A 5CBPB 2E6KA 2EEPA 4JC5A 4CDMA 1NSFA 2ZJ8A 4BCDA 1DHRA 3ZVMA 1NVKA 4LS3A 1XFDA 2C1XA 3VISA 1UMCA 4J91A 4M8SA 4ND5A 4RPJA 4I50A 2D5LA 5IM5A 3U19A 4BCCA 2NG1A 1O03A 1V16A 3MILA 3FSRA 3IPAA 4RK4A 4CFYA 4V03A 3NM5A 2OYRA 2R6AA 2ZKIA 2GF0A 4Q1DA 1C1HA 1M2VA 1XWFA 5PNTA 1YF3A 5DGHA 4ZARA 3JASA 4UM8B 2C7OA 1G3IA 2Q3LA 2WIGA 3IOBA 4LC0A 1A72A 5ARCA 4KO3S 4PCAA 1JHUA 4FYMA 1FSGA 2P3QA 4JFAA 1ISJA 4W99A 3I9KA 4I14A 1VG8A 1RMQA 2ZDHA 4K1XA 5DTRA 2HMWA 4KXQA 3SNKA 1BIFA 1JLHA 1WD5A 4OKIA 5C8VA 2WG0A 3OPNA 5EUQB 1YS9A 2Z2KA 4S1TA 2JAUA 4MW1A 2IS1A 4XVHA 4I46A 1R6TA 3QEMB 1ECPA 1OLUA 1Y8QB 3DMHA 1X38A 1KJQA 4KN5A 4X92A 2BL4A 1DBQA 4H6VA 2HGZA 4JBXA 4X1IA 5COAA 3A6PC 3CWZA 2PANA 4CRWB 3WFIA 4DCUA 2PMKA 2W2LA 5IASA 4YRDA 5DHTA 2GEFA 3K1ZA 4IH1A 3I6QA 1XZAA 2Z5GA 2BEUA 5JAUA 4WKCA 5IAAA 3PXGA 1YR6A 3L7NA 4FQ7A 4D3DA 4KR0A 2B92A 4LZOA 1DFIA 1HORA 1IHXA 1K7CA 2BFBA 5SYNA 3W77A 3WK5A 5C37A 3MRXA 1TPYA 4XM1A 2LRHA 2XYQA 2TECE 3EF0A 3LX5A 2PWAA 1N0VC 4HDMB 4HZGA 3K0AA 4FCWA 4TV8B 2A9FA 4RZSA 4Q3EA 2NW6A 1AC5A 1BW9B 3MGBA 4KUGA 3IE2A 1HQYE 4GOND 1KZGB 3KD2A 3WGOA 2PU7A 3ESDA 2D2XA 1QH1A 1Q3KA 4RA9A 1L7MA 4WLVA 4HEJA 1TK9A 5D84A 1ZKMA 2AN4A 1JQ5A 1QJCA 2B30A 4IZ6A 2O06A 4M0EA 4XOIA 3MMSA 4LX8A 1XMOB 4KQ6A 2D0DA 4X54A 5CLIA 1TYZA 1I3KA 2WSYB 4Z8YA 2EJBA 4LHXA 1KDOA 1WPGA 3T99A 1W1UA 1UJCA 1FQOA 2HA2A 1RLOA 2HU8A 3GRAA 3KETA 3GHHA 3H1AA 1NPTO 1R6UA 3HP4A 5BNZA 1GL6A 2FFJA 1Q5PA 4DB4A 4QOSA 4QFBA 1FMTA 4UC0A 3DO8A 5DXAA 4GKKB 2O8EB 1M6VA 5FKJA 1F6DA 1T2FA 4B9AA 2H1LA 1Z06A 2XIQA 2OZLA 4HZIA 2GBLA 4XYMA 1UMDA 5KX5B 1R0RE 2QRNA 2R5NA 3VO2A 2TYSB 3VYWA 1I3OA 3VR5D 4NBVA 5KYXB 3DOOA 2FEAA 2BR3A 2WU1A 2O7QA 3LYUA 3OIWA 4QU8A 4IIYA 1EFRD 4X63A 4TWAA 5IM4A 2VPYA 5FLKA 1Y9JA 4UVIA 3C15C 5A5DA 4C3UA 3B78A 2HMYB 2H4FA 2VDUE 3THSA 2HDWA 1BHJA 3U40A 2QB5A 1UFRA 2H48A 3B9BA 3KZ1E 1TJNA 2YMLA 3IFSA 3UHFA 2VPXA 4X9XA 3DMDA 2IP1A 4RH1A 2HBYA 4G3XA 4MI6A 2O57A 1CY8A 1TF2A 3JS5A 5EZ5A 1GPNA 2C83A 2OCPA 4EDFA 2HK6A 5I7AA 4JVMA 5BN5B 4G0QA 5J63A 2P3SA 3UANA 5CA1B 3F9CA 3QTLA 2XWSA 1XLTA 3J7AC 5LKRA 5HTKA 4QUJA 2ZSHA 4OGWA 1YZGA 1NVWQ 2FPIA 3MERA 2JFZA 3ELWA 4WACA 1BMQA 1PR0A 5JASA 5J43A 2FWJA 1Z2DA 1DV2A 3PR3A 1P81A 1KF0A 4JSTA 1RFLA 4F9FA 4ZYUA 4QELA 3LZDA 1U6KA 4WGFA 4ZIRB 2W2NA 3KVYA 3S99A 2AT1A 3DL0A 2W6QA 4KL8S 4D43A 4HNRA 4O4LB 4WGGA 3I2JA 5E9WA 4Y0VA 1UANA 3RS3A 3BMOB 2QM7A 3G7NA 3VZPA 4BQEA 1QXSA 3NKLA 4DMFA 2PXCA 3KLNA 3M89A 1H0HA 3AUAA 2FWPA 4I8XA 1L5SA 3ZTYA 2F62A 2EFHB 3F6BX 1EBFA 1RU3A 2RJ3A 3QFCA 5EXTA 3ZTTA 2FZWA 2XQKA 1IJEA 5CDTA 4TTRA 5KYYB 2JBAA 4K5QA 4D3ZA 3I42A 3UK2A 3HP1A 5BSVA 1KSJA 3KR0A 3LW7A 3L8CA 2FPSA 3OFNA 2PMWB 4O2AB 1H23A 3SQLA 2PQ2A 1BH6A 2CXHA 3GUUA 4P84A 3ICQB 3ZU6A 2G77B 4MCAA 2DECA 5D51S 4GUAA 2XE8A 2XCIA 3DKPA 5B5SA 1N5LA 3M3DA 3CRZA 3AF0A 1YBVA 3QWFA 3D3KA 3RAPR 1MW8X 5CXXA 3JAMA 1RJWA 1NVVQ 2BM8A 2IXFA 1OIXA 2QLLA 1JE0A 2R6JA 2W7TA 3D6FA 5AK0A 1GLVA 5JWOA 4HLUC 4OFBA 1TU0A 4WDRA 3TE7A 3MD0A 3R7DA 3SXPA 5CNJA 4WLUA 3PNLA 2WSMA 4J9UE 3MJDA 1GYPA 1H1LA 4LUCA 5HZMA 3DE5X 1VZ3A 5A6SB 4PQRA 3DAFA 4OHFA 4QXMA 4CIVA 2XB9A 3V00A 4ZO7A 1AUPA 1E1YA 4X1KB 4HH4A 1G2PA 5KTKA 1FFSA 3MPUA 1DQPA 4PEVA 1IUKA 3L01A 4FKZA 4A6DA 5ICMA 2VBIA 3OMLA 4UD2A 2Q4RA 4QVGA 3I09A 2BV3A 4DSNA 3D3QA 4AKGA 1E5QA 3F6EX 3HBMA 1IOWA 1FJ2A 1P73A 4ZVVA 1QGED 5THKA 3KQNA 2JH3A 2C4NA 1XXLA 1SQGA 3ONEA 1F3OA 4O29A 4DPLA 1TI7A 4UM9B 4CG1A 1JECA 2VIIA 3NM4A 5H4GA 3JQGB 1PYDA 1D1PA 1XTQA 1Z0IA 2Y4NA 3H6HA 3UGKA 2P91A 2VDWA 4AMUA 1CZUA 2EFDB 5JYBA 2YJ6A 4TYPA 1R0CA 5B53A 1JVBA 4MV0A 3VOAA 3YASA 2XCSB 1VHDA 1S96A 1X39A 2GD2A 1VDZA 2OC4A 4K9QA 3V4SA 4BFVA 5IS2A 1GU0A 1DRJA 3DC7A 5FBZA 5MN4A 3A3NA 2JD0A 3JZDA 4XWWA 5AH0A 3EY4A 1LEHA 4JNKA 3ESYA 4O4HA 2RGDA 1E1DA 4ALKA 4ZEXA 1OH8A 4BUJA 4KE6A 2Z3ZA 3N0WA 1LFAA 2C5SA 2IK8A 2C2XA 2CCGA 3LYAA 3TAHA 2B8JA 2CCKA 2HLNA 2R8XA 4G36A 4N5IX 3IEMA 2ROQA 2G9ZA 2ASVA 1UBCA 3BGWA 4KR7A 4B75A 4NBSA 3B70A 2QRGA 3ESQA 2PZFA 4JROA 3OZXA 4Q05A 1W30A 2KPOA 3LGAA 2Q3DA 1DOZA 1ZCZA 3OTQA 3CB2A 2OO5C 3FHJA 4QQKA 5TDHA 3CRVA 4ARZB 1RKXA 1U1IA 3VUFA 2RE8A 3U56A 3UCFA 1P8AA 2QRQA 5AXBA 5LYJF 1JEYB 5H3CA 3QKSA 1V26A 5EP2A 1AKUA 3TQRA 1NMQA 3B9RA 3COYA 4R9UC 3P96A 2JFVA 1QRAA 3QPUA 4GZ6A 1ZXBA 3LQKA 1QPZA 4RLQA 1W25A 3PXAA 1CJTC 1SIWA 2FETA 1TZMA 3EJWA 3D8BA 3SLRA 2JZNA 2H52A 2CFSA 2F1RA 3K9BA 3L8DA 4MGZR 1JTVA 1UAYA 5CDFA 5BMOA 2J8ZA 1DKUA 3IIMA 3OIYA 1JT9A 4G0VA 1PQ4A 2VDOB 2HT6A 5ALQA 1DC5A 4C7KA 1MLDA 3ZDDA 2C2OA 4TXNA 5DYGA 1R5NA 4YT2A 1GL7A 2F90A 1FP4B 3CE6A 4FZ5A 1XKQA 2DCMA 1CJMA 2G1PA 2AEJA 4ZOEA 3CW2A 2WIAA 1K3TA 3G89A 1ZUD1 1SBQA 4P3PA 4R8MA 1FTQA 3WTBA 2RAFA 1E6KA 2ZREA 4N0PA 4ERNA 2Y9PB 1CYDA 3Q9SA 3QKTA 5AVWA 5G0VA 4BV9A 821PA 1ZSNA 2BHLA 2VG8A 4ZEWA 4ZVOA 2WC1A 3GRVA 5KINB 2PSSA 5JZBA 3DD5A 3DV9A 4GSYA 4YT5A 2G7ZA 1LQ2A 3MGAA 4JEUA 5JBIA 4NU6A 1O9GA 4C5AA 3ZDXB 1YASA 4NZOA 3WIUA 1JR3A 4D45A 3UAOA 4F9TA 5FPQA 3KT3A 2PG3A 3PZRA 2IGTA 3SBXA 3UHAA 1BMFD 4E51A 4YCAA 3WGJA 3DOUA 2XUIA 5L3RA 2ZBPA 4NCJA 4TSFD 5MGBA 5AI8A 2ZIFA 4BVLA 2YJZA 4F1JA 1GLNA 1Q0UA 2JCYA 2FEPA 2N75A 1P44A 3PUWA 1SUFA 1W1IA 3N28A 1CULC 1JLLB 4WIAA 2H2AA 4BLTA 2GM5A 5EIEA 4FYIA 5EYPA 4A23A 4GAEA 4RVDA 1MAUA 1GKKA 1ZM4A 1E2LA 2O1WA 1MTOA 5KOJA 1IBLB 2AN5A 5K8UA 1Z39A 3ACDA 1RWXA 2HK8A 3E8XA 3NVAA 3O3CA 4I7EA 4DMKA 4BO4A 3TIVA 3EHEA 1U81A 5KC8A 2R6GA 3MCUA 4DTIA 5CK5A 4DCTA 3GGSA 2ZYRA 3HB7A 3G0OA 3I58A 1CVIA 4RKQA 2G82A 3OICA 4PRKA 4ENTA 1YTUA 4XM0A 4CDNA 4FIZA 3R7FA 2QVZX 3DR5A 3SZGA 2QZSA 3AF5A 4C4XA 3R5SA 1NYQA 2GHTA 4FCTA 4Q4AA 1QK5A 4JT8A 4HLCA 4CL0A 1T0JB 5JZOA 1Q7BA 3LF2A 4PIPA 2QN3A 3B9QA 1N2BA 3E9YA 3EJ6A 3PRJA 2OB1A 3UMYA 2VXOA 3O8DA 3CLHA 5TPWA 5B4VA 2WFMA 2O5EA 4WNAA 1NVUQ 2YXEA 4LA4A 3LSYA 1E9FA 3TR5A 1FL9A 3TLGA 4BLWA 2W00A 1E2MA 3AY7A 3NDRA 3LO5A 4TRRA 1JF8A 1CS0A 2Q8QA 4X0EA 3HPRA 4HDRB 3V55A 1QU3A 3REQA 3DBVO 3RROA 1TQ6A 3RK0A 1JI3A 1Q95A 1L1FA 3T15A 9LDBA 1P0IA 1SZCA 3H5NA 3KT8A 5F73A 1GJRA 5FPHA 5I7RA 3EPLA 1JQAA 4NK4A 1AXRA 2R62A 2FJPA 2NADA 4NMWA 3VH3A 5BXYA 1OSNA 1OXVA 1XVTA 3AY6A 5IKMA 2JGDA 1CUVA 1V95A 2GXAA 1NFQA 2FPGA 1ODSA 1KKLA 3FPSA 5CVDA 1PSWA 4IJWA 3PD1A 4C87A 2HIAA 3O4HA 4TYYA 3R41A 5F78A 1NVFA 3IX7A 2LBPA 2B7LA 3ZK7A 4WY5A 3REGA 1PF7E 4MRMB 2JHCA 3VTKA 3FB1A 2YYAA 4B35A 2C58A 1BU8A 1Y3DE 2JATA 5CAEB 4MGHA 3SJAA 3VDRA 4QREA 3H8JA 3RAGA 4DFDA 1RJEA 1W93A 3I9OA 3ADDA 1KU0A 2CCJA 3Q5EA 4F92B 2FFRA 2NX2A 2O3TA 1YJQA 4ESOA 1L0BA 4NP6A 3USES 4BMNA 2L2QA 3TVDA 4DVGA 1LXCA 1KE2A 4TV9F 5E4FA 4QTTB 5DM0A 2XNCA 1IN5A 2QXYA 1E3WA 2QMEA 2VI5A 1OR8A 3FMPB 4OK6A 2EG9A 5KKAA 3UJCA 4A6XA 4CKBA 3LT4A 5FF9A 3TCKA 1M1NB 1ZONA 4KREA 5MF6A 4QU0A 5D2CA 3DWEX 4OM7A 3RSOA 4ITRC 5BWMA 2ZJ2A 5KJEA 3WLNA 5AR1A 1BE0A 4MVJA 2JA1A 4UQPA 3W79A 1GNSA 4YB8A 5HVNA 4DUZB 4C4PA 5EWMA 1VJDA 3V4VB 4C6RA 4E1BA 1YC2A 3DV0B 3SEFA 4MDYA 1ONNA 1I1NA 4MW4A 4ROSA 3W7AA 1VP3A 2I65A 2K7ZA 4YI3A 3IQXA 4HMPA 4YT4A 5BR8B 4HNGA 3F2VA 4NBUA 1PG0A 3AF3A 1QG6A 5LXTF 3QOFA 5BSMA 3AESA 4BBPA 4OFWA 4X3CA 3AHFA 3MWGA 3DDOA 5DYIA 4LSWA 2E87A 5AJVB 1SK8A 4HQLA 4KXMA 3AEQB 4UUBA 2A0UA 5K6AA 3E2PA 3AI7A 4PX5A 1ONBA 2AYZA 5DX1A 1CEEA 5FI5A 4N0QA 2DUMA 4MKHA 1QHFA 2D5IA 2FN8A 2WQ7A 1W4RA 4KSBA 1K75A 3URMA 2XVAA 3ZOZA 2VHYA 2K2QB 3WLHA 3B1VA 3K9GA 3U60B 2VBFA 4JUAA 4PYRA 4AKSA 2I4TA 2CYBA 2FRDC 3KBBA 3ENQA 1YVDA 3UPUA 1EB8A 3IVAA 2UYOA 4RVOA 2WIKA 3DS8A 1FUYB 3K5WA 4YRAA 4JUBA 4JODA 2D6FA 1U1FA 1RMTA 3I9V1 4Q1VA 1O6GA 1V47A 1S8NA 2PY6A 3Q12A 3TJZA 1T2NA 2P27A 1E4OA 1SIOA 3H5VA 3MUFA 1H0SA 3TSYA 1T9GR 5ER9A 4Q9NA 1S1CA 4AP5A 5I4KA 4LE0A 3IO3A 2H3HA 3QG5A 4LY0A 2H4WA 1GCUA 1E1LA 3GJ8A 3OE7A 1B43A 4BE7B 1DRWA 1THZA 4NCHA 1V6SA 2REBA 5BQ3A 1WZEA 1JP7A 3MIZA 1JJIA 3C6XA 3FI0A 1Y1PA 3H8WA 5LMCA 5DHQA 2BHNA 4BLRA 4YHHB 3A6EA 1UP4A 1H66A 3HDYA 2B5WA 1M6NA 2VUUA 4KQCA 4WZAB 5CCBA 2FEWB 3ONNA 3E05A 3ROEA 4EATA 4LDPA 4P7JA 4P81A 4YP7A 4G8JA 4AJKA 3NUQA 2PUBA 3RRFA 2FHSA 5DN6D 1XQ1A 1T5LA 4UFPA 5CD1A 3BD8A 4BP8A 2OV2A 4CV3A 2ZG6A 2R65A 2XGSA 4LCEA 4CIYA 4URXR 2ZYUX 3QPBA 4DLLA 1CZKA 3KVRA 1QE0A 5EZSA 1SIBE 1TU3A 1YCHA 1ZOSA 3CNOA 2MSEB 1Z07A 3W6PA 3PE6A 3M1IA 3EAGA 1CX9B 4AAYA 4Y0AA 2VJBA 2R2AA 4ARUA 2P41A 1OAOA 2I4MA 3IKTA 5IRCD 1FB5A 5CFLA 1EFLA 4U2CA 4B45A 3PKZA 1FLVA 1HE2A 3K9LA 3NTUA 3IYLW 1Q0HA 4LRYA 2D1TA 3W5AA 1A1SA 4XIJA 4QA9A 4AMBA 1D07A 1QNLA 1NXPA 3LQYA 2M2IA 2O2GA 2ILVA 2PKYX 3EQ8A 1PBTA 1B14A 1YS7A 2OR3A 1JBQA 3GH3A 4OG2A 3VPAA 1V4VA 4UNSA 1RQRA 4HGOA 4TLEA 1BZYA 1JA9A 3AIIA 2G09A 3I28A 3RFCA 5IC6A 5HUJA 2RH5A 5F51A 1DO2A 1EX7A 3EF1A 4MKGA 4BRUA 4KPUB 1EBBA 5AW3A 1K8ZB 1FVXA 3K92A 3A3PA 2ATXA 4YRLA 3N07A 4X20B 3NHFA 3UA3A 1LW6E 4B7CA 3N70A 5DHFA 3N6XA 5KWVA 2WG2A 4EZEA 1USVA 4ARAA 5GADl 4QOIA 1N6HA 5B58T 3W9BA 5F4BA 1KAOA 4QSMA 3E3OA 5E7JA 4DXDA 4EQZA 1YFLA 1PG2A 4L74A 4TROA 1X13A 2J3JA 2IITA 5C4MA 2W0SA 4KXYA 4RF5A 1KJ9A 3OT1B 3AKEA 1H5UA 3C1AA 4OBXA 1WHTA 3AZPA 5D3QA 2OXCA 2P5YA 2R87A 2WSLA 5KMGA 2ODQA 4DV5B 1Y7IA 2CJPA 2X40A 5I9TA 2XMRA 3RVLA 2C96A 4R01A 3R76A 3ZXSA 3GMDA 4G97A 2YHIB 1HURA 5K7SA 1V8OA 3L4BA 5AT1A 1GCAA 4NG5A 4DKJA 5T4FA 3C7AA 4DILA 3HCEA 3WGZA 3WO1A 2XUGA 3FXAA 1T9GS 3F6SA 5GMOA 3ZE6A 4BQQA 2VDVE 2VP6A 3H6GA 4D79A 3MT7A 1NGSA 1UOOA 2PMCA 4OUKX 1CR4A 1I6MA 1W581 2HFJA 2VF5X 3BKXA 3X1YA 2VT3A 3BHMA 1Z73A 3BORA 4MUMA 3ZNQA 2J67A 4JL5A 2BGWA 2BM0A 3LI2A 3EXHC 5LP6C 3L0DA 4IRMA 4CDGA 1F51E 3NTXA 1DDOA 3GQBB 1SFRA 3UMVA 4DARA 4ZHQB 1WQ3A 1C3OA 1O97C 3EOBI 1YQDA 1LPMA 2HDOA 4LHVA 2Y71A 2HPZA 3AEUB 2Q07A 3C3KA 4H17A 3DOFA 2BKXA 3PB3A 1UPAA 1MB3A 4JJGA 4AZ0A 1KOJA 1NYRA 1XAJA 2J9RA 4R5MA 1OAKA 3TBKA 2JVIA 4AJ4A 3MAAC 3BK7A 1I33A 5I8WA 3FCSB 1LC3A 1WWKA 1EGHA 4ZDIA 1HFJA 4BGEA 1XVIA 4RQTA 3U7RA 1P1IA 2OCYC 3ZGZA 2R7MA 2V7UA 1NBME 4HYYA 1WV0A 1O6FA 2I0FA 2OY0A 4GOLD 3H9BA 4UU7A 5F21A 4EHFA 1ABBA 4MDEA 4NU8X 4CCSA 4LBYA 2G8NA 5FI1B 3FFTA 4KXXA 2V54A 2YL2A 1L5ZA 3Q0EA 4KXWA 3IIEA 1GG9A 4J0HA 5EPEA 1E77A 2FMIA 4A3SA 2XRYA 3VDNB 2J5KA 1BDIA 2P7HA 2Q28A 1N8SA 2N9UA 4G84A 1DC8A 3TXYA 3RS2A 3A36A 3QFFA 3U44A 2GUGA 1KGSA 3QBEA 3HVKA 5FOQA 5I7OA 3I9FA 2N42A 1KMMA 1MABA 1W0KA 2JB9A 3EVEA 2VP0A 2REXB 1W48A 3TTVA 3T3OA 2BHSA 1I0IA 2YJTD 3KR2A 5CIWA 2WF9A 4KKVA 4PN7A 3GLIA 3ER8A 1SXIA 3KWFA 3WKAA 1VHJA 4GZMA 1XZPA 4CKCB 3ZUPA 2I91A 2VVTA 1I3LA 2IU4A 2EAUA 2GXQA 2YY7A 2Z3VA 3FOBA 4OY3A 3JQFC 4PAWA 3FUWA 2IPNA 3EBLA 3KDSE 3PPIA 4UULA 4ZA2A 4JVNA 5KYWA 4EKGA 4EY7A 1VSTA 3MEQA 1F8GA 5KOIA 4FWTA 3I04A 2Y0DA 3KP1A 4HPJB 3I5UA 1T4DA 1U0LA 1J70A 1STOA 5LB4A 1D6MA 4F4JA 1XE3A 5EJ8A 3BD9A 5K0TA 3A6DA 4EGQA 4PYIA 1W5AA 2AH5A 1PBNA 1KRXA 4D0RA 5BOSA 2C3PA 4X65B 1M10A 3T7AA 2W2QA 5DT2A 3JVUA 5CLLA 4FC6A 1GCOA 4OI2A 1H3EA 2L42A 3LPMA 3ZDCA 5EMHA 1CD5A 1XLWA 2ZK7A 2J09A 3H5LA 2CDBA 2QD2A 4MEAA 5AICA 3Q3GE 1XU7A 4TVBA 4IIBA 2DUNA 4JEIA 1WZUA 2UVPA 1XB2A 3QYFA 3OFND 1B41A 1BXZA 1N7GA 1K1EA 3C3AA 1QHIA 2GFIA 2IYXA 3KYIB 3PTLA 3QNMA 4UDOA 1GTL1 1KJYA 5IK2D 1WL8A 2HWYA 3JATA 1KOFA 1NFFA 2G5GX 3KJFA 5IDYA 5SY4A 5E7MA 3L6DA 3V4FA 3GLGB 1EA5A 2PGAA 1DTWA 4NABA 2EGGA 4QT4A 5A04A 1X9IA 2X14A 1G6HA 1GGKA 3PWSA 4AN1A 2J0SA 1UP6A 3OX2A 1ECLA 2JIQA 4FN4A 1XLUA 2HJRA 3X1ZA 4GQAA 1ZGZA 2E82A 3ICEA 5HQ3A 2W8ZA 5T5QA 2EX0A 1EVLA 5AKZA 4OHRA 1KWKA 3G2LA 4RZXA 4A8JC 3FFXA 5JR3A 3OU6A 3LXXA 1YIDA 2G70A 2H4ZA 4G5QA 2WHPA 2VJNA 3G2IA 4X8OA 3K5HA 3REFA 4CUJA 16PKA 3HHEA 1I3CA 2R0QC 1IXRC 1ID8A 5LC1A 2C2MA 1F38A 4HB0A 4M2LA 2Y67A 3KOZA 3QMPA 1VKOA 4H31A 1EEXB 1U0GA 2LCFA 3AJAA 5DEIA 5FJJA 1KZ9A 4M55A 5H4HA 4GNRA 1KJ8A 4A1OA 4C0WA 4BNFA 1YHYA 4AVYA 4G1BA 4K8RB 4OMFG 2B0JA 4G0MA 4YJ3F 3KQKA 1SEVA 5KO2A 1QRSA 4IXMA 4AY2A 4MLCA 4A4DA 3GEEA 1CEXA 3DFIA 1RADA 3W3AA 5JHHB 5HEKA 1GP2A 1I1OA 1HE8B 1OQAA 5FLEX 4ENUA 1ZL0A 2DFLA 3K0CC 5D5HA 3JTEA 3GY0A 3UB3A 4MWDA 4BFSA 1FYXA 4B80A 3LBYA 4MIOA 1TQDA 3AJ9A 4LBZA 4C7XA 5GVSA 3EVAA 1G6KA 4OHUA 1Q20A 5IN5A 4NS1A 4O25A 4YRFA 5CLGA 3RTBA 4LQ4A 3W0LB 5B2ZA 2Q1TA 4ND2A 2QYHA 5BPHA 4NCBA 1PTJA 2P9TA 2BY4A 2W93A 1YJXA 4XW2A 3N58A 4HLUA 4RV4A 1JILA 1Y3FE 4QAQA 1KTVA 1PW5A 1UM8A 4PGAA 2IEYA 1CDOA 2VHEA 1NXVA 3FNEA 3SYTA 5A7FA 1IONA 1CY2A 3EEIA 3SIWA 4QKQA 1T4GA 1E7MA 3C14C 4D4MA 1UMKA 1ODCA 3A6GA 3R3ZA 4NHEA 2EWWA 3GQVA 4RPIA 4OQMA 2XUHA 5LQSA 3UXYA 4OBWA 3MB8A 3JWIA 3MJSA 1L7AA 3I83A 4P7GA 5DCLA 4LSMA 4C89A 1TF5A 4V2IA 4FW8A 1Z0JA 1MB2A 3C4JA 1J5EB 4DV0B 1JG7A 3C3BA 3O1JC 4JI0B 1JFVA 5JISA 2OZVA 3GGOA 1PJ2A 3QW4B 4NG4A 1LY1A 2G40A 3RS7A 4IIJF 3IB6A 1OFHA 5C7LO 3JZMA 1M6HA 4PHCA 3F5FA 1KO8A 2IDZA 2ECOA 1GAWA 3SIXA 1HLFA 4V39A 2C3OA 2HA0A 2IW1A 1Y8AA 2WVHA 2JVKA 4H60A 3I9V6 4ND4A 2LUOA 5LQAA 1R4AA 4EA9A 1USWA 3D3WB 4JUDX 2HF2A 3H2ZA 1DBIA 4EKYA 2ZTLA 3CEPB 4LZAA 3ITEA 1H3FA 3PCTA 4KQJA 3RC3A 5FL7D 1RCFA 3DOHA 3JQ7B 4N39A 4WLEA 1KDVA 2VNAA 5D3MB 3M9WA 1W34A 4HNAA 4TTPA 2AUMA 4ED9A 3ROMA 4P4TA 4K8OA 2P7IA 3A28A 1UBNA 2I1LA 1XZBA 4UE3S 3IPCA 3NWEA 3V8EA 4E5NA 3ZK8A 3FZNA 3QVSA 2H18A 4KHPB 1JEDA 1L5MA 3HKEA 1JGTA 2QQ5A 1OH5A 4ZOLA 2XRMA 5CX1B 5EFZA 1X7XA 1FDOA 1OI4A 3IBYA 3O38A 4K28A 4XVQA 4DG5A 4CG3A 4CKZA 1CF2O 1JIVA 3A9RA 4DLUA 1OD6A 1UKYA 2PV0A 3KHSA 3LM8A 4U3JB 4YGXB 3NW9A 5CURA 3KU4A 1CJSA 2VF8A 1X1AA 1JR3D 1SVIA 1O4WA 2HQSA 4PSCA 2IWRA 4QHYA 4DLKA 4B6PA 1RQ2A 4A9AA 4AZWA 3UWKA 1TZCA 3INYA 4MKXA 1S3SA 4PZCA 2Z6AA 2OO5A 3T3DA 1XEWY 3TQTA 1F4LA 3AOGA 2FPXA 3PWZA 3EXG2 5FOUA 1ONPA 1J49A 4M9UA 4KODA 2P4EA 2FPPB 4GMGA 4PGHA 4WLNA 4AS3A 2H3EA 2FY8A 2UUOA 2WA1A 4JBHA 5HMMA 4ZQHA 3GLTA 2PE5A 1WTCA 2AOTB 3QVGA 3WMRA 4BZPA 2WTUA 2DB3A 1YA4A 2AYXA 4ANFA 3WLSA 3QJ5A 1IRXA 2B2XA 3JY6A 3K4HA 2DXIA 3IQGX 5JZSA 4K3UA 1H8HA 2F17A 5EE1A 4QWWA 5JMOA 3H75A 4LNUA 3DO5A 3Q5DA 2GJ8A 1WPQA 1BXKA 1JKIA 1EDOA 2IFTA 3AIMA 4KQ2A 4WEQA 2BKAA 4GLFA 3U3JA 4W1QA 3WWOA 1PR5A 3DDNA 3TK1A 1ST2A 2HJGA 4J2OA 2BKUA 1FRQA 2F1JA 5ALXA 2FPOA 3A6ZA 3VR5H 4ABTA 1CJKC 1RJ9B 5LYYA 1A9PA 4BV2A 2XAAA 3KLPX 3OZBA 4DSOA 1O6ZA 2P75A 4MSUA 2QRUA 2GTIA 2WYVA 3EW7A 3OC0A 4TS3A 1M1YE 1W19A 1XDUA 2AN1A 5IYZF 4AJPA 2D7DA 1L4MA 1O96B 4QO8A 4ZDKA 3NUGA 1PFVA 2GD0A 1K6IA 3K6JA 4KQIA 4YPFA 1T0HB 2O4CA 4OKSA 2N3ZA 3CKKA 1GV0A 2JJMA 4MVJP 3BICA 3DCNA 3IMGA 4RAOA 4A0QA 1DQZA 2JBHA 2ZETA 3IDZA 1Z0UA 3HJGA 2AEFA 2DPGA 1N2HA 1VLVA 4MMYB 4BASA 1UXHA 2GO7A 3WJAA 2A58A 3GJ0A 3B1YA 1G19A 3SJCA 1BVUA 4B83A 1E0AA 1XNHA 1SB8A 5F3DA 3DW1X 1NMYA 1ZDMA 3OQVA 3FSGA 3KWMA 3RV3A 2GN9A 2XTNA 3VKWA 1ULZA 3F49S 3TZKA 5LLDA 2EDAA 2HEGA 4HPXB 4ZCSA 1JXOA 3AFHA 3AUJB 1U3UA 3CJQA 5F33A 1ENZA 4E70A 4Y2JA 3KIPA 4EABA 1D7AA 2WZCA 2ETXA 4QYMA 5ALOA 4B31A 3KWLA 5DZSA 3DBOB 3LL4A 1F9AA 3D7LA 3NHRA 5EKXA 1TMOA 2WABA 3TOXA 5KNBA 3L6BA 4P4SB 1RLIA 4FINA 1HE5A 4LBWA 1EBUA 2XWPA 5DNAA 3LPNA 4FD3A 1ZK0A 5ELLA 5EJAA 4JU9A 2NUTB 1EFDN 1PGQA 1PK8A 2W2KA 1K9SA 2JW5A 2Q8NA 4MRVA 1U6JA 2NSLA 3MIIA 4I1UA 5ALEA 3BB4A 2KE5A 1NI4A 2DF8A 2XLBA 3O3OB 5CYPA 3RU9A 1UZLA 5J5AA 3VPGA 1B26A 4BRWA 1OLXB 4N6NA 3JQ6A 1G8JA 1TVKB 4NAUA 4L0QA 3VHRA 5BN1A 2DH6A 1NW7A 3HTXA 2A9RA 5H8WA 1Q14A 3S0JA 1PV4A 4I6EA 1RNLA 4UTZA 3UICA 4BNMA 4GYWA 4H1HA 4GD3Q 2DM6A 4UHKA 3JXEA 2VK2A 4DC9A 2GK6A 2X8JA 5J4LA 2EBUA 3SVTA 1ACJA 5HQJA 5L7WA 2DHQA 5CFQA 4JI5B 3PJFA 4C30A 1WCIA 3HB1A 3WXBA 5G4KB 4IUBS 2K5UA 4MW2A 1DUIA 1G20A 2OHXA 3ZLVA 1E69A 4Q02A 3FUXA 1K68A 1MJ5A 3QNUA 4MVJD 4HVCA 5KHOC 4QVIA 3GLFA 3FYUB 1FFXB 2HCTA 3UO8B 1TZKA 2ESRA 1RZ3A 1V43A 1A8HA 3NIFB 5E38A 5KTNA 4QODA 5HIMA 4C7OA 1I4EB 3DEIA 3M6VA 4NFHA 5ICFA 5HS4A 1JR3E 1SN7A 3L7KA 2AOUB 4TPKA 5JDCC 1B2RA 1NSTA 3O2NA 3GPDG 9GPBA 1CFZA 5GM1A 5I47A 2O52A 2W4QA 1PR1A 3G8BA 3IB3A 4LK3A 4N12A 2QN7A 5I9MA 3RLFA 3W6ZA 5K8JB 5B7QA 1G4HA 4RL6A 1PL0A 1I2CA 1YHZA 2VPPA 3QK7A 4AO6A 2IS6A 4HEA1 4M1KA 5K51A 1EXVA 2MDTA 2Q6KA 3KQTA 1HY3A 3UJAA 1R12A 2KBFA 3AI2A 4CLXA 4DEVA 2I9KA 3B53X 2ERYA 2D1SA 2GK3A 2HJVA 2M1XA 1U7DA 2AF3C 3PJRA 4AF7A 3RK4A 1OGYA 2IU6A 2PLNA 1KP9A 3GI1A 1QOQB 1M2FA 1QQ7A 2IHBA 4N5MA 5A02A 4WBNB 4K9LA 5FHRA 3DUFA 1JEQA 4FGKA 5CMLA 2R3SA 1SZPA 4LF8B 3FA2A 3GRRA 4F3RA 4TZTA 1XZFA 1O6BA 2AUNA 4DIMA 2YOGA 1YXMA 2QRPA 1VKHA 3GUZA 4OU5A 4UQOA 4WRRA 5CP8A 3TLEA 3VVLA 4C07A 1NDUA 3VVCA 2CK3A 2ZTVA 1TKRA 4D02A 3ZWWA 2D59A 3II6X 1WUYA 3K9HA 4A36A 2Z43A 2V9PA 3FPJA 4LOKA 1IHDA 3ZWAA 5CG1A 4R98A 3QOWA 5K3EA 1Z4KA 2A1UA 2I4LA 2ZAGA 1O5OA 3E2IA 3OE7D 1Q17A 3C98A 5C8YA 1EFPA 2XQFA 2JDIA 1FSZA 4M86A 1YHNA 2P1DA 3CWCA 4RD6A 2YW9A 1JHVA 3A6KA 3QOXA 5AJYA 1YNSA 2AJLI 4MVXA 4LMBA 2JFGA 4MQBA 1FU4A 1M2KA 2AR7A 2X23A 4ZRDA 3QBDA 2XKBA 5GONF 1PWZA 2JZOA 2GPSA 3E3NA 3NBQA 1BFUA 2FQYA 1HEYA 2WAOA 1QPBA 4QYTA 3UXEA 2FK7A 1G8PA 1Y1RA 3JD0A 1GA6A 3CONA 3JVIA 4YJGA 3EX7C 1U7OA 2BD0A 4YO8A 3FNGA 3D59A 2IYFA 4QUIA 1S0UA 2CMGA 2GKGA 4BB0A 3DB2A 2UXCB 4OB7A 1I14A 2YBDA 4REQB 3RPEA 1USKA 4FNMA 2E7ZA 1U80A 2RH4A 3ADKA 1XO1A 2CBZA 4BFUA 4B3JA 2EFEB 2IA5A 3AZQA 1D2EA 4BFXA 3MJVA 4KSYA 1NN0A 4RLSA 4G1UC 2IYOA 2FRDA 4I55F 2NTNA 4MZXA 1JN0A 1SVKA 3EMKA 3DZJA 1HZJA 1TQHA 5DYYA 5G41A 3KV3O 2NT3A 2R84A 1EPUA 4P53A 4TXHA 1JBEA 4R8RA 2F6RA 2RHGB 1TVCA 4NH4A 3L4KA 3IKVA 4QIHA 4NNPA 4TXMA 2IIPA 3CRQA 4L02A 2CFTA 1P2GA 4EY3A 4OJTA 3NBYC 3ND5A 1YULA 2QG6A 4MMXB 4AQDA 4DG9A 2IDMA 4HDNB 4O4IF 4J49A 2QAJA 1JDTA 5TJHA 4C0JA 1GZ4A 3LCVB 2YZGA 4JCCA 4PQGA 2L18A 2WIDA 1CQIA 1KYYA 3KUXA 2CV1A 1SA0A 3I39X 3DP7A 3IT1A 4ZO6A 1CHNA 1UK8A 3OPXA 3WL6A 1PWHA 1X1QA 3X1WA 5E3JA 4UHFA 3GJ4A 4MVJE 1NQXA 1VBNA 1OYOA 1ZA1A 2QEQA 2ZI6A 4U00A 4UUMA 5CNKA 3J80A 2DR0A 4B5LA 3QPCA 4K9PA 1OYWA 2OBBA 1P9NA 1JPNA 1XDGA 3JYQA 5K3AA 5AW0A 3H8SA 4MQMA 5FJIA 4JXJA 3NHPA 3A14A 3DVLA 4B3BA 3P0IA 4EY8A 3TBHA 1ZIOA 9LDTA 3KYCB 4RV5A 3K20A 1MRZA 2NXJA 5EZQA 1F2TA 1QTRA 3FPBA 3BXXA 3O4VA 3ETEA 1E62A 2O07A 3OOSA 1OX6A 3T06B 1SKQA 3MFQA 2QL9A 4G25A 3GELA 1R8SA 3UJ8A 2GRJA 4NL4H 1FP7A 2XKJE 2ZSEA 3DAOA 2AYYA 2C99A 4HLNA 5FFNA 5J5CA 3RGWS 4YUXA 2XHEA 3F71A 1UADA 2HU2A 4TVSA 3D8RA 2JFNA 2IZ7A 5AJZA 4B85A 3QA3E 5LBTA 2OCAA 3O7MA 4JY7A 4IDBA 3MTQA 3NVKI 3HKCA 2M32A 2Y2VA 2AN9A 2OLKA 4KFTA 4BEWA 2HIMA 1G55A 1AS2A 1G8MA 1HQKA 4NJMA 3ZG6A 3L77A 3IDAA 3OU2A 1DQYA 2FPMA 1Y42X 2GJAA 1CNFA 3CUTA 1IE3A 5AVYA 4Z9FA 5CNMA 2PL9A 4U5QA 2ATVA 2FSSA 1IEQA 2GYVA 3I9JA 4PFQA 4M99A 4D9CA 4QPDA 4MYSA 1QCZA 3FTCA 1GUFA 1KVUA 1MO6A 4FR2A 1CE8B 1WS6A 4BO3A 4JLSA 3WIDA 3OLCX 4XE5A 5A7HA 5LOVF 1SPXA 2ZZKA 4S1OA 3BA6A 4KI7A 1W4LA 4RF4A 3LTEA 3PCXA 2C95A 3QMMA 1Z9BA 4HYEA 4YUZA 3GP5A 5B7GA 4IG9A 4D9HA 2IPMA 1SBZA 2O9JA 3FM9A 3R6LA 4NEGA 5IULC 2Z5LA 2PUTA 1WZNA 4QBHA 5HRCA 4OLJA 5FWNA 5G2OA 1A9OA 1ZIDA 4HFJA 4ZGBA 3JPYA 1U6IA 3VR2A 5KJ6A 2A94A 2AZTA 2FUG6 1XZJA 4OEHA 1Q7CA 1LDEA 3CM0A 2QM0A 2ZBUA 4RFSA 4Y6RA 3QEAZ 3GT4A 3HXQA 2A5DA 2NU9A 4IMRA 1ZLYA 2YVQA 2DR2A 5GVRA 5IUKC 4CQJA 3RT7A 1MEEA 3C87A 4U5XA 3MBKA 4LIPD 5LA6B 1P7VA 4ZKEA 4AJJA 3MOIA 4DCMA 2LCQA 3KE8A 4ZYYA 4EB6B 5K1ZA 1SCQA 5BWNA 5ICGA 1B3RA 1U8YA 3E27A 4BGDA 5K3BA 3CT6A 1N6LA 4L9RA 1TRKA 2GPNA 1MT3A 1JKXA 1V2GA 2C0PA 4MPJA 1U9ZA 1YZ3A 1W0KD 4AZVA 5LQMA 2GCOB 3JQRA 4ZC1A 1L5WA 3DSRA 1T43A 3EXHA 3PFNA 5LP6A 4Z9BA 2C9MA 2V0GA 2HIGA 2J5BA 3UNXA 4N82A 5IU6A 4IFBA 3VKGA 1UBRS 2ZE8A 3ORYA 4L2IB 3WOHA 1P61B 2R47A 4UHHA 2QTTA 1U8XX 3UENA 1NA5A 3OSUA 1IOLA 1AU9A 1QHHA 2DE0X 3PGLA 3MAGA 4M0DA 4Y2GA 1W73A 5HCNA 5TS3A 4EW2A 1RHKA 1LBSA 2JJ2A 1K3FA 3WLTA 4LFAB 2Z9BA 2Y27A 4CU2A 1Z0AA 3AG6A 2ZAIA 3VNRA 5KJ1A 1GQ2A 4O2BF 4AX8A 2G06A 2IV3A 4U2FA 2O8NA 4IH4A 5CLHA 3O8BA 3WXMA 1TMKA 4XSGA 1X3LA 3CNQS 4AFNA 1ZMRA 2OCLA 3GBPA 4KMMA 4ZCRA 3G0IA 5IJ9B 3P5SA 3DQPA 3JYHA 2B6NA 4UTVA 2Y1XA 1XCLA 2PKQO 2WB4A 4DV4B 1Y37A 1QLJA 3CLTC 3MWDB 5D85A 3ZE8A 1ZK3A 1XMPA 2WKRA 4II7A 3T3EA 3D8NA 3ML1A 2P6OA 4OQZA 4TX1A 5H02A 4EFDA 2C2YA 3I3OA 2R96A 4IGIA 5ESXA 1EZ4A 4HD8A 4W63A 1B6RA 3H6KA 4LOLA 3C1UA 1VIYA 3IIIA 4UZFA 4J1TC 4KVAA 1PQYA 1VPVA 1Z7WA 5COQA 3JAKB 4MJXA 4MPTA 5DKFA 1B8UA 3O8QB 1UF9A 2XYPA 4BO1A 1FPMA 3JQFA 4WKBA 1EGQA 4YPOA 1ZD9A 1V1JA 2B4RO 3DDHA 4DC0A 1XYGA 2ZJBA 3IAAA 3GG9A 3TUZC 1ZFNA 4A2CA 1EVEA 2ZVJA 1RWNA 3PFIA 4I1RA 1V0JA 4DSAA 1UIMA 1M7BA 2H59A 1Q0LA 3E1GA 1G21E 1N7IA 3BB3A 4W1RA 4EI7A 2HWWA 2OFPA 4WPGA 4MQ5A 1OYVA 4Q00A 2ZRGA 3LBHA 5BWOA 4UOQA 1ZGGA 2P9FA 2BFDA 3AM5A 3IOEA 2FX2A 2PKWA 4HJXA 4Q9DA 2CHEA 3FBTA 10MHA 3T5TA 1RKVA 5AP9A 3KJQA 4FYPA 1QR2A 2VRNA 3FBGA 1VI2A 3QGMA 4POAA 3SBEA 4AL4A 5I5EA 3C8HA 3X1XA 4TQAA 5HJ2A 3W3AD 2A3NA 2I7VA 2WUEA 3A4YA 4EKDA 5FPSA 1OTYA 1HYQA 1XQ9A 4AX4A 2XVMA 2BRUC 2R4TA 2XGGA 1B15A 2E4UA 1P5FA 3LZCA 4I6GA 1Z15A 4PLCA 5T7BA 2PPVA 2Q5FA 5GV8A 5E3HA 2GHIA 1ZEJA 3IVRA 4EJSB 3FDZA 1DBSA 5F1YA 2FQQA 4AJ2A 1BEEA 1P6UA 3O0DA 3ZC3A 4BWVA 3IAXA 2I4RA 3AM4A 3M5PA 5TT0A 4E08A 3I62A 1QO9A 4ETIA 4MS1B 1UJBA 3H1EA 1YR7A 4MUJA 1O6CA 1E4YA 1F2UB 1U9JA 2HTEA 2IY9A 1Q6ZA 3E03A 3T1YB 2O8FA 1D0VA 1T1IA 4LCJA 2AZXA 1BDBA 2WFAA 2I1QA 2XUZA 1PEKE 4OH7A 1GARA 4V0KA 5SICE 3ROQA 4DQXA 2UUAB 4UEQA 4IHJA 1JQDA 1Y9DA 4GWKA 1YK1A 4IRXA 4CHTA 1EIZA 1MO4A 2J1LA 1EWYA 2G0TA 2WBLC 2O6LA 3VVMA 4A8JA 4KMRA 4AN0A 1T9HA 3RU3A 3CF6R 1S8OA 1Z8FA 1XPUA 4DL9A 3GLIE 2MSWA 5DBEX 5EMJA 3WR5A 3KAPA 5K4AA 3NDIA 2VJAA 5E6UA 1PL6A 1QVAA 1VE1A 3OHMA 5EE5B 3L5OA 2AR9A 1JPJA 3UAWA 1D6JA 3OOJA 1CB7A 1CNMA 2H06A 3C43A 5BMVA 1VRVA 1DINA 1IFXA 2F8LA 1C1XB 4B8ZA 1PO7A 5TMDA 2XT9A 4D9NA 1NP7A 3PHHA 1L8LA 4TLAA 2Z2YA 5FT9A 2YWFA 4P0PB 5GJBA 3JARB 3E9MA 4ZQIA 1U28C 2A5GA 3FDXA