3CZRA

Crystal structure of human 11-beta-hydroxysteroid dehydrogenase (hsd1) in complex with arylsulfonylpiperazine inhibitor
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
266
structure length
265
Chain Sequence
QQPLNEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTSYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery and Initial SAR of Arylsulfonylpiperazine Inhibitors of 11beta-Hydroxysteroid Dehydrogenase Type 1 (11beta-HSD1)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
total genus 100
structure length 265
sequence length 266
chains with identical sequence B
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2008-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3czrA00
4M8SA 2VTDA 1DAPA 2E82A 5G4KB 4CQLA 1OC2A 2X0JA 4MKZA 1HYGA 5EQDA 5TGDA 4BIIA 5A3JA 3I6IA 3RFTA 3JD4A 4CV1A 1LSJA 1PTJA 1SEVA 2RHCA 4FN4A 3H9JA 2GCGA 3X2FA 1LBEA 1UZNA 1AHHA 2BFOA 4RPLA 4W99A 3WIEA 2NLOA 1G6KA 4H16A 3U9LA 4A5OA 3COSA 1YB4A 3IC5A 4HNGA 1KERA 3AUUA 1ZK1A 5AQ1A 5FEUA 3FPLA 2DVMA 1WZIA 1YBVA 5TLSA 3PYMA 1T2EA 2I3GA 2CF6A 1N92A 3N7UA 3HG7A 3DDNA 4GLLA 2FP4A 2CVOA 5I8WA 4L4SA 1T4BA 3V2GA 3HDYA 1B8VA 3PFWO 1ORRA 3FTPA 1B3BA 2JFGA 1V9LA 1DC5A 1YRLA 3GNQA 3OEYA 4RVFA 3GA0A 2BHLA 4C4OA 1Y8RA 3O03A 1EEHA 4BNWA 5HWSA 2D59A 4M1QA 1H6BA 1H0KA 4YXFA 4E2WA 2CD9A 4OXNA 4L4RA 4OAQA 3ETGA 1Y8QB 1DRVA 3I9KA 1UUFA 4MKXA 3I83A 3Q0EA 1YL6A 4EBFA 3PJEA 2V6BA 3JQEA 1Y8QA 5KIAA 2O7QA 1Y9EA 1YWGO 3U49A 3H65A 4BOYA 3TDKA 1HDOA 1GYRA 4DC0A 4XEHA 1GPJA 1GQ2A 2X0IA 3PHIA 5FI5A 3RUHA 2SCUA 4QQRA 3UCXA 4BUCA 1VL8A 2V65A 3JQAD 3OJFA 3WJ7A 3AU9A 4HFJA 3GGGA 4DMMA 1LQUA 4Z0TA 3GQVA 4MP3A 4DGSA 3WG9A 1E7YA 2X1HA 4GH5A 1UZMA 3ON5A 4YJHB 4MVJF 3IKTA 1L7EA 4GI2A 4CLOA 1KYQA 2NU7A 2YHIA 2XPCA 3AOEA 2TMDA 1O8CA 3W4IA 2IYOA 2Q46A 5DF1A 5EQFA 1U8FO 2AW5A 1QYDA 3VZSA 1U4SA 1U7TA 1ZSNA 4ZRMA 3VH3A 3OETA 3DZBA 4CM8B 4JIGA 2FPIA 4LMPA 3VHRA 1ULSA 3OF2A 4RCVA 2Q1TA 1UR5A 2X8LA 4L73A 3KM0A 3HJAA 5DULA 2IZ0A 4A10A 3ENKA 3O8QA 1PZHA 3QVXA 1N7GA 4R5HA 3H3FA 4OH1A 3GY0A 2O3QA 3IP1A 4Z3DA 1LI4A 4PVDA 4IIVA 4OXKA 4E2YA 1HTBA 3F46A 1D8AA 1TA4A 1X14A 2D4AA 4LSWA 4RVSA 3FNHA 5TC4A 1H5QA 1HZJA 1FJHA 4XA8A 2JHFA 2VYVA 1RKXA 4X54A 5EN4A 3GZ4A 1KC1A 4DLLA 1IY8A 2JD0A 4LW8A 5BSEA 2X4GA 5HBRA 4ALNA 1ZK0A 4MINA 4DREA 3QA9A 3RD5A 1SOVA 5ILOA 3LT4A 3PDJA 4OMUA 1PS9A 3TJRA 1HLPA 1X7DA 2EW8A 4I5DA 5JCXA 3D3WB 1FDUA 4BO3A 3JQCA 4UVIA 5IN4A 3GHYA 1V8BA 2GN4A 4NHEA 2EV9A 3RBXA 1CERA 3CINA 5GZ6A 4U7WA 2EEZA 4FFNA 3WGYA 3E5MA 4PZEA 4LN1A 4B4VA 4WNCA 1RYEA 2C7GA 1MG0A 2AQIA 2GZ3A 5CP8A 3U09A 5TNXA 1P1FA 1R4MB 3QWAA 1I3MA 3D3EA 3DZFA 1UXJA 1C14A 4FR5A 1G0OA 3NV9A 4RVGA 3WWYA 2XXBA 5KJ1A 1ISFA 4J4HA 5CDSA 1E92A 3C7CB 1GR0A 1BMDA 3B70A 2VUSA 3BMCA 4KDFA 4O6VA 1IULA 4YJFA 4Z9YA 2PLAA 3BA1A 4PCVA 5FWNA 4DIFA 5C5IA 1P33A 4II3A 1YL5A 4I5FA 1PS0A 1Y5RA 2A92A 3IS3A 1ZW1A 3RBZA 1PJBA 1BW9A 3WWZA 4KUEA 4MOWA 4UVHA 4EEZA 1U2DA 3JQAB 3FBTA 4K9DA 4YJGB 4FGSA 3OA0A 4BMSA 4OO3A 2BFAA 2IEDA 1NASA 3GVPA 1T4DA 1RM0A 2FPGA 1IL0A 2VRCA 4CR8A 1OMOA 1R15A 1NWCA 1Z75A 1GY8A 1A4IA 2I3AA 4ZQGA 3UFXA 4WK6A 1BSVA 3K2BA 3K92A 1N1EA 2GLXA 1DJNA 3HDHA 4WGGA 5BSHA 1ZCJA 4YAIA 4CUZA 4D3DA 2GUGA 3A1NA 3VAZA 4U8GA 1LRJA 3D5TA 4OGWA 3TRIA 3P5SA 5IDQA 2VTEA 5TSDA 1A72A 3ITKA 4XIYA 1BWSA 1N8KA 2R00A 3GN2A 2WJPA 4GSLA 1Y8RB 1WXDA 5GMOA 3OEWA 3WX0A 4Z9FA 3E9NA 2ZTVA 3B1JA 3JYLA 1N1GA 2Q49A 3PIDA 4ND1A 2V6FA 4ZICA 1GTMA 1F06A 1T24A 4OSOA 3D7LA 3ZNPA 3E9QA 5IXSA 1R16A 1F17A 5F1PA 2NQTA 1ADBA 1DO8A 3PHHA 1V3UA 4MJLA 5IXYA 5A9TA 1ID1A 3U4IA 4DVJA 4Z3KA 2FPPA 3RUFA 5LCXA 5BT9A 5BSFA 1PWZA 5EERA 4E31A 1C1DA 4UUMA 5JYDA 3U4HA 1P74A 2CF5A 1G1AA 2VZ8A 2BFMA 1UAGA 2HCTA 1J49A 1WMAA 2ZTMA 4JCOA 4WE3A 4DMLA 1NNUA 1KEWA 1LX6A 2OP1A 3ST7A 3GT0A 2HMUA 2I99A 2OFPA 2QQ5A 5C7IO 3GGOA 1J4AA 3PEFA 3AOEC 1KVQA 4RQTA 4ID9A 2C59A 2C7VA 3HDQA 4AJOA 4OIMA 1SAYA 5G0WA 4BKQA 3NTQA 4JXKA 4MVJD 4ROSA 2Y1CA 1GYPA 3L9XA 5CDTA 5EL0A 2C54A 4BNHA 1MB4A 1EE2A 3R0IA 4BV8A 1Q2XA 1ZSVA 3WGOA 3KRTA 1QP8A 3PWKA 1NHWA 4B8WA 2AEJA 2P9EA 3GGPA 4XGNA 3RQSA 3BMOB 1UXHA 3EYWA 4NJMA 3TF5A 5TQVA 5H82A 2VYND 3PI7A 4EUFA 4E12A 4NQZA 1DJQA 1QMGA 2D5AA 1HSZA 4FJ0A 5I7EA 5JYEA 4R16A 1EVYA 2C0CA 1LDNA 4BO6A 1R37A 4MIOA 3C1AA 3E6AA 3NDRA 4TROA 1KBZA 4AJIA 1ENPA 3D4PA 5JCJA 1DIGA 1LEHA 2DQ4A 3AOGA 3GK3A 4PRLA 3DBRA 4RZHA 3VVCA 1O5IA 1C0IA 1NQOA 5AXDA 4UVEA 2ZQYA 1ISJA 2RBEA 3GN1A 5BQFA 1XLTA 2DTDA 2G0TA 2XXJA 5JY1A 2YFHA 2FR0A 4XZ3A 4B79A 1HDXA 1I0ZA 1KC3A 2WDZA 4XR9A 4YT4A 5ICSA 3JD0A 3PJFA 3HQ4O 2AA3A 1JU9A 3W4KA 1IZ9A 3DMTC 4NJOA 1VPDA 4JJGA 2UYYA 2PKRA 2ZCUA 1XG5A 1I2CA 1DIAA 4I1IA 4WLFA 4YA6A 1K6XA 1IPFA 4BO9A 1XA0A 4E5NA 3GG2A 1KS9A 4EEXA 4KDEA 1ZKMA 2JFHA 2DTXA 4BNFA 3CMMA 3A28A 4J90A 1XQ6A 1C0PA 4RZIA 4D44A 4D43A 1O9BA 2YV3A 2P2SA 3KYDB 1OBFO 5DNAA 4GLOA 4YR9A 3GUYA 4E5YA 1QYVA 1PR3A 3D3WA 3HSKA 4LK3A 4UUNA 3K8ZA 4G5HA 4N7RA 3INGA 4FS3A 4KZPA 4D3FA 3O8QB 4HNHA 4RV9A 4K1LA 2Y68A 4RL6A 2ET6A 5T67A 2VZ9A 1K6IA 4AICA 5JMWA 4DPKA 3B1KA 2DTEA 2EGGA 1WVGA 4CQMA 2VT2A 4J1NA 1QV6A 4KQWA 3CEAA 4ND4A 1ZH8A 2VUUA 2YJZA 1LLDA 3CZRA 5JCJD 4Y6RA 1LDEA 1HE3A 4W6ZA 3Q9UA 3L4BA 3ZU3A 1E7MA 1JWAB 4GMFA 3VPXA 5FI3A 1HRDA 2O23A 1VI2A 2A94A 3RCBA 3MWDB 4CMBA 1PWXA 2DT5A 1NHGA 1N7HA 3WFJA 1ZJZA 1GYQA 2Y67A 3Q6IA 1A9YA 3Q2KA 3WLFA 1U1IA 1HYHA 3BAZA 1JAYA 2Q4EA 3TZ6A 2AMFA 4CL8A 3RU9A 9LDTA 3ASVA 5ILGA 5MDHA 2JFFA 3L77A 3LLVA 1IPEA 3OMLA 1Q1NA 3MZ0A 4KUGA 4OKNA 4YVFA 3KETA 4O0LA 1QKIA 3JQFA 2GGSA 3CE6A 3QWBA 5L53A 3JQGB 5A02A 2HAEA 2NVBA 4WOJA 3KYBA 5JAQA 3VTZA 2BD0A 3RAJA 4CLRB 3HFSA 3AY3A 4J0FA 1FMCA 3U5TA 1D3AA 4IDDA 4BNKA 4PLFA 4MVJH 3WBBA 3U62A 1DAOA 3L0DA 4QO8A 3Q1LA 5LDGA 5CG2A 5ENDA 1E3WB 4P4LA 5T6BA 1FF9A 2JKVA 2QG4A 4TQGA 4GGPA 4PLWA 5A9RA 3L4BC 3D1LA 2ZKLA 3HHPA 4W7HA 3LT1A 3NYWA 1Q7CA 2YZ7A 1AXEA 4J3FA 4WECA 3OQ6A 3IIEA 3VDRA 3VH1A 1DIRA 2DC1A 2UV8A 4MPDA 3VZRA 1Z45A 3T4EA 5CDGA 3B6ZA 4CLRA 1PS8A 4J1SA 4L74A 3FNEA 1TT5A 3MOIA 3IJRA 3ZU2A 4LCJA 2J3IA 4E33A 4II2A 3OIDA 2OXIA 4WCDA 4XJSA 5IZ4A 2GSDA 1DB3A 5I7FA 4FD3A 1DFIA 2E48A 1GZ3A 1TI7A 4DLBA 3PQEA 3PRJA 3KYDA 4ZN6A 4E5KA 4XJTA 4PLVA 2BMAA 2I66A 3D0OA 3EAGA 3F1LA 3UN1A 2EJVA 4FOOA 4IGFA 3JYPA 4PLYA 4PLPA 4TKMA 1GZ4A 2RIRA 1LRKA 4RQUA 5L7WA 3I3OA 2J6IA 5T5QA 1A71A 4DL9A 3LVFO 1DLJA 4LVCA 4IZIA 3M1LA 1HDZA 1VRWA 3K96A 2Y05A 3DZKA 1LNQA 1NP3A 5JPIA 4DXHA 2CSUA 3FTNA 2O4CA 2RCYA 4PG6A 1YBAA 3NUGA 4MVJP 1H9AA 4DPLA 1UDAA 3KXDA 1GUYA 3GHHA 1J0XO 1O89A 5THQA 5KTKA 2A35A 1UDCA 1F14A 1XU9A 1RM3A 2VOJA 1VL6A 5HM8A 5I7SA 3UICA 2FR1A 2PH5A 1PZGA 3RU7A 2BFPA 3DB2A 2DLDA 1T1SA 3GOHA 1DPGA 1YB5A 4R69A 3ONFA 5I9NA 3TOXA 3TQHA 5IJZA 3LF2A 1LXCA 4N5LA 1UXGA 3C24A 4XB1A 4XB2A 3JQFC 1ISMA 4HY3A 1C0LA 4IXTA 1GCOA 5ES3A 2D2IA 4EYEA 1GADO 2PR2A 4J0EA 1VL0A 3TNLA 4CM5A 3ZZNA 3ZV3A 4EGFA 2GDZA 1LSSA 1TXGA 2W2LD 2FR8A 5H81A 2OBNA 1E0DA 3H5RA 3PYLA 1EK5A 1LQTA 4CM9D 3GNSA 1XWFA 3ZWPA 3H7AA 3DFUA 2NU6A 3KYCB 3GLQA 3BTVA 2H5LA 1CJCA 4GWGA 1NR1A 2FMUA 2IZZA 3G49A 1A7AA 1V3VA 1X1TA 4UVGA 4BKPA 3ZNQA 2P5UA 3OBBA 2CVZA 4PVCA 1YE3A 4IMPA 1LLQA 4XGIA 5FFFA 4RDIA 3WSWA 1ZXLA 4JK3A 4RF4A 4DPMA 3E5RA 2V6GA 2NU9A 1JKIA 2B4TO 2IRWA 3EGOA 2VOEA 3JQBC 4BO2A 1IZ0A 1BDBA 2Y1FA 2X5OA 4NFYA 4GQAA 2D5CA 1Z6ZA 1XHLA 4R1UA 4FOSA 3BMQA 3T4XA 5L7TA 4QECA 5BNFA 2UVDA 4ALIA 2X0RA 3H9EO 3G79A 3GFBA 5JNLA 4P38A 1O95A 3NEPX 3DBHB 3TZQA 4ND3A 3RUAA 3ZNNA 3PQFA 4IJKA 1ZEMA 1H93A 5JDIC 3UHAA 4YAJA 4LSMA 2Q4BA 3A9WA 2Q2WA 1EE9A 3NT2A 1MXFA 4DBZA 4RJTA 3ZCXA 1OAAA 1ZXBA 3DHYA 3MJSA 2VWPA 1X7GA 3ROPA 3GDOA 3GMSA 3FHLA 3ZW9A 1BVRA 3DONA 3BMNA 4MP8A 2C29D 5TX7A 3WXBA 1PQWA 4BL5A 1K5HA 2JHGA 3T7EA 5ER6A 1GUZA 5A9SA 5CEJA 5TJHA 2BKAA 2Q45A 4FW8A 1ZBQA 3GF4A 3ZNOA 1DFGA 4LISA 2HJRA 2CY0A 3JQDA 3ROKA 3BHJA 4IQGA 5JC1A 3NT4A 3VH2A 3KZVA 5KVSA 2GERA 4MIYA 1PZEA 3WSVA 3UGKA 5I7VA 3LC1O 4DIBA 2IODA 3C1OA 1KETA 2NWQA 5GY7A 2EERA 2HJSA 3LU1A 1GEEA 5JBIA 1QLJA 3FSRA 2AEFA 2PFGA 4B7XA 1UAYA 4Y67A 1EVZA 3LC7O 3W1VA 2O4UX 1CYDA 4E5PA 5U1PA 4IBOA 1E7RA 4AJ2A 4CMIB 1PJCA 4HUJA 2VWQA 3IKVA 3HUDA 3LK7A 2FOIA 1E6UA 4R1NA 3HB5X 4AL4A 4OYRA 2GR9A 2GD1O 2W8ZA 1XU7A 1GPDG 5BSGA 1R0KA 3U4CA 1JQBA 4BO4A 3R1IA 1KEUA 3TSCA 1BXGB 3L6OO 5MGBA 3EK2A 4NU6A 4CMCA 3K73O 3WNQA 3GEDA 1B2LA 1T25A 4RPGA 2PZLA 5CDUA 1OI7A 2PGLA 3GMDA 1I01A 4FC6A 4JLWA 3DBVO 5I9MA 2BGKA 1M76A 2AG8A 4YJFB 2YV2A 2B37A 4KTTE 4J7XA 3MEQA 3OJOA 5FF9A 5BNIA 4RVUA 3L07A 2ZB7A 3VPHA 1MFZA 4CMGA 3E1KA 4WEQA 1EVIA 1ENZA 2ZYGA 1HXHA 3I9LA 3PWZA 3R6DA 4E2ZA 5DOVA 4E0BA 3IJPA 3PP8A 5DBGA 3MCVA 1WZEA 4E13A 3RUDA 5ITVA 1OFGA 1TB4A 3E8XA 4YRDA 4G65A 3S2FA 4J4BA 3IL2A 3ADOA 4NFHA 5G4LA 3I23A 3LSYA 3I4CA 3I9JA 5DZSA 3EUWA 1CRWG 1PEDA 4I9UA 5CG1A 4FCCA 2NVWA 2QZ9A 4EUHA 5IDYA 3DZJA 1HYEA 3N74A 3PJGA 2VHZA 5JXWA 4ND2A 3SXPA 4YRAA 1L7DA 2GZ1A 2J3JA 4NBWA 3RWBA 5T8KA 3PFFA 3NTRA 2YHIB 3I9NA 2IZ1A 1LDYA 1RYDA 1N9GB 3AJRA 1GL3A 3WB9A 4AJHA 1ONOA 5JLAA 3RKUA 2UUPA 2AEMA 4A7PA 3QV1A 4Q3CA 4BNJA 3RC1A 1I10A 1FXSA 1W6UA 2YQ5A 3RSHA 1C3VA 1T2CA 3VPSA 4EDFA 1DFHA 1SO8A 4BNVA 3FN4A 4JX8A 5L45A 1HEUA 2J8ZA 3PVZA 7ADHA 4M87A 3QE3A 4YRBA 3WYEA 2JCXA 3AUAA 1YONA 3OIFA 4ONEA 2BRUA 5EESA 5JDIA 2PKQO 3AUTA 5LDHA 3ZWMA 4BV9A 3O38A 2C20A 1V3TA 4M54A 3HADA 4D0SA 2DUWA 2I67A 5F1OA 3WIDA 4UEKA 1EUDA 1E3JA 4L0QA 1ZVMA 4P4GA 2X9VA 1Q0QA 1ZSYA 3BTOA 3KSZO 2EXXA 4UVDA 5IF3A 4KQXA 3H2SA 1ML3A 2P9CA 5THKA 2Q3EA 3DQPA 2NTJA 3CPSA 3F5SA 1HDCA 1HDYA 1KVTA 2HK7A 2JCYA 5CEEA 1NFQA 4UAGA 1IE3A 1EBFA 3F4BA 5F5NA 4CMAA 2X5JO 5COBA 2WSBA 4N5NA 4ZHSA 4P22A 1YVEI 3CXRA 1AE1A 1PJSA 3TOZA 2CNBA 4BNTA 2JD2A 1I33A 1PIWA 3M2TA 5BNTA 1D4FA 1LU9A 3RUIA 4YEDA 1M2WA 1M67A 1OOEA 2VRBA 3VDQA 2A9FA 2QYTA 3TWOA 3WQSB 4QX6A 4ALMA 1MXHA 3EVTA 2NNLD 1WW8A 1U5CA 1JAXA 3UOGA 3JYQA 3QJ5A 2IE0A 5G2OA 1PL7A 1Y7TA 3PLNA 5K6AA 1W8DA 3FF4A 3C3XA 3U4DA 1K89A 2ILTA 4ZU3A 4ALKA 5IDWA 1A4UA 2R6JA 4RPKA 2YHUA 1JTVA 1EFKA 2OL4A 2HUNA 3GUCA 1GU7A 4OXYA 2P68A 2DPHA 1ZMOA 2G17A 1XEAA 4NR0A 2VWGA 3WNVA 1PL6A 1WAMA 1BDMA 2EKPA 2POQX 4GGOA 5IZCC 3V1UA 4TKLA 2WTBA 5A04A 4CQMD 3WDSA 3P2YA 2EKQA 1MX3A 4OL9A 4P4NA 4D0RA 2W98A 3MTJA 2FZEA 1NAIA 2Q1WA 3ZWAA 5A5FA 3ZWBA 3Q2IA 3GNTA 4MVJE 4ALLA 1JN0A 1DEHA 3KB6A 3IUPA 4W82A 2GPTA 4BO5A 3ABIA 4RGBA 4IGEA 5TT1A 5CDYA 4QXMA 4YQZA 1BXKA 2TMGA 2PZJA 1E3WA 4H15A 1S6YA 3IP3A 3RROA 1T2FA 1BG6A 1DHRA 5AVOA 5JO0A 1I36A 8LDHA 1K6JA 4AVYA 3EMKA 3I9MA 3S2EA 1GEGA 5FYDA 2OO5A 4BHTA 2PV7A 1W0CA 4WLVA 1DRWA 2WM3A 3AY7A 3FBGA 1BTOA 4ZVVA 3SX2A 3WYBA 4B7UA 3C7DB 4MKRA 2F00A 2EIHA 2WYWA 5F3RA 4GX0A 4FFOA 3PHLA 2BF7A 4J4TA 4BO8A 1B7GO 3OECA 1GUFA 1CDOA 1MGOA 2H9IA 4NNJA 5CHEA 1GFSA 4TZTA 1LSUA 5JY6A 3KO8A 4CM6A 2RHRA 3Q3CA 4UEJA 3UAGA 4FB5A 2B0JA 2BI8A 4ND5A 2PD3A 4EJMA 2C2YA 3MTGA 1HETA 3O4RA 1E3SA 3ZU4A 4CM8A 5IAAA 4XR4A 1RJWA 5IZCA 2WD8A 3DL2A 4AJEA 1ZK2A 1YJ8A 4M86A 1IUKA 4B7CA 1JKFA 2GNAA 2W4QA 2DFDA 2AHRA 4O59O 2FSVA 4GVXA 3WGQA 2ZTLA 1J5PA 2PTGA 3G3EA 3WGTA 4C7KA 3FRJA 4XIJA 3P2OA 2C07A 4IM7A 4ZRNA 4IDGA 5C37A 4PLTA 1NX6A 3PIIA 4GBJA 1MG5A 4ZA2A 3RFXA 4FFLA 3ANNA 4GVLA 2CFCA 4MVJA 4BGEA 2VQ3A 5HRUA 1HE4A 3PJDA 4BKOA 3PLRA 1SB9A 4RPHA 3EC7A 1NPDA 3EDMA 5L95A 5DCYA 3LF1A 1F8FA 4I8XA 5JAIA 4D42A 1U8XX 3E48A 3ZHXA 4BNIA 2WYVA 3GAFA 2X5KO 2E6UX 3ZV5A 3QY9A 1EQ2A 4TWRA 2HKIA 3AM4A 3WMWA 4XWYA 1T2AA 4IPTA 5A9SB 2WE7A 4Q3BA 5TJ9A 2X0NA 3GR6A 1U3WA 1E5QA 1E3EA 1KEVA 2QW8A 4XQ9A 3O26A 3JYNA 3P7MA 5HTOA 1JW9B 5A4DA 4KMSA 4K26A 3F6YA 4W9NA 5ENVA 4PN3A 3TZKA 2X7HA 3AM3A 5AXBA 5L40A 3VVBA 4JBIA 4WKGA 3ASUA 4PLCA 5HS4A 2WWRA 2HMSA 4HFRA 1Z82A 2O3RA 2P5YA 1QSGA 1Y81A 3NT5A 3UUWA 4F45A 4OQZA 4U5QA 4XD2A 1VC2A 4IZHA 3BTUA 5EMHA 3RJ9A 4R54A 1NVTA 1I24A 2F1KA 3IAHA 3ZU5A 2OOSA 1LC0A 4A03A 4BO1A 4IQ8A 3K9QO 2O3TA 4XRRA 3VPGA 3RASA 1TVEA 4Z9XA 3ETEA 2HU2A 1V6AA 3HFGA 3M6IA 3TPCA 3D5QA 3ZWXA 1XR3A 1VJ0A 3H3JA 4E2XA 4IJVA 3R3SA 3IMFA 3DTYA 1EDZA 1HSOA 2HQ1A 1EDOA 3I1JA 4GL4A 2DBQA 1RWBA 1QYWA 2A4KA 3OFSA 4A26A 3JQ9C 3INRA 3OM9A 3BMOA 4NJMB 2W2LA 1W4ZA 4BMVA 3BMQB 4LGVA 4YBZA 3VKVA 3OICA 4BNLA 5ITWA 3MJ4A 4QTZA 1E7QA 3SJ7A 4E32A 1M6HA 1FDWA 4R5MA 3ULKA 1PQUA 2X58A 3JSAA 3A06A 4PLHA 1MLDA 2Y1DA 1HF3A 1JLLA 2CDCA 4FFPA 2EKLA 2C5AA 1TT7A 1P31A 2UDPA 1EUCA 2Z95A 3AI3A 3ANMA 3FR7A 3BZUA 1I32A 3L9WA 2CUKA 5KNLA 2RAFA 2DBRA 1WLYA 3GZNA 4MVJG 2CDAA 1KVUA 3PPIA 4XDYA 4CMIA 1YS4A 4YT8A 5KJCA 1AUPA 1DSSG 3NJ8A 1LDGA 1Z74A 4R3WA 3FR8A 3OSUA 3ZHZA 4JP3A 3QIVA 1ADGA 1U7HA 3GG9A 5C7LO 4WLUA 1H6DA 1PGPA 2Q1SA 4FSHA 4PRKA 4RPJA 4FDAA 3NTOA 2AQHA 3LT2A 4CMEC 2HRBA 1LDBA 2PZMA 5L9AA 3WQQA 3WBFA 3PQDA 2DPGA 4NU5A 1O94A 1X1EA 3ZN2A 4J16A 3F4LA 2UAGA 5JAMA 3RJ5A 1CIVA 3KHUA 4CLDA 2P4QA 4G81A 1PR9A 1QV7A 3PHJA 5HS6A 2NADA 1NVGA 1P77A 3ZH2A 1XDWA 1RM5A 1BVUA 2ZJ1A 3JD1A 1NBOA 4DLAA 3D64A 5DCWA 1ZJYA 1CQJA 5AOVA 1P1HA 2YQ4A 4UUPA 1B3RA 5JDCA 1XKQA 3MWEB 5G0TA 3W8EA 1C1DB 1DC3A 3H9QA 3JQ8A 3I52A 1YQDA 3K6JA 4PLZA 3OP4A 2NUAA 3GH3A 4LRSB 3E18A 3F3SA 4CLHA 2CMDA 2NSDA 1SB8A 4Y6SA 3DXFA 3FD8A 3DAFA 4QT0A 4U6SA 3WS7A 3KBOA 1SMKA 4WOKA 4JBGA 2R00C 4QEDA 2X23A 4EZBA 2W2KA 3GPIA 2BGLA 4J91A 4PZCA 4XQGA 2UUOA 2X6TA 2I65A 5JFOA 5A06A 3DZHA 4PIVA 4J2OA 3L6EA 3RC7A 3ZHBA 3VKUA 1DXYA 3DAPA 3K31A 4R4JA 5TRTA 3C7AA 2D1YA 2BH9A 5DDIP 4HX5A 4CMEA 4PZDA 5ICMA 2VCYA 3PZRA 4HP8A 4MVJI 2AXQA 1DBVO 2H63A 2PA3A 1WDLA 2GZ2A 3NRCA 1XGKA 2P91A 3GVCA 1P1KA 4I9HA 4IINA 3KSUA 3QVSA 2YDXA 3S2GA 3WFIA 4J1TA 3QLJA 1B26A 4W9NC 3ZDFA 1X13A 1PGNA 1KY5A 4BQPA 2IEBA 1ISIA 4BNMA 1H6CA 1WNTA 4WLOA 3I4FA 4JJFA 1KOLA 2FN7A 4B8ZA 3CIFA 2GN6A 5G0SA 1NPYA 3NGLA 1NPTO 3EW7A 1E3IA 3OQBA 1OC4A 1SEPA 2OMEA 1HLDA 2Q1UA 3QWFA 3PK0A 4EUEA 5JW6A 2LDXA 5DOZA 2IXAA 1LA2A 4B3HA 4DYDA 3HB4X 1SPXA 5A3VA 3X2EA 3ZWCA 3DAGA 1FDSA 1F8GA 1G0NA 3BHMA 2W2KB 2VUTA 1U2GA 4XYMA 5DT9A 4YWJA 3S55A 5G0UA 1K2WA 1ADCA 3E9MA 1YBMA 4NIMA 3DZIA 2QRJA 4LCEA 2WD7B 4B4WA 1R0SA 2JD1A 1BHSA 5L3ZA 2NU8A 5F1KA 3RUEA 5KCZA 2B4RO 3H5NA 3QQPA 1LLCA 2O48X 2ZYDA 4G2NA 5KVQA 4KWIA 3BMNB 1IB6A 4E30A 4EW6A 4Q3EA 1E77A 3PGXA 4I5EA 4NBRA 2BGMA 3I6QA 4XRGA 4YDRA 4A2CA 3UCEA 4UUOA 4CM9A 1ZZEA 3ONDA 4S3MA 2JJYA 3ITDA 5G0VA 4CLOB 1BGVA 4HWKA 4YJHA 3DHNA 3GVHA 4JGBA 3BHIA 4BB5A 1MUUA 3HNPA 2PGJA 3ZWNA 4S1VA 9LDBA 1UXIA 1KY4A 1TT5B 4IXWA 3W8DA 5A5EA 4OSPA 3SLGA 3OIGA 4D79A 3GRPA 1DIBA 1ZIDA 3WGGA 4AG3A 2CDBA 5KVVA 1XSEA 2ZB3A 4KP7A 3V2UA 1EFLA 3H6KA 3AM5A 2PKQP 5G4KA 4E21A 5L4NA 3M2PA 3SC6A 4AJPA 3QWIA 4QO7A 3VTFA 1A5ZA 3TL3A 1RM4A 1E1MA 2AQ8A 3ICPA 5A1TA 3TL2A 2Y0DA 3FNGA 3H9UA 4DWVA 4J9UE 4WLNA 2WE8A 2QX7A 4RLSA 4N18A 4WCFC 3RIHA 4HV4A 3VZQA 1AHIA 4NZ9A 1EVJA 2VHWA 3UVEA 4NMHA 2P9GA 1EUZA 4RVHA 1NFRA 2VZ0A 1H9BA 2CVQA 2FZWA 3EVNA 3ANLA 3ICCA 4CL3A 3NDIA 1RPNA 4FGWA 3RVDA 4Q39A 3FI9A 1YGYA 3C85A 4XDZA 4BKRA 1HDGO 3MJVA 3AFNA 4GPD1 4GX1A 3KSDO 1DRUA 4R68A 3ZWVA 2D3TA 3NX4A 4K6FA 1XELA 2G76A 4CV0A 5JS6A 3I5MA 5JSFA 4L9RA 4U6QA 5KKCA 2Y0CA 2HO5A 4O5OA 2OUIA 5DP1A 3GAZA 4W7IA 3D4OA 4NH4A 2PK3A 4L4XA 4ESOA 2YW9A 1W73A 2YFQA 2YDYA 4IDEA 4BNYA 1D1TA 3JQGA 4MO2A 4NBUA 5JO9A 1O6ZA 1TEHA 4YJDA 4ZQFA 2PZKA 4YAEA 1KVSA 1NR7A 2PD6A 3JD2A 1V0JA 2QYSA 2X9NA 2ZCVA 3GDFA 4MP6A 3V8BA 2NV6A 3S1LA 1CF2O 1NWHA 3HWRA 1H6AA 3JQ8B 4NDNE 1XYGA 3SLKA 3NDJA 1N2SA 4FC7A 4AJ1A 2GASA 4IDCA 4RF5A 1B0AA 3FWNA 4O1MA 3B1FA 2YYYA 4URFA 4WCFA 1PJ2A 2QRKA 3MOGA 3P19A 4RDHA 1NYTA 2Z1NA 2PH3A 4GKVA 3KTDA 1EQUA 2DFVA 3SEFA 4OJNA 3VH4A 1PJQA 3WTCA 2QIOA 2Y1EA 5TS3A 5DP2A 1N9GA 2V6MA 3A4VA 4ALJA 1YB1A 3FWZA 2HLPA 4I9NA 5T8KC 3KUXA 3NJ4A 2JCVA 3DWFA 4CUKA 3DBLA 3AI1A 4CR7A 1AN9A 3KLMX 2PY6A 1X0XA 4XYGA 2DBZA 1ZEJA 4OQYA 4LMRA 3OJ0A 4CM4A 2AE1A 5DBFA 3ROQA 3KLPX 1QLHA 3RFVA 5HA5A 1TLTA 3DMYA 1GCUA 1LJ8A 3AU8A 1ONPA 3DO5A 1XCBA 4WUVA 2DBVO 3M1AA 4XGKA 5K0ZA 1UXKA 3JV7A 1YO6A 4GSKA 2YV1A 1D1SA 4B4UA 4J43A 3DHEA 5TT0A 3PGJA 1YL7A 3SJUA 5IDXA 4L8VA 3PZBA 4F3YA 4XX0A 4CV3A 1YQGA 4ILKA 4BMNA 4EJ0A 1NFFA 3JQ9A 4TMFA 5DCUA 4XYBA 3AY6A 4NK5A 3E82A 3ZW8A 1BXGA 1Y9AA 1CWUA 1E1NA 2HMWA 4DC1A 4LRTB 2EP5A 1MA0A 1HKUA 4RVDA 4K28A 1JVBA 1PGOA 4TRMA 2Y1OA 2VT3A 4TSKA 2HDHA 7MDHA 2ZTUA 4BB6A 4KWHA 4DTIA 4J2HA 1NQTA 4KTVE 1MC5A 3ROMA 3AI2A 3C1TA 1MFPA 1IOLA 1VSUA 2WYUA 2I9PA 4PLGA 1YJQA 1NQAO 3UCFA 1IYZA 4N5MA 4EI2A 4AJ4A 1U5AA 1Q7GA 1QXSA 3SVTA 4YACA 1R66A 1CETA 4D45A 4IJUA 3W4JA 4UREA 1FDTA 4TRRA 1DC4A 4CMKA 3WGHA 1L1FA 1UJMA 3R3JA 3DBRB 3UKOA 4YT2A 3AFMA 1HE2A 3PWSA 1X7HA 3QVTA 4RO0A 4PG7A 2OP0A 4IMRA 4J1QA 4YT5A 1P0FA 5U9CA 4ZQEA 1R4NB 4CPDA 1J6UA 1MV8A 3CSDA 4FIZA 3BTSA 5K9ZA 1UP4A 1HE5A 1YOVA 4QUKA 4JROA 2Y99A 4INAA 4YTEA 2DM6A 1VM6A 1H2BA 1SNYA 4JP2A 1MC4A 3DBHA 3RI3A 5IN5A 4R1SA 2DKNA 4CQMB 2DAPA 1WPQA 3OJEA 1R4MA 3JD3A 1NM5A 5F5LA 2PD4A 1ISGA 2O50A 3GDGA 4IS3A 1M66A 3ZV6A 1LDMA 2QRLA 1I3NA 3DBLB 4FFRA 1NVMB 1BRMA 4OHUA 3W6ZA 4Q3NA 2HK9A 3RC9A 3UH1A 4TVBA 4A0SA 2NM0A 1I2ZA 2C82A 1Z73A 2RH8A 3RUCA 1C1XB 1T26A 3JQBA 1GZ6A 3K2EA 1H94A 1IHXA 1JVSA 4M55A 1LUAA 3NGXA 4C7JA 5B1YA 4CODB 1ENYA 2Z5LA 4WCFB 1A9ZA 5CFZA 4XYLA 2Q99A 1ISHA 1UP7A 3FPCA 4NBTA 4YAKA 4M49A 1XIVA 2FY8A 4NK4A 4R01A 1SC6A 3W6UA 2HRZA 1UZLA 1T1RA 1ARZA 1NAHA 3QVWA 4CLEA 5B4TA 1CQIA 1QORA 3DOOA 3F5QA 3TFQA 4YPOA 1E7SA 4A27A 4FFMA 1M75A 1IHYA 1E1KA 1PGJA 2FSSA 2PGDA 4DBVO 4IUYA 3WLEA 4CR6A 4Q3DA 3DZGA 4AJLA 3B20A 3LLSA 2HMTA 4DQVA 3INTA 2OORA 3KYCA 1NQ5A 3LYLA 1YXMA 3PXXA 2WEKA 4ITUA 3G0OA 1F0YA 3OA2A 5EPOA 2H1SA 4Q9NA 1VLLA 2YY7A 1D7OA 3EZYA 2GYYA 3QVOA 2B69A 4UULA 4AJNA 2J5RA 3G1UA 1PJ3A 4YCAA 5CEFA 2HMVA 4XKJA 1VJTA 5IFLA 4DQUA 1WMBA 4GX2A 4EITA 3ZWYA 1WWKA 2XOXA 3GFGA 2VYVD 4CM7A 5IG2A 2PWZA 3LC2O 5JAZA 4BS9A 1P0CA 3OH8A 1SCUA 1DIHA 5CPBA 4CLXA 4UEOA 4WNIA 2Y1GA 2ZJ0A 2JL1A 4BNGA 2B36A 2I76A 3GEMA 3JTMA 4R3NA 2GF2A 3IOYA 1E1LA 4BGVA 3IDSA 5I8ZA 1QR6A 4CM3A 1PJTA 3H9GA 1E6EA 3OQ1A 4PFJA 4PG4A 5L51A 4HBGA 5ER9A 1I8TA 1ULUA 1GV0A 2LDBA 4WASA 1DC6A 2OGUA 3GVXA 3WQRA 4P8RA 5B4UA 5ADHA 2Y93A 1H2HA 3ETDA 3FCOA 1EZ4A 3CTMA 4FJ1A 3LDHA 5BR7A 5GZ3A 4I5GA 3C8MA 3Q11A 5C3MA 1P44A 3PHGA 3UW3A 3QWHA 2V7PA 4EJ6A 2J5KA 4H7PA 5COQA 4FPXA 4PGFA 1WDKA 3JQ6A 1I3KA 4IY1A 3PTZA 2BLLA 2ZK7A 1R6DA 3VZPA 5J23A 3DOCA 2AG5A 5B37A 3WYCA 2ZB4A 3K30A 2OZPA 2FRDA 1ADFA 3F9IA 4GAEA 4L75A 4Z0PA 4BVAA 3MJTA 3N58A 4TVOA 5B12A 4WEOA 2EG9A 2E4AA 3NKLA 2IDZA 3JQ7B 3STHA 1LSOA 2O3JA 1P1IA 4YQYA 3CZMA 1UH5A 3H4VA 1DHTA 4D41A 1T2DA 4N54A 3RBVA 4CMJA 2Q2VA 4TRJA 1EK6A 2Y66A 1Z7BA 3KVOA 3UF0A 2I5PO 4QSMA 4B3JA 4OM8A 3F1KA 3ORFA 4TRNA 4TZKA 1ZNQO 2J3KA 2Q50A 3AW9A 5DBIA 4R41A 4BGUA 1VKNA 4R1TA 2B35A 5L7YA 4U0KA 1V35A 1YQXA 4CMHA 4Z6KA 3QSGA 3GRKA 5I9LA 1UDBA 3VPFA 4Y9DA 3FNFA 3DOJA 3TZHA 6ADHA 1X0VA 1PGQA 4XCVA 2W90A 5CAEA 3L4SO 1Y6JA 1GDHA 4F6CA 1P1RA 2IXBA 1ZUD1 4E3ZA 4YAGA 4IDBA 1ENOA 1GAEO 1WP4A 1JKJA 4O63O 4DQXA 4HADA 5KJ6A 4J6FA 2G82A 2XAAA 1E5LA 3ZGYA 3DMTA 1S7CA 1O0SA 4KOAA 4NFSA 2X9GA 3HZZA 3G17A 1DOHA 4NI5A 3DC2A 4B4OA 4FJ2A 2CZCA 2Q2QA 3A14A 4RORA 1FDVA 4R51A 1I3LA 3UXYA 3TN7A 3EHEA 1VSVA 3BXXA 4DIOA 5EJ2A 5H83A 4BKUA 4F6LA 1MP0A 1ZO8A 1K0UA 1LC3A 1SBYA 3ZWOA 4HFMA 4DUPA 4CQLB 2B5WA 1B8UA 4BO0A 4IIUA 5K6AC 3W8FA 3LZ6A 2WD7A 1I2BA 2J3HA 4KUHA 6LDHA 1GD1O 4IDFA 5KWEA 2Z1MA 1U3UA 3G1TA 1ZK3A 1UP6A 1LLUA 2C2XA 3KV3O 3OJLA 2G1UA 5F21A 5KVCA 4Y98A 3WICA 4JN6B 5KJEA 2BI7A 5JDCC 2J5QA 3PDUA 1C1XA 4AFNA 1JWBB 3JQ7A 3F47A 3IQDB 4JJIA 5EIOA 2GRAA 2EWMA 2D8AA 1YDEA 2GO1A 4CV2A 4BGIA 1PX0A 1U9JA 3GZNB 3HDJA 2B83A 2JAHA 1P45A 3WGZA 1Q0HA 4GMGA 3CKYA 2P4HX 1C0KA 3WMXA 2O7SA 4AJJA 1YDWA 2NTNA 1KEPA 2X86A 1PSDA 1KIFA 2O3UA 5A03A 1E7WA 2VHVA 4JNKA 4J7UA 3VC7A 4YB8A 3RKRA 4RF2A 3ZI0A 3GPDG 1Q7BA 5CPFA 2VYNA 2WMDA 3I9OA 4BO7A 3JYOA 4MIEA 2VHYA 3H5AA 2FHSA 2EF1A 1B15A 4PG5A 2QHXA 1Q0LA 2VRCD 5A05A 5AXAA 5AYVA 2FWMX 3S2IA 5U4QA 4QFCA 5T64A 3U3XA 1QG6A 2IYPA 4E5MA 5L4LA 5JE8A 2NVUB 4ZQBA 4HFNA 3ZWWA 1ZK4A 4D7AA 2ZIZA 3WR5A 3WGIA 2HK8A 2AE2A 1A7KA 3IUSA 3GVIA 1VKOA 1GQQA 4CUJA 2XF8A 1AXGA 1FK8A 2EHDA 5DN9A 1PQPA 1ZMTA 2E37A 1CEQA 3SBOA 1JDJA 4LVUA 1XQ1A 3TZCA 3ADPA 3CMCO 1B8PA 4MDHA 4E4YA 4MVJM 4GKBA 4W4TA 1N5DA 3Q9NA 5JC8A 4AJKA 2G5CA 1PZFA 1WDMA 3WOHA 4ZJUA 3V1TC 3JCZA 4WPGA 4ZD6A 2C5EA 4Y6PA 2R2GA 3D4NA 2NQ8A 5L4SA 4E6PA 3QRWA 4DRYA 3AWDA 1Y1PA 2O3SA 2ZATA 3ONEA 1EBUA 3DR3A 3T7CA 3BIOA 2I6TA 1A27A 4J9VA 3O9ZA 1U3VA 1QYXA 5LC1A 4OOEA 5T57A 4D46A 4GX5A 1NXQA 4XYEA 1YOVB 4PG8A 3MJEA 3OHSX 4BQRA 4QFDA 5KKAA 4NG5A 4I08A 1DDOA 1R12A 1KVRA 1U3TA 5EINA 2AQKA 5COAA 4ZGWA 1I5RA 4WJZA 1QYCA 3KOUA 2ZQZA 4XQCA 5KJFA 2BELA 3H2ZA 3QP9A 1YKFA 4BNNA 3EY4A 1PJLA 2O2YA 2PNFA 2O2SA 5JMPA 5B4VA 2HSDA 1P1JA 4JQCA 3HN7A 4ZQHA 4DYVA 4D3SA 1PL8A 1B14A 3V5NA 2EP7A 3LQFA 1GV1A 4H3VA 4IQ0A 4Y8VA 2DUUA 1R4NA 3QHAA 4J49A 4OOFA 1BXZA 4K6CA 1SOWA 1EMDA 3AK4A 3V1YA 2E49A 1X15A 4WLEA 4HKTA 4RLHA 4IDAA 2X22A 1LRLA 5AXCA 1HWYA 5TIIA 8ADHA 3ZV4A 4A73A 1HZZA 3DFZA 3AUSA 4U0JA 1PU2A 3WJAA 4CM1A 2EJWA 3L6DA 2ZB8A 4J7CA 4HXYA 1PJ4A 1P9LA 2VWHA 4IJWA 1ZFNA 3SC4A 2GN8A 2VHXA 3GC6A 1B16A 2D0IA 4Z0HO 2H6EA 4B3IA 1HL3A 3BMCB 4BNXA 3H8VA 3BYZA 3ENNA 4OKIA 3WTBA 5C7OO 3RC2A 4RF3A 1M6WA 1U4OA 3LT0A 1E3LA 4L76A 1GQYA 4FBGA 1F12A 2QZZA 1Z7EA 4CM4B 3KEQA 1I30A 4GWKA 2ZYAA 1JA9A 1BW9B 1VJ1A 2VNAA 4YYZA 3E03A 1VE9A 3JQAA 4YJGA 4BNUA 1E6WA 1Y5MA 3HE3A 1OZAA 1DLIA 3ZHYA 2DU8A 3V2HA 3DEYX 2GN9A 1AGNA 4XQEA 1QRRA 3DTTA 3PYXA 4Q3AA 4F46A 3NAQA 5KOIA 1LTHR 2VN8A 1K3TA 1YH3A 3U0BA 1U28A 4NBVA 3MJCA 4R9RA 4NPCA 4BNZA 1HT0A 3VOSA 4CJXA 2VNSA 4M89A 4IS2A 2NVUA 4R9SA 3S8MA 2Y0EA 2EGHA 2NTVA 2B4QA 2OHXA 2OBYA 4DA9A 1R0LA 1HDRA 2NACA 3CH6A 3QW2A 3EZLA 3TFOA 5TF4A 1NTOA 3HN2A 3KEOA 4FQ8A 2RH4A 1P3DA 2B5VA 4JBHA 2YUTA 1SZJG 2EW2A 3GEGA 3CUKA 5GZ1A 3K5PA 2JAPA 1ONNA
chains in the Genus database with same CATH superfamily
4M8SA 1UC8A 4G8DA 1D6MA 1RWPA 2PGIA 3WLOA 2AYXA 2VF8A 1OC2A 2X0JA 4G0UA 1G8MA 3U4QA 1HYGA 3WYNA 4NCHA 5EQDA 3ZCQA 2VSXA 3AT1A 4UTPA 3T3HA 1QQ5A 2PHZA 4CV1A 1LSJA 1PTJA 4LFAB 1P7ZA 2WABA 4AMYA 1KK1A 4NMLA 4ZZ2A 2YIVX 4BCBA 4RPLA 1FL9A 4W99A 2F3SA 3BFXA 1G6KA 3PR3A 3PR2B 3COSA 5AQ1A 2BFCB 4UOZA 1XNGA 2C2KA 2X7JA 3K0KA 1F6WA 2DVMA 2E85A 1WZIA 1QKKA 3DVAA 4ZVOA 3X43A 1L5NA 3R9WA 3A4LA 2SNIE 4RYDA 4PQRA 1B2RA 1JPNA 3KKOA 4M0MA 2CVOA 3DBOB 2G6BA 3FCEA 3ZZUA 5ARBA 2ZR7A 1FVFA 1NMSA 3HDYA 3PFWO 4FZRA 4BBAA 1ORRA 3P52A 1B3BA 2A5LA 3IP8A 4HPWA 1L4UA 1GL6A 4RVFA 1Z7WA 2BJHA 3GXBA 3QX8A 4C4OA 3GCDA 3BN3A 3G0CA 4J0GA 4YALA 1QK3A 1Y8RA 2HJHA 4HNAA 1EEHA 3M0EA 3QEBZ 4Y18A 4D26A 1YU6A 1V4VA 1H0KA 3N7AA 4Q24A 2BFNA 3WJ1A 4KNYA 2CD9A 1MTZA 3TW6A 1RQLA 1RWXA 4ED9A 1Q6YA 3KXIA 4Y1RB 5CYGA 3L4JA 3SM3A 3Q0EA 4F4IA 3DO6A 5FOTA 1Y8QA 3KKZA 3PQ6A 1N32B 2BR4A 5AH0A 1E96A 1Z0ZA 3KQMA 4INPA 1KFBB 4F9GA 2FEXA 1GYRA 2O5EA 1B0UA 3WRYC 3LHDA 2CHEA 5DHPA 5DMXA 1GQ2A 1A98A 4QQRA 4BUCA 2A9PA 3Q7RA 1OZHA 1SUWA 2ERCA 2YOGA 4JT8A 2H1LA 4PSCA 1GG5A 3LSTA 2JFYA 1GA4A 5AHOA 5E0KB 2QAGC 5LD2C 5ALQA 4N9QA 4IXNA 4QYSA 3VAAA 3EXHC 4CEIB 3LVRE 4MKIA 4DQLA 3EMDA 1W4RA 4OL0A 3WG9A 3R20A 1F51E 3LW7A 4YMWA 3VR5D 3M5CA 4KX3A 3IKTA 4YJHB 1WZUA 2EF0A 1J25A 2OHHA 3DGFC 3ON5A 4ZI2A 4X45A 1VLVA 3JAKA 3QOWA 1SA0B 3SDZA 4ARUA 4LJ7A 3QTLA 4Z49A 1PVDA 5GVRA 3W4IA 2M98A 1DWPA 5DF1A 3FMPB 4JUAA 1TJNA 1XZPA 3KZXA 1Q0RA 4PO1A 1N8SA 5EQFA 3MK31 2AW5A 4B45A 1QYDA 1VCIA 1XF9A 4O4HF 1M7HA 1U7TA 1ZSNA 1VJDA 2RB5A 3DV0B 1X7XB 2CB9A 3VH3A 1QP4A 3COVA 3G2PA 2VJMA 5HZHA 2BW0A 1KMMA 5DWDA 5JSHA 3RNOA 2REBA 1AKQA 1UR5A 4TYMA 5HIAA 4CKWB 1AY0A 3P0IA 4L73A 4S2EA 5DULA 3RDPA 3U3DA 1Y6GA 2P0EA 2CCKA 2R8YA 1H85A 5CGZA 1FYWA 1JE0A 3QVXA 5HFNA 3UK6A 4R5HA 3H3FA 4BMXA 2F9LA 8OHMA 4PVDA 4CTJA 1REQB 4E2YA 3NM4A 2LCIA 4IDQA 4HDRB 1U3DA 3OY2A 3WWDA 1WOYA 4MRPA 4PPQA 3DLAA 1RRVA 4PYJA 4RULA 5TC4A 3P9QA 4IRUB 3RVSA 2VQDA 3HVIA 2NT3A 4HYYA 2RHGB 3S8EA 2JRLA 3JVUA 4DLLA 2JD0A 2V59A 4OQQA 4X1IA 4PAQA 5HBRA 1T35A 4KZKA 3R0JA 2VCHA 4Q93A 3WRYA 2IGBA 4MINA 3EE6A 4AUNA 3RD5A 4QUEA 2FETA 3F2VA 2Z9DA 3OPYA 3FOFC 2OOKA 3GEBA 3LT4A 5KAMA 3G2KA 3RGGA 3TJRA 1X7DA 2R1VA 2ZBRA 3DL7A 3GFOA 3MBIA 4C7OB 4KXFB 4LPKA 3D3WB 3FOCA 3G7UA 3OIVA 3JQCA 3WZMA 1O97D 5IN4A 3A1TA 1FDRA 1JEOA 1K98A 4A5SA 2BONA 2SICE 3RIMA 4NHEA 1UBKS 2EV9A 4L5CA 1MX1A 4MRVA 3D0KA 2X76A 3ETJA 2RAVA 3MINA 4LXHA 4ZAYA 1NNEA 2VT7A 3AMVA 3K5HA 1AS3A 2QI9F 3CM0A 3WGYA 3KNZA 2RGXA 3EF3A 3P2IA 4MUXA 1NE7A 3EIWA 4G6ZA 4PZEA 3WNDA 5IASA 4GUAA 4LYJA 4DCJA 3FDIA 2PU7A 2PWBA 3N2GB 1MG0A 3AF6A 1RLIA 1RZ3A 3DYBA 4Q37A 1R18A 5CP8A 2GETA 4N5HX 3LBIA 2PIAA 5HGXA 1R4MB 3QWAA 2NAFA 2R62A 1OGJA 1UXJA 1C14A 4FR5A 4RVGA 3NV9A 2XXBA 5K0TA 5CDSA 1E92A 4RDXA 3O4JA 1Z0SA 2CK3A 3B70A 3R41A 5I4KA 3GLIE 1H5NA 4KDFA 4O6VA 2QSUA 3TUJC 4BQOA 5LQRA 4YJFA 3SF8A 1FVHA 2B25A 3DWEX 5FWNA 4PCVA 3MLEA 4II3A 1JU4A 4D9BA 2O1XA 4OQPA 1YL5A 2QNRA 3NUZA 2FPWA 4TWBA 5ITSA 2C9ZA 2GJ9A 3RBZA 4S1WA 3BIFA 4KQJA 4KUEA 2ODTX 1U2DA 3JQAB 4F9TA 4K9DA 2Q8NA 4FGSA 3A6LA 3V8QA 4DUYB 2QMQA 1E0JA 2R6R1 3C3EA 4V3BA 3BWBA 4RK6A 3GIDA 4WN3A 3VR5A 5C32A 4AM8A 1TJ3A 3D4IA 3P0JA 4NZZA 1K8ZB 1RC1A 4CR8A 5FX2A 5F9HA 2ODAA 5EWMB 1SQ6A 3OURA 4MW0A 3U19A 4EY7A 1QCDA 1Z4JA 1A96A 3AWIA 3CU5A 3F74A 4F12A 3ZCSA 2FX2A 3UFXA 3UK2A 3QFFA 1BSVA 3K2BA 2IV2X 2AJLI 3AUKA 1ZCJA 4URZR 3OEHD 4CIDA 2HOQA 3TI7A 4CUZA 5BVHB 2C88A 1PBNA 3A1NA 4HZUA 1CUGA 4PIPA 1T5OA 4DZTA 5B36A 2OFWA 1Z33A 3IIJA 1A72A 4QATA 4K9OA 3NZEA 3T41A 3JZFA 3I62A 3WRWA 5CX4A 1R10A 2DKOA 5JS2A 2IY9A 4RW0A 5GMOA 3ISTA 1Q20A 3WX0A 5KOJB 4KFSA 2PPLA 2PZFA 3CIOA 3E9NA 3JYLA 4MRNA 4X60A 5G40A 2JPDA 3PIDA 1Q91A 1YS2X 3EA4A 2I33A 2E9SA 3CCCA 1II9A 4JI6B 2JI8A 2VEOA 3NORA 2OMKA 4JAVC 3D7LA 4KVGA 5HSGA 4W9MC 3ZCPA 1R0YA 2RHTA 2FQYA 2NQTA 5EJFA 1H8ED 2RK6A 3CVWA 1V3UA 3TLAA 1PHPA 4DE5A 3PFCA 2VAWA 1T8PA 3ND6A 3MUEA 4IMJB 3U4IA 4IW3B 1JG6A 1JFVA 2FPPA 3DV2A 4UASA 1PBTA 5EERA 5CIYA 3VTKA 4DV6B 4QPNA 4A16A 2BZGA 5AVQA 5KQLA 1WRBA 1G1AA 1ZL0A 1UAGA 3BD7A 1J49A 3RRJA 2QAGA 3VO2A 3ZYCA 3D4BA 3G2NA 1NNUA 1K8XB 1XLTC 2AN1A 4IO0A 4AF7A 2HMUA 3HJUA 3FPGA 2QQ5A 4XFJA 1J2JA 2HF8A 1VSQA 1DAHA 3MUOA 3W6OA 1N2GA 3MBKA 1XWIA 3P5BA 3BDIA 4KO4S 3FCYA 5CM2Z 2NUAB 3AOEC 1XMVA 4TV8A 1KDPA 1SIUA 4KIWA 3GEHA 2C7VA 3O3NB 1ECPA 3C8UA 3IALA 4MVJD 1G5FA 3BCSA 2Y1CA 4JBYA 3VDXA 3L9XA 2EARA 3W5UA 3EGEA 5BV8A 5CDTA 4HNUA 1FMTA 1XZHA 2C9DA 2G9ZA 1LBSA 1CZKA 1MB4A 2NZJA 3LUFA 4BV8A 3EDCA 3ZDBA 5K0CA 1L7PA 2Q0QA 5AJUA 3PWKA 4TLLB 2P9EA 5K3OA 3EZ9A 3PUHA 5KYVA 3WLQA 2VYND 1NUSA 4V38A 4E12A 4EUFA 4NQZA 3EBOA 4QUJA 1V37A 2D5AA 3BXPA 1HSZA 4MDEA 1ATIA 5JYEA 1C9NA 2PWAA 4R16A 4TTJA 3WIBA 2PX4A 4ESEA 1R6TA 2MJLA 1LDNA 1L4FA 3E6AA 3DQQA 3NDRA 2IU6A 3UJHA 5K3BA 1E2HA 5FBLB 1ENPA 3FUVA 2QM8A 2XODA 3TSOA 4UBNA 1DIGA 2QTHA 4XUDA 1U0OC 1CR0A 3QE0A 1PYDA 2J9XB 3H7IA 4PRLA 1Y5LA 1QG4A 3MLAA 2ZANA 2PPVA 4RZHA 3H4TA 3Q98A 1O5IA 2HTFA 4RMJA 2CNNA 3GBPA 4UVEA 1NVKA 1Y1KE 821PA 2DTDA 1TYZA 4MUIA 3OTIA 5JY1A 2JI9A 3GRFA 4AF6A 1M3SA 1T5TA 2XBUA 4Y6LA 3ECSA 4REQA 4XZ3A 3FFBA 3THXB 4F11A 3PG5A 1DBRA 1FRNA 3HA2A 3UENA 4W5OA 3N1UA 4KPYA 1AF7A 3JD0A 4IL5A 5E1OA 1T4MA 4RCZA 3HUFA 4CEHB 1IZ9A 4JJGA 5J2UA 1ZR4A 1LJUA 4M7PA 2ZCUA 1ZD2P 3ZTYA 5KNCD 1XJCA 1ECGA 4MJ3A 3D0QA 4EGCB 2JLVA 4YA6A 3KPYA 2RGGA 2IS1A 1TADA 2EDCA 4IIFA 4NAUA 4PYLA 4QJ3A 4OXRA 1TM4E 5AHXA 3S7ZA 3HC7A 4BMOB 5ADVA 3EFOA 3IUMA 3NM6B 1B76A 3UUFA 3TKLA 3VU0A 2LIVA 2IUYA 3H0EA 3TR6A 4J90A 4B47A 1XQ6A 5L6MB 4F4JA 3ZY3A 1P9NA 4N65A 5LFAA 3CCBA 2V5VA 3IB3A 2BEWB 3TEFA 5CFLA 5JBNA 5JR3A 4GEGA 4QOIA 4JENA 4CCSA 1BVHA 2NNWB 2F8TA 1JR4A 3G2IA 5DNAA 4JBWA 1N3IA 1L1EA 1QGZA 4WCVA 5HUJA 4AYTA 1U2DC 1WZNA 3PQ5A 1QYVA 4TKUB 3D3WA 2VP5A 1AKRA 2WAYA 4G5HA 2C78A 2JFPA 1KKMA 5EE3A 1A7UA 5EJIA 2A1TS 4HNHA 2V55B 1SUFA 2AZMA 2Y68A 3FYUB 1NW8A 1TMKA 3PRKE 5T67A 2CYAA 2VZ9A 1E5XA 1SU8A 1KQ3A 4FQ7A 4Q7JB 3B1WA 5AOBA 2W83A 3URKA 4DPKA 3B1KA 3OOJA 2O54A 1YHNA 4D0LB 1WVGA 4IILA 4AY6A 4KQWA 1T36B 1OROA 1QBKC 1G6OA 2G4VA 3CZRA 5JCJD 4Y6RA 3TSYA 1ECBA 1HE3A 2XE8A 1I2AA 4GD3Q 2GA8A 2ZQ5A 1QR2A 1R0ZA 3LQ4A 1AUOA 5FI3A 3QIAA 1HRDA 1OWLA 4XTRA 3OD1A 4CVNA 4PS1A 4QNNA 3ZCVA 4FI3F 2Q6IA 4X84A 3RCBA 3W9UA 4CMBA 1HTWA 2CYBA 3MCTA 5BPHA 3LL7A 2WMOB 3G9UA 2QTNA 5GJBA 1X2EA 3P4YA 2PL9A 5GGXA 1N7HA 3A1SA 3F67A 1ZJZA 3F5DA 3FRHA 4NMMA 4RA9B 5FOXA 5DI9A 4MW6A 3FPKA 3KKMA 4UD2A 1U1IA 1JLMA 3K4PA 3N2EA 4D5GA 5IYZB 1JAYA 2HD4A 2NGRA 2EX1A 1P91A 2AMFA 4OJKA 3TZ6A 4CL8A 1ZJ4A 4CXMA 3PCXA 2XE7A 5ILGA 1X2BA 2MSKA 4G1UC 2HHLA 4AXBA 5MDHA 3P9PA 2RONA 3LLVA 2X6RA 3IAUA 1IPEA 4QFMA 4UPVA 3IEXA 2PL3A 2QD3A 2GM3A 4NENB 3I42A 3HFJA 3MZ0A 3NVKI 2BDEA 3KETA 5IYZF 2VH2A 2Z2ZA 4RD0A 1CRZA 2P69A 4TYNA 2XGOA 5BVGB 3N39C 4DA6A 1RKUA 3O0TA 4MITA 1JXQA 4WX2B 4N3GA 4ENSA 5JAQA 5KYNA 1DKNA 1UWKA 2VJKA 3PXAA 1N4DA 2BDUA 3ZS8A 4CLRB 4Z7NB 3N75A 4FYYA 3AY3A 5I9BA 2PUCA 1U8TA 4PLFA 4MVJH 3WBBA 4RYLA 1P1CA 2ABWA 2H48A 3U62A 2Z83A 1UKEA 5JZOA 3PKJA 4GT1A 4OHYA 1UINA 1P2TA 1QZUA 2VSYA 3HKCB 4L2IB 3R2JA 3LPNA 4NICA 1GGNA 4URHA 4LZNA 1Q0ZA 2CWDA 4ISCA 1E2LA 3FPSA 4TYQA 1NE2A 1U6JA 4HVTA 4G9EA 4U39A 4PLWA 1FSSA 3OZRA 3DAHA 3TS1A 5A9RA 3L4BC 1U2PA 1IXZA 2VAXA 2XZOA 3BK1A 5D7NA 2PQMA 3EXAA 3KTFA 3QK7A 4DUZB 3BXEA 1C1HA 4KL8S 3VDRA 1DIRA 2OZVA 4F21A 4GPIB 4ITVA 2UV8A 5K8CA 2R5NA 5DGCA 3OQOA 4QKQA 1RWMA 5T3YA 3GD5A 3HMQA 4I55A 5AVYA 1J5EB 4TLDA 4GM4A 4ZYYA 3LYAA 4CCAA 4UBOA 1XRLA 4FIDA 4PEVA 3T5DA 4IXMA 4MS3A 4E33A 3FUTA 4DN6A 1V6CA 2OXIA 3TQFA 4PZYA 3DYIA 2CLMB 4TKUA 1QK4A 4OBEA 1DB3A 2E48A 5D8DA 3CBGA 5DASA 1TI7A 4ZN6A 1VJ5A 1EVEA 4LOAA 5T41A 3OWXA 4XJTA 4BEVA 3QX3A 4QSHA 3EAGA 4GSYA 4BNDA 1YK1A 4OTZA 3CLKA 4FOOA 4IGFA 5DEIA 3U7GA 1R5OA 3JYPA 3KK0A 1UM9A 2IIVA 4FUTA 4PLPA 3T5BA 4TKMA 1JX6A 1LRKA 3DGEC 3IAM6 3KJGA 3U7QA 2J6IA 1A95A 4EPVA 1T29A 5T5QA 3IBFA 4TXMA 3WFZA 2W2XA 2CLCX 3LVFO 3PC2A 4PV7A 3OPYB 3N3AC 3T34A 2IHZA 3RC8A 4G5OA 1R6UA 4CKEB 2P9TA 4YR7A 3K96A 2AMVA 5IMBA 1U8YA 2WTEA 3D5EA 2FEPA 4OD0A 3FKSA 4KSBA 1H2YA 3SJZA 4GOLD 5JI2E 1NDQA 3FTNA 3HCRA 3MWKA 2XXAA 2RCYA 4F4UA 1DC8A 4IJMA 2QPOA 5FHRA 2VAMA 3GLVA 1GQFA 2DR0A 2GVDC 2IU4A 3IPCA 1JDTA 2UUAB 1M9NA 2X19A 4YN3A 1Y1TA 3R0QA 5THQA 5KTKA 1L5HB 1RXVA 4ZCMA 1RJEA 4V02A 1VL6A 3SKXA 2BZSA 3EUFA 4EA6A 1I51A 2VF5X 3V6LA 3LVBA 4F2HA 3U16A 2OILA 4LSGA 2BFPA 1C9EA 4UNQA 3FYDA 3M5WA 4JJKA 2PMFA 3ND8A 3K16A 4K6MA 4V0RA 5AUPB 7GPBA 3BJRA 1A04A 4Y2JA 3REQA 1UFRA 2XY4A 4D9EA 1JQAA 4QPZA 4N5LA 2M1ZA 3C24A 4IGIA 4ZYVA 2ZWOA 4XB2A 5JNUA 1ISMA 4EKNB 3ZX5A 2B82A 1KSFX 3QKWA 2ZYUX 3C4QA 1EUYA 2AMJA 2HDOA 5ES3A 5D3KA 2G8NA 4PZZA 4D80A 3K0SA 4RKQA 2G0AA 5DYYA 1Z4LA 4JL6A 4TXNA 2B8WA 4XQ0A 3ZV3A 2GB4A 1T9HA 2W2LD 2FR8A 4BJHB 5EE9A 3RJMA 1M8PA 5REQB 1N2CB 2WUFA 3ZW7A 2CLKB 1U04A 5FO1A 3GNSA 7YASA 1H69A 1EE1A 2HQSA 2OHGA 3H7AA 5KSYA 1C8LA 3KYCB 4F1JA 1D5CA 3SS9X 1R1DA 1MB0A 3O21A 2Q0HA 3G49A 4YRCA 4HX2A 1A7AA 3DTVD 1AU9A 5HZKA 3L1KA 2G88A 1SELA 3V9PA 2UYCA 2CVZA 2PQ6A 4HDNB 1YE3A 4XLLA 1M2FA 1LLQA 1XTBA 4JKIA 3AM1A 5FFFA 2SKDA 5ENZA 3P9NA 4L5JA 5MFZA 2V6GA 5M2QA 1JKIA 2B4TO 3AYZB 4NAHA 4XX1A 3MT7A 2DUJA 1PUXA 1H4TA 3B9PA 4K7JA 4KGXA 4HNQA 2EQAA 4JI2B 1QZTA 3AV3A 2BM0A 3T9CA 1KQFA 1Z68A 2O2XA 3BEOA 2JCGA 1NBMA 2EKZA 4QECA 5BNFA 4F8YA 9ATCA 1IXYA 1GJRA 3MGGA 3GFBA 2A5DA 4P38A 1O95A 2GSWA 1GUAA 4LDAA 3TZQA 3PQFA 5T4EA 4ETWA 4UE6A 1AMNA 3WY9A 4NZPA 1H93A 3G0DA 5FV4A 4YAJA 1HBJA 3EQ6A 4G97A 3HKDB 5IVIA 3V9AA 1EE9A 1RRMA 1ONSA 1T4GA 2XYGA 4L95C 3I92A 1FXWA 4GM0A 4HLUC 4DBZA 3ZGZA 3ZCXA 2ATXA 4XWKA 1GUBA 1BCRA 1TCBA 4JYBA 1XQ9A 1ZXBA 2VWPA 1QDUA 2QRVA 2WAXA 2R7MA 5CRIA 5DNWA 5DLPA 3ROPA 2WB2A 1N7IA 4L4YA 3V7WA 5A0VA 1XVTA 3FHLA 3ZW9A 3CVOA 3KWLA 3BMNA 4BKMA 3NI2A 3IV6A 3U17A 3DEKA 3PC7A 1Z8FA 5H59A 1PQWA 1FFXB 1PWHA 2C3OA 4HMPA 4HDSA 3KBBA 4M38A 4G4JA 4HMQA 3L7BA 4ZOLA 4EHKA 2CV2A 1F38A 4IAOA 2Q45A 3RFCA 1VJCA 3GF4A 3ZNOA 1E4EA 4LISA 2CY0A 2X8BA 1KI3A 1B73A 2Z9BA 1SQ0A 3BHJA 5FPQA 4YIHA 3VH2A 2HIAA 5ALEA 5HOEA 5KVSA 3USZA 4D5EA 1OBVA 3MJFA 3ESZA 5I7VA 4JEIA 1T0UA 1SCIA 2IODA 5EWMA 1SQ5A 5GY7A 3UJBA 5J4VA 2X2OA 3DSRA 3WLSA 1RC0A 1SG9A 4C04A 2HJSA 4XGRA 3LU1A 2ANBA 1JFFB 3V4ZA 3IVAA 5ELMA 5CCXA 3UMBA 3HR4A 2ATVA 1RVDA 2ODPA 4FGUA 3F7TA 1KS2A 1CUBA 4CNQA 4G5XA 2GJSA 1UZAA 2IQ5A 1HY3A 2FSPA 1F2DA 1PJCA 2ZU0C 4GDMA 4L6IA 1FNCA 2P77A 5P8WA 5T4BA 3R74A 5EYPB 1GZ7A 3CPJB 1JFLA 1ZJ6A 4RA6A 2H1CA 2R7AA 1Z9BA 1VKZA 4EY3A 5D85A 2FOIA 3LUGA 4EG0A 4EGAA 4YDHB 3VNSA 2BGUA 2Z9CA 1D2NA 2AUTA 4OYRA 3TCNA 4UQPA 4GR5A 5BSGA 3R7NA 1N2CA 1DQZA 2HNKA 3N8NA 1U5BB 3K09A 3WLJA 4BO4A 3U5ZB 5IKXA 3HEAA 3K20A 3AR2A 1XCJA 2LTAA 1M10A 4FHGA 1NW4A 1OLUA 3BM5A 5JALA 2VNHA 4NU6A 4C3UA 5MGBA 3ZDYB 4W5QA 3QYJA 4WK0B 3WNQA 2KJQA 1B2LA 3HCEA 4M9SA 4Y2HA 4AY3A 3NDBB 4TXJA 5DI3A 3R8CA 1Y63A 3G0GA 4FDUA 2M1XA 1PR6A 3HLTA 2JJ2A 3A05A 1NTRA 2D06A 4JLWA 3PQ2A 3OWOA 4HQFA 1QMPA 3L0IB 3DO8A 1QH8A 4MUEA 4NJEA 1LV7A 3QXJA 3KT3A 2XDWA 5F12A 1V7CA 3ADCA 4YMVA 3OJOA 1LZKA 4WVLA 2FK7A 2H2GA 5FF9A 2ZSBA 4B3BA 4O4LF 2C2ZA 5K3AA 3UTDA 1RPAA 2HNBA 3L07A 2ZB7A 4GOOD 4MV5A 2HF7A 1NU6A 2QXTA 1AKTA 3E1KA 3NXSA 4RV4A 4C88A 1EVIA 5B6PA 3TG2A 1ENZA 1C8KA 3NHJA 3LHFA 5FL3A 5TVKA 1G5RA 1M1NA 4GOKA 4QLBA 2FDCA 4BY9E 5IT0A 5DTEA 3BQMB 2ADFA 5CPBA 1ZCBA 3SIWA 3U39A 4E0BA 5DBGA 1KNQA 2V7WA 4B2YA 4LRUA 2B9EA 1A2BA 4J4BA 3ZXIA 4G41A 2DWPA 5G4LA 2RG7A 2WU0A 1H4VB 3HA5A 3I23A 3GLGA 2D74A 3I4CA 3TLYA 2EC5A 3LGSA 3NHMA 3I9JA 5LZ2A 3CSUA 5K3CA 3VYTB 2G1JA 2OY0A 1GTZA 1HFWA 1BHQ1 2NVWA 2QN2A 2WB4A 3B5EA 3OZSA 4EYKA 2QTFA 3DKKA 3DULA 5FOSA 1HYEA 1SCDA 2C92A 3ELDA 3E7PA 3LCVB 1CIPA 4OJTA 2Q21A 2V5UA 4NS1A 5WRFA 5DM0A 1IM2A 2EZUA 3PL1A 3DH0A 2FG7C 2IY8A 5FPPA 3FBWA 1QFYA 1L7DA 1RACA 2GZ1A 2VR1A 1JJIA 1YNSA 4NBWA 3RWBA 4QDXA 2BGGA 2V0CA 1J1IA 1GZSA 2ZDHA 4HDRA 3AIIA 2YHIB 3LX8A 3P2EA 3R3WA 4KLNA 4RSGA 4UOEA 2BY4A 1UWVA 4WBNB 3O2QB 3NHPA 1NUAA 4AJHA 1W88B 4L8WB 1N8NA 4X62B 3C5CA 1H3EA 2AEMA 1B0PA 1QE5A 2ARKA 4YI5A 5JJIA 3RC1A 3J81A 2YQ5A 1RADA 2WZQA 3K7EA 2RJ3A 4H7EA 4UAUA 3QFCA 1Z6TA 3FB4A 3ELYA 3NKFA 2YV4A 1B8OA 2FPRA 3PVZA 5AI0A 4M87A 4UHHA 2BHSA 3WYEA 3P9RA 2H0RA 2PSHA 1YONA 1P4SA 2B98A 2POCA 3J7TA 1MF7A 3OIFA 4H0NA 3UPDA 5KX5B 1EFVA 1KH2A 2PO7A 5KYTA 2PKQO 4TUYA 3K70C 3NBXX 1L3CA 3L8YA 4Q7LA 3ZWMA 1PDVA 1M8KA 1TQ8A 3SSAA 2BMVA 3ZLUA 2C20A 4M54A 4DEVA 5JH7A 2QTVB 2V7QD 2VT6A 2WIJA 1P0IA 2DUWA 3UY4A 4MKGA 3WIDA 4UTVA 1EUDA 1E3JA 3Q3JB 2HV9A 1YCGA 5JAOA 4WXRA 1ZYUA 3SSNA 1RC8A 4OFXA 1M2OA 1MW8X 1W5TA 3UMVA 1D7AA 3JQPA 1ZSYA 4LJ6A 2YNMA 3OJWA 3HABA 4UVDA 2VSOA 4X90A 3QVJA 4KQXA 3QE9Y 5THKA 2Q3EA 3I64A 1E1QA 2JJ2D 1DXHA 3CPSA 4WZBE 2GTPA 2GJ4A 3LD9A 1W44A 4OXIA 4EF4A 1RJ9A 1LI7A 2P41A 4UAGA 2Y77A 3SYTA 3BF7A 3TSZA 2O20A 5KAPA 3EG9B 4KH1A 4NOJA 2YS6A 4QNRA 4A8PA 1VJRA 5COBA 3DE3X 2OQ2A 3AY0A 1R0XA 3JAWB 4P22A 4ZHSA 4RS3A 1Z08A 1PJSA 2CNBA 2AFIA 2HNAA 2CXHA 1I33A 2CXPA 5BNTA 1JI0A 1ND6A 1Y37A 2H07A 1DQSA 4A1OA 4J0HA 1OT3A 1X6VA 3I73A 2FW0A 2JVKA 3L5KA 3MELA 4G0OA 5EXDA 5I6DA 2H59A 1WXHA 4D8XA 3F5MA 2Y1XA 3WQSB 3JX9A 1JE1A 1F5SA 3U7IA 4D4JA 3P9SA 3SJAA 4MQFA 4YS6A 2BFBB 3WSTA 4NXMB 1U5CA 1JAXA 4W5JA 4ZIRB 2C95A 3E9YA 1AQIA 3B6EA 6Q21A 4JEMA 1PL7A 5CNKA 5BSUA 1G9TA 2JDID 3U4DA 3WQHA 4R2HA 1Y1RA 3USCS 1A77A 1L8LA 3L40A 2WHPA 3DVAB 2JW5A 3AKCA 3QXGA 1LPSA 4UMDA 3RK1A 2W2VA 2YHUA 3MOSA 4PAGA 3UM9A 4EKGA 1JTVA 4UU1A 1FE8A 2J1LA 2ZBFA 1KSGA 5IS2A 1UMKA 3QBJA 1V8PA 4NULA 1IVYA 2DPHA 2G17A 3LNTA 3V4RA 2BFDB 1OH7A 1U0LA 2I2DA 2VWGA 3WNVA 1NNSA 3AFHA 1MENA 1WAMA 4WFKA 3UH0A 1IQRA 2QJRA 4GGOA 4OQDA 1W4CA 1VE5A 1SKYB 1UJCA 4FI3C 3TZEA 5A04A 4QDOA 4F3KA 1V43A 2WUGA 4QPPA 5AICA 4D0RA 4OL9A 5D6NA 3Q9LA 2FUG1 3MTJA 2YYZA 1YVUA 4J0DA 5CCEA 4KXXA 3ZWAA 1IN6A 4ZVQA 3BWYA 4PX3A 4E1BA 3GNTA 1QPBA 3HM9A 1G64A 3IUPA 2AKEA 3HSSA 3SZMA 3IT2A 1CW2B 2DULA 4KWCA 3ABIA 3IAM1 5TT1A 3W5IA 4QXMA 4YQZA 3L7MA 2MSLA 2I7CA 5BMVF 1BXKA 2DSTA 2TMGA 4LZLA 4S1OA 3D8RA 3LXXA 4GMDA 1KAGA 3U3OA 3HKEA 1ZGAA 5JO0A 3SC3A 2XQGA 1H65A 1SH7A 5E38A 4MSUA 2UYGA 5AHWA 4AVYA 1BU5A 3H11A 4Z4GA 2ZI9A 1OFUX 4BHTA 2EL7A 4QGFA 1YB7A 1QNLA 3NHYA 2FMKA 1BC5A 1FNNA 3O8DA 1BH2A 5HUQA 4MKRA 1YS7A 2EIHA 4ENVA 2RI6A 1Z4IA 3PHLA 4ARAA 2XMSA 3EH1A 3WZLA 5ADUS 1J9GA 3PUVA 3KCQA 2O1EA 4QXQA 2H9IA 2J67A 2HXGA 4BX9A 3V1LA 4TZTA 3KO8A 2Q27A 4CM6A 1F2UB 1PF7E 2E5WA 2RGEA 4H7KA 4NCKA 3KTAB 1IY1A 2QRZA 1ACMA 3DM9B 2AL7A 2OAQ1 1PRYA 2ACEA 1UC5B 3FSJX 4XIFA 5TMEA 2GEUA 2NUTA 1USUA 3EXHB 4FFDA 5IAAA 4LYAA 4PAMA 2WD8A 4POAA 3CVJA 1O0CA 1ZR2A 1YJ8A 2SECE 4DR4B 1JKFA 2OHIA 1T9GR 2GNAA 5CH5A 4Z53A 2VP0A 2GCEA 3AP1A 1QHXA 3KVYA 1GPWB 1SZDA 4KIUA 4OAPA 1HNXB 4ZV9A 3I1FA 3WGQA 2ZTLA 5ICEA 4YCCA 5LZ9A 1Z16A 3AINA 4L8YA 3A2LA 2C07A 3W34A 2CJFA 1DTEA 3WNCA 1TJ5A 4J0QA 3N5CA 3I6YA 2RAPA 2W6ZA 3PIIA 4GBJA 1MG5A 5H3CA 3SHFA 4ER0A 3ANNA 2FOXA 2CFCA 4MVJA 4WK2B 5LOVB 1HE4A 4FWIB 1RXCA 1RAFA 1VBNA 2XVZA 3PLRA 1OBOA 1IN4A 1NPDA 2CNDA 3PQ8A 5LJIA 7REQB 2AX3A 1USVA 2PE5A 1FSPA 1F8FA 1G66A 1P81A 3D8TA 3RIEA 4U00A 4UXHA 2P62A 2ZRJA 3ZV5A 2RGNC 4OY3A 4FBMA 1JHOA 2GKSA 1K7XB 5BN1A 2N9UA 5BRAA 3VM6A 3DMPA 3QXXA 2EJUA 2FN4A 4S0ZA 2H3EA 4FCVA 2QK4A 2I7VA 3KEGA 1G38A 1WSDA 2BFFA 4FXPA 1V7ZA 2DQYA 4OCZA 5LOVF 1CB0A 3UK1A 1E62A 1ODFA 1FUEA 1ZS9A 3A36A 4MRAA 4DEYA 2ZITA 1I0LA 2PU5A 2RK4A 1OWPA 1DX9A 1BS2A 3C87A 1OBCA 4XQ9A 5ALYA 5EXEA 3JYNA 5CFPA 4MB0A 2WNHA 4IOKA 5K0BA 2A9OA 1C5KA 4DNQA 2F6RA 2VZEA 5KX5F 3JR3A 5AXBA 4JLNA 1HNWB 3IHKA 3T94A 3ORRA 3VVBA 4KR7A 4WKGA 2A78A 2ID4A 3HUUA 4B3TB 4C4SA 5HS4A 2JLSA 4HS4A 4KVFA 4DIMA 4U7TB 1T5SA 1I5EA 2IPNA 2QUIA 2GN0A 3OFKA 3AR3A 3D7MA 4G5SA 4WAUA 3S1AB 4U5QA 2PT9A 1MH1A 1UC4B 5JAPA 1JR3D 4MGHA 5EMHA 3Q8KA 4R54A 1NVTA 4H59A 2F1KA 3IAHA 2OOSA 1LC0A 4P4SB 4TMXA 1W29A 4G0YA 4YJ3A 4IQ8A 5KNBA 5BOVA 1ST2A 4L6CA 3K9QO 3ROEA 3WGMA 4HDCA 3MN1A 1S4MA 3JASA 4Z9XA 3UAWA 3ETEA 4L9WA 4XJXA 4E2XA 3W9BA 1WUIS 4DMUB 3FNIA 1PT5A 4OI1A 4ZWNA 3URMA 3Q3EA 2V0GA 1Q3KA 2FPOA 3DTYA 1EDZA 3I1JA 4B87A 1K63A 4PHHA 2O59A 1HFEL 2DBQA 1RWBA 3R5SA 3RC3A 4X6UA 2FW8A 2A4KA 2N46A 1YQ9A 4IEIA 2YWRA 5KQPA 4ABYA 2XOEA 3IUNA 5EIBD 1W4ZA 2WQZA 3BMQB 4BNLA 5ITWA 2ZTHA 2MR6A 2QTTA 4HLCA 4F56A 4P0QB 4BX0A 1GKIA 3IKMB 1XZ8A 1CX9B 3AG5A 3WRXC 1MLDA 2Y1DA 2QPTA 3MTIA 5BY2A 1JLLA 1XDZA 4LQLA 3U6BA 5E7QA 1NXPA 2EKLA 2C5AA 4MA0A 5K2OA 4L27A 4RTKA 1EUCA 3AI3A 2VNJA 4HGYA 1E6MA 1JSZA 1T2UA 2AR0A 4IKPA 3QXCA 3KQQA 1D0IA 1D0SA 1I32A 3L7NA 4JJ4A 2D8MA 1CNEA 4LI3X 3SIRA 2BEUB 5KNLA 3QU7A 4CF5A 2JNWA 2Z09A 4QUDA 2DBRA 4C6TA 1WLYA 2I4RA 1M8JA 2QUZA 1PWYE 5I47A 2CJXA 1V5FA 3T15A 1UK8A 4A8HA 4E70A 5KJCA 2C3UA 1AUPA 4O1HA 3SXUA 5J1TB 4ZYZA 3NJ8A 1LDGA 3ZHQA 5ISMA 4G56A 1U1EA 4HAWA 4UJ5A 3THYA 4RNDB 3RVJA 3FW1A 2F8LA 3D8SA 5B58T 2EZ9A 1FS5A 4EO4A 2AVDA 1H6DA 1KYWA 5A0FA 4PRKA 4FOPA 4RPJA 2AJ8A 2C7BA 4M0EA 1IK4A 4I1OA 1U0NA 3LAWA 1FQOA 2GYUA 3DE2X 2PS1A 1H1TA 4K9NA 3MWFA 2PZMA 2PEZA 2HPHA 3OPXA 4RA6B 5EKTA 5H80A 3RU3A 1RPJA 5CYFA 4DDKA 4BWVA 1JTFA 3CRZA 5JNRA 2JLXA 3WMGA 1DKQA 1T43A 2Q5EA 2P4QA 3KHUA 1FTGA 3OC0A 1REQA 4G81A 4JL5A 5HKOA 5JD5A 1SKMA 2EX0A 1KYXA 1QHEA 1K9SA 3GLGE 5B1EA 4ZCLA 2OFFA 2CXTA 3JD1A 3P9XA 2BTEA 1NUTA 1XALA 5J2TF 3GAMA 2WU3A 2VF2A 3FIUA 3Q5DA 4Z5XA 2YCBA 4M4SA 5G0TA 2D0DA 2R1UA 1X8LA 2VDPB 1D1QA 4FSDA 4JYCA 1UOEA 3JQ8A 3AR8A 1G2QA 1YQDA 1FU8A 1EFPB 1FNBA 3EIXA 1C81A 1W19A 2A5GA 1RE0A 1ODLA 3CUSA 3CEMA 3M9XA 4LRSB 1U99A 5KZMB 3SR3A 1SB8A 3SVLA 2OVFA 2ZIUB 4QT0A 2R00C 4KXUA 3GPIA 5GONB 2BGLA 1EWTA 3Q7SA 1NG1A 3H5VA 2CEKA 4OF4A 4XQGA 2WOOA 2O5CA 3DKVA 2D7DA 1L0BA 1RI1A 2I4TA 3A0UA 1N5IA 1ODKA 1BE1A 4IVPA 2PCJA 2R11A 4U3JA 1EFHA 2IEGA 2XMQA 2X3YA 2VP4A 3DZHA 4FTWA 1JG3A 4PIVA 4M6WB 3RC7A 5BRJA 1QTRA 2PSDA 4V2UA 5SY4A 5TRTA 4BQIA 2D1YA 1EEXB 4NOKA 3T9EA 4G5YA 1U98A 3VR6A 2NUPB 2MU1A 3GIWA 1TZBA 2A7XA 4CF3A 4HP8A 3WYGA 2IY7A 2AXQA 1VMAA 2J3EA 1E63A 5F2OA 4L15A 1WDLA 5EHNA 3DLIA 3UAYA 3C6BA 3NRCA 2J0QA 4FE4A 3O82A 1JG4A 4FZJA 5J1SB 3GQBB 4LXUA 1QKJA 5DLDA 1A1VA 2ST1A 4ZCIA 3KSUA 3QVSA 5EJ6A 5ALOA 3WIOA 4PNZA 4WVFA 1VL5A 3CGGA 5LBTA 3ZEAA 4ZYLA 5CYOA 4FQ5A 3ZJUA 3WOVA 1X13A 2GESA 4IOMA 1OV4A 2IEBA 4J0JA 3ZHOA 3B82A 1Y9DA 5EIAA 4YV7A 1ORWA 2PG3A 3B89A 2R5WA 2CLDX 3I4FA 2HSWA 4DA7A 2F1JA 1MHPA 1YUNA 1XRQA 5A7HA 1F2VA 3T9AA 4B8ZA 3CIFA 3HB0A 4IV5A 4X00A 2P4UA 4D4IA 3DLPX 3DG9A 2CFRA 5GJCA 3NGLA 3V8NA 1E1QD 2XWPA 3EW7A 4KNVA 1E3IA 1IN5A 1OC4A 1N25A 1SVSA 2PT7A 2QQGA 5KX5A 3PK0A 2FX3A 2IW3A 1HGXA 4P4UA 2G06A 4BEBA 4EY4A 4UFNA 5LJLA 3Q88A 1DBWA 5EE5B 3Q2OA 5MGNA 5B3JC 2XLCA 1TL7C 3UMCA 1UFKA 4G0NA 1PKXA 4L3OA 1E1CB 1IXRC 1L1RA 2IYVA 2XDQB 4PWYA 3EIOA 4Y7CA 4YRRA 4NPHA 1F8GA 1NDHA 2Z04A 3A1EA 3VUEA 4BJ6A 2I6GA 1JQ5A 2BP7A 5E7IA 5ECDA 4XYMA 3M70A 4D8VA 3BRSA 3NBYC 3NG1A 4MR9A 4I1VA 1E98A 1K2WA 5CCDA 1FXUA 2QD5A 1ADCA 2E4ZA 1GAWA 1YBMA 2MWMA 2PBFA 4LDRA 5BMOA 2ZJ3A 3MQFA 4LCEA 2WD7B 1UMBA 4B4WA 4PZ9A 4D8YA 2FLWA 2BVNA 2JD1A 3MMNA 3H5NA 4LHWA 1LLCA 3HCFA 1Z2EA 2ZPAA 3KJNA 3ZE1B 1IOVA 5EVJA 3W77A 1KF0A 1BU8A 5AW0A 2JDIA 1XC7A 3QOYA 4BLQA 1ZD5A 2B4YA 1U8AA 1YTUA 3BFJA 4KSYA 1GGMA 3PUZA 4MWDA 2AYZA 3CYFA 3GRRA 1ULZA 1E77A 2JHCA 4FMDB 4EZEA 3OTGA 3P8ZA 1MU0A 4Q3LA 4NBRA 3I6QA 4O8CA 5EJ7A 4C6SA 1XF1A 2J6CA 4M2LA 4UUOA 3UCEA 2JIZA 3V1NA 4MKFA 3EC2A 3N6RA 3H4IA 1W96A 2OBLA 1XX6A 2H06A