3D01A

Crystal structure of the protein atu1372 with unknown function from agrobacterium tumefaciens
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
163
structure length
158
Chain Sequence
GTENLYFQGMSDVIEGRLKELGFTLPVANYVPFTISGNLLYVSGQLPMESGKIAVTGLVGRDVDVASAQRAAELCAVNILAQVKAALNGDLSKIRRVIKLNGFVASVPEFVEQHLVINGASNLIATVLGEPGRHARAAVGMASLPFNASVEIDAIVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the protein Atu1372 with unknown function from Agrobacterium tumefaciens.
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 49
structure length 158
sequence length 163
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2008-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14588 YjgF_endoribonc YjgF/chorismate_mutase-like, putative endoribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3d01A00
1XRGA 1JD1A 2CHSA 1UI9A 3KJKA 1PF5A 2CHTA 2UYNA 1NQ3A 2CW4A 3LYBA 2DYYA 1FNKA 2UYPA 3M1XA 4NWOB 1UFYA 2UYNB 3ZP7A 1ONIA 3I7TA 3MQWA 3ZP4A 3K12A 1QD9A 3VCZA 1COMA 1QAHA 2CSLA 3V4DA 5HP8A 3ZOPA 1QU9A 4ZK7A 2EWCA 3D01A 1ODEA 3I3FA 5HP7A 3ZO8A 2B33A 3LMEA 2OTMA 3L7QA 1J7HA 2UYKA 1XHOA 2UYJA 1FNJA 3GTZA 1X25A 1DBFA 3QUWA 2CWJA 3KJJA 2IG8A 2CVLA 3M4SA 3K0TA 3R0PA
chains in the Genus database with same CATH superfamily
3I55F 4YJ3A 1YITF 2BTQB 1XV2A 2YXZA 3SIUA 3O85A 3JASB 4DRXA 5FNVA 1QVGF 3IKFA 1Q7YH 4HNAA 2HP0A 1NMUB 2H6LA 2HS4A 3MDOA 2CSLA 3F0FA 3WPWA 5FLXM 2ZODA 3D01A 1ODEA 3OBYA 3P0ZA 3N2GB 4IIJA 4EI7A 4X1KA 1JFFA 3JALA 1N8RH 3CCSF 1YHQF 2H8CA 3TD4A 3AGKA 4IHJB 1TUBB 1DT9A 2FGYA 1M1KH 2OTLF 2AMTA 3ELCA 3CB2A 3IR9A 3FBAA 2CHTA 1FSZA 2UYNA 4HNAB 4ZHQB 2RHJA 5IYZB 3J81M 3VOAA 5GAPK 4BT7A 3HKCB 3ZOPA 4X1KB 4F6RA 3JALB 2IAFA 1FFXB 3WGMA 1Q82H 5JCOA 3JAKA 3LDTA 3VO8A 1VQ5F 4EB6B 3CG6A 3N2KB 2R751 4NWOB 1H48A 3M4SA 4ZHQA 1JD1A 3I56F 5JH7B 2GLZA 5GONA 3CD6F 1VHAA 3WGJA 1KC8H 4RHAA 1VQ9F 4TUYA 1ONIA 1X7PA 5LP6C 1FFXA 4G4YA 3VYTC 3V7EA 5IT9M 3WJQA 4FFBA 1RQ2A 2GZLA 1IV1A 3HKDA 3JAKB 3SIVA 4ZI7A 3TD5A 3N2KA 2R6R1 2Z1FA 3DC2A 5C8YA 2FC3A 3LFOA 3VIUA 2UYJA 4G4WA 5BMVB 5JVDB 1OFUA 3D00A 3KJJA 3D54A 3R0PA 1RA4A 1GO0A 5J2UA 2KGWA 2ZVZA 3S02A 2HVYD 4PWTA 3C9RA 4O4JA 2DYYA 4E6EA 1TVKB 3CC2F 4FFBB 2QTPA 4C8IA 1GX1A 2AIZP 3RYCB 2BO1A 4ZI7B 5HP8A 3C9TA 4B62A 1VK3A 1YJ9F 3K14A 4X1IB 2LBTA 4ERHA 1U43A 5GANK 5KMGB 4B45A 1SZQA 1RLGA 2ZOVA 5MN5A 5KX5A 4O4JB 5ITZB 5CA0B 3WGNA 2MQEA 4BW0B 2N48A 4B46A 3HKEA 2HS0A 2UYPA 3M1XA 3HKCA 3QTYA 1X7OA 4O4HA 4BT2A 5IJ9B 3CPWF 3S06A 4BT3A 3C8LA 4X1IA 2VGNA 4C81A 5EZYB 3CCRF 4C8EA 4NQ3A 3CCQF 5MN6A 2DT4A 5DCVA 3V7QA 3JAWA 3IKEA 1XHOA 5HWEA 5GIPC 3JARB 3V3TA 2Z01A 4R40B 2VGMA 2UZHA 1RLUA 3GYQA 3RE3A 3VI6A 4C82A 3LWVC 3RYFB 5LA6B 4DRXB 5JQGB 2G9IA 1JJ2F 2K1SA 3IEWA 3KHNA 5A2QM 2GVIA 4X20B 1X52A 4ZHWA 2B33A 1W3EX 5BMVA 3CC4F 2HX0A 1YIJF 2PHNA 2OZBA 4O4LA 1VQ8F 1U3LA 3QUWA 2HQSC 4O2AA 5EIBD 5MN4A 3K0TA 4I55B 3LWRC 3E22A 4X1YB 3EORA 3RYFA 3RYCA 2WALA 1YJNF 3WPXA 4C4WC 5JCOC 1VQPF 4X20A 1YJWF 1M90H 3V4DA 1GZ0A 1QU9A 2NMUA 2ZF8A 5B8FA 1VQNF 3DDNA 3LMEA 3MCQA 4LCKA 4YJ2A 3F6MA 3FD5A 2VXYA 4I55A 1S72F 5IJ0B 3NMUC 3RA5A 4X3MA 3J7AR 4O2BA 5IJ9A 1CK2A 3N4YA 3T80A 3LYBA 1KQSF 4TZZA 3WJRA 5LXTA 5GONB 3JCMM 3OBWA 1QVFF 3FPIA 4BT5A 4M8IA 5EIBC 2EWCA 4I50A 4LNUA 1YQNA 4YJ2B 1H47A 5FJ4C 1H7MA 2RHLA 1KNJA 1KNKA 3RYHB 1VQ7F 3JATA 5CA1B 3C9UA 2F9ZC 1X25A 3C9SA 1DBFA 4ZK7A 2IG8A 4BVSA 3CCJF 3ERNA 1YI2F 2CHSA 4O4IA 1K9MH 2CW4A 5LP6A 4WBNA 1FNKA 5J2UB 3FFMA 3ZP7A 4LNUB 1U3PA 3UT5B 3VYUC 4BVQA 2OTJF 2ALEA 3HKBA 2Z1EA 2KTUA 3I3FA 3G6EF 3WGLA 3OONA 3S0HA 3RYIB 2LBWA 3GTZA 3P4EA 3CCUF 3E22B 2BTOA 4X1YA 3NVKE 4TV9A 3VMFB 3P10A 4KWEA 2IQQA 3KIZA 1Z5WA 2KTVA 2VAMA 3HTNA 4BT6A 1UFYA 1W5FA 2VAPA 3QHDA 3VCZA 2P6YA 3RYIA 1JFFB 5HP7A 3CXCF 3MBMA 5HY0A 4XCQA 4TV8A 3F0DA 5IJ0A 5LOVA 5HY2A 3NK6A 4O2BB 1K73H 2VAWA 1YGYA 2RB9A 3CCEF 1VQOF 5JVDA 1E7KA 5J2TB 1VQVA 1W55A 4X3LA 4G88A 1SA0A 1Q8RA 3S0WA 1W5BA 2I6DA 4I4TB 4F6RB 3F0EA 1QD9A 1KD1H 1VQMF 4EI9A 3CYPB 1U40A 4G4VA 5LA6A 3VOBA 5CA1A 1W40A 2ZVYA 5LYJA 4EI8A 1VQ4F 3L7QA 1IV3A 3CMAF 3LWOC 5CB4A 1W42A 5EB1B 1K8AH 2ZAUA 2Z1TA 4O4IB 2H8EA 5KMGA 5HXZA 3JASA 1SA0B 4WBNB 3KE1A 1UI9A 4O4LB 5FNVB 3G71F 1VH8A 4TUYB 4I4TA 3B6NA 1Z5VA 5CA0A 3HKDB 3CC7F 3MQWA 2OHWA 3E20B 3PAFA 3G4SF 1W5AA 2JNBA 3HAXD 2Q1XA 3Q8HA 5EWRA 5CB4B 5EB0A 5EYPB 4U3JB 5EZYA 4BVRA 3OW2F 2AIFA 2HRUA 1FNJA 2YYEA 3ON1A 5IYZA 1TVKA 1NJIH 1PF5A 1NQ3A 4RQOA 3JARA 2KG4A 2CZWA 1RQ7A 5HXUA 2L26A 3I7TA 1GO1A 1W59A 3IEQA 5AVMA 3PLAC 3WXMB 2Q1YA 5EYPA 1XBIA 4U3JA 4TV8B 4ZOLB 3RA6A 2W8BC 1ZWZA 4EB6A 3VTIC 1Q86H 3JVHA 4DXDA 3NVIB 3ESJA 5ITZA 2V9YA 3GHZA 3U0OA 5J2TA 5JH7A 3HJWC 4NUTA 1T0AA 2PMPA 2CVLA 2OTMA 3JATB 3K2XA 3RYHA 4O4HB 1T0KB 4O2AB 3CPQA 5HY4A 2HS3A 1W2BF 4YJ3B 2I6RA 2HP3A 3M84A 1JN1A 3S0YA 5LP6B 3ZP4A 1QAHA 4ZHVA 3VYSC 3JAWB 4C8GA 3HKBB 3N2GA 4IIJB 3CCLF 2UYKA 5G4UC 3CMEF 3NK7A 1W581 3CYQA 1CN7A 1VQLF 1W57A 1XRGA 3LWPC 1TUBA 4BVTA 1R1MA 3N4ZA 4TV9B 1IPAA 5JQGA 2RHOA 2UYNB 4BT4A 3IMPA 2RHHA 4U39A 3K12A 3WGKA 1COMA 5LXTB 3LWQC 2QA4F 1W41A 3JAMM 1Q81H 3MCAB 3ZO8A 3BYQA 4I50B 2HRYA 5KX5B 3TD3A 1SDSA 1W5EA 3J80M 3E1YA 4ZHYB 1OAPA 5LOVB 1VQ6F 1J7HA 1JY8A 4G4ZA 3WJPA 3S03A 3HKEB 4G4XA 3KJKA 2LCAA 1IV4A 1CLIA 3CCVF 2Z1UA 3HWUA 2QEXF 1PXWA 2BTUA 5EO3A 4ZOLA 1IV2A 5GINC 1VQKF 2QI2A 4BY9D 2HP0B 5EAZA 3FD6A 3UT5A 5HY1A 5G4VC 3CCMF 4B5CA 5GIOC 5LYJB 3F0GA 2LBXA 2CWJA 5C8YB 4IHJA
chains in the Genus database with same CATH topology
1XRGA 1JD1A 2CHSA 1UI9A 3KJKA 1PF5A 2CHTA 2UYNA 1NQ3A 2CW4A 3LYBA 2DYYA 1FNKA 2UYPA 3M1XA 4NWOB 1UFYA 2UYNB 3ZP7A 1ONIA 3I7TA 3MQWA 3ZP4A 3K12A 1QD9A 3VCZA 1COMA 1QAHA 2CSLA 3V4DA 5HP8A 3ZOPA 1QU9A 4ZK7A 2EWCA 3D01A 1ODEA 3I3FA 5HP7A 3ZO8A 2B33A 3LMEA 2OTMA 3L7QA 1J7HA 2UYKA 1XHOA 2UYJA 1FNJA 3GTZA 1X25A 1DBFA 3QUWA 2CWJA 3KJJA 2IG8A 2CVLA 3M4SA 3K0TA 3R0PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XRG A;  1JD1 A;  2CHS A;  1UI9 A;  3KJK A;  1PF5 A;  2CHT A;  2UYN A;  1NQ3 A;  2CW4 A;  3LYB A;  2DYY A;  1FNK A;  2UYP A;  3M1X A;  4NWO B;  1UFY A;  2UYN B;  3ZP7 A;  1ONI A;  3I7T A;  3MQW A;  3ZP4 A;  3K12 A;  1QD9 A;  3VCZ A;  1COM A;  1QAH A;  2CSL A;  3V4D A;  5HP8 A;  3ZOP A;  1QU9 A;  4ZK7 A;  2EWC A;  3D01 A;  1ODE A;  3I3F A;  5HP7 A;  3ZO8 A;  2B33 A;  3LME A;  2OTM A;  3L7Q A;  1J7H A;  2UYK A;  1XHO A;  2UYJ A;  1FNJ A;  3GTZ A;  1X25 A;  1DBF A;  3QUW A;  2CWJ A;  3KJJ A;  2IG8 A;  2CVL A;  3M4S A;  3K0T A;  3R0P A; 
#chains in the Genus database with same CATH topology
 3I55 F;  4YJ3 A;  1YIT F;  2BTQ B;  1XV2 A;  2YXZ A;  3SIU A;  3O85 A;  3JAS B;  4DRX A;  5FNV A;  1QVG F;  3IKF A;  1Q7Y H;  4HNA A;  2HP0 A;  1NMU B;  2H6L A;  2HS4 A;  3MDO A;  2CSL A;  3F0F A;  3WPW A;  5FLX M;  2ZOD A;  3D01 A;  1ODE A;  3OBY A;  3P0Z A;  3N2G B;  4IIJ A;  4EI7 A;  4X1K A;  1JFF A;  3JAL A;  1N8R H;  3CCS F;  1YHQ F;  2H8C A;  3TD4 A;  3AGK A;  4IHJ B;  1TUB B;  1DT9 A;  2FGY A;  1M1K H;  2OTL F;  2AMT A;  3ELC A;  3CB2 A;  3IR9 A;  3FBA A;  2CHT A;  1FSZ A;  2UYN A;  4HNA B;  4ZHQ B;  2RHJ A;  5IYZ B;  3J81 M;  3VOA A;  5GAP K;  4BT7 A;  3HKC B;  3ZOP A;  4X1K B;  4F6R A;  3JAL B;  2IAF A;  1FFX B;  3WGM A;  1Q82 H;  5JCO A;  3JAK A;  3LDT A;  3VO8 A;  1VQ5 F;  4EB6 B;  3CG6 A;  3N2K B;  2R75 1;  4NWO B;  1H48 A;  3M4S A;  4ZHQ A;  1JD1 A;  3I56 F;  5JH7 B;  2GLZ A;  5GON A;  3CD6 F;  1VHA A;  3WGJ A;  1KC8 H;  4RHA A;  1VQ9 F;  4TUY A;  1ONI A;  1X7P A;  5LP6 C;  1FFX A;  4G4Y A;  3VYT C;  3V7E A;  5IT9 M;  3WJQ A;  4FFB A;  1RQ2 A;  2GZL A;  1IV1 A;  3HKD A;  3JAK B;  3SIV A;  4ZI7 A;  3TD5 A;  3N2K A;  2R6R 1;  2Z1F A;  3DC2 A;  5C8Y A;  2FC3 A;  3LFO A;  3VIU A;  2UYJ A;  4G4W A;  5BMV B;  5JVD B;  1OFU A;  3D00 A;  3KJJ A;  3D54 A;  3R0P A;  1RA4 A;  1GO0 A;  5J2U A;  2KGW A;  2ZVZ A;  3S02 A;  2HVY D;  4PWT A;  3C9R A;  4O4J A;  2DYY A;  4E6E A;  1TVK B;  3CC2 F;  4FFB B;  2QTP A;  4C8I A;  1GX1 A;  2AIZ P;  3RYC B;  2BO1 A;  4ZI7 B;  5HP8 A;  3C9T A;  4B62 A;  1VK3 A;  1YJ9 F;  3K14 A;  4X1I B;  2LBT A;  4ERH A;  1U43 A;  5GAN K;  5KMG B;  4B45 A;  1SZQ A;  1RLG A;  2ZOV A;  5MN5 A;  5KX5 A;  4O4J B;  5ITZ B;  5CA0 B;  3WGN A;  2MQE A;  4BW0 B;  2N48 A;  4B46 A;  3HKE A;  2HS0 A;  2UYP A;  3M1X A;  3HKC A;  3QTY A;  1X7O A;  4O4H A;  4BT2 A;  5IJ9 B;  3CPW F;  3S06 A;  4BT3 A;  3C8L A;  4X1I A;  2VGN A;  4C81 A;  5EZY B;  3CCR F;  4C8E A;  4NQ3 A;  3CCQ F;  5MN6 A;  2DT4 A;  5DCV A;  3V7Q A;  3JAW A;  3IKE A;  1XHO A;  5HWE A;  5GIP C;  3JAR B;  3V3T A;  2Z01 A;  4R40 B;  2VGM A;  2UZH A;  1RLU A;  3GYQ A;  3RE3 A;  3VI6 A;  4C82 A;  3LWV C;  3RYF B;  5LA6 B;  4DRX B;  5JQG B;  2G9I A;  1JJ2 F;  2K1S A;  3IEW A;  3KHN A;  5A2Q M;  2GVI A;  4X20 B;  1X52 A;  4ZHW A;  2B33 A;  1W3E X;  5BMV A;  3CC4 F;  2HX0 A;  1YIJ F;  2PHN A;  2OZB A;  4O4L A;  1VQ8 F;  1U3L A;  3QUW A;  2HQS C;  4O2A A;  5EIB D;  5MN4 A;  3K0T A;  4I55 B;  3LWR C;  3E22 A;  4X1Y B;  3EOR A;  3RYF A;  3RYC A;  2WAL A;  1YJN F;  3WPX A;  4C4W C;  5JCO C;  1VQP F;  4X20 A;  1YJW F;  1M90 H;  3V4D A;  1GZ0 A;  1QU9 A;  2NMU A;  2ZF8 A;  5B8F A;  1VQN F;  3DDN A;  3LME A;  3MCQ A;  4LCK A;  4YJ2 A;  3F6M A;  3FD5 A;  2VXY A;  4I55 A;  1S72 F;  5IJ0 B;  3NMU C;  3RA5 A;  4X3M A;  3J7A R;  4O2B A;  5IJ9 A;  1CK2 A;  3N4Y A;  3T80 A;  3LYB A;  1KQS F;  4TZZ A;  3WJR A;  5LXT A;  5GON B;  3JCM M;  3OBW A;  1QVF F;  3FPI A;  4BT5 A;  4M8I A;  5EIB C;  2EWC A;  4I50 A;  4LNU A;  1YQN A;  4YJ2 B;  1H47 A;  5FJ4 C;  1H7M A;  2RHL A;  1KNJ A;  1KNK A;  3RYH B;  1VQ7 F;  3JAT A;  5CA1 B;  3C9U A;  2F9Z C;  1X25 A;  3C9S A;  1DBF A;  4ZK7 A;  2IG8 A;  4BVS A;  3CCJ F;  3ERN A;  1YI2 F;  2CHS A;  4O4I A;  1K9M H;  2CW4 A;  5LP6 A;  4WBN A;  1FNK A;  5J2U B;  3FFM A;  3ZP7 A;  4LNU B;  1U3P A;  3UT5 B;  3VYU C;  4BVQ A;  2OTJ F;  2ALE A;  3HKB A;  2Z1E A;  2KTU A;  3I3F A;  3G6E F;  3WGL A;  3OON A;  3S0H A;  3RYI B;  2LBW A;  3GTZ A;  3P4E A;  3CCU F;  3E22 B;  2BTO A;  4X1Y A;  3NVK E;  4TV9 A;  3VMF B;  3P10 A;  4KWE A;  2IQQ A;  3KIZ A;  1Z5W A;  2KTV A;  2VAM A;  3HTN A;  4BT6 A;  1UFY A;  1W5F A;  2VAP A;  3QHD A;  3VCZ A;  2P6Y A;  3RYI A;  1JFF B;  5HP7 A;  3CXC F;  3MBM A;  5HY0 A;  4XCQ A;  4TV8 A;  3F0D A;  5IJ0 A;  5LOV A;  5HY2 A;  3NK6 A;  4O2B B;  1K73 H;  2VAW A;  1YGY A;  2RB9 A;  3CCE F;  1VQO F;  5JVD A;  1E7K A;  5J2T B;  1VQV A;  1W55 A;  4X3L A;  4G88 A;  1SA0 A;  1Q8R A;  3S0W A;  1W5B A;  2I6D A;  4I4T B;  4F6R B;  3F0E A;  1QD9 A;  1KD1 H;  1VQM F;  4EI9 A;  3CYP B;  1U40 A;  4G4V A;  5LA6 A;  3VOB A;  5CA1 A;  1W40 A;  2ZVY A;  5LYJ A;  4EI8 A;  1VQ4 F;  3L7Q A;  1IV3 A;  3CMA F;  3LWO C;  5CB4 A;  1W42 A;  5EB1 B;  1K8A H;  2ZAU A;  2Z1T A;  4O4I B;  2H8E A;  5KMG A;  5HXZ A;  3JAS A;  1SA0 B;  4WBN B;  3KE1 A;  1UI9 A;  4O4L B;  5FNV B;  3G71 F;  1VH8 A;  4TUY B;  4I4T A;  3B6N A;  1Z5V A;  5CA0 A;  3HKD B;  3CC7 F;  3MQW A;  2OHW A;  3E20 B;  3PAF A;  3G4S F;  1W5A A;  2JNB A;  3HAX D;  2Q1X A;  3Q8H A;  5EWR A;  5CB4 B;  5EB0 A;  5EYP B;  4U3J B;  5EZY A;  4BVR A;  3OW2 F;  2AIF A;  2HRU A;  1FNJ A;  2YYE A;  3ON1 A;  5IYZ A;  1TVK A;  1NJI H;  1PF5 A;  1NQ3 A;  4RQO A;  3JAR A;  2KG4 A;  2CZW A;  1RQ7 A;  5HXU A;  2L26 A;  3I7T A;  1GO1 A;  1W59 A;  3IEQ A;  5AVM A;  3PLA C;  3WXM B;  2Q1Y A;  5EYP A;  1XBI A;  4U3J A;  4TV8 B;  4ZOL B;  3RA6 A;  2W8B C;  1ZWZ A;  4EB6 A;  3VTI C;  1Q86 H;  3JVH A;  4DXD A;  3NVI B;  3ESJ A;  5ITZ A;  2V9Y A;  3GHZ A;  3U0O A;  5J2T A;  5JH7 A;  3HJW C;  4NUT A;  1T0A A;  2PMP A;  2CVL A;  2OTM A;  3JAT B;  3K2X A;  3RYH A;  4O4H B;  1T0K B;  4O2A B;  3CPQ A;  5HY4 A;  2HS3 A;  1W2B F;  4YJ3 B;  2I6R A;  2HP3 A;  3M84 A;  1JN1 A;  3S0Y A;  5LP6 B;  3ZP4 A;  1QAH A;  4ZHV A;  3VYS C;  3JAW B;  4C8G A;  3HKB B;  3N2G A;  4IIJ B;  3CCL F;  2UYK A;  5G4U C;  3CME F;  3NK7 A;  1W58 1;  3CYQ A;  1CN7 A;  1VQL F;  1W57 A;  1XRG A;  3LWP C;  1TUB A;  4BVT A;  1R1M A;  3N4Z A;  4TV9 B;  1IPA A;  5JQG A;  2RHO A;  2UYN B;  4BT4 A;  3IMP A;  2RHH A;  4U39 A;  3K12 A;  3WGK A;  1COM A;  5LXT B;  3LWQ C;  2QA4 F;  1W41 A;  3JAM M;  1Q81 H;  3MCA B;  3ZO8 A;  3BYQ A;  4I50 B;  2HRY A;  5KX5 B;  3TD3 A;  1SDS A;  1W5E A;  3J80 M;  3E1Y A;  4ZHY B;  1OAP A;  5LOV B;  1VQ6 F;  1J7H A;  1JY8 A;  4G4Z A;  3WJP A;  3S03 A;  3HKE B;  4G4X A;  3KJK A;  2LCA A;  1IV4 A;  1CLI A;  3CCV F;  2Z1U A;  3HWU A;  2QEX F;  1PXW A;  2BTU A;  5EO3 A;  4ZOL A;  1IV2 A;  5GIN C;  1VQK F;  2QI2 A;  4BY9 D;  2HP0 B;  5EAZ A;  3FD6 A;  3UT5 A;  5HY1 A;  5G4V C;  3CCM F;  4B5C A;  5GIO C;  5LYJ B;  3F0G A;  2LBX A;  2CWJ A;  5C8Y B;  4IHJ A; 
#chains in the Genus database with same CATH homology
 1XRG A;  1JD1 A;  2CHS A;  1UI9 A;  3KJK A;  1PF5 A;  2CHT A;  2UYN A;  1NQ3 A;  2CW4 A;  3LYB A;  2DYY A;  1FNK A;  2UYP A;  3M1X A;  4NWO B;  1UFY A;  2UYN B;  3ZP7 A;  1ONI A;  3I7T A;  3MQW A;  3ZP4 A;  3K12 A;  1QD9 A;  3VCZ A;  1COM A;  1QAH A;  2CSL A;  3V4D A;  5HP8 A;  3ZOP A;  1QU9 A;  4ZK7 A;  2EWC A;  3D01 A;  1ODE A;  3I3F A;  5HP7 A;  3ZO8 A;  2B33 A;  3LME A;  2OTM A;  3L7Q A;  1J7H A;  2UYK A;  1XHO A;  2UYJ A;  1FNJ A;  3GTZ A;  1X25 A;  1DBF A;  3QUW A;  2CWJ A;  3KJJ A;  2IG8 A;  2CVL A;  3M4S A;  3K0T A;  3R0P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...