3D01A

Crystal structure of the protein atu1372 with unknown function from agrobacterium tumefaciens
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
163
structure length
158
Chain Sequence
GTENLYFQGMSDVIEGRLKELGFTLPVANYVPFTISGNLLYVSGQLPMESGKIAVTGLVGRDVDVASAQRAAELCAVNILAQVKAALNGDLSKIRRVIKLNGFVASVPEFVEQHLVINGASNLIATVLGEPGRHARAAVGMASLPFNASVEIDAIVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title The crystal structure of the protein Atu1372 with unknown function from Agrobacterium tumefaciens.
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Structural genomics, unknown function
total genus 49
structure length 158
sequence length 163
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2008-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14588 YjgF_endoribonc YjgF/chorismate_mutase-like, putative endoribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3d01A00
3QUWA 2CW4A 2UYKA 3ZP7A 1FNKA 3K12A 3MQWA 3R0PA 3ZOPA 2CHSA 3M1XA 2UYJA 2CVLA 3V4DA 3D01A 1UI9A 1ODEA 1JD1A 2CSLA 3GTZA 1NQ3A 2CWJA 2OTMA 2UYNB 1QAHA 1QU9A 2EWCA 3VCZA 1J7HA 3K0TA 3ZO8A 4ZK7A 1QD9A 1XHOA 2IG8A 3I7TA 2DYYA 2B33A 2CHTA 3KJKA 1X25A 3I3FA 2UYPA 3M4SA 1COMA 2UYNA 4NWOB 1PF5A 1DBFA 1XRGA 3L7QA 5HP8A 3LMEA 3LYBA 3KJJA 3ZP4A 5HP7A 1ONIA 1FNJA 1UFYA
chains in the Genus database with same CATH superfamily
3P0ZA 4G4ZA 3IEWA 3I55F 1YITF 3K12A 2NMUA 3CMEF 5MN5A 2H8CA 3RYCA 1X52A 3HKBB 1GO1A 4I50A 1W5BA 5J2TA 1KNJA 3MBMA 3WGMA 3LWOC 2Z1UA 2HRYA 2HS3A 3NK6A 3ON1A 1SA0B 3WGJA 1H47A 1CK2A 4G4XA 4F6RB 4XCQA 3M4SA 2HX0A 5FNVA 1M1KH 1GX1A 3TD5A 3CYQA 2UYKA 3HKDA 3OONA 3E20B 2OTJF 2DT4A 5G4VC 4IIJA 4O4JA 2RHLA 1N8RH 3CCQF 3S06A 4B45A 5KX5B 3CCUF 1JFFA 1T0KB 4DXDA 3ZO8A 5EB1B 3VYSC 3CPQA 3LWPC 3RYCB 2R6R1 3KIZA 2ALEA 2ZF8A 3WGLA 2GLZA 1FSZA 2YYEA 3C9SA 3CCEF 4U3JB 4FFBA 5EAZA 2Z01A 1VQ7F 5LYJB 2CVLA 4EI7A 1W5EA 2KTVA 2OTMA 3JVHA 3IR9A 4I4TA 3VYUC 1VQ4F 3JATB 2AIFA 2P6YA 3WGKA 5CA0B 2CHTA 5BMVB 2ZODA 1ZWZA 4TZZA 3NMUC 3ERNA 2VGMA 5EO3A 4X1KB 1XBIA 2VAMA 2I6RA 2RHHA 1VQOF 4O4IB 4YJ2B 1Q8RA 5GONB 4ZHQB 5A2QM 4IHJB 3E22A 1VQ8F 3V4DA 2QA4F 3D54A 1YQNA 5JVDB 1W42A 1VQPF 3EORA 2IG8A 2B33A 3RYFB 3KJKA 2HS4A 3HKBA 3I3FA 4B62A 2ZVZA 2VAPA 1H7MA 3L7QA 1W59A 3LMEA 5EIBC 3KHNA 2BO1A 1ONIA 4B5CA 4WBNB 4RHAA 3CCSF 3U0OA 1YHQF 1SA0A 1W41A 4G4WA 3CC7F 4F6RA 2ZAUA 3P4EA 3WJRA 1ODEA 2CSLA 2VAWA 3GTZA 3JCMM 2LBTA 4C81A 4G88A 4EB6B 5G4UC 2K1SA 3RA5A 3IMPA 1S72F 1U3PA 3S0YA 5KX5A 1RLGA 5CB4B 3E1YA 5EZYB 5IJ0B 3CXCF 3C9TA 5KMGB 2LCAA 3C8LA 1VQNF 3ZP7A 5IYZB 3MDOA 1VHAA 5MN4A 2VGNA 3LDTA 5JH7A 1X7OA 1FFXA 4LNUB 2FGYA 1Q7YH 1W581 1PXWA 3RE3A 4ZI7B 2OTLF 3FPIA 3OBYA 2IQQA 1VK3A 3IKEA 4U3JA 5LYJA 3K14A 4DRXA 1VQKF 2LBWA 1W5FA 3JARB 1COMA 2JNBA 1OFUA 3JATA 2FC3A 3LYBA 3CC4F 1W40A 3BYQA 2UZHA 4BT3A 1Z5VA 2OHWA 5CA0A 3T80A 5HY2A 2BTUA 4BT4A 5BMVA 4NUTA 5LXTB 2KGWA 3WXMB 3LFOA 4X1KA 2F9ZC 3F6MA 3WJPA 5JCOC 4O4IA 4ZHQA 4YJ2A 5GONA 4IHJA 5J2UB 4ZHVA 5FLXM 5HWEA 4B46A 4BT5A 3HAXD 3DC2A 3CPWF 5IJ9B 3G71F 3ESJA 4ZHWA 2Q1XA 5JVDA 4X3MA 1CN7A 5EIBD 1XRGA 5JH7B 1FFXB 5LP6C 3KJJA 4TUYA 5HP7A 5HXUA 1CLIA 5AVMA 3CCVF 3RYFA 4C82A 3S02A 3RYIB 3Q8HA 1JN1A 4DRXB 5ITZB 2KTUA 1QVGF 4WBNA 3FFMA 3ELCA 1OAPA 2I6DA 3I7TA 1X7PA 1X25A 2AIZP 4PWTA 3J80M 1TUBA 2LBXA 3VO8A 4C8IA 1GZ0A 3D00A 4KWEA 3MCQA 4C8GA 2G9IA 4M8IA 5HP8A 3CCMF 4EB6A 3VTIC 1YI2F 4LCKA 2HP0B 5CA1A 3VOAA 3ZOPA 2GVIA 3SIVA 3NK7A 2Z1FA 5CB4A 5EZYA 5IJ0A 2V9YA 2HP3A 3PLAC 1Q81H 4X1IA 3F0EA 5KMGA 3HKCB 3QTYA 1RLUA 5IYZA 3K0TA 4ZK7A 4TUYB 1QD9A 3JAWA 1JY8A 4LNUA 3C9RA 5LOVB 3N4ZA 4BT6A 4O2AB 1PF5A 5FJ4C 4BY9D 4ZI7A 1Q82H 1U43A 2QTPA 3OBWA 1FNJA 1RQ2A 3DDNA 4C8EA 3JAKB 3WGNA 3JARA 2CHSA 1Q86H 1VQ6F 1T0AA 3HJWC 4NQ3A 5EWRA 3LWVC 3D01A 1JD1A 3CCLF 1TUBB 4EI8A 2HRUA 3S03A 2WALA 5DCVA 1YJWF 3N2GA 2KG4A 1XHOA 5LXTA 3C9UA 3GHZA 5CA1B 3CG6A 3IEQA 1YJNF 2HQSC 1XV2A 2VXYA 2BTOA 5B8FA 4O2BA 2HVYD 1YIJF 5J2UA 3CD6F 3JASB 4X1IB 3CCRF 2CW4A 2YXZA 5EYPB 2PMPA 5IJ9A 2PHNA 4YJ3A 3UT5B 5GIOC 3JAWB 4X20B 3F0FA 4BT2A 4U39A 1K8AH 3S0WA 3HWUA 4X1YA 1QVFF 3HKEB 1U40A 2IAFA 4BW0B 2CWJA 1KC8H 4E6EA 1QAHA 4C4WC 2OZBA 3SIUA 1J7HA 3RYIA 3JALB 4G4YA 3MCAB 3LWQC 3AGKA 5ITZA 3VIUA 2Z1EA 4ZHYB 4HNAB 4ERHA 3CC2F 3RYHB 3P10A 3ZP4A 1W3EX 3F0DA 1TVKA 3M84A 3N4YA 4I55A 1VQVA 3V7EA 2W8BC 5LP6B 3JAMM 1KQSF 2Z1TA 3N2GB 1VQMF 1IV2A 1E7KA 2RHJA 1M90H 2Q1YA 2HP0A 2EWCA 4BVQA 4O2BB 3FD6A 5GINC 3CYPB 3GYQA 2R751 1W55A 1VQ9F 3V7QA 4BT7A 4O4LB 2UYNA 4YJ3B 2HS0A 1W57A 3HKCA 4RQOA 3TD4A 5HY1A 3NVIB 1Z5WA 4X1YB 2QEXF 1UFYA 3G4SF 3MQWA 5LA6B 5C8YB 3CCJF 5LOVA 3B6NA 5GAPK 4O2AA 3N2KB 3VOBA 3VYTC 4TV8B 5JQGA 3VCZA 3JAKA 5EB0A 4BVSA 1YJ9F 2ZVYA 1TVKB 3RA6A 2RHOA 4I55B 2DYYA 3WJQA 2UYPA 3QHDA 4TV9A 5MN6A 4I50B 5GIPC 3NVKE 1GO0A 5J2TB 3KE1A 1VH8A 3QUWA 1IPAA 1FNKA 3VMFB 3S0HA 2CZWA 1VQLF 1NJIH 5FNVB 1NQ3A 2UYNB 3JASA 3K2XA 1KNKA 1KD1H 5EYPA 1IV3A 3UT5A 4BVTA 2H6LA 3HKDB 4X20A 3TD3A 5HY4A 4IIJB 4O4JB 2GZLA 3HKEA 4ZOLA 1DBFA 2MQEA 3JALA 5JCOA 1JFFB 4BVRA 5JQGB 1YGYA 1DT9A 3CMAF 4O4HA 5HY0A 4R40B 3PAFA 3HTNA 3R0PA 3J7AR 2UYJA 4HNAA 3WPWA 3RYHA 1QU9A 3LWRC 4TV9B 5LP6A 1RA4A 1SZQA 2AMTA 4EI9A 1IV1A 1IV4A 3J81M 4FFBB 5GANK 4NWOB 2L26A 3FBAA 3CB2A 2H8EA 3IKFA 3V3TA 4G4VA 4I4TB 4X3LA 2BTQB 1RQ7A 3G6EF 3M1XA 4O4LA 3F0GA 1UI9A 2RB9A 1JJ2F 1H48A 5IT9M 1U3LA 1W5AA 4ZOLB 1R1MA 5HXZA 3I56F 5LA6A 5C8YA 3O85A 2N48A 3FD5A 3OW2F 1W2BF 3N2KA 3E22B 3WPXA 1K9MH 1VQ5F 4O4HB 3VI6A 4TV8A 1NMUB 1K73H 2QI2A 2ZOVA 1SDSA
chains in the Genus database with same CATH topology
3QUWA 2CW4A 2UYKA 3ZP7A 1FNKA 3K12A 3MQWA 3R0PA 3ZOPA 2CHSA 3M1XA 2UYJA 2CVLA 3V4DA 3D01A 1UI9A 1ODEA 1JD1A 2CSLA 3GTZA 1NQ3A 2CWJA 2OTMA 2UYNB 1QAHA 1QU9A 2EWCA 3VCZA 1J7HA 3K0TA 3ZO8A 4ZK7A 1QD9A 1XHOA 2IG8A 3I7TA 2DYYA 2B33A 2CHTA 3KJKA 1X25A 3I3FA 2UYPA 3M4SA 1COMA 2UYNA 4NWOB 1PF5A 1DBFA 1XRGA 3L7QA 5HP8A 3LMEA 3LYBA 3KJJA 3ZP4A 5HP7A 1ONIA 1FNJA 1UFYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QUW A;  2CW4 A;  2UYK A;  3ZP7 A;  1FNK A;  3K12 A;  3MQW A;  3R0P A;  3ZOP A;  2CHS A;  3M1X A;  2UYJ A;  2CVL A;  3V4D A;  3D01 A;  1UI9 A;  1ODE A;  1JD1 A;  2CSL A;  3GTZ A;  1NQ3 A;  2CWJ A;  2OTM A;  2UYN B;  1QAH A;  1QU9 A;  2EWC A;  3VCZ A;  1J7H A;  3K0T A;  3ZO8 A;  4ZK7 A;  1QD9 A;  1XHO A;  2IG8 A;  3I7T A;  2DYY A;  2B33 A;  2CHT A;  3KJK A;  1X25 A;  3I3F A;  2UYP A;  3M4S A;  1COM A;  2UYN A;  4NWO B;  1PF5 A;  1DBF A;  1XRG A;  3L7Q A;  5HP8 A;  3LME A;  3LYB A;  3KJJ A;  3ZP4 A;  5HP7 A;  1ONI A;  1FNJ A;  1UFY A; 
#chains in the Genus database with same CATH topology
 3P0Z A;  4G4Z A;  3IEW A;  3I55 F;  1YIT F;  3K12 A;  2NMU A;  3CME F;  5MN5 A;  2H8C A;  3RYC A;  1X52 A;  3HKB B;  1GO1 A;  4I50 A;  1W5B A;  5J2T A;  1KNJ A;  3MBM A;  3WGM A;  3LWO C;  2Z1U A;  2HRY A;  2HS3 A;  3NK6 A;  3ON1 A;  1SA0 B;  3WGJ A;  1H47 A;  1CK2 A;  4G4X A;  4F6R B;  4XCQ A;  3M4S A;  2HX0 A;  5FNV A;  1M1K H;  1GX1 A;  3TD5 A;  3CYQ A;  2UYK A;  3HKD A;  3OON A;  3E20 B;  2OTJ F;  2DT4 A;  5G4V C;  4IIJ A;  4O4J A;  2RHL A;  1N8R H;  3CCQ F;  3S06 A;  4B45 A;  5KX5 B;  3CCU F;  1JFF A;  1T0K B;  4DXD A;  3ZO8 A;  5EB1 B;  3VYS C;  3CPQ A;  3LWP C;  3RYC B;  2R6R 1;  3KIZ A;  2ALE A;  2ZF8 A;  3WGL A;  2GLZ A;  1FSZ A;  2YYE A;  3C9S A;  3CCE F;  4U3J B;  4FFB A;  5EAZ A;  2Z01 A;  1VQ7 F;  5LYJ B;  2CVL A;  4EI7 A;  1W5E A;  2KTV A;  2OTM A;  3JVH A;  3IR9 A;  4I4T A;  3VYU C;  1VQ4 F;  3JAT B;  2AIF A;  2P6Y A;  3WGK A;  5CA0 B;  2CHT A;  5BMV B;  2ZOD A;  1ZWZ A;  4TZZ A;  3NMU C;  3ERN A;  2VGM A;  5EO3 A;  4X1K B;  1XBI A;  2VAM A;  2I6R A;  2RHH A;  1VQO F;  4O4I B;  4YJ2 B;  1Q8R A;  5GON B;  4ZHQ B;  5A2Q M;  4IHJ B;  3E22 A;  1VQ8 F;  3V4D A;  2QA4 F;  3D54 A;  1YQN A;  5JVD B;  1W42 A;  1VQP F;  3EOR A;  2IG8 A;  2B33 A;  3RYF B;  3KJK A;  2HS4 A;  3HKB A;  3I3F A;  4B62 A;  2ZVZ A;  2VAP A;  1H7M A;  3L7Q A;  1W59 A;  3LME A;  5EIB C;  3KHN A;  2BO1 A;  1ONI A;  4B5C A;  4WBN B;  4RHA A;  3CCS F;  3U0O A;  1YHQ F;  1SA0 A;  1W41 A;  4G4W A;  3CC7 F;  4F6R A;  2ZAU A;  3P4E A;  3WJR A;  1ODE A;  2CSL A;  2VAW A;  3GTZ A;  3JCM M;  2LBT A;  4C81 A;  4G88 A;  4EB6 B;  5G4U C;  2K1S A;  3RA5 A;  3IMP A;  1S72 F;  1U3P A;  3S0Y A;  5KX5 A;  1RLG A;  5CB4 B;  3E1Y A;  5EZY B;  5IJ0 B;  3CXC F;  3C9T A;  5KMG B;  2LCA A;  3C8L A;  1VQN F;  3ZP7 A;  5IYZ B;  3MDO A;  1VHA A;  5MN4 A;  2VGN A;  3LDT A;  5JH7 A;  1X7O A;  1FFX A;  4LNU B;  2FGY A;  1Q7Y H;  1W58 1;  1PXW A;  3RE3 A;  4ZI7 B;  2OTL F;  3FPI A;  3OBY A;  2IQQ A;  1VK3 A;  3IKE A;  4U3J A;  5LYJ A;  3K14 A;  4DRX A;  1VQK F;  2LBW A;  1W5F A;  3JAR B;  1COM A;  2JNB A;  1OFU A;  3JAT A;  2FC3 A;  3LYB A;  3CC4 F;  1W40 A;  3BYQ A;  2UZH A;  4BT3 A;  1Z5V A;  2OHW A;  5CA0 A;  3T80 A;  5HY2 A;  2BTU A;  4BT4 A;  5BMV A;  4NUT A;  5LXT B;  2KGW A;  3WXM B;  3LFO A;  4X1K A;  2F9Z C;  3F6M A;  3WJP A;  5JCO C;  4O4I A;  4ZHQ A;  4YJ2 A;  5GON A;  4IHJ A;  5J2U B;  4ZHV A;  5FLX M;  5HWE A;  4B46 A;  4BT5 A;  3HAX D;  3DC2 A;  3CPW F;  5IJ9 B;  3G71 F;  3ESJ A;  4ZHW A;  2Q1X A;  5JVD A;  4X3M A;  1CN7 A;  5EIB D;  1XRG A;  5JH7 B;  1FFX B;  5LP6 C;  3KJJ A;  4TUY A;  5HP7 A;  5HXU A;  1CLI A;  5AVM A;  3CCV F;  3RYF A;  4C82 A;  3S02 A;  3RYI B;  3Q8H A;  1JN1 A;  4DRX B;  5ITZ B;  2KTU A;  1QVG F;  4WBN A;  3FFM A;  3ELC A;  1OAP A;  2I6D A;  3I7T A;  1X7P A;  1X25 A;  2AIZ P;  4PWT A;  3J80 M;  1TUB A;  2LBX A;  3VO8 A;  4C8I A;  1GZ0 A;  3D00 A;  4KWE A;  3MCQ A;  4C8G A;  2G9I A;  4M8I A;  5HP8 A;  3CCM F;  4EB6 A;  3VTI C;  1YI2 F;  4LCK A;  2HP0 B;  5CA1 A;  3VOA A;  3ZOP A;  2GVI A;  3SIV A;  3NK7 A;  2Z1F A;  5CB4 A;  5EZY A;  5IJ0 A;  2V9Y A;  2HP3 A;  3PLA C;  1Q81 H;  4X1I A;  3F0E A;  5KMG A;  3HKC B;  3QTY A;  1RLU A;  5IYZ A;  3K0T A;  4ZK7 A;  4TUY B;  1QD9 A;  3JAW A;  1JY8 A;  4LNU A;  3C9R A;  5LOV B;  3N4Z A;  4BT6 A;  4O2A B;  1PF5 A;  5FJ4 C;  4BY9 D;  4ZI7 A;  1Q82 H;  1U43 A;  2QTP A;  3OBW A;  1FNJ A;  1RQ2 A;  3DDN A;  4C8E A;  3JAK B;  3WGN A;  3JAR A;  2CHS A;  1Q86 H;  1VQ6 F;  1T0A A;  3HJW C;  4NQ3 A;  5EWR A;  3LWV C;  3D01 A;  1JD1 A;  3CCL F;  1TUB B;  4EI8 A;  2HRU A;  3S03 A;  2WAL A;  5DCV A;  1YJW F;  3N2G A;  2KG4 A;  1XHO A;  5LXT A;  3C9U A;  3GHZ A;  5CA1 B;  3CG6 A;  3IEQ A;  1YJN F;  2HQS C;  1XV2 A;  2VXY A;  2BTO A;  5B8F A;  4O2B A;  2HVY D;  1YIJ F;  5J2U A;  3CD6 F;  3JAS B;  4X1I B;  3CCR F;  2CW4 A;  2YXZ A;  5EYP B;  2PMP A;  5IJ9 A;  2PHN A;  4YJ3 A;  3UT5 B;  5GIO C;  3JAW B;  4X20 B;  3F0F A;  4BT2 A;  4U39 A;  1K8A H;  3S0W A;  3HWU A;  4X1Y A;  1QVF F;  3HKE B;  1U40 A;  2IAF A;  4BW0 B;  2CWJ A;  1KC8 H;  4E6E A;  1QAH A;  4C4W C;  2OZB A;  3SIU A;  1J7H A;  3RYI A;  3JAL B;  4G4Y A;  3MCA B;  3LWQ C;  3AGK A;  5ITZ A;  3VIU A;  2Z1E A;  4ZHY B;  4HNA B;  4ERH A;  3CC2 F;  3RYH B;  3P10 A;  3ZP4 A;  1W3E X;  3F0D A;  1TVK A;  3M84 A;  3N4Y A;  4I55 A;  1VQV A;  3V7E A;  2W8B C;  5LP6 B;  3JAM M;  1KQS F;  2Z1T A;  3N2G B;  1VQM F;  1IV2 A;  1E7K A;  2RHJ A;  1M90 H;  2Q1Y A;  2HP0 A;  2EWC A;  4BVQ A;  4O2B B;  3FD6 A;  5GIN C;  3CYP B;  3GYQ A;  2R75 1;  1W55 A;  1VQ9 F;  3V7Q A;  4BT7 A;  4O4L B;  2UYN A;  4YJ3 B;  2HS0 A;  1W57 A;  3HKC A;  4RQO A;  3TD4 A;  5HY1 A;  3NVI B;  1Z5W A;  4X1Y B;  2QEX F;  1UFY A;  3G4S F;  3MQW A;  5LA6 B;  5C8Y B;  3CCJ F;  5LOV A;  3B6N A;  5GAP K;  4O2A A;  3N2K B;  3VOB A;  3VYT C;  4TV8 B;  5JQG A;  3VCZ A;  3JAK A;  5EB0 A;  4BVS A;  1YJ9 F;  2ZVY A;  1TVK B;  3RA6 A;  2RHO A;  4I55 B;  2DYY A;  3WJQ A;  2UYP A;  3QHD A;  4TV9 A;  5MN6 A;  4I50 B;  5GIP C;  3NVK E;  1GO0 A;  5J2T B;  3KE1 A;  1VH8 A;  3QUW A;  1IPA A;  1FNK A;  3VMF B;  3S0H A;  2CZW A;  1VQL F;  1NJI H;  5FNV B;  1NQ3 A;  2UYN B;  3JAS A;  3K2X A;  1KNK A;  1KD1 H;  5EYP A;  1IV3 A;  3UT5 A;  4BVT A;  2H6L A;  3HKD B;  4X20 A;  3TD3 A;  5HY4 A;  4IIJ B;  4O4J B;  2GZL A;  3HKE A;  4ZOL A;  1DBF A;  2MQE A;  3JAL A;  5JCO A;  1JFF B;  4BVR A;  5JQG B;  1YGY A;  1DT9 A;  3CMA F;  4O4H A;  5HY0 A;  4R40 B;  3PAF A;  3HTN A;  3R0P A;  3J7A R;  2UYJ A;  4HNA A;  3WPW A;  3RYH A;  1QU9 A;  3LWR C;  4TV9 B;  5LP6 A;  1RA4 A;  1SZQ A;  2AMT A;  4EI9 A;  1IV1 A;  1IV4 A;  3J81 M;  4FFB B;  5GAN K;  4NWO B;  2L26 A;  3FBA A;  3CB2 A;  2H8E A;  3IKF A;  3V3T A;  4G4V A;  4I4T B;  4X3L A;  2BTQ B;  1RQ7 A;  3G6E F;  3M1X A;  4O4L A;  3F0G A;  1UI9 A;  2RB9 A;  1JJ2 F;  1H48 A;  5IT9 M;  1U3L A;  1W5A A;  4ZOL B;  1R1M A;  5HXZ A;  3I56 F;  5LA6 A;  5C8Y A;  3O85 A;  2N48 A;  3FD5 A;  3OW2 F;  1W2B F;  3N2K A;  3E22 B;  3WPX A;  1K9M H;  1VQ5 F;  4O4H B;  3VI6 A;  4TV8 A;  1NMU B;  1K73 H;  2QI2 A;  2ZOV A;  1SDS A; 
#chains in the Genus database with same CATH homology
 3QUW A;  2CW4 A;  2UYK A;  3ZP7 A;  1FNK A;  3K12 A;  3MQW A;  3R0P A;  3ZOP A;  2CHS A;  3M1X A;  2UYJ A;  2CVL A;  3V4D A;  3D01 A;  1UI9 A;  1ODE A;  1JD1 A;  2CSL A;  3GTZ A;  1NQ3 A;  2CWJ A;  2OTM A;  2UYN B;  1QAH A;  1QU9 A;  2EWC A;  3VCZ A;  1J7H A;  3K0T A;  3ZO8 A;  4ZK7 A;  1QD9 A;  1XHO A;  2IG8 A;  3I7T A;  2DYY A;  2B33 A;  2CHT A;  3KJK A;  1X25 A;  3I3F A;  2UYP A;  3M4S A;  1COM A;  2UYN A;  4NWO B;  1PF5 A;  1DBF A;  1XRG A;  3L7Q A;  5HP8 A;  3LME A;  3LYB A;  3KJJ A;  3ZP4 A;  5HP7 A;  1ONI A;  1FNJ A;  1UFY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...