3D01A

Crystal structure of the protein atu1372 with unknown function from agrobacterium tumefaciens
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
163
structure length
158
Chain Sequence
b'GTENLYFQGMSDVIEGRLKELGFTLPVANYVPFTISGNLLYVSGQLPMESGKIAVTGLVGRDVDVASAQRAAELCAVNILAQVKAALNGDLSKIRRVIKLNGFVASVPEFVEQHLVINGASNLIATVLGEPGRHARAAVGMASLPFNASVEIDAIVEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title The crystal structure of the protein Atu1372 with unknown function from Agrobacterium tumefaciens.
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Structural genomics, unknown function
total genus 49
structure length 158
sequence length 163
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2008-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14588 YjgF_endoribonc YjgF/chorismate_mutase-like, putative endoribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3d01A00
3I7TA 3M1XA 2CHSA 2CSLA 2CHTA 2CW4A 3KJJA 2CVLA 3ZO8A 3ZOPA 3ZP4A 1PF5A 2IG8A 1ONIA 2UYNA 2UYNB 1FNKA 1XRGA 3KJKA 1FNJA 4NWOB 3D01A 3ZP7A 1COMA 2UYPA 4ZK7A 1NQ3A 2DYYA 1XHOA 2UYKA 3V4DA 3MQWA 3GTZA 3M4SA 3R0PA 1J7HA 1X25A 2EWCA 1DBFA 1UFYA 1QD9A 1JD1A 3LMEA 1QAHA 2CWJA 3K12A 2B33A 5HP7A 3QUWA 1QU9A 3VCZA 1UI9A 5HP8A 2UYJA 2OTMA 3K0TA 3L7QA 1ODEA 3LYBA 3I3FA
chains in the Genus database with same CATH superfamily
4O4HA 5LP6A 2CSLA 4LNUA 5EZYA 5LP6C 2MQEA 2OTLF 3M84A 1VQPF 1W57A 2DYYA 3JAKA 4O2AB 3WPWA 3LFOA 1K73H 3HAXD 3RYCA 5IJ9A 1GZ0A 3LWOC 1TUBA 5FLXM 2HX0A 4WBNA 4BT4A 3PAFA 4I50A 1H48A 4M8IA 4YJ2A 1VQ8F 1VQNF 2VAWA 5KX5B 4G4WA 2UYJA 4O4LA 3N2GB 2L26A 3CCRF 3HKEA 4ZHVA 1KNJA 1M1KH 2CHSA 3ZP4A 2HVYD 5EIBD 1VQLF 2UYNB 3ESJA 4U3JA 1GO0A 3VYUC 3IR9A 1JFFB 2HS3A 3WJRA 3C9RA 3M4SA 4C82A 2EWCA 5IT9M 3N2KA 1U43A 3KE1A 1FFXB 4EI8A 3LMEA 3QHDA 1W581 3VTIC 3HJWC 5IJ0B 4O4JB 4G88A 4HNAA 2ZOVA 2RB9A 4TUYB 4EI9A 3VYTC 1Z5VA 3OBWA 3C9UA 3CD6F 3ZOPA 3LDTA 4ZK7A 2Z1EA 4DRXB 5JCOA 3JALA 3OONA 5JCOC 2VGNA 3RA5A 3D54A 5EO3A 3FPIA 3LWRC 2HS4A 3V4DA 1JJ2F 3DDNA 5GONA 3O85A 3WJQA 3RA6A 4B62A 3CXCF 2P6YA 3JATA 1KNKA 3Q8HA 2YXZA 4IIJA 4BVRA 1VQ9F 3UT5A 3JAWB 3HKCB 3QUWA 3VYSC 4EB6A 3CCEF 4PWTA 1W3EX 1XBIA 3ZO8A 1W40A 4I55A 1FNKA 1XRGA 4TV9A 3CPWF 4ZI7A 2KGWA 5HY1A 3NVIB 2YYEA 3S06A 3FFMA 3I56F 1SA0B 1YI2F 5LXTB 3ELCA 2LBWA 4C8IA 3F0EA 3SIVA 5C8YA 3J80M 5CA0B 2VGMA 2ZODA 3IMPA 1UI9A 4I4TB 2Q1YA 4ZHQB 5EIBC 1U40A 2HS0A 3VMFB 3JARB 1ONIA 2H6LA 3KJKA 2QEXF 4B5CA 5FNVA 1DT9A 1FSZA 2VXYA 4X1KA 4X1YB 1SZQA 4C8GA 1H7MA 3RYIB 2RHLA 1U3LA 3C8LA 5EB0A 4C8EA 4YJ3B 3JCMM 3F6MA 2DT4A 2CWJA 5GANK 4ZOLB 2HQSC 2BTUA 4TZZA 3WPXA 3K0TA 4TV8A 3PLAC 5ITZB 5JH7B 1GX1A 1TVKA 1PF5A 3WGMA 5HY4A 4O2AA 3CCVF 1KQSF 3C9TA 3MQWA 2FC3A 2I6RA 3CYQA 3S0YA 2BTOA 1JY8A 1RQ2A 3HKBB 1W59A 1W2BF 1VQVA 1H47A 2QI2A 1KC8H 2QA4F 1VQ7F 2R6R1 1RA4A 5LOVB 5CB4A 3K14A 3WGJA 3JVHA 4IHJA 4X1IA 5J2UB 4BT7A 2R751 1YITF 3I3FA 2HRUA 2GZLA 3KHNA 4O4HB 5LP6B 1VK3A 4LNUB 3RYFA 4F6RA 3GYQA 3OW2F 3JASA 3CCMF 4B46A 1VQKF 4FFBA 3JAKB 2F9ZC 2N48A 3F0GA 1W5BA 2OHWA 3RYCB 3F0FA 3TD5A 5IJ9B 1TUBB 4WBNB 2RHHA 4I50B 4G4VA 4YJ2B 4BT6A 1Q86H 5EYPA 3RYHB 2QTPA 3G71F 4X20A 3CC2F 1X7OA 1K8AH 3HKEB 4NUTA 2CW4A 1CK2A 2OZBA 2PHNA 3CPQA 4U3JB 3CCQF 3ZP7A 3KIZA 3HKDA 4XCQA 1K9MH 3GTZA 1J7HA 3CC7F 4ERHA 1X25A 5LYJA 3N2KB 3IKEA 3VOBA 3CCSF 5J2TA 1Q8RA 2AIFA 5IYZA 3K2XA 5AVMA 1W41A 4BW0B 2HP0A 4RHAA 1YJNF 4HNAB 3HWUA 2OTMA 1YJWF 2HP3A 1T0KB 3JALB 2ALEA 2JNBA 4R40B 5HXUA 1RQ7A 4O2BA 4E6EA 5JVDA 4LCKA 2VAPA 1PXWA 5GONB 4KWEA 1DBFA 5KMGB 3ON1A 1Q81H 5G4VC 5CA1A 3F0DA 4U39A 5LA6A 2H8CA 1QAHA 3WXMB 4IIJB 4RQOA 5JQGB 3UT5B 4C4WC 5HWEA 4I4TA 3V7QA 3CG6A 3NK6A 4EB6B 5GIPC 4BT5A 3RE3A 3SIUA 3KJJA 3OBYA 5GIOC 2GVIA 1FNJA 4I55B 1QVGF 4TV9B 3MDOA 1VQOF 3AGKA 3E22A 1S72F 1OAPA 3FBAA 5BMVB 1VQ5F 1IV4A 4O4IB 1VQ6F 3MBMA 2LCAA 1NJIH 3I7TA 3D00A 2PMPA 3CMAF 4B45A 4ZHYB 2I6DA 5FNVB 3T80A 3S0HA 4X1KB 1NQ3A 2UYKA 3E20B 1IPAA 3IEWA 1W5FA 4C81A 1OFUA 1CN7A 1YIJF 1N8RH 1W42A 4ZHWA 2Z1UA 3S0WA 3TD4A 2W8BC 3WJPA 4G4ZA 4G4XA 5KX5A 5J2UA 3CMEF 1M90H 5HP8A 5B8FA 2K1SA 3N2GA 3LWPC 4TV8B 1TVKB 5HP7A 2Q1XA 2UYNA 5EZYB 3CYPB 5MN4A 3WGLA 1YQNA 1JFFA 1T0AA 5A2QM 3HTNA 3R0PA 5GAPK 3I55F 3N4YA 4BT2A 3WGNA 3E1YA 3V3TA 1UFYA 2VAMA 1RLGA 1QD9A 5MN6A 1YJ9F 4NQ3A 1FFXA 3RYHA 3NK7A 1YHQF 5IJ0A 4O4JA 3J7AR 4TUYA 5CB4B 3TD3A 4IHJB 2KTUA 4X1IB 3LWVC 2GLZA 3J81M 2KG4A 1W55A 1ODEA 4O4LB 5HXZA 1CLIA 3B6NA 4DRXA 4F6RB 3RYFB 5MN5A 2Z1FA 3JASB 1VH8A 4FFBB 1W5EA 3U0OA 3G4SF 4X3MA 3S03A 2UZHA 4BT3A 2Z1TA 1SDSA 1VHAA 3MCQA 1VQMF 1Z5WA 1IV2A 5EYPB 3JAWA 5G4UC 3HKCA 2ZVZA 1QU9A 4G4YA 5EB1B 4X20B 5EAZA 4EI7A 3LYBA 2LBTA 5FJ4C 3VO8A 2IG8A 4NWOB 5EWRA 3VOAA 3D01A 3WGKA 4BY9D 3CC4F 3HKDB 1QVFF 3MCAB 5KMGA 1X7PA 1SA0A 5LYJB 5LXTA 1U3PA 1R1MA 3P4EA 3JAMM 5J2TB 5JQGA 5IYZB 1JN1A 2FGYA 3JATB 3K12A 5CA0A 2IQQA 3IKFA 1XV2A 2HP0B 3C9SA 1W5AA 4ZHQA 2H8EA 3M1XA 3JARA 3N4ZA 1X52A 3ERNA 4X3LA 4DXDA 2Z01A 2RHJA 1COMA 2AMTA 3LWQC 4X1YA 1GO1A 3CB2A 4O2BB 3GHZA 4ZI7B 5JVDB 3RYIA 1KD1H 3BYQA 1E7KA 5BMVA 5CA1B 3EORA 1ZWZA 2KTVA 4BVSA 4YJ3A 4O4IA 5LA6B 4BVTA 3S02A 3VI6A 1RLUA 3G6EF 4ZOLA 3IEQA 2B33A 5C8YB 3NVKE 5HY2A 2V9YA 1NMUB 2BTQB 3P10A 3L7QA 3CCJF 1IV3A 5ITZA 1YGYA 5JH7A 2CHTA 2CVLA 2HRYA 3DC2A 2NMUA 2G9IA 2RHOA 2UYPA 2AIZP 3NMUC 3P0ZA 3CCUF 1XHOA 5HY0A 2ZVYA 2IAFA 4BVQA 1VQ4F 3E22B 2ZAUA 2LBXA 1IV1A 2BO1A 5GINC 3HKBA 1Q7YH 1JD1A 2WALA 3FD6A 3QTYA 2CZWA 1Q82H 2ZF8A 5LOVA 3VCZA 3CCLF 2OTJF 5DCVA 3V7EA 3VIUA 3FD5A
chains in the Genus database with same CATH topology
3I7TA 3M1XA 2CHSA 2CSLA 2CHTA 2CW4A 3KJJA 2CVLA 3ZO8A 3ZOPA 3ZP4A 1PF5A 2IG8A 1ONIA 2UYNA 2UYNB 1FNKA 1XRGA 3KJKA 1FNJA 4NWOB 3D01A 3ZP7A 1COMA 2UYPA 4ZK7A 1NQ3A 2DYYA 1XHOA 2UYKA 3V4DA 3MQWA 3GTZA 3M4SA 3R0PA 1J7HA 1X25A 2EWCA 1DBFA 1UFYA 1QD9A 1JD1A 3LMEA 1QAHA 2CWJA 3K12A 2B33A 5HP7A 3QUWA 1QU9A 3VCZA 1UI9A 5HP8A 2UYJA 2OTMA 3K0TA 3L7QA 1ODEA 3LYBA 3I3FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I7T A;  3M1X A;  2CHS A;  2CSL A;  2CHT A;  2CW4 A;  3KJJ A;  2CVL A;  3ZO8 A;  3ZOP A;  3ZP4 A;  1PF5 A;  2IG8 A;  1ONI A;  2UYN A;  2UYN B;  1FNK A;  1XRG A;  3KJK A;  1FNJ A;  4NWO B;  3D01 A;  3ZP7 A;  1COM A;  2UYP A;  4ZK7 A;  1NQ3 A;  2DYY A;  1XHO A;  2UYK A;  3V4D A;  3MQW A;  3GTZ A;  3M4S A;  3R0P A;  1J7H A;  1X25 A;  2EWC A;  1DBF A;  1UFY A;  1QD9 A;  1JD1 A;  3LME A;  1QAH A;  2CWJ A;  3K12 A;  2B33 A;  5HP7 A;  3QUW A;  1QU9 A;  3VCZ A;  1UI9 A;  5HP8 A;  2UYJ A;  2OTM A;  3K0T A;  3L7Q A;  1ODE A;  3LYB A;  3I3F A; 
#chains in the Genus database with same CATH topology
 4O4H A;  5LP6 A;  2CSL A;  4LNU A;  5EZY A;  5LP6 C;  2MQE A;  2OTL F;  3M84 A;  1VQP F;  1W57 A;  2DYY A;  3JAK A;  4O2A B;  3WPW A;  3LFO A;  1K73 H;  3HAX D;  3RYC A;  5IJ9 A;  1GZ0 A;  3LWO C;  1TUB A;  5FLX M;  2HX0 A;  4WBN A;  4BT4 A;  3PAF A;  4I50 A;  1H48 A;  4M8I A;  4YJ2 A;  1VQ8 F;  1VQN F;  2VAW A;  5KX5 B;  4G4W A;  2UYJ A;  4O4L A;  3N2G B;  2L26 A;  3CCR F;  3HKE A;  4ZHV A;  1KNJ A;  1M1K H;  2CHS A;  3ZP4 A;  2HVY D;  5EIB D;  1VQL F;  2UYN B;  3ESJ A;  4U3J A;  1GO0 A;  3VYU C;  3IR9 A;  1JFF B;  2HS3 A;  3WJR A;  3C9R A;  3M4S A;  4C82 A;  2EWC A;  5IT9 M;  3N2K A;  1U43 A;  3KE1 A;  1FFX B;  4EI8 A;  3LME A;  3QHD A;  1W58 1;  3VTI C;  3HJW C;  5IJ0 B;  4O4J B;  4G88 A;  4HNA A;  2ZOV A;  2RB9 A;  4TUY B;  4EI9 A;  3VYT C;  1Z5V A;  3OBW A;  3C9U A;  3CD6 F;  3ZOP A;  3LDT A;  4ZK7 A;  2Z1E A;  4DRX B;  5JCO A;  3JAL A;  3OON A;  5JCO C;  2VGN A;  3RA5 A;  3D54 A;  5EO3 A;  3FPI A;  3LWR C;  2HS4 A;  3V4D A;  1JJ2 F;  3DDN A;  5GON A;  3O85 A;  3WJQ A;  3RA6 A;  4B62 A;  3CXC F;  2P6Y A;  3JAT A;  1KNK A;  3Q8H A;  2YXZ A;  4IIJ A;  4BVR A;  1VQ9 F;  3UT5 A;  3JAW B;  3HKC B;  3QUW A;  3VYS C;  4EB6 A;  3CCE F;  4PWT A;  1W3E X;  1XBI A;  3ZO8 A;  1W40 A;  4I55 A;  1FNK A;  1XRG A;  4TV9 A;  3CPW F;  4ZI7 A;  2KGW A;  5HY1 A;  3NVI B;  2YYE A;  3S06 A;  3FFM A;  3I56 F;  1SA0 B;  1YI2 F;  5LXT B;  3ELC A;  2LBW A;  4C8I A;  3F0E A;  3SIV A;  5C8Y A;  3J80 M;  5CA0 B;  2VGM A;  2ZOD A;  3IMP A;  1UI9 A;  4I4T B;  2Q1Y A;  4ZHQ B;  5EIB C;  1U40 A;  2HS0 A;  3VMF B;  3JAR B;  1ONI A;  2H6L A;  3KJK A;  2QEX F;  4B5C A;  5FNV A;  1DT9 A;  1FSZ A;  2VXY A;  4X1K A;  4X1Y B;  1SZQ A;  4C8G A;  1H7M A;  3RYI B;  2RHL A;  1U3L A;  3C8L A;  5EB0 A;  4C8E A;  4YJ3 B;  3JCM M;  3F6M A;  2DT4 A;  2CWJ A;  5GAN K;  4ZOL B;  2HQS C;  2BTU A;  4TZZ A;  3WPX A;  3K0T A;  4TV8 A;  3PLA C;  5ITZ B;  5JH7 B;  1GX1 A;  1TVK A;  1PF5 A;  3WGM A;  5HY4 A;  4O2A A;  3CCV F;  1KQS F;  3C9T A;  3MQW A;  2FC3 A;  2I6R A;  3CYQ A;  3S0Y A;  2BTO A;  1JY8 A;  1RQ2 A;  3HKB B;  1W59 A;  1W2B F;  1VQV A;  1H47 A;  2QI2 A;  1KC8 H;  2QA4 F;  1VQ7 F;  2R6R 1;  1RA4 A;  5LOV B;  5CB4 A;  3K14 A;  3WGJ A;  3JVH A;  4IHJ A;  4X1I A;  5J2U B;  4BT7 A;  2R75 1;  1YIT F;  3I3F A;  2HRU A;  2GZL A;  3KHN A;  4O4H B;  5LP6 B;  1VK3 A;  4LNU B;  3RYF A;  4F6R A;  3GYQ A;  3OW2 F;  3JAS A;  3CCM F;  4B46 A;  1VQK F;  4FFB A;  3JAK B;  2F9Z C;  2N48 A;  3F0G A;  1W5B A;  2OHW A;  3RYC B;  3F0F A;  3TD5 A;  5IJ9 B;  1TUB B;  4WBN B;  2RHH A;  4I50 B;  4G4V A;  4YJ2 B;  4BT6 A;  1Q86 H;  5EYP A;  3RYH B;  2QTP A;  3G71 F;  4X20 A;  3CC2 F;  1X7O A;  1K8A H;  3HKE B;  4NUT A;  2CW4 A;  1CK2 A;  2OZB A;  2PHN A;  3CPQ A;  4U3J B;  3CCQ F;  3ZP7 A;  3KIZ A;  3HKD A;  4XCQ A;  1K9M H;  3GTZ A;  1J7H A;  3CC7 F;  4ERH A;  1X25 A;  5LYJ A;  3N2K B;  3IKE A;  3VOB A;  3CCS F;  5J2T A;  1Q8R A;  2AIF A;  5IYZ A;  3K2X A;  5AVM A;  1W41 A;  4BW0 B;  2HP0 A;  4RHA A;  1YJN F;  4HNA B;  3HWU A;  2OTM A;  1YJW F;  2HP3 A;  1T0K B;  3JAL B;  2ALE A;  2JNB A;  4R40 B;  5HXU A;  1RQ7 A;  4O2B A;  4E6E A;  5JVD A;  4LCK A;  2VAP A;  1PXW A;  5GON B;  4KWE A;  1DBF A;  5KMG B;  3ON1 A;  1Q81 H;  5G4V C;  5CA1 A;  3F0D A;  4U39 A;  5LA6 A;  2H8C A;  1QAH A;  3WXM B;  4IIJ B;  4RQO A;  5JQG B;  3UT5 B;  4C4W C;  5HWE A;  4I4T A;  3V7Q A;  3CG6 A;  3NK6 A;  4EB6 B;  5GIP C;  4BT5 A;  3RE3 A;  3SIU A;  3KJJ A;  3OBY A;  5GIO C;  2GVI A;  1FNJ A;  4I55 B;  1QVG F;  4TV9 B;  3MDO A;  1VQO F;  3AGK A;  3E22 A;  1S72 F;  1OAP A;  3FBA A;  5BMV B;  1VQ5 F;  1IV4 A;  4O4I B;  1VQ6 F;  3MBM A;  2LCA A;  1NJI H;  3I7T A;  3D00 A;  2PMP A;  3CMA F;  4B45 A;  4ZHY B;  2I6D A;  5FNV B;  3T80 A;  3S0H A;  4X1K B;  1NQ3 A;  2UYK A;  3E20 B;  1IPA A;  3IEW A;  1W5F A;  4C81 A;  1OFU A;  1CN7 A;  1YIJ F;  1N8R H;  1W42 A;  4ZHW A;  2Z1U A;  3S0W A;  3TD4 A;  2W8B C;  3WJP A;  4G4Z A;  4G4X A;  5KX5 A;  5J2U A;  3CME F;  1M90 H;  5HP8 A;  5B8F A;  2K1S A;  3N2G A;  3LWP C;  4TV8 B;  1TVK B;  5HP7 A;  2Q1X A;  2UYN A;  5EZY B;  3CYP B;  5MN4 A;  3WGL A;  1YQN A;  1JFF A;  1T0A A;  5A2Q M;  3HTN A;  3R0P A;  5GAP K;  3I55 F;  3N4Y A;  4BT2 A;  3WGN A;  3E1Y A;  3V3T A;  1UFY A;  2VAM A;  1RLG A;  1QD9 A;  5MN6 A;  1YJ9 F;  4NQ3 A;  1FFX A;  3RYH A;  3NK7 A;  1YHQ F;  5IJ0 A;  4O4J A;  3J7A R;  4TUY A;  5CB4 B;  3TD3 A;  4IHJ B;  2KTU A;  4X1I B;  3LWV C;  2GLZ A;  3J81 M;  2KG4 A;  1W55 A;  1ODE A;  4O4L B;  5HXZ A;  1CLI A;  3B6N A;  4DRX A;  4F6R B;  3RYF B;  5MN5 A;  2Z1F A;  3JAS B;  1VH8 A;  4FFB B;  1W5E A;  3U0O A;  3G4S F;  4X3M A;  3S03 A;  2UZH A;  4BT3 A;  2Z1T A;  1SDS A;  1VHA A;  3MCQ A;  1VQM F;  1Z5W A;  1IV2 A;  5EYP B;  3JAW A;  5G4U C;  3HKC A;  2ZVZ A;  1QU9 A;  4G4Y A;  5EB1 B;  4X20 B;  5EAZ A;  4EI7 A;  3LYB A;  2LBT A;  5FJ4 C;  3VO8 A;  2IG8 A;  4NWO B;  5EWR A;  3VOA A;  3D01 A;  3WGK A;  4BY9 D;  3CC4 F;  3HKD B;  1QVF F;  3MCA B;  5KMG A;  1X7P A;  1SA0 A;  5LYJ B;  5LXT A;  1U3P A;  1R1M A;  3P4E A;  3JAM M;  5J2T B;  5JQG A;  5IYZ B;  1JN1 A;  2FGY A;  3JAT B;  3K12 A;  5CA0 A;  2IQQ A;  3IKF A;  1XV2 A;  2HP0 B;  3C9S A;  1W5A A;  4ZHQ A;  2H8E A;  3M1X A;  3JAR A;  3N4Z A;  1X52 A;  3ERN A;  4X3L A;  4DXD A;  2Z01 A;  2RHJ A;  1COM A;  2AMT A;  3LWQ C;  4X1Y A;  1GO1 A;  3CB2 A;  4O2B B;  3GHZ A;  4ZI7 B;  5JVD B;  3RYI A;  1KD1 H;  3BYQ A;  1E7K A;  5BMV A;  5CA1 B;  3EOR A;  1ZWZ A;  2KTV A;  4BVS A;  4YJ3 A;  4O4I A;  5LA6 B;  4BVT A;  3S02 A;  3VI6 A;  1RLU A;  3G6E F;  4ZOL A;  3IEQ A;  2B33 A;  5C8Y B;  3NVK E;  5HY2 A;  2V9Y A;  1NMU B;  2BTQ B;  3P10 A;  3L7Q A;  3CCJ F;  1IV3 A;  5ITZ A;  1YGY A;  5JH7 A;  2CHT A;  2CVL A;  2HRY A;  3DC2 A;  2NMU A;  2G9I A;  2RHO A;  2UYP A;  2AIZ P;  3NMU C;  3P0Z A;  3CCU F;  1XHO A;  5HY0 A;  2ZVY A;  2IAF A;  4BVQ A;  1VQ4 F;  3E22 B;  2ZAU A;  2LBX A;  1IV1 A;  2BO1 A;  5GIN C;  3HKB A;  1Q7Y H;  1JD1 A;  2WAL A;  3FD6 A;  3QTY A;  2CZW A;  1Q82 H;  2ZF8 A;  5LOV A;  3VCZ A;  3CCL F;  2OTJ F;  5DCV A;  3V7E A;  3VIU A;  3FD5 A; 
#chains in the Genus database with same CATH homology
 3I7T A;  3M1X A;  2CHS A;  2CSL A;  2CHT A;  2CW4 A;  3KJJ A;  2CVL A;  3ZO8 A;  3ZOP A;  3ZP4 A;  1PF5 A;  2IG8 A;  1ONI A;  2UYN A;  2UYN B;  1FNK A;  1XRG A;  3KJK A;  1FNJ A;  4NWO B;  3D01 A;  3ZP7 A;  1COM A;  2UYP A;  4ZK7 A;  1NQ3 A;  2DYY A;  1XHO A;  2UYK A;  3V4D A;  3MQW A;  3GTZ A;  3M4S A;  3R0P A;  1J7H A;  1X25 A;  2EWC A;  1DBF A;  1UFY A;  1QD9 A;  1JD1 A;  3LME A;  1QAH A;  2CWJ A;  3K12 A;  2B33 A;  5HP7 A;  3QUW A;  1QU9 A;  3VCZ A;  1UI9 A;  5HP8 A;  2UYJ A;  2OTM A;  3K0T A;  3L7Q A;  1ODE A;  3LYB A;  3I3F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...