3D06A

Human p53 core domain with hot spot mutation r249s (i)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
192
structure length
179
Chain Sequence
VPSQKTYQGSYGFRLGFLVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRSPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of restoring sequence-specific DNA binding and transactivation to mutant p53 by suppressor mutations
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Cellular tumor antigen p53
total genus 44
structure length 179
sequence length 192
ec nomenclature
pdb deposition date 2008-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3d06A00
5AOLA 4IJTA 2AHIA 5LGYA 1HJCA 3QYNA 5ECGA 3VD1A 4MZIA 3WTYA 1E50A 1YCSA 4AGNA 2WGXA 2J1YA 4LO9A 4GUOA 3D08A 5ABAA 1TUPA 2AC0A 3VD2A 2XWRA 4XR8C 2J21A 4HJEA 1GZHA 1CMOA 2BIPA 1KZYA 3D05A 1UOLA 1H9DA 4AGPA 3EXJA 4GUQA 2J1XA 2X0VA 2GEQA 2FEJA 5AOIA 2ATAA 3WTVA 3IGLA 2BINA 3IGKA 3Q06A 1HJBC 4L0YA 2J1ZA 5G4NA 2IOOA 4IBZA 2J6WA 2BIQA 1T4WA 4L0ZA 1LJMA 3VD0A 4IBSA 3QYMA 2J20A 5G4MA 3WTXA 3US1A 4IBUA 3WTTA 2BIOA 2J1WA 2X0UA 4G82A 3US0A 2IOMA 2IOIA 2H1LM 1EAQA 4IBQA 2YBGA 3D07A 5AOKA 2P52A 4AGOA 1CO1A 5G4OA 2PCXA 5AOJA 2ADYA 4IBTA 2X0WA 4IBVA 1IO4C 4A63A 1TSRA 4MZRA 3WTWA 2OCJA 1HU8A 4IBWA 3TS8A 2MEJB 4G83A 3WU1A 5LAPA 4AGLA 5BUAA 4IBYA 1EANA 4LOEA 3KMDA 3D0AA 4QO1B 4KVPA 2XWCA 3KZ8A 2VUKA 3EXLA 3D06A 4L18A 1GZHC 2RMNA 3ZMEA 5KBDA 3Q05A 5AOMA 5AB9A 4AGMA 3WTSA 2BIMA 4LOFA 3WTUA 3D09A 5A7BA 1EAOA 4AGQA 3Q01A
chains in the Genus database with same CATH superfamily
3TCTA 3MZGB 3AREC 4DOHE 6FABL 5CJXC 3ABMB 4XAWL 5F7MC 2E47A 2VLMD 4NP4H 1RULL 1U4EA 4JKLA 3UTTE 1UM5H 5SWQA 3VFSA 5HVHC 3QYNA 4KNTA 4HFWA 3ZDWA 3KL5A 5I1GH 1OK0A 3EBGA 5E7BA 5FYJH 3BLPX 5LBVA 2AV1A 4DN4H 4JG1L 3BRFA 1X7QB 1BAFL 3IDNB 1LQBC 1WZ1H 1P7QA 2EIKB 5IVZA 3U6XA 5EZJB 1MCWW 5EPMA 2NY5H 3CJJA 3EGXB 3QG7H 1MELA 1Q1JL 2OK0H 5IHHA 3HUJB 5AKSA 2X3CA 3LIZL 1RZFL 3SPIA 5I0YA 2NRDA 2APVA 2Q8BL 3OR6B 4ERSL 1V3LA 3MA9L 5AOIA 5EZPA 2NR6C 2X28A 1TZIB 5C0CB 2Z35A 4RFNB 5ESVA 4XN2A 3ISWA 5GZND 4HIEA 3RY5A 5ESQB 1TJGH 1HC1A 2X3AA 3KPLB 3NJXA 3ASOB 2JKLA 2VE6B 1NCBH 4WU7A 3MN8A 2BIQA 2BJML 1M6OA 2NY2D 3GIVA 1ACYH 1KN2L 5FKAA 4Q9QL 1GCYA 4I18B 3AU1A 3CVBA 4LCCC 4X99B 5EFIA 3LKRB 1KSRA 4L29B 1AR1C 4ELKA 1U30A 4P5TB 5BS0A 1L7IL 4ZYKA 1MVYA 1AXIB 3O6FB 4FZEH 5LGJA 5GS1C 1BCIA 3AROA 3VSUA 4IRZA 4LEEA 2R9HC 5J06A 4OSUH 1CGWA 2B14A 2G0KA 5CWSB 3BVNA 1X3DA 3AM8A 5GGTH 1SHWA 4RFOL 2VYRE 4I87A 1U8HA 1H3GA 3ARDA 3T65A 5F7AA 2YMTA 5GPRA 1I4FB 2N1TE 5E4EC 4Y16B 1XXDC 5F1KC 2F7PA 3I9PA 3FCBA 3PS6A 3V95A 4EIGB 4ZUTB 5DA0B 1N2RB 1I1CA 1BGXH 4UWQB 4JMNA 1EVUA 2NXYC 4NRYA 5KVEL 2IH3B 3FONB 4HH9A 3D39E 1BZ7B 1LDPL 2ZKHH 4J28A 3ZE2B 4YHML 5GGQH 1MFUA 1WVZA 2X40A 5DWPA 2R0KH 2EYTA 4RFOH 5KYUA 1KB5A 2CNYA 4K94C 4GSDH 3ZT5A 2F7RA 3OPZL 4GQZA 2B1OA 4NAJA 4QRFA 4X6CE 3TCLA 2UY7B 1SYVA 2CO4A 4IJ3C 1GJIA 1AR1D 4TSBL 1Z0NA 1OSZA 2ENSA 5KG9A 2JWYA 5C3TA 1MHEA 1JTPA 3WNOA 1NSNL 3E80A 4A67A 2DQGL 1EDHA 3FN0H 5C86A 1T03H 5AVQB 4M62H 4ZFOA 5M94B 5CEZE 2A4ZA 4X6BA 1YUHA 4K9EL 1P7KA 2YS4A 1KCVL 3OX8A 1MFDL 5F21B 2H3NA 3NSYA 5TQ0L 4A68A 5F7UA 4JNXA 1K6QH 2Y9RT 3UERA 1KIQB 3A6CH 3VYNA 3N50A 1KCWA 4R3SB 5ACZB 1NICA 3TN0C 1WITA 3JWNE 3ESVF 4XP9L 3S88L 1V27A 4CRPA 4Y5VC 5IJKA 1OVZA 3MUGA 5D1ZI 4N8UA 3RTLA 4OFKA 3FQWB 5EOCH 3VXSA 2O5ZL 1L9TA 5L2JB 4PVBA 2EKSB 3QWRA 3FT4B 3NFNB 5CJQH 4Z3GA 3MJ8A 5C0FA 4U1GC 4XTRD 2HTLD 4YSQA 2WSKA 1WISA 1Q1PA 3DUSA 1V54B 5IHUH 5ITBH 2WLJA 4PP2B 3OZ9H 3ZZSA 4LB8A 4RMQA 3LQAC 4AQEB 4IU2B 3GEFA 1U6AL 1QBLL 4BRJA 4QNPF 2P44B 3CLEH 2LGNA 1JVKA 4OGZA 1S8DA 3QHTC 1AZVA 1TVBA 2YPLD 3A4FA 3LKQA 3IJYA 4FNRA 1P2CB 3FFCA 5DUPH 5D7KE 4GMTH 1JNHB 1QWHA 3JV4A 5C08A 4YQXH 2XUWA 3IM1A 4JKPH 1UASA 1PSKL 3FULA 2LU4A 2XWDA 5AAMA 3H2PA 4MXWL 4PJDA 5T5FH 1QAWA 3LB6C 3H2QA 3S96A 5FKPA 4WUUA 3IGAB 2BRRL 1UZ8B 1IO4C 4XN9A 4L8SB 2EO9A 5HVFB 3K71A 3EHBD 4HIQA 4I13B 1JPFB 2EEFA 4FI7A 4Y2DC 4Z0BH 1CVRA 5IB1A 3RBGA 4GAGL 3HUJA 4HJ0C 4JJ5A 5CSGA 5GSVB 1SM3L 1NWOA 4TUKL 2WQXA 3TZVB 1TJIL 3UZEA 4W93A 4HUWB 4MKMA 1UJ3B 3LPWA 1MUJB 1ETB1 3MNVB 3VXOB 3FOMB 3G5WA 3OKLB 4W6YB 2C9XA 2WB7A 1KYFA 3KS0H 1KLGB 3E6HA 2DQUL 4ELMF 1XD0A 2DJSA 2NX5D 4ZFFA 3L5IA 4G5AA 1RZJL 2CJTA 4WK0B 3GPSA 1CJYA 2AXJA 3LZRA 1FGNL 3DDFA 4OCXL 3VGFA 2OKMA 4Z76B 1JGLH 3PREA 4JPKH 1UOKA 3C2SA 5F1IB 1FFRA 2DMGA 2GIYA 4P59L 4Z7UE 3BAXA 4NZTH 4YMPA 2WHVA 4R84A 1OZUA 5D5MA 3FUJA 1MPAH 3GSQA 4QIRA 4P23C 3BPNC 5CBEB 1NGXB 1HJCA 3WUWB 1FVDA 2NLJA 4N26A 2PCFB 1JGUH 2FLMA 4WI3A 4LO9A 1O6VA 3TLRA 5IJBC 4L5FL 3BT2H 4YPJA 2JCCB 3LZOA 1Z9SB 1T5XA 3EH1A 4QD2E 1LMIA 4PB9H 2GJ6E 1JJUA 4GG8B 1A7QL 5KBMA 2R1YB 3U0WL 5JYLA 4Y4FA 3EHBC 2Z92A 3FRUA 2BSCA 3H0TB 5DHMC 5FW8A 2WMPA 4YH6A 2CRYA 3Q5YA 2WBJD 4YC2B 3S8FB 2IH1B 3I6SA 3ZKNC 3ZE1F 1KENL 2NW2A 4OGYL 1ZVHA 4XNYH 5I74B 2VDPL 2BP5M 1OIOA 3V6FA 2K0RA 5JQ6L 1T0PB 2BFVH 4IBLT 2BW4A 4M61A 3KYMB 2DWEA 4JGJA 1TQTA 2KLRA 4L0PB 3ZTNH 5A16B 4TSCH 1R3JA 4R96B 2PWGA 3RDTC 3FO2B 3O9WA 4LCIH 2BIOA 4LU5H 4UB0H 5EU5A 3TYGH 4BWTA 1KV7A 3DX8A 4OZHF 1MH5A 2F53D 2FJUB 3WS3A 3KH3A 3DXAE 2B1HL 4YHMH 4FERA 1DUZA 3GBNL 1A7RH 4X4MA 1LTXA 3QUHA 4J6RL 4L05A 1L7TL 1N64H 1IM3A 1IB5A 3KYOA 1G7PB 1GA2A 2KBGA 3REVB 1MQKH 4PJ7E 2OMBA 1L4IA 5KBKA 3RX8A 3BW9B 2A83B 4X4YB 3WHE1 1AE6H 1RIVL 2XPZA 2I9TA 1UZ6E 1MH5B 1MN4A 3LZLA 1OSPL 3PWJA 5SWZA 4X9HA 5IHZA 1MCOH 1OHZA 2DBJA 4A7TA 1U92A 4LHUB 2ZCLL 5A2FA 3RYMA 4HEME 3QFJD 4RISH 1IBDA 2XIBA 1G87A 3EJQA 4D0BB 1CIUA 2HA1A 4GI9A 4PV9B 4OVUA 3BIKB 1UWXH 2OX5A 3MXVH 3WIIH 1S8DB 2VR4A 1AHKA 3QI9C 2X4UA 4X8XA 4L1LA 5SX4I 5C6TL 2O5XL 5F6IB 2G5RA 5TJWK 1MFCH 3CXHJ 4AQAA 4BZ2H 1TCMA 2CPCA 2EDDA 3HNTL 4KH9A 1VENA 3Q01A 5EORH 5LNEA 5CCKH 1U2YA 2X9YA 1DBJL 1LO5A 2ADJA 1K85A 1G7IA 3RHWF 4M4PA 1RZ8B 1U8NA 4UM9B 2ZXWB 3RKDC 3PWPA 5AB2A 2Z7WA 4RGNE 4FC3E 5KYYA 1P4UA 4DK3A 2BZCA 1EGJA 2XYCA 2AXWA 3F6JA 3RZCA 3DIVA 5J12B 3JUYA 4JB9H 3TVMB 4CC0A 2XZCH 5CXPA 4WO4A 3T3PB 5EO1A 4MMXB 2GHZA 1A6ZA 2XWTA 3C5ZD 5GGVL 3U2JA 2AQSA 2BS71 2B2XL 1I1RA 2K3TA 2W0FA 2GSMB 4MKTA 1BXVA 1AHWA 3PIQB 2CSPA 4UF7C 3IMWA 3M45A 4OSUL 5HD8C 4IRSD 2Y6SC 3TH2T 1ZIBA 2C3GA 3FMGH 4LMQE 2IOOA 1J0ZA 3NCJL 3HUJE 3CE1A 3EF7A 3NA4A 4LCWD 3VD0A 1G9NH 1RVFH 3QDGD 5I8CB 4GW1B 4HJGB 3LXAA 3U9PL 5CP7A 1S9YA 3VFGL 4MCNA 1GGTA 3QAZB 3WLBB 4A7GA 1XF2B 4YFDB 3WSQL 1Q94B 5CJOL 2CO2A 4QRRB 4XP1H 4ZW3A 1SLVA 4MMZC 2XWXA 5FCSH 5TF1L 4S0HA 3B9VA 1IRAY 3UAJA 2AEQL 3MA9H 1OSEA 5GGTL 4Z7NE 3HMXH 1EHLL 3HVNA 1OHQA 3WENA 1TTCA 4DCQB 4W9GC 5EC2A 3UPCA 3JVGC 2DQFB 2HFEB 2XN9E 4HFUH 4UDTB 5CD5C 2WLLB 4QF1A 3UTSE 4XBEL 3Q43A 3VH8B 5C08B 4J1UB 3OMNB 4Z3FA 2AQPA 4C57C 1S2EA 1OGSA 5J8OA 4AQ1B 3QIBC 1BHGA 1MLCA 4HOMA 1PDKA 5C0DA 2H6PA 4AV5A 2R2EA 3S97C 4JPSA 1IKNC 2AERT 5SV3A 1I8UA 4G7YH 5I1IH 3WOVA 1OP4A 4UZGA 5IHWA 4NO0B 5IROC 1VZGA 1RZGB 1DANT 4ZFZA 2R2EB 3GMRA 4G7VH 5KJRL 1J5CA 4XNQA 4FG4A 3NIDE 4OZIB 1S5HB 2P43B 2WY3B 4ZOAA 5ANMA 1XR8B 3FO1A 2VUYA 4DIXA 1X5MA 1RIHL 5AOLA 1IM9B 4LP4A 4NQCD 4DO4A 1N0XH 1Y07A 3ZX1A 1I85C 3GB7A 5HP5A 4PJAF 1FH2A 2XG5A 4ORGA 2BCMA 4P4KB 1I9IH 3KLLA 4HGWA 1VDGA 4QRSB 5FGSA 3MZTA 5CLXA 5C7XH 2EDEA 3NJVA 1BDYA 5HHOD 1JHLH 1L0PA 3ILDA 4YSAA 2CALA 4Z7OF 2E75C 5E4EB 4XO8A 4FHBD 4PGBA 1G1KA 4P4RA 5ES4B 4X7TB 2V9RA 1U3ZA 1U8MB 3E9UA 3IJHB 4BINA 2ZOUA 1Z9OA 2E27L 1UXLA 4AITA 1WZLA 3F00A 2YZ1A 1T5WA 4WJ5A 3ESNA 4FQ2L 4Z7UF 2H1PL 3D39A 3KJ4B 2GJJA 4DEWA 4XP4L 3II3A 2F58L 4OZGA 1WH0A 3VU2A 4BUGA 1BYPA 5E9DB 5FM5O 3H42H 3MV9B 2J44A 4G42A 1SFDA 4LL4A 5I6PA 1OARH 3IXTB 4YLBA 1JHTB 4YS4A 3US1A 1S7QA 3HFMH 3LRSB 5MENA 2W91A 1FA4A 1GW0A 3SDAA 3BYYA 4I4WB 3T3ME 4DPBX 2A74C 3D18B 1ILSA 3QPQC 5EA0H 2XETA 5DD1L 1FE8H 1E5AA 4O02B 5K39A 1Q38A 3ESOA 2P80D 3PAUA 3PUUA 1YJDC 3LN4A 1IKOP 2WIIA 2WBWB 2OMZB 2VW7A 4K3EL 3BIAX 4KI5E 2F5BL 2JTYA 5CZVL 3ZN6A 5J6HB 2V7NA 2F7OA 1QPPA 4IBVA 1RK1A 3QWQB 3B4NA 4BKLA 4MQXD 1CBJA 2FBRA 2ATPB 3ECBA 3KYMA 5TDNB 4NO2B 4Q9RL 2OL3H 4N6RA 1ZIAA 3FONA 4KXZH 1B6UA 1JGLL 1FZKB 1NDMA 5EUOF 4YDNA 2J71A 4RWYL 1SOQA 3HE6B 2X4NB 4P06A 4IBYA 1NC4A 3EYFB 3G6DL 1VACA 2AXFA 2ZIDA 4JKMA 3QDJE 4TQ8A 3DRQA 5FOBB 3NP4A 2WLKA 5HJBA 4C55A 3U4AA 4FQPA 3GMQA 3SCMD 4FXGC 4N1CA 3OHXC 4NWUH 4GG8A 4ELDA 5F7BA 3STLA 5KSBE 4PQXA 3O8XB 3KYKH 4Z5RB 4WKZB 3NIFE 5AOMA 2VH5L 1UZGA 2AQ2A 1J0YA 1VLXA 3IMTA 5D72H 3S34L 4H8HA 2A9NL 3UIYA 4R7NA 5IVXA 2EXYD 3HPJB 5IG7B 5IT2H 5EPMB 3EKCA 4PGZA 2ZYRA 5G2NA 1IC4H 5DJ8B 5ECGA 5BZWA 4JFHE 1ORSA 5JUEL 5JORB 3UTTA 1R1CA 3NA9L 4AGNA 2OL3B 4NOFA 5DEFB 1RUPL 4A2HA 1CPUA 4G80B 3WS3B 1E7VA 5DZOA 3FUDA 2J25A 4U2ZA 5HGBB 1B4JL 3HG4A 5IVZB 1EA9C 1F6AB 3DGCR 3DV6B 2ZWZA 1MI5B 3QG6A 1JGVH 1IVLA 4NJAH 5M95B 1YYMH 4QTFA 4G80A 4OCXH 2BWIA 1FNLA 3AZUA 4UIKH 2IPKB 2Y0SA 1PX8A 1SF3A 1TR7A 3RVWC 3RZCC 1ORSB 3ORJA 4Z6AT 3NAAH 5JORA 3L7EB 1T2XA 3VMOA 1IVTA 5IB5B 5FEBA 1KLFB 1Y1DA 2C34A 3U6RB 2HVJB 4P2OB 4I0KA 4KQ3H 8FABB 4EN2A 5ABZA 5IFHL 1YNTB 3T3MB 1T7YA 3HC3L 4WI4A 3ZYZA 2B77A 3BE1L 5DGQA 5KSVB 1U3YA 2P8PB 3BWAB 3B9DA 3DLQR 3QEQB 2V8LA 4HW6A 5IROA 3ZE1B 5JPMA 2D9QB 5CBAB 3FQ2A 2KMWA 1IAKB 2OQJB 3QJQB 3BLKA 4FLOA 1JXFA 3IB4A 2R56H 3AB0B 1BVKB 3MA7A 2OMXB 2W0FB 3MRIA 1G4MA 4QDGA 3EYUL 1KLUA 3KWWA 1A6AA 1KEMH 5DMGD 4F7MA 2X2JA 4WO4B 2JKNA 4P4KA 3HZKB 1DEDA 5BCAA 4Y9EA 5I19H 5EC1B 5JR1H 2FGWH 3MBED 1QUNB 4NO5B 3P4MA 1YQVL 1F11A 3EW3B 1BQSA 2V9QA 1UH4A 4W9HC 5DO2C 3COOA 1JRHI 2VT0A 1JSYA 2CHWA 3SZ6A 4NO3A 1MW2A 1KGWA 1XH0A 3MR9A 3QJFA 3CK0L 4NZJA 1TFPA 2JV6A 3X1EA 5JTWA 4LFHG 4Z7VF 1K4DB 2CO6B 4WNQB 2XZQL 4X5PA 5C9JA 4K23H 5ANME 2MQGA 4OCNC 1JL8A 1T7VA 1NMBH 5I76A 3FFDB 1BREA 3U1SH 2CDGA 3D2UA 5I28A 1N10A 2EDBA 4PGDA 4Y19A 2ZKYA 3K74B 4QRQB 1KDIA 1RIHH 3MRKB 1P7QD 5DK2A 3T09A 1ZT4B 4I9WD 2IFFL 3MRBB 1LO0H 4PREA 5T3XL 2FIKA 2Y4SA 4L1TA 4KH2A 4WHTB 4FQJL 3FZUC 3WHE0 4CMHC 1I7ZB 1M7IB 3CZUB 1ITCA 3ULUL 1VADA 2N0KA 4AKPA 3OZ9L 4FXGB 1P7KB 4HZAA 1F8TH 1ET5A 2HLAB 4PWFA 4XH2A 3G5YA 3R7QA 4E9RA 1BVNP 5LN8A 1NBCA 3T0EC 2K4WA 5JHLA 2KERA 3F12B 5CGBA 3WEAA 2BP0A 3LIUA 3U36B 5INDA 3EOAA 3F7YB 3G04A 3E2HC 4PI2A 4WW2A 5D4JA 4EDXA 1GYVA 1NSNH 2ISDA 3PFUA 2UV3A 2EDNA 2UWEF 5L4MA 2EH8H 4Q74A 5KWYC 3SDAD 1IGMH 2UYLA 5ICZA 3UZQA 4QRPE 1FO0L 4GG6A 1C12A 3IJYB 1QTYT 4Y7MA 3L3DB 2XG5B 4ORGB 4DPAX 4NUPA 3OKMB 1K6QL 3VWKD 3V9EA 3OJMB 5CJOH 2EVFA 4WUUB 2XIIA 1IBFA 3KM1A 3QIBD 1YEFL 3G5VB 3P02A 3BKYH 3L1EA 2VMDA 2L7EA 3P2DA 4I0PB 2A6KA 3S2CA 3QQNA 3ZT6A 3JYBA 5DS8A 1X5FA 2B1AL 1RZGA 4ZFZB 2XICA 4PBVC 1V3KA 4LQ1A 1JTTA 3VRIB 1S9XB 4E41B 4M4RB 1SEQH 3FO1B 1NPUA 2IOIA 4UNIA 4IBQA 4KNSA 1CE6B 3DPBA 4N28A 4YO0B 4H2AA 3LNHA 2DLFH 5IF0B 2GK0A 3ZE0E 3TT1H 2A3TA 4XPFL 4BH7B 1DBMH 1SQMA 1DSWA 3O2WH 2E9JA 4C59B 1TMCB 1ZT7B 1I8MB 2DQJH 3NCMA 1IEBA 3RURA 4YSRA 3BP7A 4X83A 4LPXA 2C9RA 1A66A 1AD0A 1QASA 3T4AB 5FF6B 4Y5YB 1U42A 3FUEA 4I4WA 3UIZA 2CUIA 1OOWA 2X2IA 2DYSB 3S4SB 1YMHB 2IPUG 4LFHD 4M9PA 3QDJA 4G1MB 4MQTB 3UTTD 1QLEB 3GJFH 4N2MA 1QKZH 5J9PA 3QC5X 1R3IL 3GSUB 1ASQA 4LNRA 3TURA 3DYPA 5JXED 3WEXB 4ZMLA 4HUXB 5DRXB 5DJXA 5J89A 4JY6A 2ZUUA 2ZUVA 2FT6A 5CR8A 5CINH 2OP4L 1SY6H 3ZE2F 4P9HH 4F8QA 2VN7A 4D0DB 3WI9A 2ZOKA 1EHAA 5E1IA 3CZFB 4DFIA 2C4XA 4APXB 4Q58C 3KPNA 5GS2H 4FMKA 1FRGL 1U8CB 2GT9A 3QORA 4KVCL 3TEXA 3GSNA 2VXTH 1P9MA 3NZHH 3PYCA 1KEML 1MJJA 4UQCA 1XCTA 1SHMA 1YMMB 2J72A 4Y2DB 2XSKA 3QQ9C 4OD2B 5HVGB 4B41A 4PV8A 5C2BL 4G6KL 1BZOA 1ZLEA 3L9RB 3CNKA 2WXFA 2J1KA 4K7FA 4OB5H 3QPXH 4X7SL 1X7TA 4XXWC 3E6FB 3VG9B 2QVIA 4E9XA 1A9EB 2WWOA 4D7BA 4RZCB 3FCTA 4M7ZC 4XP5L 2Q7YA 1WBYB 3K4ZA 3ZYIA 2LW3A 3LAFA 2YFNA 4UYQA 1WDAA 1WBZB 1U95A 3BZ4A 4TS6A 4QTHB 3E2HB 1ETJA 5EB9A 4G6FB 4PRHB 1G7QA 2UWEA 1OF2B 2DAVA 4LCIL 2IQAA 1ZHLA 3MBXL 2DDQH 2DJMA 5A2KH 5AUMB 1XEUA 1CFBA 4R97C 3SB3A 4RZCA 2BSSA 2XG4A 2BVPB 3SOBL 3QI9B 1J5DA 2VDPH 3BVDB 4U3CA 1T6VN 2XX1A 4W81A 4GAFB 4YFLF 2B15A 3PAZA 2W60A 4J8RA 3SPCA 3TO4C 4ENED 4FTVB 3TBYB 3RWDB 2I9TB 1A6PA 2JI1A 4N9GA 2BP0B 3U36A 5MEPA 4LLUA 3IRPX 4KNQA 1DFXA 3M1OA 4IMLA 3NFSL 4JQIL 4LP8A 1CGTA 4PRHD 4UINL 3C08L 5ESQA 5BQ7A 3RPBA 1IGYB 1WSST 3F5WB 3NZ8B 4R5XA 1X5KA 4BFOA 2XQYA 2NXZB 5F7KC 1TFHA 2VLRB 3NIGF 2DI8A 3HS8A 4LDCA 2OX5B 1IC7H 3BWUF 3IXAB 4G9FE 4ODVH 2G2PA 2X38A 4GG6B 1OD7A 2OL3A 3Q6GH 5DR5L 1QFOA 3L1OH 3UL4A 4Z7UA 2DLEA 3HG2A 3OF6D 2AGJH 5TK4A 5IHZB 1V5JA 4PWJA 1BBDL 1CFVH 3L7EA 3ZGHA 1CZ8H 3P3RA 3EFDL 3W37A 1NLBL 4LARH 4ONHB 1C8PA 1XGTA 4AIOA 3GJFB 2D03H 1BAGA 4PRID 1N19A 2GBTA 3GMOB 5ETUA 4JPIB 3ARGB 1CT8A 3NJJA 2PR4L 1MQKL 3PWLB 1U8LA 3ESMA 5T1LB 4Z7WB 5HBBA 4G11A 3CC5A 2BS9A 2FHFA 1HILA 1NC2B 2ICES 3HEIB 4R8WL 3WKMH 1PLAA 3S9DB 1KYDA 4MXQD 5ELIA 2X9ZA 3ELQA 1ROWA 1BBDH 1CFVL 3QUYD 2YAFA 5HJ3B 5JOPE 2IV9A 1KJ3L 4ZG1A 2A77H 1I8LA 1FGVL 2MQ0A 2HLFD 3VYPA 1W80A 3II1A 3K46A 5D8JH 4ZW8A 4YSDA 1WHOA 3PWVB 1AJ7L 5I76B 2UZYA 1U8KB 1A14L 2BSTB 2HT3C 2XA8H 3BSZA 2WBXA 3GBLA 5ANHA 3GD1C 1ODUA 5T1LD 3FW6A 2PPDA 2Z7UA 1BZ8A 3GHEH 3RVUD 2AS5M 3BZFA 2FUQA 5J1AA 5DHVH 4PYGA 2LOEA 1C1EH 5D96B 2MSPA 5EU4B 1OP3K 4LNVA 3L4TA 3MRJA 3MBEB 2CDFA 3F05A 3B7UX 3DBXB 4OLWH 5C0RL 3H3PH 2ZE0A 3U7WH 1AO7D 3DJZA 1S5IH 4UQBA 3UC2A 1E4KA 4LGSB 2YWYA 2E9WA 2NZ9D 4CN6A 1B2WH 1FVDB 1M2OA 1LK3L 4EIUA 1G7MB 3VFUB 5B38A 5GGSY 4F9LC 2E4TA 3JWOH 4JFSA 4OV6F 2CIKB 3BAWA 1IGJB 5D1ZC 2VZ3A 4CC1A 3V4VL 1X5XA 4APXA 3KL3A 2EC8A 2P52A 4U7SA 1KELL 4AGOA 5GS1B 2ZWNA 3DURB 4IHOA 3ZKSD 5IKCB 5DMKA 3PLYA 2ZUSA 5AB0A 4H5SB 4XMTA 3IDMB 5DWUH 4KDVA 1GYCA 1TCRB 4LSUH 5DUBA 5C0BA 3CFCH 1X6NA 2Q86A 2L8AA 4ZXBD 3IU3B 4QWWD 1HWHB 1SVZA 5EZLA 5E1GA 4FXKB 1U58A 3L3JB 4WTXA 1QR1A 3ZUCA 4Y2OA 1YLBB 4AGLA 2HRPL 1FNEB 3N41F 3GNMH 1KY6A 4F33B 5I23A 2WXLA 2WXMA 2YEVB 4X6DF 1E3XA 3B3BA 1QBLH 3L8QA 3CSGA 1UOVA 4JX0A 3S8WA 2DQDH 3HC4L 2F08A 4YDIH 3STLB 3PF2A 2WUCL 2ZCKL 1ZWIA 3QORD 1DYZA 2V5MA 4ZX6A 2CUHA 3D0LA 2WCGA 5GRXG 1YN7B 3WY1A 1NC2D 5D7JC 2QPDB 1M1XB 3F85A 4J3WA 4XBEH 1X5JA 1JTOA 5DD3L 2N4IA 1I7RB 1Q9LB 4P5MA 3DRTA 4N25A 2QV2A 3CXHK 4AT6B 4F7PA 3ZDZF 1OT2A 3L95B 2YRPA 2VCOA 2X4SB 4AUYA 1ID2A 3DK0A 1CF8H 4GMSL 2WLMA 2F58H 3RVVC 3UMTA 1ZLVK 5BOJA 3UTZA 2H45A 3T1FA 5LGJB 2IAMD 5IWLC 4PTTB 1UYWH 3TOPA 1X9LA 4DO5A 1N0XL 2VC2H 2DWDB 4E41A 1CR9H 4FZ8H 5GRJH 1ADQH 4ES8A 1GOHA 2ENJA 1RJZA 2I69A 3TC9A 4FYRA 4ODTL 1HH9A 2YPVL 4NP9A 1TDQA 1F45A 2BFGA 2BVYA 2GYSA 4YN3A 3TNMB 3UBHA 1IV8A 1VERA 1WBXA 3Q3GA 4XPTH 2GJPA 1JHTA 4LL9A 3ULVC 2HT4C 3GI9H 4JL1A 3QR2A 1XH2A 2W65B 4CVZA 3WTVA 1JWMA 2VERN 3Q2CA 4CN1A 2ERJB 1Z9SA 3GKWH 1RPQA 4HU2A 3PFQA 1SJMA 4ZD3L 5IBTH 3GSNB 4HEPA 4XAKD 5DVKA 3FQ4A 2CPUA 3ZTJH 1JK8A 1ZHBB 3OHXB 2A0LC 4DP2X 3L13A 4WO4D 5CO1A 3TO2A 3D9AL 4GFXA 5DHXB 5HTSA 4D8PA 4BKTC 4PJGE 3ARUA 5FXCH 4G9DB 1JZ8A 1H6UA 4OLEA 4XRCB 3V8CA 4OI8A 3JWNC 3QZBA 4JL2A 4OJFL 1YEKH 5CP7B 4OIFA 3O6FD 1FG2B 5LUMA 3DROA 4GO9A 5IJVA 3QRGH 2VDRH 4TKWA 3MRQB 1AC0A 3MTXA 5ACMA 2R29A 1A8ZA 4K5OA 5FK9A 5TE4L 1PPIA 2EYTB 4JANB 1TU2B 5AKRA 4LSDA 5H35B 3HPJA 2EZ0D 4XXWA 2WQWA 5IG7A 1HSAA 2UY7A 2H6OA 3K7UA 2X89A 3UCQA 3QJRB 4JFFA 4U6XB 4KK9D 5C0AA 1YEEL 5KSBF 1FYHB 1O7VA 2NT0A 2I25N 4LBEB 3ZE0B 1P5VB 1DJIA 4IU3A 5IMOB 3TBVA 2IDCA 3P3YA 1MCDA 3MMEA 5D6CB 4ZMQA 4HCIA 3GMLB 4PRBA 4JM2F 3TJEL 3MGOA 3VCLA 1MRFH 3LHPL 3EO1B 3QJUB 1QA9B 4ISVA 5EBWA 2Q76A 5FUCE 1CFQB 2EC9U 2BNQE 1WBYA 4EJ1C 5DMIL 1LEGA 1RU9H 5DK3A 1GGYA 1S78C 5C7ZA 1MFEH 1B90A 1FFPA 2XZAH 3BJ91 5IMOA 3DJTA 2DIEA 4K3HA 1U0QA 3OC8A 2MOVA 3SDDB 2AVFA 4UT9A 4AJVA 1ML0A 3QWRD 3VCLB 3NJLA 3RX5A 2C3WA 4PAZA 4BFFA 3FTYA 3QEUB 4NP4L 3IU3A 3NAAL 4KK9C 3PWLA 2H7WA 1SLWA 4C56E 5BOZG 4HIXL 5KSVA 2X4PB 4JG5A 1BW8A 1FIEA 2DZEA 3GJFA 4YBLC 4J5VA 3QUXB 3VFNA 5CKGA 3IDYC 2D3VA 4LGPB 3BISA 2YPLA 3PWUA 3QIUD 5KVDL 4ZMVA 4LHUA 3MRCB 1UATA 1BQRA 2ATAA 1BXXA 3BHBA 4A39A 2ICCA 4TUJB 2HX7A 1URLA 5A2AA 4AH2B 4AKOA 3C8HA 3U4KA 1E4XH 4CL7A 1A1OA 5J12C 3RAJH 2D31B 2F74B 3PABA 4K5PA 4M6ML 1E2ZA 4E9YA 1EEUA 5C09A 2DBLL 4GQQA 2WB1A 4XGZA 3ZMNA 5FYLL 1A2YB 5JDSB 3TN0A 5F3HB 3MFFB 4HYTB 2XBTA 2A0LD 1MDTA 2X70A 4WEBH 3V6BR 3MGTA 5F96H 4NZRL 5D7LA 4U7KA 3CPUA 5I8CA 1CGXA 2F18A 3P9MB 2C4FU 1A21A 4N0RA 4OCMC 3BPOC 1CBVL 2ENQA 3DVGB 4H1LG 4FP8L 4NYLB 4XX1E 5I75B 3T8XA 2CDGB 3D2UB 1AE6L 3MRFB 2FD6L 5EIVA 2F15A 3MLWL 3NRPA 1RZIA 3A0OA 3LKPB 3Q5TA 3ULVL 4NM8L 2ATKB 3GGWA 3CLFH 3AS3A 3CFEB 3TP4A 5E1AA 2WD0A 4BFIB 2HH0H 1JV5B 3DA0A 4YXLH 1KIPA 3O4OB 1PLBA 1PL3A 1W0VA 4M7LT 2F54D 4GG6F 3U1SL 1QTPA 1D6VH 2CQVA 4NDMB 2EYRB 1FIGH 3SY0A 5AAMC 5GZNC 4G9FB 3S36X 1TJHL 1UD8A 1BFOB 1KB3A 3CQFA 5KVDE 1QSVA 2DMBA 2FJHB 2Z34A 1DZ0A 1KXHA 5FC9A 3SZKC 3WIHA 1LP9E 2EJ1A 5E2VH 3S5LB 4EI5C 1D5ZB 1OSYA 2X41A 3L2MA 2CUAA 4MYWB 3BKCH 1OY3B 4P5KA 4HAGA 3CXDH 4M5SA 1VF5C 3HIZA 1A6WH 1D2OA 4IOSA 2CK2A 2YGQA 4OBSA 4PY8I 4U1KB 3RWHB 1JYXA 4EPSA 4IS6A 3FS9A 5FK9B 2UZIH 1PSKH 5DMYA 2PO6B 4QHNA 1YNLH 5JW4R 4JM2D 5J5EA 1SQ2N 1AZBA 5I8KL 3ROLA 3FO2A 3O9WB 3S96B 3VFRA 4AZUA 4EIZC 2YD5A 3CLEL 4L37B 3GTNA 3UZVB 4ZXBC 4FADA 4YSEA 4G6JL 4JN1L 3SDCC 2HFGH 3PDGA 2Q1EA 2XLLA 2FX8H 3A67L 3L4WA 4NPYB 1E28A 1N4XH 2Q86B 3TM6A 4OF8A 2ZX6A 3V4VH 3KGSA 4DVBB 3LNDA 1IARB 4UT7H 1PAMA 1JGUL 2DQTH 3F7RA 3F83A 4NJ9H 5FWRA 2BHYA 3RVTD 5BZDA 4A6YA 2UXGA 4NLHA 1UUSA 2JCCF 3DJ9A 2G2RB 4NEHB 2MCPL 4AX3A 3B6SA 1WTLA 4HUUA 1AZZC 3NIFB 1GY1A 4C83A 1GVIA 1PMYA 2E56A 4CW1B 3OWEA 4O4YH 1BVZA 4I3GA 3RP1A 2NTSP 4HDIB 2DV6A 3HHSB 3AWEA 1DO5A 1E30A 5AKTA 1L5GB 5JUEH 5I0WA 2FWSA 2ALAA 1V7ML 2EYSB 4L8CB 1OB0A 2IDQA 5E5UB 1S4IA 1A6VL 2B8OT 1E2VA 2CJ3A 4LHQB 5I73C 2BOCB 1UGNA 3HHSA 4AK1A 3SBQA 1KTDA 5B1JA 3O11A 1JMZA 5T5FA 3T8VA 4CW1A 5EF3A 1UVQA 4F8TA 4N2HA 5MERB 5MHSE 5IVNA 4O5LL 2MCMA 5GJTH 1F90L 1KCLA 2P8PA 4XB3A 4TN9A 1FSKB 1E27A 3GMOA 3HMXL 3HN3A 3F8UB 3TH4T 1U8PA 1MNUL 2VIRA 3L9EA 2GI7A 1MFEL 5LG6A 2VL5A 2CKNA 3KPNB 4QLWA 3NSDA 4UMSA 3S35H 3CUPB 4HUXA 3N41B 5EEZA 1GMEA 4L2LA 5FCUH 4BFGA 3WJLC 4QY8A 1HZKA 4OFIA 3RU8L 2AJVH 3LZFH 3VYOA 3ZO0A 3K8KA 2YMOA 1RSFA 1EHNA 3FH5A 4MAYC 2DDQL 4XOEA 5C0CD 3U4EA 5EIIG 5HHME 3MJ9H 3WTYA 5FFGA 1UT2A 3K2IA 4KI5D 2EO7A 4U31A 1M7UA 4KJPC 3MRGB 3N85H 3D08A 4YHYB 1AP2B 1UT1A 5GGUB 3Q6GL 3QO1A 3RL2B 3UBXI 4Z3EA 4HJEA 1PZCA 3DX8B 3VWJC 1AKJA 3ASWA 4WWOA 4DQOH 3NTCH 5FUCC 2V2TB 5J11B 5H94A 3NCFB 1QRNB 4BE5A 1N0LA 3QH3A 1UOLA 5D1XE 2CK0L 3WFBH 3Q8EA 1NUFA 5MP6H 2XWBB 3DX2A 1YC7A 2CLVA 1A6UL 1E90A 4GW5A 4TNFA 5IBLD 1VRSA 2HFTA 3SE8H 3AG2B 1HAUA 2JIXB 3QNFA 3Q06A 1KULA 3H9HB 1YEHL 1YEHH 4F93B 1KFAH 3FCSB 3IBEA 2GC7C 3QUKB 3WFHA 5D6CA 3GEWB 3VFWB 4L4VD 1G7JB 3TO4D 2BO0A 5IQMA 4NSKB 3FSAA 3FN0L 5ADPL 3QYMA 3NRQA 4A7VA 2VE6A 1GOGA 4M1CD 4JQVA 3EJYC 3QUKA 3WFHB 3HAEH 2WTRB 3QP3A 4G6MH 3MV9D 1WPCA 2CXGA 3Q1EA 5DHEA 1EAQA 2XOTA 3ZTDC 1WFIA 2LU5A 3HMWL 4EI0A 3FT9A 4FOMA 3ARGD 4HAFA 5EBWB 2NXZD 3VG0H 4IU2A 4LGRB 1IBYA 4OJYA 2D0FA 4OJCA 1NEUA 1PX3A 3BPCB 1UFGA 4PJ9D 1PBYA 4MMYB 3TT3L 5IGXH 4XBMA 1LO4L 3CIAA 5I75C 1IFGA 1BBJB 1YYLH 4FKEA 4HJSA 3EO9L 1WLHA 3DJRA 3EG9B 4V1DD 5ID1B 3LSOB 5DJYB 3MX0B 1HEJC 1GKOA 2ZCZA 3BH8B 4Y1AE 4B9ZA 1IQWH 2CLRB 4OGXH 4QHUB 1WWBX 2QPEB 1KCKA 4J8QA 2X4TA 4P2OA 4PV1C 1DJGA 1A7OH 2Z31B 2CRMA 4NKMB 1KCUH 1KCSH 3UTPD 1DTUA 2FVNA 4UUJB 1NMCC 1CD1A 2ITEA 2XKNA 1CTNA 4XVUD 1QPXA 1DUYA 1A1OB 2W1NA 1E4KC 3SQOH 5EORL 3ZDXE 2XVLA 3MODH 4YK4C 3X3FL 4ENZA 4ZDHB 4Y2NA 1FFNB 1Q4NX 3E1ZA 2X53A 3TBBA 3ARBD 5I5MA 4EO5A 2CLRA 2QFRA 2ZYIA 1XAUA 3H4HA 2BVTA 5CJ8A 2VR6A 5JHAA 3GHBH 4YBHA 5DJZA 3WN6A 5C3IA 3LN5A 1NFDF 2BJMH 3NQIA 4AE1A 3DOIA 3EOTL 2J6EA 2Z7ZA 3VI3A 5DUMH 2N59A 1ZT4A 4J3OD 5JZ7C 5TF1H 2D9CA 1GGIL 3UYOD 4BH8B 5JHDA 3L3KA 1HQRA 12E8L 1CLCA 3R8BB 2G5BA 1LO2H 3L48A 1G94A 2J21A 3NQKA 3SEPA 5BV7L 4F37F 4MJ6B 5JLZA 2ZKMX 5HI5D 1FH5L 4C56D 5E23A 2F1AA 3B1TA 1HTYA 1JWUB 1TQSA 1UJ3C 1G9NL 4Y9BA 1WRFA 3P0YL 2AEOA 2QKIA 1AGEB 1AQDB 1IAIL 1NWPA 1IAIM 1KN4H 1RUAL 4ES9A 4YL9A 3GM8A 3GLEA 4DGYH 3V5KA 1KIPB 1VACB 1TZOA 1FC2D 4HKZA 1YEJL 3ZDYE 5E6ID 4MMZA 1MWAB 4U4BA 1F00I 1PNCA 3UBXB 5CZRA 5D70L 5DZNA 3VXPA 4CC4C 1CYXA 2XWJB 2F2HA 2WVUA 1MIML 4KJWC 4OUUA 3AWFA 1KIRB 2C1PB 3IDIA 5E24E 2VRQA 2NZIA 4HKBB 5ICZB 2Z31C 5GXBB 3ZKXB 3TV8A 2FEEL 3HS0A 5C0RH 2YD7A 2A74B 1CN4A 3HE6C 3QNXB 2H2PD 1OLZA 4G7RB 2W38A 3OTTA 2AV1B 4JFDE 4IM8A 1CLZH 2J55A 4P2OD 4W9CC 5EO9B 5F88A 3BH9A 2E8YA 2CBPA 4L9LB 4NCC2 4U3SB 3MAWA 4XOAA 1OGTB 4NOBA 1QUPA 2XQYK 1MAMH 5CD5D 2Z31D 3Q2VA 5C6PB 1LM8V 1D9KD 2C9UA 5C0JA 3BH9B 5CGMA 3UGUA 3ML9A 4IOFC 4PHZA 3HE7D 4RAUB 1J9RA 2B4CL 1IFHH 4A1RA 3MLSL 3APMA 1GH7A 1MAML 3NSFA 2P5PA 4ETQB 3QUYA 2NQ3A 3T5WA 1UCBL 4WI0B 4GJTB 4JFVA 5EU5B 5KYWA 4P9HC 3B9KA 3WO3B 1A1MA 3B3IA 4MJ5B 4AL8H 3LKOA 4WSJA 5LBSH 3VFRB 3V0IA 4XE5B 3BGFC 5K9KB 5I1KL 5F6IC 4AMKH 1NQBA 2FX9H 3MJ7A 4IGBA 4PJIE 5JHBA 3W56A 2AK4B 3BDYL 5MERA 1V05A 4Z7OB 2BXZA 2Y5TB 2PXYD 3QFJA 3WFCL 4ZMWA 4YHPB 3P11L 2G75B 2B1HH 4X7CC 1PZ2A 3T77B 1NUDA 1FAIH 5IMKB 5KYNA 3LS4L 1FNFA 4X4ZA 1JUFB 4G8FB 3IFOA 5D7IE 5GSRB 4E9QA 4W6XB 3VD2A 1SM3H 2WXKA 4FJ6A 2J57A 4AEHH 4YSCA 1U8IB 5HGHB 3EDEA 4TOYL 1SMOA 2V37A 4U6HA 4A2MA 4XBPB 1G7IB 5T8IA 4PRAA 1MCWM 2ZONA 4CNIA 1KTKE 4O51A 2JCCE 3PPSA 3GK8H 5EG6C 3ZKQD 3MR9B 5IMKA 3WFEL 4MJID 3V0FA 4XBPA 4XCFL 3ARGA 4HUNB 2HRHA 5DO2D 1UB5B 2LU3A 2GTZB 3VGGA 4UIMB 2QHRL 3APDA 2H2SD 3CN4A 2VXSH 4JRYA 1ZLWK 2X4NA 4J3OF 5LKNA 2EVIA 1HEZA 5DMJB 4B9KC 4YQXL 3DHUA 2JVUA 1FC1A 3KJ6L 2OM5A 2AQNA 3RGVC 3VGEA 4PV8B 2VGLM 4UQ2A 4E41E 3E7JA 4M3JA 2DQIL 3BKMH 2IBBA 3V4PA 1MLBB 4GB9A 1E8WA 3OX8B 1G7HB 3ARRA 4B9PA 2H26B 4CMMA 2YSSA 4FA8A 3WUZA 1S3KH 3RWJA 4G8GE 3QDGA 4YSUA 2WVVB 5HHXL 1D6EB 1ES0A 3E8VA 4ZZKA 4F57H 1E6JH 1W72B 1CLOL 2MTPA 1QYGL 4BWUA 4KO7A 1WICA 3FO0H 4WFFE 3ARFB 5CJ5A 3RPIA 2MPVA 4GKOA 3WGUB 2C1OA 3A3YB 1BSIA 4ZW7A 1ED3A 1PFOA 2WLNA 4Y19D 3WTWA 1A25A 1WFJA 3FF8A 3KG5A 4U1HA 3RTQD 3AAZA 4LL1A 2NY4C 5DEFA 3FFCE 2GPZA 2ZUWA 2J43A 3VMPA 4Y5YC 2GFBA 2OR9H 3K5SA 3SDDA 4O2EA 1MWAH 2V0AA 1PVHA 4QLRA 3QG6B 4WKZA 4F1SA 5IHBA 4HUVA 3U4BH 1Z7JA 1EXGA 5C08D 1N5AB 2EUZA 1KTCA 2GY7B 4KPHL 1UWGL 3SGJC 3KBEA 2KI6A 1IGIH 3L4XA 1O7DE 3LKQB 4P9HL 2R7EA 5GRVK 3O2DA 2Q76B 2ZUXA 2H3XC 2HXAA 1AZNA 4XHJC 3VFWA 4IRJD 4C56A 1KNOB 4LLWA 1O75A 3VXSE 3DWTA 3NP3A 3VXSD 3EJCA 1UXSB 2PWDA 2R83A 4K4KA 3ML8A 4Y2LA 4NAQA 2Q5BA 2DJUA 1B9ZA 2VN5A 4JQIH 4WU5A 4JY5L 5TDPA 4NRZA 4OIIL 3V0JA 4EUPG 4F3FA 4FKKA 1QKZL 3O6MH 1C5CH 4DN3H 3T08A 1MLCB 3D3VA 1TJGL 1CE6A 4ABUA 2ZT9C 2YOAA 4FQ2H 4DEPC 4HJTA 1PTZA 3WS6A 5IB4A 3U48A 3TX4A 3B7TA 1MHHB 1MVUB 4LLWB 1D7DA 1J9QA 1BECA 1ZCRA 2G3NA 5HDRA 3L4CA 3MV8B 1F1GA 1BPVA 4X9FA 3ZKMD 3UYPB 4Y1SA 2UZXA 3GMMB 3L4ZA 5FECB 2IC2A 2J8UA 1CBVH 1FFNA 4WI5A 1QTSA 2OTWB 3MLUL 4UAHA 1A7PL 5HYSB 4J39A 2VWEC 2YIHA 1T22A 3OQRA 1HJBC 3LD8C 3LKOB 4OLVL 1BXUA 1X5HA 4MA8H 1Z2KA 1FL3B 1HKLH 3FQUA 4DUVA 3ARFC 3M1BA 3NZSA 2V2XA 5IIEA 3HG1D 4XAWH 4HUWA 1UA3A 1D3CA 2X4TB 3BUQA 3QPQD 1XGRA 4KK5D 4Y1AA 5LB1A 5I1CL 5F9AC 4BWWA 5I2IB 2H1XA 3BZEA 5DLMH 3MFFA 2A99A 2EDYA 5GS3A 1JZEA 2X0UA 3NN8A 3C5XA 2F7QA 2AITA 2ED8A 3PGFL 5B39G 2DN7A 3SYOA 4N2OA 1HCZA 2LE9A 4JHZA 4S1SH 3VVWA 1YMHA 1XF2A 3HJ0A 2YGPA 2C9SA 5J0BA 3MREA 4DZBA 5B38B 5BVPH 5DJ2A 5L88H 1AI1L 1XGRB 1RCYA 4Y1AB 2OJEB 3ZMRA 3V55A 2BY2A 5I0VA 1DSYA 3MV7B 3GSNL 4QRTB 3IYLW 4KI1A 1IL1A 2ED7A 4E5XB 3H9SE 2GITA 3EFFB 4X5WA 4U6TA 2ADGA 2D7NA 4LLVB 2FO4B 4ECNA 2CGZA 4PJCE 4EIBA 4N0UA 1G1YA 4PGEA 3FT3A 3D85A 4RGNC 5H2BB 4NUQA 3EO0A 4AXWB 4OKDA 2CLZA 4HPOL 5EZIH 1DBAH 1OZTG 1RUQH 4L8DA 4G1EB 5ENWB 1ET7A 3C09B 4QTHA 3SPVB 4O9HL 2QQLH 3D85B 4MNQE 2NPLX 5H2BA 3SDCD 5I8OL 1FORL 1RUMH 4ODHH 3CQQA 3D09A 5I24A 4OCYL 1RJLB 4ADGA 4PS4L 1YYLL 4TNEA 2VDNH 1OANA 2ZXDA 4PJEB 5SX4H 2VKWA 1KB9J 4TPRH 2WYIA 5JIMA 1P0SE 4GQPH 4H26A 5E9NA 3UJIL 3I02A 1CURA 5IROD 3FQNA 3HA0A 4U2YA 5DRZA 1CGSH 2MNWA 3BW9A 3IRCA 4UYPA 3C60B 1NEZG 1UH3A 4MHHG 5LAXB 4JPQA 5AVUB 1NUNB 5ABAA 2YJLA 4ZMAT 1Q9WB 4QHLB 1Q9LA 4P5MB 2V2TA 4FXKA 1GY2A 1QWUA 3SODB 5CZXD 4G6JH 1DJYA 5FDWA 4Q97A 4JO1L 3INUH 2Y7QA 2CO1A 2F61A 1LO3L 2K9UA 4XP6L 4DEUA 5LQBL 5GGTA 1ACZA 1HNGA 4NCDA 4UZSA 4J7RA 1EHKB 4JB9L 4YIQB 3QNZA 4M1GH 5KVMC 2ZWYA 2BCKB 2V3FA 4NPYA 1XZ0A 1IM3B 1MUJA 3THMH 4UILH 2VN6A 1WZMA 3H3PL 2WKLA 4OJFH 3F64A 3FQRA 4JFDD 4N2GA 3KWVA 3EJPA 5IBUB 1XAKA 4I18C 5KOMC 3SE9L 4P5TD 1KJMB 1PG7L 1QD0A 4U6YA 4XZUB 3KYOB 2X7LA 2DMCA 1YEGL 4Z95H 4A66A 5BQ7B 4GRWH 2KC0A 3PAVA 5C0BE 3I9GL 1SLUA 2VITA 2ICWA 3DBSA 1HEHC 3BAYA 3CX5J 5F7FA 1E4WH 5EEVA 5CGTA 3DVIA 5G4OA 2DWDA 1OF0A 5DQDH 3TBTA 4MFHA 2VL5B 3APFA 2Z93B 1CFNA 5C07E 4MMXA 3BYTA 3D25A 1JERA 2CHDA 3PQYE 1XF5A 4GBXA 4NQSA 1ZA3A 3DIFA 5T3XH 4ZX5A 3TS8A 2FX9L 3K81A 3QHZH 1CIDA 2QKSA 2OYKA 2AEPH 2LAAA 1HYSC 2KPNA 4R5TA 1A6AB 1AO7A 2Q7NA 4N90E 4GMSH 4OY9A 3LIZA 4F7MB 4OH2A 3TYFA 3TN0B 3UG4A 5I1HL 4U1LA 4UU9B 3IAGC 1JAEA 3L1GA 3WXWL 1KPRB 5HJ3A 4LU5L 1U8KA 4X80H 1UKQA 4Q0XL 1HKFA 2XQBH 1MCKA 5MEOA 1TQCB 2BERA 5ACZA 4TSCL 3X2QB 4G8IB 1RJCA 3CBRA 5T1KB 3WXWH 1UXWB 2R23A 4JDVA 2FAUA 4IJTA 4JDZA 3PHQA 5DEJA 4QHKJ 3ME0B 4ZNEE 32C2A 5F1NA 4RBPH 2NR6D 1RL1A 1TLMA 1XMEB 4Q6KA 2L7QA 2H0FA 5LXGH 1KY7A 1PCSA 2Z65C 5K59F 4YXKH 1NBQA 5L2KE 2Z7YA 1F3JA 4G71B 1Q94A 1FYTD 1N6QH 3JV5A 3SOBH 4A6YL 5DFAA 3Q2WA 1BF8A 4LLUB 4LPVA 1CFSB 1MCRA 4PG2A 3H3KA 4I1NB 2FR4B 2X0VA 1RI8A 3L5WA 1HCYA 2RHEA 1NCHA 2F53B 3BP4A 1JPTH 3QA3A 1DQKA 4FF9A 5CUSH 4Z7WF 4L0YA 2OSXA 3BLBA 5IMMB 3WIAA 4JFPB 2A9DA 5B3NA 2ERJC 4M5ZH 1D5ZA 4HJ1A 3HLAA 2BVPA 2CJUL 4Y16C 3OXSB 1W0WB 4W9JC 3U46A 3FF7A 2C1PA 4J3UA 5EA0L 3ZDYB 1LXMA 4M29A 3WY2A 1A02N 3FB8B 3O0LA 4JHAH 2QR0A 3DURA 4IHOB 4L0ZA 4AUUA 2Z8RA 3UTQB 3KYNA 4JJOA 2GSGA 3IDXL 3EAKA 1S46A 2A6IA 2VLKE 4YJZL 4ZUVB 4WW2C 3NJFA 1VEPA 5I8OH 4HGWB 5FHAH 4ACPA 4ZS6D 4H8WH 4UQ3B 3TJEH 5K9OB 1PQZB 2ETWA 4XNDA 1BFSA 4MNHB 5KYYB 4GH7B 2Z64C 1BQHA 3LZNA 1CG9B 1JFQL 3HE7B 3X3GL 1P2CA 3FFCB 3WL9B 1FV1B 4KDTC 1KIUB 2L4OA 4FXTA 4TSAL 1UM6L 1DBBH 3IDGA 1OP5H 4Z7IA 1QFPA 2BOBB 4IBWA 1T0NA 2GJZB 2OS7A 3VI3B 1EZVY 4R4FL 5B8CC 3LQMA 4NN5B 1F0LA 4IRZL 3FQYA 1VFBA 2Z35B 3KGTA 3RBSA 1UT9A 2QZQA 3LN5B 2F8XC 3RIFK 2OTUA 1E2WA 2H32A 5L8LB 1KEGH 4K07A 2YUXA 1QFWM 3ZDXB 4CVXB 1OT4A 4XC1H 4XMPH 4KTDH 4HIJB 1YY8B 4F27A 3WAKA 5IUSA 1QWNA 3FOMA 3HZVB 3Q05A 2WIIB 2DQHL 2YPLE 4M7JL 4PU2A 5D9SA 4M1DH 5EWIH 2UX6A 4F58L 2MOGA 4O02A 2BNUA 3DMMA 4P4RB 3VXRA 5JIIA 5HPOA 2MIZA 1U6AH 1LWHA 2W9DH 4G7YL 2G60H 3S8GB 3DSFH 3SYQA 4QRRA 1CE1L 1WK0A 5B3SB 3BXNA 2QV4A 4TVPH 1ADWA 2VW6A 5B1CA 2J1YA 3NABH 2EDMA 3N04A 2WXPA 3UCRA 5IW6A 3OLEA 3VTTA 1JHKL 3SE3A 1JZHA 4M8QA 5LO7A 1MXGA 1T7WA 3HOGA 4LASL 1MRCH 1MFVA 4H8PA 1KN4L 2ADIB 3UO1H 4WY7H 2ZSWB 1NEPA 2N56A 2Y7LA 2QTEA 1DQMH 5JPMC 4LLYA 2JB6A 1IC5H 1GPOH 1DSFH 4YR6B 1KIRA 3GDCA 3AXIA 2XY1A 4FE9A 3Q2LA 1YEDA 2CKBL 2QEJA 3R18A 3C60C 4N90D 1E4XL 2XVGA 4F91B 1E5BA 1BFOA 5ISZE 3OJVC 4R4BB 4WV1A 1AIZA 4RBPK 5DUJA 3FU9A 4JRXE 1TTGA 5F7WC 3MMEB 3ZSTA 5CU9A 1B0RB 2HJFA 4Z7OE 4DERA 3HR5A 2CDEB 3FQNB 5CIPH 4F1ZA 4UOW1 1OAKH 2A6KB 3UJJL 4F80A 1NA8A 4X6FA 3P73B 5D2LA 3SKNA 1U3HC 4LKCB 1FFOA 1MG2C 3I6GB 3JWDC 4F15B 4F7TA 1A3RL 4GSDL 2DJ4A 1I9IL 1IKFL 5DFVD 4GXVH 3VNYA 2ORBH 4APQD 3O81A 3QH3B 1JI1A 4PVMA 4XAKE 4KV5F 5F0PB 3ZVVA 4HPYH 1WWCA 4OCWH 4IGBB 4DAGH 3HKFA 5C0CA 5CNHA 3A5VA 4KU1A 5I6NA 2GJ6B 3CH1B 1M56B 1PZDA 4J3TA 3ZZQA 4AIEA 1JBJA 2ED9A 2EKSA 3KPLA 1VKXB 2IFFH 3FCSA 3LPOA 3C12A 3F04A 1WZAA 5FPIA 4L3ED 2VSCA 2HVJA 5I5JA 1LP9A 2VLRD 3HBGA 4NPKA 1QI5A 2WSPA 3KWTA 1NCDL 4KRLB 4NQUA 5DTFB 3A4EA 4GKSA 5KAQG 2OYMA 1N8OE 4G43A 1E4XI 2Y5EA 4Y9GA 2HJKB 4YDVA 1KFGA 2IPKA 4NNPH 1C5BL 2YLKA 1GZQA 2XZQH 3U6XS 1NKRA 5AZUA 1JWMB 1A8JH 1M71A 4YIQA 5LN4A 3VGHA 1KJ2B 1QRND 1T89C 1O5DT 1XCWA 3T2NL 4AM0B 4D3CH 1A47A 2XRAL 3QQ9D 1CFMA 3R1GL 3KPSE 4WFHD 1RUKL 5KS9A 2YPKA 1CI3M 5KUMA 1JCKA 3CFBB 2GTZA 1F41A 1G84A 3U25A 3IMRA 1AH1A 3FL7A 1AAJA 3F3HA 5E0QA 4EDWL 1DVQA 2YQ3A 4EF3A 3CUPA 2HLFC 1R5WA 4JFEA 4R90L 4J3OG 1N12A 5L8KB 3GM0A 3BAIA 3WKYA 2HKFL 1R19A 2XTJB 4KBPA 5I9QB 3BVNB 5FHAL 5I1LB 3U2SB 2FT8A 2Q8BH 5HGHA 3PWVA 3WFEH 5TPWH 2NXYD 4NBZB 3AG4B 2JMRA 3LVTA 1AY1L 1G6VK 2J8UB 4OFYD 3PP4H 4R5VA 4ZO7A 4LQFH 4V33A 5C8JA 3C75A 2X6UA 5KBLA 4GOSA 1I3UA 4MNGE 4GLRI 4PJBF 4ABVA 4JM0A 1EJOH 4PWIA 3CN0A 4BIKA 2QZ5A 1NCTA 2X88A 4GI8A 4OFQA 3TZVC 5ILTL 2P5ED 5TE6L 3O6LL 4Q14A 2J1ZA 2QKIB 3SYPA 3O3BA 2KS0A 4UBDD 3HCVA 1Y7VA 15C8H 2YXWA 3F6LA 3OXRA 4FLHA 4LVHB 1IE4A 4IK7A 2CAKA 2WQAA 4U1MB 2JJUA 2AXHA 2VLKB 3L9YA 3LNIA 3SD2A 3RWEA 4NZTL 1IM9D 4H88H 3U0TA 2XZCL 1YEIL 3Q5OA 3V0VA 4JE0A 3ETSA 4LVEA 5I15H 1JF1A 1JZ2A 3SDYH 4JPKL 1XCXA 3QS2A 2A38A 2X2UA 4TLUA 4BA0A 4TL5A 1VSCA 2O6FA 4FKHA 2GFBB 2ZICA 5DJ2B 3QO1B 3RIFF 1AGCB 3ZTJG 1WZKA 2QMJA 1A9VA 2P24B 4JFXA 3T2LA 3P9LB 4GS7B 3ATBA 3I3BA 4Y4HA 4A2FA 4DP8X 5I16B 5CP3H 1D9KC 1XR9B 3BP4B 4R4FH 5BV7B 4Z9KB 2A9NH 4WEUD 1QLFB 4JBSA 3VB8A 3ULUD 2YKKA 4OD3H 4O58L 5EEWA 5E4OA 1F6FB 4NN6C 3AS1A 1CDGA 4O02L 2R8SH 3BVVA 3N85L 2A6JB 1O7SA 3WIFB 4KVPA 4GLRH 3TU6A 5CLYA 1XIWB 2BNQA 4N2AA 1A6VH 4G6AC 4JCWA 5BRZB 3NSJA 2XPYA 3DXAD 4KXZI 1MG3C 4KRPC 1N68A 1QQDA 3MRRA 2IQ9L 5ITFA 5HYJD 1M1SA 3TONA 2HKHH 3B7SA 2N7BA 2ROYA 1FPTL 5E8NA 4E36A 2X4QA 4FQLH 4DSYA 1XTMA 1BQHG 2FIRT 1BZ9B 1XSKA 5DJ6B 1AGBB 5C0AE 5I0XA 1N59A 2PO6A 4MXVE 3IPBA 5L2KA 1L9RA 4KTDL 5BO1H 4GRLB 3ZQ9A 3IGUA 3CGTA 3V0GA 5F0JB 5I66A 2WJ5A 4LSTL 1MJ8H 2LFGA 1L0QA 3KXFE 2CH8A 5EOTA 5AW9B 4JY4A 3QIWA 4MWFA 3VWKA 4KKAD 5GS0D 4J4PC 5IR1B 4LCYB 1F5WA 1MCQA 4F7EA 1GSKA 1K9TA 1XCQB 2E6QA 4PRIE 5E70A 4NZRH 2YO3A 4FQHB 2XKSA 3HFFA 3JV6A 4K3JH 2HRLA 5I6OA 1DN0B 1JYVA 2Z0UA 5BJTB 1MJUL 4URTB 4YK4B 4GRLA 1MFMA 2Z3FA 1YRKA 1FLTX 3GIZL 5BPPA 4CA4A 1S9KC 3RA7H 3QIWB 2VAJA 4Z7QE 4MCYB 3FNKA 4Z76A 4WRLA 1NGXA 2FGWL 3NGBC 2FHBA 4H8QA 1I3GL 1T4KA 5DK0A 4A38A 4GP8B 5CCGE 5D5MB 3QXDA 2NX5E 5MENB 1HQRB 4B9JA 3A23A 5A43C 4RH4A 3MV7A 2MOQA 1I1AC 4K7PY 2X05A 4D9QD 2PCFA 5G4MA 2ZSWA 2W5PA 3ILQD 3RFZC 1HK6A 4H25A 2RGSA 3WHXA 5E00A 5KS9B 4KK5C 3ROOB 4WEEA 2SODB 2NY6B 4E2OA 1T5WB 1DVFB 2V3DA 4IDLA 3NCYS 4L9DA 4Y4KB 5LVEA 4O2CB 3ZTCC 3KLHD 1H3PL 4XCEB 1FG2A 2EIMB 4QOKD 1RJYB 4G42B 1AQHA 4WVRA 2VRAA 4AW4A 1UEMA 2O5ZH 5IKCA 1ZKAA 1DBKL 1M2VB 2IF7A 2HH0L 4YXLL 1Q9KA 5F0MB 1K3ZA 2VDNL 3L5XH 4J12A 2IWGA 1KWGA 3BO8A 2XACC 4XCCH 4P3WA 1K4CA 5HYJA 3UDWA 4GKZB 1ND0A 1THAA 3CCHB 5C0EA 4R96A 1J10A 4KTYA 3U7AA 5IOKA 2BK8A 4BSWA 1RZJH 2D03L 4PCSA 4XVOA 3RWFA 4M61B 5CLWA 3HS0B 5EO0A 2FJHA 1OGTA 4DQAA 6PCYA 4Z7VA 1A6WL 4P8QA 5D1QD 5D2LB 1OGAB 1KBVA 5KANG 1RSYA 4L18A 3H85A 3VWKC 3IDJB 3WMPA 1TJIH 2IAND 3TIEB 4RGMC 5AUMA 2XBDA 1X7SA 4Z7VE 3BN9D 3APCA 3QIUA 4F7TB 5DS8B 5EUOE 2Y5QA 3ES6A 5IQ7H 2X6VA 2HJFB 2APXA 2WVTA 4W4OA 3J27A 3OKDA 4XB8A 1FHNA 1TEFA 1A1NB 4OLUL 4PRHA 2RAMA 3PP3H 5LGYA 4Z77A 1NAMH 3LKNB 3A6OA 1A6TB 4WTQA 1BM3L 3HN8A 1I9JH 4K5MA 5I17A 4MA7H 3VXNA 4N86A 2AEQH 4FQXA 4KITB 2GUOA 4JO5A 4X6FB 3THML 5D2NE 4PJCB 4Y9FA 2EADA 3OKDB 4UTAH 1CGVA 4Q6YA 1DLHA 1S9VB 1ZS2A 2APTA 2X4UB 3GSWA 1WJ3A 4GMTL 3H9YA 3FZUD 4YHPA 4HOWA 4FTVD 3VFGH 2ICWB 4M03A 3WLWD 1XH1A 3LV3A 5LQBH 4D0BA 1KXQE 1X5YA 2B59B 4HWUA 2DD8L 1YC8A 2MPAL 4FFZA 2VXUH 1U8LB 2R0ZL 3SCMC 4KJPD 1JD9A 1TZIA 1OQXA 2DQ6A 3EBHA 2ZOLA 2VZOA 5DVLA 1JYNA 4OTXH 3PWJB 1B3JA 1IIKA 2BZDA 5D7EA 3C9NA 5AVWB 4I3SL 4UOW0 5AQ0A 4OI9A 4FG0A 4IKIA 4BSVB 2JLLA 2OA9A 3EOYG 2FTAA 5AW8B 3Q9QA 4HIIB 2QQKL 5LHDA 3ULUH 1FBIH 1H8SA 3LPFA 5CJBA 3C87A 2DQEL 3FOLB 5JMOC 1V8HA 4HF5H 1E9OA 4UANA 3JQOB 2EXTA 4YAQA 3C8KB 1OTTC 3O41A 2QGCA 1JG9A 2OMVB 3RGVD 5F9DC 5FIEA 2CM6A 2W9EL 1CR9L 2QQNH 3OF6A 2YBGA 5K59E 4ZX3A 1DO6A 1JWSA 3B7RL 1NFDE 1S7XB 1LVEA 1K4DA 4JS7A 2B16A 3TGXA 2JXMB 1DUYB 1AD9A 3IJSB 3QPKA 3POHA 1J8HD 1VZHA 3V9FA 3HG0A 1HFUA 1FN4B 2CM5A 1YPZF 1KJ2H 3PIQA 3R19A 5CINL 4GW1A 3LVEA 1M3JA 2OTWA 5DURD 3TH3T 4TNVK 4IMKC 4YSSA 4E9LA 4M7LH 1FL6A 3GJEB 3BDXA 4UV7H 5C70A 4JFWA 3WU1A 5LAPA 1PZAA 2IANB 4UIMA 1ZGLM 1Z3GH 4L3CA 1UKTA 2DM4A 1W0VB 2G9KA 3MYJB 2VUKA 2XV0A 4JO2H 3S0PA 4DP0X 1CXKA 4DETA 2FX7L 4TULH 2B3RA 4RIRB 5HYIA 3EGDA 4KO5A 4LLQA 3FT3B 2JKJA 3OKEA 1J48A 3PJSB 4MD0B 4PJ8B 2AP2A 3I2CH 1D7BA 3NEXA 3BVWA 3QXTA 4I5BA 2Q0ZX 1SDDA 1UD4A 4OJDH 3VH8A 4P2QB 4AENA 1PNDA 1OB1B 1TTRA 3DO7A 5ID0B 5AWNL 1KZQA 3FB6B 2AHIA 1BMZA 4MJIE 3QA3B 4RSVA 3OL2A 3T0EE 5JLZB 4ZXBA 1K72A 2A1WH 4S0TD 5EC2B 2OJEA 4EDXB 4QXGL 1IX2A 3QXVA 4M8QB 1QLEL 4ZTPL 1R33A 3FUIA 4NNYA 4WWKC 5E2UH 1TZAA 1NFKA 1QRNA 2UYLB 5JIKA 3BQVA 2NY6D 2YHGA 1WO2A 1KGIA 2CRIA 3MI6A 3P9LA 4ZNCD 4GW5B 1CMOA 4PJ7B 3HE7C 4IOFD 4G9FD 1E5YA 1GIGH 1NIBA 2EIJB 1YN7A 3RQ3A 4BZ1L 4KZ0A 3VFTB 1AGCA 1AXSB 5F70A 4LPUA 4XH2B 1WAAE 2FJSA 2P49B 2YQGA 5AD0B 1NCUA 4JFTA 4OQTA 5EZJA 3H56A 2DWTA 3GXFA 3SPHA 3IGLA 4P5KB 4NHUB 1MCPH 3SKOB 1CB4A 3PGFH 4G8GB 1LE5B 1P84J 3IF1B 2FWOB 1FZMB 5I82A 5F7LB 2N3JA 4PYHA 3E3QC 4MJIB 3ZDYF 2UWEE 1KCRL 3ROLB 4HG4J 1KT2B 1XD1A 5DRWB 4PEEA 1YQ2A 3QG7L 3VO0A 1B4LA 2PTUA 4IGBC 3ULSA 4ZMPA 2NY0B 3FRPB 3S34H 4GKNB 1VGKB 4FFZL 3N0PB 4PJHF 2O61A 4ZODA 3MQIA 3I6KB 1HH9B 4KVNH 3LNEA 1R3KA 2QLVB 2VQTA 3K2KA 4XWOD 4X8JA 5FGBA 4PI0A 4WI7A 4KROC 5IB4B 3WEMA 1J1PL 2OFQA 3GBEA 3L3IA 3VGAB 2Q9OA 3Q8CA 4KGLA 4NAMA 2D2OA 1WS7A 2HT2C 5AFAA 1JGDA 2B2XH 2ED6A 4MNQD 3WL9A 1UB6B 5MEQA 1KACB 3P4NB 5HHMB 5I66B 2DYRB 1CYGA 2DTMH 1DCLA 1GW6A 2VDNB 2ZAHA 3CFJA 4IW4C 4UBDC 1BVNT 2AW2A 3PHOA 4WTWA 4C4BA 4MAUH 4Y4KC 4CNIB 4NHCL 1JK9B 2QT6A 1KGJA 1UA7A 2GJRA 4HJIA 4Z7WE 1M6OB 4PJFB 5TK2A 3TZVD 4ODUA 1YECL 2IV8A 4BBWA 1C5CL 4DN3L 4F57L 1E9PB 1KEGL 2BOCA 4YWGL 5ESAB 1JGDB 3TWYA 4R7VA 4FNLL 3MLVH 4XNMA 4J3OC 3BPOB 1IL1B 4FN0A 5GHWH 4LRIC 4L8CA 4ONGL 3LMJH 4YDZA 5B4MD 1DHKA 4PGCB 5DZJA 3C5ZC 5L7XL 3O9WD 4Q9BA 1TQWA 1EDQA 3TBCA 3NJGA 3DX9A 5E08H 4NZUL 2OCCB 4JO4H 2YMXL 4ZS7L 4AOFA 5JHDB 2C5DC 5DHDA 3PWNB 2F8IA 1Q9KB 3S5ZA 5T33L 4FLQA 2VLRE 4NWTH 4YWGH 2XHNA 2R1XB 1NPJA 2Y2WA 2GTWA 5BS0E 2F19H 5H4YA 1IFRA 5HYSG 3QIUC 3QEGH 2RR3A 4QHKI 1G9MC 3VWJB 1TZ8A 3RWJB 5C9KA 5D5ME 3GNML 1T66D 3HG1E 1ZANL 2AXGB 4WW1A 1QBML 4K8RC 1DJWA 1ZPLA 4BUHA 4L2YA 4BXSV 2PW1B 1TMQA 2EDJA 4QHNB 2NX5A 4XVSH 2WAQA 1K8IB 4HMEA 1MIMH 4QY8B 5F89A 3EXJA 1KCBA 2VDQL 4EVNB 4K94L 3W9DA 4EOWH 1KPRA 1D2PA 4PH8A 2D7PA 1WFTA 4QYOA 1WQVT 1J0HA 3LQAL 4KRPD 1R17A 4LIQL 2WV3A 4AVIA 1MDAA 4PWEA 4R7NB 3DVNA 3VTMA 4GQ9H 2BDNL 2XG4B 4ONFL 4PM1A 4U1MA 3H6JA 1RUAH 2AFNA 3FBKA 1RZ7H 1WAPA 3GSWB 5FDWB 3WTXA 2QDWA 2W60B 3OBAA 4NPJA 1N6VA 4KQ0A 1CICA 1QBAA 3QUZC 4JRLA 4M1CC 2CCLA 2J1WA 5C2BH 1KYUA 2BSDA 4L4JA 5MEPB 2E3VA 4JZNA 3KXFA 5DD5H 1NEZB 4S1QL 3TPUB 3R4DA 1CFQA 3ESUF 3HRZA 3GSRA 2X0WA 1FZOB 1YPZB 2KQNA 1A1NA 4L29A 4UDTA 4KXDA 1CDYA 1NKGA 4HGKC 3L3HB 4UT6A 4W70A 2XCMC 4BK5A 2F0CA 1TZGL 5FS5A 4AG4H 2YPKB 4PJXA 1NOLA 1D5MB 2OMXA 4AEHL 4Q0XH 2K3HA 2P8MB 5F93C 3W57A 2I60L 3G9VA 3O2VH 3VXRE 5BNXD 1KJ2A 2WPGA 5GGRY 3RVXC 3GYRA 2PW2B 3HAEA 1IBZA 3LS4H 3R4RA 4EKJA 4PJ9A 1IC0A 2AJZA 4N5EC 1CD0A 3IKCA 3U2SA 1GZHC 1HT6A 3BSZH 2A1WL 5JIQA 1I7TA 2BIIA 2PF6A 5AWNH 4DPCX 3ARQA 1ZLSL 2F7IA 1S7XA 4FNQA 1PAZA 4FJZA 5FYJD 2ZTBA 2FBOJ 4HKXA 3WXVL 1H3TA 2DIJA 1I7TB 4PR5B 3ZL1A 1RFDL 2HWZL 5E6IA 5HJDA 2HKFH 5E9DE 4YAQB 2A9AA 1GHFH 4OLXH 5HPMA 4TTGA 3BN3B 1BMGA 1OSZB 2NXYB 3HRZC 5F1OB 2WGXA 4OJEH 3GMMA 4K3DH 4ZD3H 2PNDA 5HPMB 3DHMA 2BOBA 1GTNA 3GKWL 3TCLB 2JSFA 4C8XA 1XB3A 3KL0A 2JJWA 2MQCA 3RWIA 3N42F 5IW1B 4NGHH 3P54A 2ZOOA 2YD1A 4PJGB 2P7TB 2QHLA 5JDJA 2YQ2A 5EEUA 1JF1B 3IJHA 3I3DA 3IETB 1EO8H 1W72L 4AENB 5GGSB 3NFSH 1WEJH 3BMVA 3QZLA 1M3IA 3B5TA 3VI4B 2BSED 5KYUB 1TENA 5TE7L 1SUJA 4PJ8A 5DEGA 3G3LA 2OMWA 2HZHA 2BVOA 1OKEA 1Y6MR 4YZFF 2C3VB 2NQCA 4P48A 3KLAB 1N5YH 2JI3A 3IFLH 4MAYA 2OXGA 3D48R 3GLAA 2X42A 1XHHA 2Y07L 3CTTA 4JHWH 1BFVL 1XWVA 5I1DA 1NJ9A 3FRPG 3OLGA 5FO7B 4XO3A 4GSQA 5FDYA 5BRZD 1F4WH 4XC3H 2L7UA 3HNSH 1XT5A 2K7QA 4W9EC 3TNNA 4C56B 2F6AA 3L5WB 4DKFL 3QQXA 4AQ1A 5KSAB 4HS3A 2ZG2A 3SE6A 4APQC 1BZEA 3CBKB 4N85A 2N7AA 5I1AA 3G5VA 3GXIA 1HESA 2LVEA 4JRWA 5T3ZL 4BA8A 2EUVA 1HH6B 2B4CC 1XF1A 1BJMA 1L9PA 1MHPH 2OCJA 2DKMA 2GW5A 2Y07H 1MHPL 1PLGL 2VQUA 3P3UA 4W6WB 4AQ1C 1PLGH 2WYZA 3BRDA 1UFUA 3R06A 3SGKA 2W9LA 5FYKL 2YN3A 2DWSA 3Q44A 5GS1A 4F9PA 4Z7VB 1N64L 3FYEB 3L3JA 2FQFA 1OO2A 5EU6D 2HTLC 3BUYA 3D7PA 4PJ5A 3HVDA 3L3DA 5C71A 1T0MA 1LHZA 3ZKND 3MHZA 3S3PA 4CU7A 3PP3K 3VG0L 2B08A 3CHOA 5F7DA 4MYPA 5KJ7E 5D1XA 4MA3A 5C0JB 4PW4A 1AG0A 5C2UB 1MF2H 4KKCC 1DN2A 3L7FB 1MREL 4HHWA 4DGVH 4HXAL 4WI2A 3C5SB 5KW9H 2I7SA 1FL3A 4L8SC 5BXFA 3NIGE 2APFA 2OTUB 5FM5M 2EXWD 3FFCD 3QIBA 1BG1A 4R97B 4YHLL 4PGBB 4ALAH 4TV3A 1JFQH 3KPOB 1Y6KR 3RWDA 1NCNA 2NY5C 1D5IH 2NY1C 3LEVL 2LT9A 4XNYL 3SIKA 4S1SL 4GW4B 4LSQH 3PHOB 2XJLA 3G9AB 3PWPE 3QEHA 2ZP9A 4NM4H 1EEYA 2WW8A 1NGPH 3MOBH 1QMUA 5E2JA 2D7OA 4AJWA 2HT3D 3P0VH 4BV1A 4Z23A 4CVZB 1NLDH 4MJHA 4MCZB 1J1OH 3L5JA 4JRXA 1CXFA 3D05A 5EIQA 4P5TA 3WAJA 4MTMA 3TT3H 5DS1A 2EACA 1XL6A 4YBQD 3Q13A 1EDYA 1BOGA 3N91A 4XC1L 4XMPL 3CFJB 4ZUTA 4I77H 4U0QB 5CJXA 3NPSB 1A6ZB 2XWTB 2ZPKH 1VEOA 3VXUE 2Y1AA 5CN1A 4GRWB 3TWCL 2VMEA 3VM5A 3ZE1E 2PO6C 3OKKB 4XN5A 3HR6A 4WFED 3I50H 1J8HB 4HEMA 3T65B 4POZD 1QFHA 1KJ3H 1KGYE 2FEDC 5FGCB 3Q0HA 5L4FA 4J2QA 3VE0A 5CWSA 1YAZA 2FH6A 3GMPB 3VFOA 1O6TA 3EYOB 4K5LA 1RZ8A 1U8NB 2QBWA 5GJSL 4MBRA 1NH6A 1U8IA 4P46B 1RK1B 4HHGA 3AREB 1CFNB 1V10A 2WANA 3GSXB 4R0LB 4NN7B 5F9WC 3RIAK 3PAYA 5AZEL 1SJEB 5CU5A 4HUCA 1QNZH 4I0CC 5DRNB 1MI5E 1NM9A 2FK9A 3IN2A 5IESL 5GGUA 3RL2A 4I2XE 1DDHB 4WHYH 1EFQA 3KBFA 1I1FA 4YGVA 2O6EA 4QPEA 1M42A 3SD5A 2YAOA 4W1TA 1IC4L 3IN0A 1KBGH 3ZHNA 4PJ8D 4RNRA 5J6GB 3DROB 1Z5YD 5IJVB 4N6QA 3HS9A 3UXFA 2R69A 3WJJA 4OLUH 1A14H 1CD8A 2OAAA 1E5UI 3NUKA 2P24A 4Z0BL 5D8JL 2ITDB 1IBGL 3ABGA 4MDIA 3HB3B 2WLYA 1ACXA 1MCIA 2JFCA 4J8RB 4JFHD 3HKZA 2ESVB 1HX0A 1WCBB 5ECJE 1UZ6F 4ZTOL 4YPGA 2AXGA 4GYBA 4WW1B 4EBQL 1OW0C 1J5HA 3Q8BA 3FFOA 2R23B 3MOAH 5FA4A 3IFNH 3A4DA 5E6SB 4FA7B 2O30A 1D5RA 1RJLA 4XX1G 4DPRA 4OAWB 4PRDB 2D7TH 4BCZA 4FAAB 1VA9A 3BUDA 1X4YA 3Q1SH 5GRYA 2D7QA 5EBGA 1O6SB 1D5MA 2P5EA 5BRZE 4K9EC 3LRMA 3CVHA 3B2VH 3UTSA 4RDQG 1NAKL 5HDWA 1CLOH 2XN9A 3V6OA 3FT2A 4AYFA 4NWTL 3DGDA 2DM3A 1YPZE 5FAAA 4PP1D 2DQTL 4NJ9L 5DQJA 1F97A 3N9GH 2Y3AA 5LWYL 2P46B 3KDMB 4ONOA 5EV7A 1WV7T 2YUVA 3P4LA 4P49A 5FO2A 4F9PC 3IDYB 2P9RA 1LMKA 2EDHA 1TVDA 3DX3A 4J3XA 2BHUA 2IG2L 3VRJA 4AQAB 1JV2B 1QBMH 2W07B 4N2BA 2H47C 3ETBJ 5T1KD 3KYNB 3KLSA 3BSHA 1HYRC 1ZA3B 3DIFB 5DJAA 3OKNA 1U21A 2EICA 3A6CL 2OMVA 1T6BX 4PV9A 1RHHB 1MW0A 1P4BL 2IPTL 1FQ9C 2DKUA 1KXVA 1T21B 3D33A 4OJAA 3GBML 3AGWA 1WA2X 1K3IA 2E27H 3D8MA 3FRPA 3QUMB 4FHJA 3WJMA 3X1FA 3MLZH 4ATTA 1UURA 3KW8A 5EF0A 4DF9A 4A7GF 4Y5VA 3D69B 1HINH 1FN4A 5AL0A 2J8UE 5I6KA 2BZ7A 5GSVA 1S7WA 4KUZH 2XN1A 4IRJA 3O4LA 1NANH 1FJ1B 1EO5A 4X80L 1Y1UA 2H5UA 3MNVA 1DEEA 3VXME 3IXTA 4NKMA 3CFMA 3NK4A 5I6MA 3MACL 1OW0A 5FECA 3PDOB 1QEWA 5IW3A 4MX7B 4HIHB 1EFXB 4TQHA 2A5UA 2PO6D 1N18A 4RMBA 1CICD 2F5AH 2PPFA 1SHSA 4Y5VB 4ELMA 3AY2A 4WF7A 2WBKA 1QO3B 5DJ0B 4HEPG 3F2LA 1YY8A 3CIQA 4AIZA 3ULUE 4WCYH 5BUAA 1E3FA 3EYSL 2AK1L 3K6DA 4YX2H 1NFAA 2UZIL 5JHLH 4FRWA 4F20A 3OB8A 4AJYV 5LCVA 5T3XE 1MWAA 4FMFA 2BSBA 4KK6C 3K4AA 4QXUL 2X09A 3QDMA 4CUCA 1CQKA 3RVVD 5KZCB 3FB7A 1EUTA 2G3XA 5B7FA 3AXHA 3PJSA 4KVNL 4MQSB 3NBNA 4NSKA 1SZNA 3BP5B 1F4YL 1NCAH 2VZ1A 3TFBA 5GISH 2VDLH 4Y1AD 3MU3A 3ULUF 4UTBA 5E2UL 4ZPTA 1YEDB 1BIIB 2NYZA 3JZ7A 4Z3TA 5L88L 5JOPD 4TLTA 3AVEA 5CKAA 2FO4A 1XCTB 4WFEE 3CCHA 4TUOA 4MMZB 5C0EB 1GXEA 1A3QA 3MROB 1U91B 3V4PH 4Z7NB 3NEEA 4NQXB 2HFEA 1X4ZA 4L8BA 1P7QB 3T0VA 4WFGE 3I3EA 1YG9A 4WK2B 1YEIH 4FTVE 1EK3A 5I15L 5EF1A 3GHBL 5HHQA 4HLZG 1GIGL 4P2RD 2Q7YB 2FBJL 4MHHI 3E0GA 3D0LB 1WAEA 3RGVA 2KUTA 3G6JB 5EUOA 3VQMA 1INDH 4OM0L 3FN3A 4WWKD 3T0ED 4K3EH 1H6EA 4JG1H 4PSPA 4NN5C 5TE6H 1I1YB 1TZHB 3FB5A 5IEKB 5F72S 3UZVA 4KGJA 3IF1A 1N7MH 4QJ5B 1CD1B 2F1EA 4FX5A 3QZPA 2HLEB 4N2IA 1EAJA 1LJMA 4HZLB 4ZDHA 4Y4FC 1YMME 7CGTA 1ASPA 3M1BB 2KQMA 1F3DH 1W6LA 5AZ2H 4BSVA 1I8KA 1FH5H 3H3BC 1N5YL 5HHVL 2QDVA 2DMHA 5C0GB 2NCEA 1PIFA 4G8AC 2CXKA 4KZDL 3LZPA 3RAJL 2AJSH 4KHTH 2ZX7A 2Z6FA 3WKNA 4YHZH 1A7NH 2UZPA 1WFNA 1JXKA 2GABA 3KVPA 4QEGA 3CZSA 4KJQC 1EMTL 4TQPA 2OJZL 2RA1A 4JVPA 3IDGB 3RUGF 4H25B 1IAII 3WHXB 2L3BA 1U8PB 4APQB 4U6HB 2RCSH 3Q6FB 1ZT7A 2WQRA 4D0CA 2VM9A 1QSFD 2VXQH 4LVOC 4A04A 2BP8A 4CSSA 5JOFB 3Q9PA 1MREH 3TA4D 1OLLA 1B6DA 1JV2A 3IFOB 4LASH 5AW4B 1S9WA 2V9UA 5FA3B 3EYQD 4WWPA 2N7SA 3QWOB 4UM9A 1KYOJ 2VJ0A 1MEXH 2R4SH 4ABWA 3DUUA 4YDJA 1EMTH 3CHPA 3O6FA 2R0KL 1NBVH 3B9KC 3K6FA 5HDBB 1EPFA 2G60L 2IMNA 1BVKA 3CSTA 3MA7B 1DQQB 4YHZL 2ZX5A 2CKBH 3EO0B 3RNKB 1OTTD 2FEEI 1VJSA 2AJUH 3T4AC 2Q2EB 4ZUSA 1CF1A 3L4UA 4KTEH 4HF5L 4MJ2A 1ZDQA 3SDXA 4XMZA 2AJUL 4OLYL 1INQA 1NCCH 3SCMA 3K72A 1RVFL 1IM3D 1U9KA 2ILLA 2OMZA 3IWUA 4LSUL 2MH4A 4OFYA 5HGAB 4HOZA 3RWFB 1XH3A 5JO5B 3VXTA 1TQBC 5DGRA 1IKFH 3LXBA 1F18A 2R4SL 3VX1A 2C9AA 2CA3A 3CFKA 1AQKH 5F3BB 4HFWB 2FHCA 2YXFA 3O2VL 2BRQA 1PS3A 2QPSA 5DJ0A 4M02A 3MXWH 4QTIH 4WSKA 2VDKH 5J6GA 4ZFOB 4ZK8A 2NSXA 2DW5A 3MKKA 4UTBL 2J5LC 1K8IA 1CFSA 1DDHA 4V1DA 2VW4A 3QEQE 4KUCD 3SOTA 3BD4A 2IEPA 2WXHA 1G7PA 1DQDL 3WDHA 1SXNA 4QRAA 4PRPB