3D08A

Human p53 core domain with hot spot mutation r249s and second-site suppressor mutation h168r
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
191
structure length
182
Chain Sequence
b'VPSQKTYQGSYGFRLGFLHSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQRMTEVVRRCPHHERCGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRSPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular tumor antigen p53
molecule tags Transcription
source organism Homo sapiens
publication title Structural basis of restoring sequence-specific DNA binding and transactivation to mutant p53 by suppressor mutations
pubmed doi rcsb
total genus 43
structure length 182
sequence length 191
ec nomenclature
pdb deposition date 2008-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3d08A00
2J1WA 3QYMA 3WTTA 2VUKA 3TS8A 1KZYA 4AGMA 2ADYA 2X0VA 1CMOA 2IOIA 1HU8A 2J1XA 2OCJA 4AGLA 4GUOA 3D08A 3US0A 2GEQA 4QO1B 4GUQA 5KBDA 3VD1A 2IOOA 4AGPA 2FEJA 4MZRA 2YBGA 3D0AA 3D07A 3KMDA 4L0YA 2X0WA 1T4WA 4IBTA 5AOKA 2XWCA 5AOMA 1YCSA 1TUPA 4IBYA 2PCXA 5G4NA 3WTVA 5LAPA 3KZ8A 4IBVA 3D06A 5AOJA 3QYNA 3ZMEA 2MEJB 2H1LM 1TSRA 4A63A 2BIMA 2X0UA 1EAOA 2ATAA 4KVPA 3Q06A 2BIQA 3Q05A 5A7BA 4AGOA 3IGKA 4IBUA 2BIPA 5AB9A 4HJEA 4LOEA 2J1YA 2BINA 2J21A 4IBSA 3US1A 5AOLA 2WGXA 2J6WA 2AHIA 4IBZA 5ABAA 2RMNA 3Q01A 4L0ZA 3VD0A 1EANA 2BIOA 5ECGA 5BUAA 2IOMA 5G4MA 3WTSA 5G4OA 3IGLA 3EXJA 4G83A 4G82A 1E50A 4IJTA 3WU1A 5LGYA 4AGQA 1HJBC 1CO1A 4MZIA 1HJCA 1EAQA 2P52A 4IBQA 3WTUA 3VD2A 2AC0A 3WTWA 1IO4C 1GZHC 2XWRA 2J1ZA 3EXLA 1H9DA 1GZHA 1UOLA 4AGNA 5AOIA 3WTYA 4IBWA 4XR8C 3D05A 2J20A 3D09A 4LOFA 3WTXA 4L18A 4LO9A 1LJMA
chains in the Genus database with same CATH superfamily
4M4RA 1J18A 4WU5B 1WDAA 5IMOA 1PG7W 3S2CA 4FNRA 1TETH 4WCYL 1WA1X 1DSFH 1Q8MA 4ZMYA 3FQ2A 4KK9D 1JXJA 1TOXA 5FUZH 2A4ZA 1KN2H 3PABA 1ZSHA 1U8OA 5D6CB 4GKNB 1QBLH 5CBEA 2AJ3A 3FT2B 1N67A 3E3QE 3OR6B 1JFQL 4LHUG 4U6XA 1RUQH 3MJWA 4IKIA 4N6QA 2WWKT 4KXCA 4IU3B 2CKNA 4DPAX 1QLEL 3BUTA 4PGCA 5F1SA 3L7FA 4EF3A 2X70B 5K5YA 4XVTH 3FN3A 4HJSA 1JWMA 3K1KC 5L0QB 5LJYH 4TQEL 4OIFA 3X12A 2A77L 2Q1EA 3A6BH 1HESA 1DO5A 1JI2A 2RHEA 3RWGA 4WFED 5KN5A 3EH5B 4UV7H 1KGXA 3LZNA 4Y5VC 1TT6A 3IKKA 1T5WB 3DX8A 1I9IH 2C4FU 3O41B 4TN9A 3OZKA 3SPVB 1KTKE 4WGKA 2F6AA 1L6XA 4X6DA 2BDNH 4NO5A 4DZBA 4EDWL 4B9FA 1MCDA 5B22A 4BYHA 3KW8A 2A9NH 5EORL 4HP5A 4DKFH 1Q1JH 4YEFA 1ROWA 1DEDA 2XZAH 3MRNB 2BSRA 5T1MB 1RIHL 2Z31A 2BSTB 4POZC 4DZ8A 3CD4A 3X1BA 4JFDE 3F7QA 5DEZA 1MHPH 1OD7A 1IKFH 2DIBA 3HNTL 3MRLA 1JGVL 1ZHBB 5EO0B 4ZOCA 3HVDA 1KCKA 4C57C 4RNRB 5KOMC 4HUUB 4MCNA 1DHKA 1F90H 2FGWH 2EDQA 2B2XL 5CMAB 5F2FA 2Z35B 4AIEA 1PW3A 3G04B 4G2AA 1LLAA 1U92B 5FYKE 2AABL 3TX4A 5L7XH 4QHKI 5AYQA 1XMEB 3A4DA 3H54A 3DURA 5LGYA 5GGSY 2J8UA 2XIIA 5J4MA 3US9A 4KZEH 1JPSL 2E6PA 3MLVL 3B9KA 2XWZA 3IU4L 4R4NC 4YBHA 5SWQB 4F7TA 4NC0B 2HMIC 1GGYA 2GHZA 1RL1A 2LOEA 4GO6B 4XMUA 1YQVH 2GFBA 4QKTA 4YHNB 4URKA 1BQSA 3LZFL 5D7IA 2J72A 3VFRA 2CLVA 3QORA 1GS7A 5F7FA 4MAYC 5DJ0A 5IJDC 1VCAA 2E75C 1ET5A 2Q8BL 4H8UA 4JUSA 3GSQB 5AW8B 2EIKB 3F12A 3IFOA 4GKLA 1IBBA 4KOBA 4N2IA 4WNQA 2C9XA 3ESPA 5JOPE 1OSZB 3BRDA 4QOKA 5CLZA 4KK8D 1LQBC 4N68A 3VRLF 5GS0C 1XAKA 2YXVA 2MPVA 5GZNC 2HJFB 1AHWC 3IWVA 5E6IA 4KPHL 3DTXB 3DXAE 1SBBA 1T3FA 4FJYA 4R7VA 2FL5A 3I9GH 3INOA 4KRPC 5AALA 5AENA 4FTDA 1BIIA 3WNOA 4DCQA 1M57B 2CALA 3P30L 4PGDA 1MOEA 4PJDE 2IADA 1QWHA 3LPFA 4LPCA 5CINH 2Y69B 3OLEA 3TZVA 1QFUH 3CHRA 2W0KA 3SGDI 2ZOKA 3IDYB 4BZ2A 4EI6B 3CIAA 4PRPE 3HUJB 3GLEA 4LCCA 3EJCA 4LSPH 5DEJA 1LWHA 2B59B 1YLBB 3WLBB 2CO7B 3WJMA 3ELAT 3VMNA 4PW9A 5DK3A 5D96C 3TTYA 3AROA 1J0HA 1F4AA 3K2UL 4IKJA 4HX1A 3MTRA 3UJIL 2P44B 3CHOA 1XGZA 3MA9L 1DTUA 1UD3A 4GKNA 4JM2B 4HG4J 3GIZL 2BSSA 1PDKB 3IGKA 4IK7A 2Q87A 3LXUX 4N2CA 2VR8A 2NY6B 2H6OA 4L4VD 4E9XA 2N3JA 4EO5A 4ELMB 4AJYV 2X70A 4A6YB 5LQBL 2FLMA 5FX3A 3DETD 3O81A 3RKDC 3DX9A 3LDBC 4TLKA 4JFXA 3BP4A 2LU5A 5GRZA 5IMLB 1E3ZA 4PR5A 5DD3L 5KSVA 4H1LH 1NTDA 2WZPA 5KN5B 4P46A 2F1AA 1NBVH 3ARBD 1F90L 2FGWL 4X4MA 1F3JA 3UPRA 3T1FA 3B9AA 5CSGA 4GIAA 4L29B 4PB0L 1OM9A 2PYEA 3U30B 4Z3TA 3VWJA 4X6DB 3QC5X 4FNPA 4MJ2A 3WY4A 5JIIA 2A6KA 3D4CA 2NDFA 1XEDA 1E4JA 5D4JA 5ID0A 4MVBD 4TVPE 2HVKB 1Z1WA 4D3CL 2VDRH 3U9WA 1K8DA 2F7PA 5DJZA 3WXWH 4QYAA 3BPNC 3R4DA 1CBJA 3UTSD 5HYEA 2WLJA 3OG6B 1W2KT 2DWDB 4DVRL 15C8L 3MTXA 2NZ1A 1KEGH 3P4MB 4K2UL 1YQ2A 2EDRA 1IGYB 2EKJA 5I15H 4BFIB 5ISZB 2GG1A 4APQD 3HN3A 5D2LA 2PR4L 3QHFL 5GGQH 5DQ9A 3D12B 1HXYB 3F84A 4HFWA 1T20B 3VX0A 4H0HB 1WAAA 2EDMA 4WTZA 1KUMA 5AZEH 1JSYA 2ZUWA 3X3FH 5EOCL 1ZPLA 4MQTB 1RCYA 2MJWA 4I2XA 1E7UA 1S46A 3CX5J 3L54A 2KZWA 1VGEH 3S6CA 1OHQA 5D7IB 2B1AH 2CSPA 4M7ZC 5JPMB 3JV4B 1TJMA 3QRGL 4WSKA 4F33B 5BW7A 5H35B 4PJCF 3VAEA 3QS2A 4S1SH 5EZIL 2BVUA 2F54E 3AREA 3Q44A 1K6QL 1DSFL 3QUYD 4UMSA 2Y07L 2WD0A 3IS0X 1V7ML 1BJMA 5I1LB 1IL1A 2GSIA 3HC2A 4JX0A 2P49B 2VLJA 3UYRL 1E2VA 3IDUA 3QT2A 4P06A 5L2KB 1QLFA 1M6OA 4M61B 3MOBH 1YNLH 2VAJA 3STLB 1HQ4B 4DW2L 4P2OD 1IGML 1HHGA 1UB5A 2EVGA 1XH2A 4G8GE 4UIKH 4X6CB 5CO1A 3RVWD 1NBYA 4PQXA 4CJ1A 3EH2A 3LNFA 5HHXH 3N5AA 1ANUA 2QKIC 4EN3A 3TONA 3QXDB 3UBXI 3U36B 3NZSA 3M07A 3W37A 3MRDA 4R26L 1GSKA 3SQBB 2WGXA 2QADD 4CMMB 4UIMB 3HBQA 1IEHA 2UYLA 4L8CB 2PR4H 2NLJB 3QDJA 3QHFH 4HZAA 4R9HA 2KERA 2OM5A 3MBXH 2EDNA 3MBEB 4U6VH 4JZJC 3K8MA 1YMMB 3V9CA 5JHBA 3BPOC 4K3DH 1AHWA 2WNKA 3QCVH 4DPRA 2WK2A 4FLQA 3CH1A 3QJZA 4OT1H 4G83A 4GQZA 5ITBH 5T5FL 4HUWB 3CMOH 4WU7B 4A7UA 1H6TA 3C12A 4JM2A 5C0BA 1J0IA 1NCIA 1MZYA 4JHWH 4XN4A 2DWSA 5EN2A 4RBPK 4TUOB 5T33H 3QYCA 4OH2A 4F9LC 4UOW0 1A6PA 3NRPA 3BGFB 1A6UL 4A6YA 3D85D 4QHPA 5I6LA 4PJAE 5DA0B 4OJCA 1MW0A 1DBKL 4RDQG 2AZUA 4OCSL 2YRPA 2CUIA 2DH3A 4FQQA 2V2XB 4JFXB 4NB7A 4I88A 4PVBA 1BVNP 2JJTC 1CF8L 4X7EC 1KC5H 4IRZL 4E9LA 3DVIA 1E0OB 4P46B 4BQ9A 2FB4H 4AIZB 3M46A 2H7WA 4A2GA 4Z9KB 1KDJA 3L4TA 1B0IA 3RY6C 4KTYA 3O3UN 4FXTA 3ZXAC 2YUZA 5FCUL 1CGVA 4C56D 3NP4A 4N0UB 4Y2OB 2R2HB 4J3WA 5IB3A 4ODSH 3FUMA 5HGGS 3NA9L 4MA1B 1RHHA 1BBJB 4JZNA 5D7LA 1TQUA 1K8DB 3N40P 2J43A 4YZWA 2WAHA 1K2DB 3NACH 4JHUA 1TZAA 1TJHH 4XMKL 4HS8H 3A67L 2YWZA 3HG3A 3L3GB 2HLAA 2QQKH 1CGUA 4Z7VF 1FVEA 4GXUN 2WINA 3RVXD 5BOJA 1CE6B 3QPKA 2XPYA 4YHLH 1EJ8A 3H0TB 1JGIA 3FC8A 5CXPA 4M7JL 1F56A 2F8XC 1SXAA 4AI7A 1HXYA 3LRHA 3U9UB 5JZ7D 2C1OA 4TLUA 2AMUA 1BXUA 5E8PA 2VXVL 5GS0L 1B4LA 3PHAA 2BM3A 2BP8A 2YRZA 3H55A 4IGBC 1U8LB 4NFDA 2ARJQ 2E9JA 1EEQA 2UZYA 4H0GA 2CHXA 2OR9L 3U6XS 5JPMA 3BEVB 5I2IA 2C4XA 5GZOD 2CLRA 5F7MC 4LVHC 3MU3A 3OF6A 4LCWE 1FF5A 5E2VH 3T4AA 5HYJE 2EINB 1JCVA 1WHPA 4MDRA 4GRMB 4LF3A 5D1ZA 4TNVK 5F44A 2NXYB 5D7SH 4MXWL 3DVNA 4LGRB 4XNUH 4OJYA 5EU6E 1RUAL 4WI4A 2C9VA 2XA3A 2QTEA 3IGFA 5FOJA 4GUCA 2OSYA 4Y1SA 5IHLB 3D5OF 1K4DA 1WFTA 4ZMAT 1E4XH 3FTZA 3HE7C 5KSBF 1KXVC 1NIDA 5LBSH 1YQVL 3IETA 1ADWA 1RK0A 3NCYP 4JKPH 3ZL1A 4CVZA 1C5BH 2VWEE 1R75A 4X8JA 4WK2B 5DD6A 5IVZA 2R2BB 2NW2A 3AACA 5D1XC 3V4PA 3SKOA 3SQBA 5HHMD 2PPCA 1M05A 2EE3A 3MO1B 4QJ5B 3RIKA 1IZKA 3IJEB 4WO4B 1UYWH 4I2XE 4HKBA 4IEFB 3V55A 3BSZA 3OXRA 4HUXB 4JUTA 3S35X 1H3GA 3U83A 2ZX6A 3EHBD 2D2CC 2AVGA 3RBSA 4KWUA 4X9HA 3MR9A 4IIQB 2P7TB 3FUNA 1OCWL 2VRAA 3CDGA 4YH6A 3U0WH 3S4SA 3KYKL 3SKNA 3DHUA 4XOAA 3K8KA 2WQRA 4WUUD 5HP5A 3FJTA 2R2EB 3H56A 4JY6B 4KUCF 4U1HB 4ZODA 4DIXA 2NQ3A 3CHXA 2EIBA 5EN2B 2QSQA 3OM3B 1BFTA 4A67A 4UT6H 4DEWA 1UM4H 1AAJA 5PCYA 2YD0A 3V0WL 3V95A 3TNNA 2FEJA 5A3ID 3KPNA 4N90E 1G9EA 1GMIA 1T4KB 2CPUA 3D3VE 3S37L 1EJOH 2V9TA 2XX0A 5AAMA 2YAQA 1EHKB 3T3PF 4FQCH 1ZDQA 4JREB 2WW8A 2AKRB 3R18A 4EDXB 1T7ZA 2VZ1A 4K3DL 3TO4A 2ZWSA 3BDYL 2X4QB 3PWJB 3VXUE 1G9NH 1OT4A 4AQ1C 4M3KB 1RD6A 2K7QA 2CK0L 2ADGA 5J6HA 1W8EA 5H8DA 3LHPL 1Q9LA 5MEND 1HEJC 4ISVA 4Q8BA 1N2RA 4XCNB 4AYDC 1S7QB 5ACZB 3GGWA 4LHUA 1V3LA 3SE4A 2DQGL 4MNQB 4AYMC 1QSFE 3T0EB 4J28A 5HHOB 1DJYA 4PW4A 1N8ZA 5DWPA 1IM3B 2F2HA 2X4RB 4FZ8H 5DDHA 4UTAA 3LPOA 3EZ8A 2C26A 3MNDA 3VQMA 2AK4B 4K07A 5JW4R 2CBPA 4FYQA 3WS3A 1N0XH 1A0QL 2OTWB 1L3WA 3O6FC 2GW5A 4WI3A 1WAEA 4RETB 4FFZA 4JR9H 1PJWA 4HQQH 3OC8A 1HILA 4DERA 2Y22A 3QZMA 2YD5A 4JHZA 5AYUL 4BCXA 5CLWA 3AJ7A 3RVUD 5T1KB 1UH2A 3U7YL 3RDTB 3G6JA 3HIZA 1QLEB 4AQOA 1RVFH 2I07B 3B7RL 4R6UA 1UACL 2EYTA 4YHPA 1TQVA 1G7PA 2HUHA 3F00A 2ZCHL 4PJGB 2NT0A 2O5XL 4AV4A 3KLSA 4ZPVA 4TUKL 4O00A 1VGEL 4HMCA 2UZYB 2OL3L 3HE7B 1NWOA 2PCPA 4UIKL 1H15A 4WY7L 5CEYA 2D9CA 4Q6IA 4WIQA 2L0DA 3VTAA 5G2NA 5IT2H 1VERA 4OJEH 2V8MA 1VFUA 3GUFA 1HXMA 4WSJA 2XWTA 4OCWL 3UACA 5F7YC 5F1OB 4OD1L 1ADQH 4L4VE 1VFAB 5I1IL 1BZ7B 3SBWC 3NG5A 5JQIB 4LCWA 1RJLB 1AIFA 1K4DB 1BJ8A 4ZTOH 1R24A 3L95B 3SZKC 1I3RA 1LE5A 4JFED 2P28B 3DRQB 1RK0B 3QEUA 2QL1A 3UAEA 2P8PB 1KCSH 1XX9C 1QATA 2IMNA 4ZW3A 2DQGH 3V4PB 3DSNB 3F58H 3FU7A 3DDFA 3MNVB 2ORBL 3ZGHA 3B3BA 4U2ZA 1XSOA 1CFVH 1Z5LA 2WVVA 5GGQL 3KYOB 4PG9A 3MLSH 3KEDA 5I15L 3O8XC 1HKLH 2WBKA 1MFVA 2VAAB 4GIPD 4M1CC 4LLQA 3RNQB 2P7TA 2XIBA 4FFTA 4MQ7B 4DP9X 5L8JB 1EHLL 1VZIA 3OAUH 1EJOL 2FE0A 4JFSA 1JWUA 3QDMD 1FNGA 2VDMH 4UQCA 4H8PA 1EBAA 3PQYD 1RMFH 2B20A 2VCOA 3FTVA 1G5GA 4F2FA 1IU1A 1MCCA 1H3PL 1XGUB 5GSRB 1WGVA 4RMUA 2NY1C 3WNKA 4ANKA 2VO8A 4ONGH 2AJSH 3L7EA 3RIFK 4B9CA 1DQLL 1TG8A 1XIWB 2NCMA 3WHE1 2DQUH 3NT0A 1RZJL 2XN9B 1GZQB 4OM1L 2WCPA 3BKJH 3JV5A 4NQDA 2H6UA 4GPVA 5D1QA 5HHPB 3E6HA 3L3OA 1J9RA 1ETJA 5E8OB 4KKCD 4HUKB 3IAQA 3T6ZA 2GBTA 3THMH 5AW2B 3A6OA 3PWJA 2V8LA 2F7RA 1JGDB 1MN4A 2OJ1A 3WEBA 4DAGH 1ZWIA 1JZGA 5J6HB 5F7LB 1P7QA 4ATWA 1KGCE 3UAJA 1SJHB 1YEFH 2GJ6B 4XZUA 1KENL 2X7LB 4QGYA 5FW8A 3EDDA 3N1FC 1XR9A 5FIEA 4BCYA 2X2JA 1CL7L 3CU1A 5I18H 1UFGA 4XCCL 1MQ8A 1KT2B 2YD6A 5DDHB 1OV8A 1SXCA 1ACYL 5I76B 5DJCB 4LGSB 1S9KC 1FG2B 4J4PA 3KCPB 2R0ZL 4ZFOA 2X3CA 3QAZB 4KPHH 4P2AA 4WQOA 4N0YH 1A66A 3IN0A 4LIQH 5B39B 1Y0LA 4MKMA 3O4LB 1FN4B 1QFPA 2FATH 4MXVE 2CKBA 1UADC 2N4IA 5M95B 5T1KA 3VI4F 2EACA 2XV0A 4NDMA 1MFCH 1RSFA 1PZDA 1UZGA 1YECL 3RDTA 5JIDA 5EEZA 3MRCA 1BV8A 2BNQD 2VH5L 4WK0B 1IFHL 4AYSA 2VZVA 2QLVB 4YHPB 1G0YR 1XXFC 1U8MB 3JWNG 3D1MC 4R7XA 4DPBX 1TVHA 2Q86B 4WEBH 2QADC 5K69A 4MBOA 4NCC1 1T2JA 2XTJC 2EECA 5EDSA 4ZFGH 2CO3A 4PH8A 4XXDA 1AGDB 1H9VA 4AWJC 2Y5EA 5F9AC 4P4KD 5JMRA 3QC6X 3K71A 4IJ3C 5EA0H 4MHHG 3QK0A 1EK3A 4UOJA 2V9RA 1JK9B 1HWWA 2CKBL 2J8OA 2UZXB 1XF3B 5BS0D 2GTZB 2OZ4A 1BD2B 3TBSB 1VFAA 3VB8A 1LP9F 3LJ3A 1R3KA 5J9PA 2FR4B 5J13B 4ONHB 2GEEA 4L5FE 5B4MD 6PCYA 2Z6FA 5AOJA 4GMSL 4AJ0A 1PD6A 5LGHH 4DP4X 1AIFB 1H0DA 3HRPA 2AXWA 3FUIA 1W6LA 1SUJA 2CR0A 1Q0YH 4E5XA 4MXQC 4C54A 3T65B 4GFTB 5I6XB 2AERT 2EDWA 3VA6A 4NZUH 1U8JA 5DHMC 1A7NH 3SO5A 4CC0A 3FB7B 4AV0A 3WDIA 5EBLB 2VLKB 2AABH 4HIIB 1OGAD 1Z5LB 1I8MA 5CBAA 1OOWA 3BSGA 2ZYSA 3V10A 3MFGB 2RH0A 1Q94B 5DGQA 1OCRB 1RK1B 2NUPB 3TA3D 4WW2A 2VGLM 3CSPA 1DUZB 3FQUB 1R17A 2X3AA 3HS8A 4PRNA 4XP9H 3V9EA 3VD7A 4Y5VA 2WCGA 5CLTA 3RNQA 4YDMA 5IFAH 4QY8B 4JN2B 4RIRB 5J56B 3E8UH 3O2DL 1R46A 4E68A 3FTSA 4AGQA 4E9VA 4DOHB 3OKMA 1MCIA 3HTLX 2HH0H 5GSRA 8PAZA 3UGUA 1JTOA 4U33A 3UPCA 5D72L 2BRRH 5T33L 3MYZA 5F96L 2WQSA 4PJAB 1QRND 1H8LA 5HHPA 3E6HB 3L3OB 5IQ7H 1SHWA 2TSAA 3N0AA 1G7IA 1MLBA 4J3OC 4OGZA 3V8CA 1AACA 3H2QA 5DHEA 2R59A 5CWSA 3QCVL 3V5KA 5IFJB 4J3UA 1A02N 4IRSD 3DV4B 3AB0C 3TCLB 4BK5C 3U48A 4I9WE 4KTDH 3LZPA 3BN9C 1NJ9A 1NMBH 2GITB 4MNHB 3VYPA 1P7QB 2D7TH 3AGVA 2Q3ZA 4YPGB 1MY5A 1FFRA 3F7LA 4NAQA 4WFGE 3JWNE 3L4CA 2QVFB 4N86A 4TSCL 3U7AA 2F9BT 4M1GL 3DOSB 4AQ8A 4YBLC 5A6MA 4JM4L 3KLDA 4L05A 2D31B 4YJZL 2YAPA 4J3VA 1JRHH 4LSRL 4LVNB 1MCPL 3LKPA 5EH1A 1YYLH 3TT3L 4CILA 4OV5A 4CNIB 3BCFA 3IDGB 1JZFA 3KCPA 1N7MH 1NA8A 4BH8B 5C0NC 1AXSA 2VLRD 4KKCC 4FTVE 1KYUA 1T7WA 5E2TL 1A7PL 2EP6A 1EA9C 3O4LA 4JG5A 1FN4A 1A7PH 3GSUA 2DY2A 1CDYA 3QDJE 2P8MB 4K15A 3QQNA 4PJ5D 4ELMF 1PZ5A 1N0XL 5I75C 1UT1A 4K5PA 5EWIL 3B56A 1YYLL 3TT3H 4HJIA 4BFFA 4RFEB 4ZAKC 2BX5A 1EQWA 5L88L 1CDUA 5H94A 3HZ3A 1MCLA 2OYLA 5F96H 2ERJB 4AENA 4DN3H 1AO7A 1U9KA 1IKOP 1QNZL 2WXFA 4Z18A 4M7KH 3Q06A 5D6CA 4HIEB 2EXWC 1A1OB 5I1EL 1KWKA 4NX0A 2WLLA 3QORD 4PGEA 2BSEA 3QJXA 3ZYZA 4OM0H 2QHRL 3P4OB 3PP4H 1JYXA 2TSBA 1JNLH 3GMPA 4W9ZA 1S78C 4QXVA 1ID5I 3WJJC 4EZMA 3L7FB 1B4JL 5EV7A 1JK9A 3DYPA 1PD0A 1JWMB 5CHNA 3RL1A 3LN5B 1SN5A 4GQ9L 2DTSA 3WKYA 1OZTG 4DPCX 3LS5L 5EIVA 3TBSA 4FQCL 4KFZC 5G5DB 2PYFB 4ZX4A 1BVZA 3IMRA 1A4BA 4MMZB 3RTQA 4LSSL 5K93A 5GPRA 1XGRA 2WC7A 1CURA 1EH9A 5F9OL 1V7NH 4JDEB 4C4BA 4HWBL 1MHHB 4OZ4B 2ZE0A 5ISZE 3N04A 1X5AA 4PI0A 4P2YA 2VXSL 5EOQH 3UZVA 2JVUA 5GRXG 2VUOA 1HEHC 4WFEE 5H37G 3TZVD 2YGOA 2AW2A 3WFCH 3K6NA 2XV2A 4GUPB 3CBRA 4QTIH 2VLKA 1LVEA 2BSTA 4X9BA 3SDAB 4DHLA 4UB0L 4DZ8B 3G6JF 4ZNCD 1I8MB 1D7FA 4JRXA 1OLZA 1DZ0A 4ZUWA 2FQFA 4HF5L 4CU7A 4GEJA 1UOLA 4PRNB 3ARFD 4RNRA 1JHLH 4NQED 1SMDA 1RH8A 1CTNA 4N2KA 4JANB 4AT6A 4QY8A 4GG6F 4X4XB 3ZUCA 2XZCL 3IYLW 1WV7T 2DJMA 3ZN6A 4DQAA 2B7DT 3K3QA 3S8FB 2VUKA 4D9LH 1K5NA 1SYVB 3AU0A 1I7ZB 3CN1A 4ECNA 2EDXA 2DQTL 3ZGIA 3SOBL 1N8OE 3C5SA 2EC9U 4KV5F 3V4UL 1IAKA 2DBJA 1U30A 1CR9L 4Q97A 4NUQA 3SYCA 5F7HA 6PAZA 3MV8D 4WJG3 5K9QG 4K94H 3GXDA 2PKDA 4AUYA 5GGUA 3X1EA 5BQDA 1WS8A 2QELA 5HYFA 3CLEH 4JKMA 2IH3A 3ILEA 2CLVB 2Q7YB 1LTXA 4KO7A 1ZLWH 3T1WA 5AZUA 2EE6A 5CWSB 1P2CA 3F12B 1TUPA 3MLRL 3BSZL 4NZFA 2DQIL 2Z93A 1IC0A 2H0EA 4QOKB 5A2CA 2GITA 4X7DC 4BFNA 4K7PY 2C3VB 1R3IL 1C7TA 3W2DL 1W16A 3EGDB 2EIMB 2KPWA 2NSXA 4KX7A 5C7XL 4Z6AT 4GG6E 2AAAA 2WKLA 5IJVA 4F9PA 2EUWA 1QFWH 1K8IA 3EYUL 3TYFB 4QF1A 2EVHA 4JKNA 1DP0A 2R1WA 2RR3A 3FCTB 1AFVL 4XMPL 4L9LA 4RZKA 1OGAE 4YDLC 3SPIA 3IDMB 4PJGF 5D7IF 2DW5A 1KENH 1JIBA 3PS6A 5GS2H 3NSDA 2EUVA 1T21A 1TZIA 3ZTDC 1PVHA 1DVFB 2IADB 5KS9A 4K8RC 1HCVA 2RACA 3W56A 1M7XA 3K81A 2QV4A 2D0HA 5AZ2H 3DARA 1GCFA 4FQXC 4LCIL 4LEEA 5J13C 5E5UB 3WEXB 5CD3B 1RFDH 3DHMA 1C16B 4XVSL 1WCBA 4ZT1A 5ENWA 4APQA 1OD9A 5E8DH 3U30C 1SDAB 5B1JC 4XMKH 2H8PA 5DYFA 4BUHA 2K8QA 4TLSA 2CGRH 4R5VA 3SHSA 1EZVX 2BS71 2DQUL 1QUNA 5I73C 3PY9A 2JIXB 4ODSL 4W70A 5BJTA 3LPWA 4PJXF 4XAKE 4IOIA 3WU1A 3EH1A 1QRNE 4HIEA 4JFUA 4WHYG 4EN3C 5K9JH 4LNRB 1JVOA 1YEFL 1IAIM 5KVDL 3IWUA 3MV11 5KVEH 1ZV9A 4D9LL 1HJCA 2G0KA 2I9LA 3C9NA 4JQIA 5D4QA 3ARED 1WTLA 1DLFH 3K6OA 4H8WC 5C0AE 4PWGA 2ZKHH 3PJLA 4LK4A 1YEIL 4OCSH 4DQOH 2XZQH 4X5RA 2PYFA 1MCOH 4E5XG 1IQWH 4OSUH 3J27A 4BZYA 4KAQL 5C6TH 3MOQA 2QVIA 5C0BE 4L18A 1MCBA 3L5XH 3W57A 3LHAA 3F58L 2VQ1A 1NWPA 4DGWC 1FNSH 4L29A 4JLRB 3MLTB 2HAZA 5F7EL 3ULSA 5IBUB 1JN6B 5SWSA 2M8XA 1VCBC 4HETA 1GHFH 1NCBH 3ZDZE 4WZ9A 4M6MH 5TE4L 2AK1H 1HN1A 3CFUA 3VRIA 3SYQA 4W9GC 2E9WA 3Q8BA 5IMMA 3UJTL 3AB0B 3QDJD 1FIGL 4UWQB 3DIDA 2NYYC 2UY7B 2D3NA 4FFVD 4HK3J 5IVXB 2DLTA 1BLIA 5AVSB 4M3JA 1FZKA 3LS5H 2A99A 3CDFA 5SX5H 4F5CE 3BZDA 1JJUA 5IROD 4EKXA 4ZW5A 2HVBA 2Y72A 4X4XA 3MLYL 4NP4H 4LCVA 4HGWB 1MAJA 1NGQH 1SJMA 3EYSH 3O0RL 4GSRA 4TQEH 4XN7A 5FA4A 1F0LA 5TF0A 3H9SB 2YSSB 1K5NB 5F72S 3VRLE 1T20A 3SB3A 5MEOB 4OFDA 1U8PA 4GG6A 4K71C 1JVKA 3ME0A 5I1CL 1F41A 1IAMA 1F3DJ 2WUCH 3WO4B 1BMZA 4DN3L 2ARJA 1O9VA 5FF6B 4DW2H 2XN9D 2W0FB 3ZTJG 2L8AA 5FGBC 3MV9E 1FZOA 5LBSA 4H0IA 3MFFB 3NN8A 2IH3B 2WNGA 4DP2X 4QTHB 1KGWA 3UP6A 2GC4C 4QRTB 1FSKC 1P7HL 1A64A 2XQYA 3ZKMC 1AKJD 2WXGA 2WTRB 4MLSA 3CFCH 4PJFA 4GI6A 1HZHL 1DBJL 2WBWB 4NC2B 5AFAA 1IGTA 3ES6A 1G9MC 2VKWA 1WPCA 2YQBA 1AQMA 4GAJH 4MAUL 4F8PA 1IGIL 2ARWA 5AB1A 3WFDH 1YEDB 2K45A 1AXTH 4EE2A 1FAKT 4L3CB 2C9AA 1BQHA 2VDKL 2ICWJ 4LIQE 4RH4A 3FOLA 2JXMB 5E95B 2F54D 2O5XH 1DL7L 3AUVA 5JHDE 4LAJH 4OY9A 1XWVA 5LNEA 4QRAA 5CIPB 5CGTA 1ZY9A 2CD0A 3HAEA 1QABA 3KL3A 5B3SB 5IM7A 2UUDH 3OLIA 4BRVA 1T21B 4EN3B 4R7NB 2X4NB 1VACA 4IHBA 4L48A 5IK3A 2ZAHA 2FQEA 4NQEE 3FU0A 3MRDB 4DGVH 2FVNA 1IVTA 3D50A 4LARL 3VA2C 4XBPB 4FKEA 4TS6A 1CICD 3QDJB 4LASH 3BIAX 4QWWC 4D0DA 2NDGA 1XB6A 3MV7A 4FN0A 3WXWL 1CXKA 2XVLA 1HL9A 4WDIB 4XP4L 2ENSA 1UUSA 2F53D 2B1OA 2VLLA 1I8AA 5GRJL 1O5DT 5MERB 4FNLL 4PV8B 3VGHA 5LUMA 3JT2A 3TO2A 4XP5L 1E5AA 1QX1A 2DQEL 1NCDH 4WU7A 1LMKA 1UATA 4K23H 3LRSB 5FO2A 3UO8B 4J8RB 4PBWD 1DSYA 3BVTA 5LDUA 4N0CC 5GZOA 4HALA 1G94A 4Y4HA 3RVXC 5E2WL 4HLJA 3DMMC 1BAFH 3EDJA 2BFVH 3T2NL 3D07A 2YKLL 1D5ZA 3DUSB 5IB2A 4QHLA 1SF5A 4WWKC 1T83C 1CXIA 4NWUL 3WJLC 2FX7L 4LLMB 3CDYA 4L3ED 3WTVA 3SDXB 5E00A 1L7IH 2NR6C 1NBZA 4HHAB 2VL4A 3KPLB 3ELQA 3I3EA 4NAJA 3VVVA 3D4GA 3QZWG 3ARFC 1FVDA 1YMHB 25C8L 4A6YH 4U1MB 4JGUA 1Q0YL 4I9WD 5I9QC 4BXSV 1OTTD 3FFDA 4N0UA 3CFNA 3GSWA 3EJRA 3HI1B 2HFGL 4GO8A 5T3XL 3JV6B 3UTTD 3VXUB 4KJQC 1ZOXA 1U21A 4A7VA 4Z76A 2A5UA 3S0PA 5AB9A 4IRSC 3E38A 1RHHB 3U7WH 5TPWH 3VD5A 1UXMA 2F8VA 1S3KL 4JZNB 5D7LB 5IMMB 3QFJA 1CDHA 3BP6B 4MBRA 2K9FB 3L3GA 4M8VA 1TVBA 1DN0B 5F1KC 3IAPA 2WINB 4HC1L 1CE6A 4YSOA 2Z7YA 5D1ZI 2P24A 1FFPB 2X42A 4FQLH 4L1SA 3PXLA 5AVXB 3V6ZB 3LRKA 2X6VA 2CRZA 3IGLA 1DBBH 2YSSA 3WG7B 5D1XB 3MRPB 4F7PA 1FCCA 3ZDWA 3ME0B 5GJSH 4NO0D 3WN5A 5C7XH 1QR1B 1E4XL 4JQXC 1MNNA 2R4RH 1A3RL 2Y1ZA 1OAYH 3GKWH 3OMIB 2DF3A 2JKNA 4FQLL 2OMTB 2CUAA 4J2QA 3CC5A 3FN9A 4LRIA 2JV6A 3TVMD 1NCHA 2CLRB 3RWHA 2FRGP 2YO3A 2WTRA 3PYCA 1KIPB 4KDVA 3H9SE 1NAKH 5CJQH 5D2NA 2HT3C 5DA4A 2OMXA 1JDCA 3CLEL 4UOZA 5I73B 3WKQA 1MWAH 2P3YA 3KPMA 2N7BA 4ZO8A 3JUYA 4AXWB 1AO7E 4QMEA 1E9QB 2DDQH 4Y7OC 5T3XH 1J0ZA 5DMKA 3VD4A 3I3BA 1T2QH 4PJ7B 2N59A 3ERXA 1C5DB 3BQUC 1N10A 4PJ9D 2FO8A 1E9OB 3N6YA 2YK1L 3CWGA 4MAZA 4PJIB 4C4KT 2GBAA 2BOCA 4HIJA 4YDVB 4GI9A 3QXAA 1BQRA 1CXLA 4LU5H 2GIXA 2CZNA 5KBLA 2VR3A 3SJVD 3AGWA 3DPDA 2IJ0C 3BAXA 4WFFD 1NMAL 2C3HA 2FB4L 1A3QA 2G4GA 2OZNA 2W95A 3QUZD 4E42A 3FT9A 3Q8EA 4HKBB 4IEFA 4A2EA 1DQQA 1ZK9A 4D0DB 8CGTA 3A67H 3BWUC 1FGVH 3WLWD 3VO0A 1BG1A 4F8TA 4MD5A 4P99A 5MP6H 3MR9B 4IIQA 5E2WH 3WNJA 4F37K 5MERA 5D71H 3PHOB 5DEFB 3TO2B 1SOXA 5IHWA 1MFDH 2MCPH 1OW0A 4NT6A 3C5ZC 4JFDD 2XYBA 3WOVA 4AQ8C 2F7IA 1QP1A 4FFZL 4YHZH 5IROC 2X41A 5FA3B 2DMKA 3FL7A 2Q2LA 2X4OA 1D7CA 4NJ9H 3TF4A 3UYOD 3KDMA 3WS6C 4M6NH 5CJOL 4I0PC 1RKRA 4E9RA 1QRNB 1KIUB 2EADA 2WUBL 3QJFB 5IHHA 3C8HA 4U1KA 1D5ZB 3DUSA 4QHLB 1N3NB 1CT8B 1KBKA 2LW3A 5MEQA 3OHXA 4MS8C 3FT1A 2X4QA 4N8PA 3SDXA 4EEEA 3FQXB 5E00B 4Z7WE 1U2HA 3KLHD 4XP1H 4ZOEA 3VD3A 3LQMA 4QWWD 2E6QA 3MRNA 2BSRB 3AY4C 1Q9LB 3NCJL 4JFEA 3ZIYA 3CCHB 1JFQH 4IDJH 2Y1YA 4JPQA 3GGWB 4NOFA 3IS1X 5HHXL 3T0VA 4L1DA 5AG8A 2R9HC 4MNQA 5A2AA 3STZB 3IPFA 2J25A 1IGMH 2ZP9A 4MMXC 4KH2A 2P52A 2AQ1A 1OGAB 1ZKAA 1MFAH 2WVUA 3G04A 3LSOA 4MAUH 3MDJA 3U6RA 1I8IA 3NIDB 3GRWH 2CM6A 4PMFA 3WS3B 1SFHA 4AKQA 5IB4B 4Q14A 1SJEA 3WFEL 3B9KB 2YEZA 2X9WA 3BKYH 1PX8A 3CU7A 1HILB 1IT9L 1FG9C 2MCAA 2R0WH 2GFBB 4JFYB 3VXOA 1JPST 4GSDH 4PRPD 3G6JB 1V3JA 4KKRA 5DLML 3KBEA 3MLUL 3QORB 2PPAA 1FC2D 4HS3B 5D1XD 5I1CH 3QEGL 4X4ZA 1N64H 2UX6A 5E24E 1G7PB 5ICZA 2VDKH 4PJGA 5SX5K 2I85A 3VX1A 5BMFH 3C8KA 4WNQB 2VMCA 3HKZA 1OSZA 4AGLA 3KVPA 4FQXD 3HC3L 3EYSL 4XPFH 5D1QD 1FC1A 2PCPB 1M1XB 2HJFA 3KS0H 4G8FB 5E6IB 4F7KA 3TEYA 1CDGA 4HJJL 4M5ZL 3U2SB 1FH5H 4KKQA 5LG1A 3UZQA 2J8UF 1OAZH 2IG2L 2Q2EB 2ATPB 5BW7C 4DK5A 3JWOL 5FGRA 1JWSA 1YO4A 2XN9E 2A9AA 2CRYA 4LSQH 3VACA 1EGJA 4H40A 1D6EB 3V4PH 4Q9BA 5F9JB 3VQ1C 4JB9L 4MAYA 1BMGA 1WCQA 1UA6L 1J5OH 2GVYA 3K91A 4EI6A 2PWHA 3SCMA 5GZND 2ZXQA 3V5HB 3A6CH 1S7TB 2VXUH 1GGIL 3V79C 2QGEA 5EUKA 5ABZA 4I77L 2BY2A 1MCNA 2JKTM 3EOTL 3ZT6A 2CRIA 1FHGA 2AQRA 3S4SG 3WIHH 3KYOA 4PG9B 3RGBA 5DYOB 1FIGH 1OSPL 3S7GA 1DQQB 2XBTA 3X14B 1CG9B 1F1DA 4O4YL 5T8IA 1WSST 5KYWB 1SVZA 2AI0H 1CD9B 1EANA 3ZR6A 3RL2A 1BJ1J 1G9HA 3GPSA 4MJIA 2PPEA 4JRYA 1SM3H 2CHZA 2ZNWA 3HG1A 4JFEE 2DH2A 3FUEA 3DX9B 3SGEI 4AYID 4LVEA 2CXGA 3FQWA 3GHEH 4LLYB 5FA3A 1PY9A 1X7SA 1YEGH 2HLFC 3BP4B 3H2PA 1XCQB 2BVOB 4ENED 4ZMTA 2LGNA 4B9ZA 4TTGA 3KDMB 4GXFA 4BKTC 5C0JB 3KYKH 1AMYA 4O58L 3T1FB 1GZHC 5DMYA 2QSCL 2CJSA 2CKBH 5E5LA 3HAEH 1UUNA 3GO1L 4POZD 1TCRA 3CFIC 3VWJB 3T0ED 3BPLC 4QR7A 1GY1A 4U3XA 1FLRH 2CO4A 3FQXA 2LAAA 3L2LA 4M5YH 2UVEA 1MCQA 3IKCA 4L37B 2FH8A 5IOKA 2SODB 3EYVB 2APSA 2KLTA 1MEXL 4LO9A 4N0CD 4JFEB 1AFVH 1I1YB 2GQHA 2E7DA 3N41F 5CINL 4KO6A 4HKJB 4G8IB 4M62L 4XZUB 1E67A 2Z4TA 3NP3A 3T3MF 4LL1A 4OGAD 1FE8L 3BEWB 3OAZK 5HYJB 3HC4L 4UI2A 5C0RH 1NCWL 1OGAA 1NFDB 3AT9A 5KUKA 5DQ9B 4D9RE 5CJXC 1FG2A 4W9HC 3TA3A 5CCKH 1MG2C 4K5MA 1A2YB 3DIFB 1KXQA 4DH2A 5KJ7E 5B39A 1UM6H 3LB6C 1QFUL 3QRLA 1JZ6A 3VD9A 4CBZA 4I2XB 5F9WC 2XPZA 1X9LA 4JFYA 4ELKA 1WWAX 2ITDA 3WDJA 3N9GL 1N5AA 2F0CA 4OZHB 1M6UA 4F33A 2OR9H 3CFQA 5DVLA 3AWGA 1RP9A 3CSFA 1U8MA 3F7RA 2BP0A 2AXJA 3L5IA 2BIMA 4KO5A 4NNPH 2V5MA 4GKZB 2J5WA 1NGYA 3VGBA 3VI3B 3V0GA 3SOTA 3FU9A 4RZCB 5I1LA 2DAVA 3LKOB 5DD1L 5EBWA 3GO1H 5D2NE 3P2DA 2ZXDA 2DTML 3BAYA 1ZA6B 5BZZA 5KSAC 3D2UB 2P5ED 4PCTA 3QZNA 4R4ND 4TNVF 1CXEA 3BC9A 4NQCA 4CKQA 5BV7C 2IH9A 4QD2E 1S9XA 2YXFA 1OGPA 2ZWLT 1TJHL 3BGMB 4OBRA 3HNTH 4HW6A 5FAAA 3QXDA 1DQLH 1MY7A 5JDSB 3MRKA 4FHKA 2DD8L 2QGDA 4IRJC 4MAYB 4PJBA 1CU4L 3K6SA 1Q1JL 1PNCA 5DURB 5C0IA 1RSYA 1NCGA 4UIMA 4AK1A 1IEAB 3L3OC 1JP5A 1HE8A 1JGUL 2DV6A 2XPGA 4HIXH 1S7TA 5F71A 4IS6A 3G9AB 3VFUB 3VQ2C 2V6HA 5D7KE 3QIBD 4J1UA 4WEUD 4LSUL 3LY6A 4JPKL 1CI3M 3CH1B 2CDFA 3C6EA 3IPBA 2OK0H 4Y16C 4JGMA 4OCLC 3DDGA 4HIIA 3JZYA 3GZPA 5FC9A 4KMQA 4PBDA 4BRJA 4AYFA 3ZDXF 1SOKA 4PS3A 3FQUA 1S7SB 4CVUA 1JNLL 4JM0A 2ZJSL 3DC0A 1P4BL 2HG0A 4MJIB 4JN2A 4RIRA 1YC8A 5LNGA 3KL0A 1ODUA 4U1JB 1BG9A 1IMHC 3OKMB 2W1NA 3SPCA 4G6KH 3O45A 4FQQB 1QWUA 2DQMA 3T2PA 2QKIB 2BZ7A 3TBWB 3P3UA 3ZTNH 2BFGA 3AABA 2KL6A 4AIZA 5ITBL 2E8YA 2NW3B 2KQNA 3FO2A 3WLWC 4M6OL 2YQGA 2EH8H 5ACMA 3TFBA 1MI5B 4OCRL 4U7SA 1SOQA 3S36H 3RGVD 4N2FA 1W0YT 3PGDA 4UINL 3ZMRA 3O9WD 2A77H 4KMLB 1SMOA 1LO0H 5D7HA 4JZJB 4BE6A 5HYQB 4ZS6C 3ZL2A 1N7ML 4M8QA 2R2HA 4O58H 5IB3B 4JFOA 3U1SH 4E9SA 2GK0B 2JB6B 2NY6C 2Y9RT 1V55B 3EYVA 5AAMC 1NEPA 5KW9L 3GI8H 2I5YH 2JF1A 4D2NA 1K2DA 3L2NA 3GXFA 1PX3A 4LDOB 5F3FA 1NMCC 3RZCA 4X4ME 3DOSA 1SF3A 2HLAB 2NY0B 5ACLA 2F54B 1EDHA 3KLLA 3JWDC 5HYJD 3ZW3A 1QZ1A 4A7SA 2XIDA 3Q1EA 3WNLA 2L4OA 5DC9B 4WO4D 5FKAA 3RWFB 5HI4C 2WAQA 4K3JL 3BGFC 5IJKC 3Q48A 2QTVA 3VE0B 3IDGA 4K7FB 4KV5E 3VJ6B 3T8XA 5I82A 1MJ7H 1XF4B 4NQEA 4YXHL 3WIHL 2AV1A 4WI0B 3LAFA 1OAQL 4P2QB 2YD8A 3FULA 3O11A 2C4FT 1MCPH 3Q2NA 4ELKB 2COQA 4NWTL 1YAZA 4KVNL 4LZKA 4F92B 1QKZL 3GTNA 2Z92A 3BIKB 1YG9A 4KY2A 2CXKA 3QJSB 3TV3H 1PNDA 4NZRL 5EZOH 4CA4A 3T4AB 5H94B 2HH0L 4TTDD 3C75A 3UO1L 1MIEH 3X3FL 4GKZA 4IRJB 4J3TA 4OVUA 4Z3JA 3VI3A 5KEZA 1KJ2B 1E8XA 2BOBA 2WWKO 5DWUL 3KR3H 4QHNA 2DEXX 2IBZY 3P4OA 2YS4A 2V7HB 4NIKB 4ANVA 3TA3C 2AMGA 4P5TD 2AC0A 2FT8A 1EVTC 1TTBA 2XJKA 3S35L 3ZO0A 1R5WA 2APTA 2DLIA 2GSMB 1BFVH 2AJXL 1UQSB 1S9XB 4EXPX 1I8KB 4PY8J 3QRFM 3BGMA 4FDWA 4J12A 4OJAA 1AR1D 1KBGL 1Z0NA 3UTZA 5D72H 1DE4B 1S5IH 2L7JA 2RBLA 5DD6B 3K6SB 4PJBB 4JDEA 5A2KH 3NZHL 2VXQL 4MHHI 5DQJB 3MO1A 1A3LL 3RX7A 1BP3B 3NCYS 4KY1H 3K46A 2XPGB 4FRWA 1HCFX 5TDOA 5TDPB 2WV3A 2X05A 1FGVL 4GMSH 3PP3K 3ECUA 4I9XA 1FJ1A 5FYLL 3FYIB 5ES4B 5GIRA 3CDGB 1MCHA 1MXGA 1NKRA 4I18B 2P4AB 3LQZA 4FOMA 2IPUK 4Q52A 4MZRA 3SDAA 2VUYA 3AREC 3ZHDA 4FMKA 2PW2A 1KPRA 5BRPA 3CZFB 5K9KA 1I1AA 4AYFB 4UCFA 4MDJA 5ITFB 3S88H 4NZUL 5KSAD 1K72A 1EUUA 2IAMC 1TQTA 3FXIC 1M53A 5FV1L 1GW0A 1H8OA 4QT5A 1QHQA 3FFCA 4UU9A 4BM7A 5LAPA 5SWSE 4XODA 3L4YA 1DBAL 1T4KA 2UXTA 3O2DA 1WE5A 3QFJE 4HDIA 1AGFB 4LL4A 3HI5L 2YA2A 4K8RD 4U1SB 1ETA1 3ESNA 1SYVA 4HH9A 2AKRA 3OB0K 4Y9BA 2OKMA 5HVGB 3ZZQA 4JFHD 1IFHH 1UWXH 1DQDH 2AQPA 3GNML 3B2UC 1IM9D 3QUYB 4A39A 4R3SB 4FFVC 5HTSA 2VDQB 4YE4L 4FS0A 3N85H 3GHBL 4NNXB 4TYUA 1N2RB 4PJGE 3RX9A 4LHUB 2OXHA 3V2AR 3U4EA 4JZJA 5HYQA 2JJSC 1P2CB 2X5PA 3OX8A 5A2LH 3VNYA 2XWBB 1FP5A 1LDPL 4XNDA 4JPSA 4OLZH 3WELA 4J27A 3M8OH 3F64A 3FB8A 3NFNB 5E6UB 2AK4A 4N85A 1I9RL 4M7LH 3SIKA 1K5WA 1BZDA 4J6RH 3RZCB 2OTWA 1A9BB 3MCLL 5DO8A 4WUKH 4QF1B 1UWGH 1CJYA 4JFQB 5K1VA 2R1WB 4K7PH 3NCXA 4XO8A 3DIVA 3P0GB 3O6ML 4R96B 1KFAH 2YUVA 5HGHA 3VE0A 1MJJB 1KBWA 1TZIB 5KS9B 2JFCA 4JFFD 3SO3C 1O6TA 2VZUA 3THML 2EYTB 5C0CE 2QQKL 5I6KA 1TFPA 3QUZB 1HQRA 1QYGH 1UH4A 1C16A 5FW7A 3BGAA 3BX7C 3ZVVA 4JG9A 1SPDA 3L4WA 3NIFB 5T1DH 3BIKA 4ABVA 1ASPA 1UGNA 4XNZC 1LJMA 2N56A 3BSHA 5EC2A 1PLAA 4WV1B 4IOIB 4E9YA 1KB3A 3M8OL 1P9MA 3ZDXE 1DFBL 2OL3B 3ZE1B 4JFDB 2JMRA 2JTDA 2B15A 3NAAH 3VXTB 4AK2A 1IC1A 5LGKA 1HSBA 1MFEH 5KYXB 3CXDL 4C83A 2BCKA 3EJTA 3DX0A 1E4KC 2WXKA 1IKNA 3M7FB 2DKMA 2CNYA 3P3SA 4PGBA 4TULL 5I6NA 3MLSL 3UABA 1I3RB 4BZ1H 1UQSA 2WLMA 5AOMA 3B5HA 3KPSD 4JN1H 2YXWA 3HFML 4JEGB 4BJLA 1TYRA 5ILTH 2P8PA 4FG6D 5J57B 3T2OA 1ZVYA 3N1PC 1DE4A 1DVXA 4KKNA 1A25A 1MVUB 2XZAL 3FU7B 5LLIC 1W15A 3D51A 3EOAB 5EORH 3B2PA 2MEJB 2EDBA 4FI6A 3WIIH 3QDME 1BQ5A 2X0UA 1XFPA 4UQDA 4LQFH 3FRUB 1MPAL 1FO0B 3OKLA 2DWEB 1FJ1B 4X6EB 5IQMA 2X38A 1L7TH 2X6UA 1GH7A 2BJMH 4P9MH 3Q6GL 2G9HB 3LQZB 1CICA 1GPOL 5T1JA 1NINA 3ARDB 4FI7A 2QDWA 5D1QE 5E6RB 4ZX5A 4GLRH 5A16A 3T09A 4G7YL 1FZKB 1NFAA 2X53A 2YEQA 5AUMA 4RCAA 1PLGH 1XGUA 3QH3A 1JMXA 2GY7B 4JDTL 4WI2A 4L1LA 3MROB 2AANA 4FFYA 4HWEH 5T3XE 4QT5B 3BZFA 3GSOB 3FFCB 1DJHA 1P4IH 4UU9B 3S3DB 3FNKA 2A74A 2DQHH 4R97B 1QLEH 1C1EH 5C0DB 1GZQA 2Z34A 3SDDC 4X5XA 4YNYA 2ICES 4WW2C 3QEQB 5FA4B 4ZXBD 3WMSA 3H9SA 1A7RL 1G7HB 4U1SA 1S5HB 5E8OA 4EKJA 1LP9B 5AKTA 5EHFA 2OI9B 4Y4HD 1DBJH 4N2OA 4P9HC 4OCYL 1JZHA 1ZWIB 4OCWH 4GAYB 3U2IA 2HCZX 1YUKB 5AYUH 1FZOB 5AW7B 4NNXA 1F6LL 3OLDA 4NWUH 1MELA 1P4UA 1OANA 2MOVA 1GRWA 1M42A 2JK5B 2BVTA 1VJSA 3O6FD 4K9EL 3OAYK 5IT2L 2OXHB 3QQXA 3U4EB 1M2VA 2A3TA 1DN2A 1XR9B 3ZMNA 5JW4Q 1SDYA 1E6OL 1RULL 3HB3D 4F57L 4DK6A 2NPLX 2BZCA 3T4AC 1IGTB 3ES6B 3HZMB 3LS4H 4UTAL 2Z1KA 2DMCA 1JNHA 4GBXA 2VSCA 3BPOB 3L4VA 4WTWA 1BQHB 3MLXH 4JL2A 3WN5C 2C7FA 3O6KL 4JZOA 5I71C 1QPPA 2KQMA 1KBGH 1COBA 2PWEA 3ILPB 3WE6B 1A9BA 1G4MA 4UTCA 1Y18B 1IB5A 2AJXH 2CKBB 3L4ZA 1TO4A 4X5WB 5B8CA 5AL0A 3FT4B 2OJZL 1W9XA 1MRFH 1LK3L 1W0WB 1JZ5A 4PSRA 6TAAA 1DDTA 3SSGA 2CHWA 3RI5F 1G7MB 1QSFA 4M4RB 4WU5A 1AHKA 4HOWA 4XNXL 3ILDA 4FTVA 5C92A 2D7OA 4JHBA 2G9KA 5DUPH 4KX9A 3NCCB 5I1HL 5FYKD 2A1WH 3OR6A 4XXDB 1AGDA 1UZ6F 2D3VA 2VLLB 4MYWB 5DC4B 3QR2A 4NZRH 5EZOL 2W9EH 2ZWKA 3K71B 4PGCB 1DL7H 4R2GB 4Y9FA 4WV1A 4QRPB 4NO3A 2R69H 4PLOB 1C08A 1Z9OA 4FYSA 4DTGH 4PWFA 1XF3A 3B2XA 5HI4D 5B7MA 4N6RA 4RAVB 1HSBB 5DD3H 3RWGB 1MJ7L 1TZ8A 3W39A 3TBYA 3P11H 4PGBB 5GRYA 3AQYA 3FU3A 1T5WA 4YWGH 4OZFA 5ALBH 4ZMNA 5IB2B 4ELME 5CKAA 3U4BL 3T65A 4DZBB 4ZZFA 1U8JB 1I3GL 1WH0A 32C2A 3EJJX 3ZHNA 3GSNH 4DP6X 3FB7A 2JKIS 1CGSL 2EC9T 1V3MA 5EBLA 5DK2B 2VYRE 1HNGA 3O2VL 3NJNA 1OK8A 1PJ9A 3MRLB 4TUUA 2J55A 5CUSL 5FB8A 2WO2B 4WW2B 3ZPDA 2LFGA 3FRUA 4PUBL 5EF3A 1XDTT 4I0PA 4AIXA 4Y5VB 1G43A 4HUUA 1PLGL 1VIWA 3IMWA 4GSUA 5EOTB 3ULUE 4FJ6A 2KZKA 1H3WM 2G9HA 4NGHL 1CICB 2WBJA 4AEFA 5DGRA 1OAXH 4DP8X 2VERA 1U92A 3R1GH 5KVFE 5F0JB 3BP6A 5A16B 2QPUA 4HZLA 5SWZE 4A7GF 3O3BB 2NNFA 4HHGA 5IMKB 4FNTA 1PSKH 1UOKA 1JRHI 1MAML 3BZFB 3GSOA 5F0MB 4P5TC 3D0VA 1NANI 3W82A 4JG1L 1F5WA 3K2KA 3RG1C 5ADPH 3W81A 5D5MA 1E40A 1G7HA 5DVPA 1DO6A 5AVYB 5EBMA 5IVOA 3I2CL 5DJ0B 2UVFA 4N2LA 3GXPA 3WTTA 2XN2A 3WXVH 3WN5B 2FUQA 1XB3A 3DV4A 1S3RA 5TFSL 4UQAA 3TCLA 3MRFB 1CMOA 4PJEB 4PMEA 1CFMA 4X7TA 3TOPA 5EEUA 4N2NA 6FABH 2EAEA 5FHAH 4GAYA 4BA8A 3NCMA 5KBNC 1H19A 1H6UA 2IAMD 4YPGA 1UCBL 5TE7L 4MA8H 3VD1A 4DQOL 4LVOC 3RWHB 2O6PA 3N55A 1AQKH 1L6ZA 3DTXA 2EVIA 3GJFB 1DLFL 2OMXB 1IM3D 3MV9B 5J1TC 2OYMA 4JO1L 2XICA 4PGZA 5LG6A 1T5KA 5H4ZA 4OZFH 5L4FA 5I30H 2WSKA 2IFGA 4AXWA 5KVGH 1OCCB 4JCWA 3QWNA 2NY4B 3GJEA 1T6WA 2HVJA 3ILPA 1C5DA 5CFHA 4PJCB 2NSQA 4JKWA 3CN2A 3GINA 5B8CB 1TR7A 3FT4A 2ENYA 4FQ1H 3VXPB 2QQLH 4K55A 2B59A 1DVFD 4DT2A 2DTMH 4PS7A 4FTVB 3MRJA 1F00I 1IZJA 1ORQA 4GXVL 4HX1B 4S0SD 4AENB 4TSAL 2WLHA 2WWOA 1EUTA 1JYWA 1KTCA 1WTGT 4XAWL 1A1OA 3AW5A 5BZDB 1T89A 1UD6A 3I2CH 4XI5C 4Z7OB 4F8OA 2IPTH 4MD5B 4EDWH 1USQA 1KBBA 1RIUH 3HHRB 5AVUB 4BDVA 3QAZC 4ZDHB 4TOYH 1A6VL 2G60L 2KBGA 4KZCA 3JYBA 3KWWB 3T0AA 4NLAA 5E03A 4BGDA 1BWMA 3GBDA 2AQTA 1LK2B 4N6RB 4RAVA 4NN7B 1R3IH 3UTQA 1B2YA 1CF8H 4KROC 2FD6L 5EU7C 4HPYL 1HAUA 1TU2A 5ANHA 5KOVC 3W39B 5CZVL 3PUUA 1V3KA 3JZ7A 4KTGA 1MHHA 2ENQA 3NIFF 4ICWA 5IB5B 4EQ2A 4OZFB 5TDNB 1YEKL 3QORC 5D6DA 4U1KB 3MUGB 4X9GA 3NPZB 3QI9D 2NNAB 1ETZA 1RZ8A 2HTLC 4N90D 1TPXB 1UENA 3IMSA 4NKDA 3X11B 4ZZKA 2RCSL 4C56A 2O5YL 2YARA 5A6IA 3UAAA 4JL1A 2OJEB 5ID0B 4KI5C 2C3WA 4GUPA 3VCLA 3D09A 3RY5A 5GZNA 3KWUA 5E4OA 1OF2A 1AXIB 4JRXB 3QYMA 4NQQA 4IRZA 3F05A 2J4WL 4HOMA 1URZA 5AW3B 3NPSB 1BVNT 3TM6A 5FUCC 2DWDA 2ROXA 1G6VK 4HLZG 3MV7E 5EOTA 4O5LL 3MLZH 1IGYA 2X1WL 3NIGE 3SDCC 4WVRA 1I8IB 1CLZL 5IEHA 1JZ4A 4G3YL 1A65A 4DSYA 4X8GA 2EYRB 1TQBB 4JVWA 3FONB 5AW0B 2FT6A 3KPSE 1LO3H 3BYTA 4XCFL 3ATBA 1HH9A 1WFMA 4MS6A 1A5FH 3TT1H 4NKQB 2DM7A 3D06A 3QHZH 5H35A 1S5IL 2PO6C 3N91A 2H45A 5F3HB 3GLAA 1LGVA 4JQIL 2H9GB 5DUPL 4NFBA 4KTDL 2OR8A 4MWFA 5T3ZE 1X7TA 4RA3A 5CGBA 5TJWK 1T6BX 4BQCA 2UXVA 1XF2B 2VDRB 1V7MH 5KBKA 1IL1B 3OKKA 1BMWA 4KHXL 4P2RD 4AW7A 2IANE 1MRFL 1TIUA 5INDB 1ES0B 2OR7A 2F1BA 1AR1B 4ZRGA 2XVKA 1UC6A 2CBMA 1BZ9A 4M61A 4YEEA 3STLA 1QOKA 4B7IA 3F7KA 3U2SA 1T7YA 4I1PA 3GJFA 4IW4C 1NBYB 4NUGH 4L9LB 4X6FA 5E4IA 5IESH 1CDBA 2NX5D 4MMYA 2FO1A 3MLXL 1CB4A 3T2QA 2JQAA 2PO6A 5BRZD 1RIVH 3BAIA 3HBPA 2DQDL 2OPCA 3TLRA 3QIWD 3MNWB 2HVJB 4XX1G 3TV3L 4UT6A 2KT6A 2L7EA 3ZE0F 1E6OH 1RULH 3S3PA 1E3FA 2UYLB 3JWOH 1ZLVH 3V5HA 2CJ3A 1JV5A 3E80A 1PG7H 1ZGLP 1BF5A 1KTJA 4GYBA 4XWGL 2WQXA 4KDTA 4QLWA 1CLZH 1YMMA 2G5RA 4YXHH 2FWOB 5H37A 5HVHB 2AJZA 1RY7B 1T0OA 4HUNB 3FRPG 4NN7C 3GEWB 3VQLA 2IF7A 4JQVA 5BJTB 4KQ4H 3MJ8B 5E2TH 3COOA 2XV6B 2ADFH 3OKYA 2VDRL 1N6QH 1X44A 2VDOH 1CG9A 2QLYA 2H3NB 3CIQA 2N0KA 3TO4C 3TT1L 1A5FL 2F5BL 5I19H 5KYWA 1LD9B 3R7QA 5DRZB 3X2QB 4IBWA 4JRYB 5I17A 3BKMH 1P4IL 5B7FA 4GSDL 3GIZH 2VDQH 2OP4H 3MA9H 2HKHL 3KWWA 4LRNH 1BQKA 2ZXAA 1I8LA 3FQWB 1AC0A 2V2XA 4TXVB 4XX1E 1BPLB 3VG9C 3X17A 2BS9A 1TU2B 2D9QB 5C0JA 3O2WL 1Z3RA 4OCRH 5IB5A 1FDLH 2Y36L 2DQJL 2W0PA 3GT6A 3LB6D 3LQAL 4M6OH 3MUGA 2W07A 4JLRA 3MLTA 3ULSB 5B38G 4Z7VE 4G80B 2XTLA 4IBTA 2OCFD 3FOMB 3HN5A 2ED8A 3IJ8A 2ZCLL 3JUZA 4JFWA 4YHMH 4TOYL 4TPRL 4L37A 4W9CC 4MJHA 3FQRB 3VCLB 3DUUA 4PLNC 1INDL 2MCPL 1PEWA 4M93C 2FBRA 2TRHA 2ZZUT 2FLBT 5JA9A 2ZCKL 4A37A 5J7CC 4KROD 4G8IA 4JO5A 2LQRA 4GP5B 3QIBA 1JAEA 5D71L 1IC4L 1FVEB 4LVOB 1TJXA 1FI8C 1RUML 3NJGA 5E2JA 2CDEA 2Z7UA 5IZ7A 3BJ91 3IDNB 5IFAL 1QSVA 1ZVNA 4ES9A 3AFLA 3V6OC 1S9YA 4GRLC 1J5CA 1ITBB 2V17H 5IEHB 3TA3B 4HWBA 4OZGE 2C1OB 3NZ8B 3MZTA 3UTTE 4AQ1B 5EMYA 1VESA 1YNKH 1C8QA 2GB2A 3NFPA 4FYTA 5SWZD 2ARJB 3TPUA 4ALAL 1U8LA 4EI0A 3FH7A 2EE9A 4XOCA 2RFXB 3EJYD 2ITDB 3AS1A 4R83A 3C08L 1CXHA 1F42A 4QRSB 4OB5H 5DJYA 3T0EC 4H2CA 3C5XA 2V2WA 4P3CH 2K4AA 3DXAD 1DQTA 1XF1A 3KPTA 3OSVA 4PJFB 5F3HA 3GBNH 4G6ML 4YSEA 3SDCD 1D5RA 1WAPA 2NZ9C 3BQUB 3DVNB 4WHTA 1GTNA 1T66D 4XPHH 4FA8A 3FQ1A 5INCB 5EBWB 3TASA 1PD1A 3O9WA 4FULA 1T03L 4HSQA 5INDA 1QA9A 4FFYL 2JXMA 5M7QA 2RA1A 4NO2A 3D2UA 5TFSH 4HH8A 4G6MH 4WWOA 1OPOA 2GKIA 2B9BA 1TZGH 2XQBL 4ODUB 4NHUB 2YK1H 1YN6B 2E76C 3IETB 3QO1B 3V7AG 4A2DA 4ZQKB 3GI9L 1RURL 5JHMA 4ANXA 4NPYB 4BZ2L 4QXWA 4CVZB 2W5PA 4R7NA 4KJWC 3BHBB 1Q9OB 4M5SA 1EEZB 4X8JB 2F53E 5T3XD 3MNWA 5JQ6L 3BUBA 3U0TB 1M05B 1Z9LA 4UANA 2DLHA 2XJLA 1CLYH 2K3TA 2NY5L 3IJEA 4WO4A 5DS2A 1GVIA 2H2PD 4FLSA 1MQKH 1RZJC 2WTOA 2VH5H 3OXRB 4B41A 1LEIA 1Q9KA 2V17L 4GW4A 1WEJL 5D4IA 1TKWA 2AJZB 4M03A 4YC2C 2QPDB 5HJ3A 5GZOC 1J5HA 2FATL 1OF0A 3S4SB 3KJ6H 5CF3A 5HHQA 5KBDA 4LEOA 1ZS2A 3MJ8A 3RNKB 2VLKE 4KH9A 3QDMA 2A73B 2WNWA 3IFLL 4DVBA 3LRSA 3C2AL 3C6LB 1HYRC 4HJ0C 4JY6A 4FXKC 2NY5C 4U1HA 3GBMH 1S7SA 1KG0B 2ICWI 3QUMH 4NERA 2XUWA 3RWDA 5C0FA 3D18B 4L3EE 5I17B 4TPRH 3FF7A 1YJDC 4U1JA 1HL5A 1OE2A 1PAMA 2DLEA 1J5IA 4KJQD 1EHXA 3TBWA 4FP8L 1QSZA 2R0KL 1EAJA 1N0LB 3P11L 5IB1A 3FMGH 1OQOA 1V8HA 1B9ZA 1SYSA 3T5WA 3IDIA 3SEPA 1MI5A 1QHPA 3FQTA 4PG2C 3VSVA 5DZ9A 1FVDB 1YMHA 5TF1L 2IDCA 5CFAA 1T1YB 3H8NA 1WZLA 1NUNB 4KQ3H 4CBPA 2PWDA 1URIA 3HI1A 5TE6H 4ZS7L 3VXUA 4UILH 1DUYB 2JB6A 1I3GH 3C87A 3FQRA 1Q0XH 3DUUB 4K23L 4PBVC 1SXSA 3ZKNC 5KVEE 4HOZA 1II4E 4XTRD 3BKCH 1ZHNB 3OGOE 3QIBB 1TVBB 1WF5A 1DN0A 1NEUA 2BNRD 4ODXA 4Y19B 4ZOAA 2UXFA 5HDBB 4W4OA 1Z7JA 3WJLA 3X1NA 5HY9B 2EDLA 2JQMA 3CSGA 4RFOH 1OSPH 1TMCB 4KRPB 5ESQB 1SEBA 4DO4A 3RDTD 3WTUA 3RRQA 1HKLL 5ALCL 1PLCA 3ABLB 4DGVL 3GRGA 1YEEL 1A6ZB 2EIDA 1AZBA 4AQ1A 3PJSA 2AV1B 4WI0A 1H3UA 5CILL 2VISA 4Z7NB 3ZTJH 3RX8A 2RFXA 2WKOA 4Y2DC 1H15B 4LLUB 2OMTA 3LZOA 1N70A 3QFDB 2Z9TA 35C8L 3OG4B 3FSVA 1VEMA 4Y19E 5HDBE 4HCRH 2MCG1 4UM9B 1QFHA 1L9NA 4G5ZH 4QOKD 1NBQA 1FNLA 2HJKA 3RU8H 2EUXA 4LASL 3DJRA 2XWTB 3KPMB 1J5DA 1D5XA 1NICA 1H5BC 1QQDB 3KAAA 2XI9A 3MREA 1E9QA 4QHNB 3U1QA 5HVFB 5E2UL 1X5MA 5HJDA 1OP5K 4LCWB 4J3BA 2NTFB 3APMA 3HB3B 2Z3FA 3MCG1 3V0WH 2IAND 3ULUH 1R24B 4F27A 2Y3NA 1IE4A 3DHPA 1L5GA 4YDVA 4NHUA 1YN6A 1G6RA 3QO1A 3QZOA 1I8KA 3WHXA 5MHSE 3VGAB 5ETUA 5T3ZD 2ZTBA 1FBIL 1PLBA 1RP8A 4JE0A 3SGDH 2NXZD 2EIZB 4NM4L 4PJDF 1N64L 3UTZB 1UA3A 4E2OA 4KRLB 2L7QA 3S36X 3MNVA 2R51A 2BVQA 3D0LB 4E42B 2ZCHH 4BHUI 5DTFB 3HE6D 5DT1L 1KJ2H 2BW5A 1QAWA 4TF4A 4UQ3A 1H3TA 4MGXA 1ZLEA 2EJ1A 1CVRA 4GW4B 2D3JA 1F2XK 1GOHA 4FP8H 3GXIA 4AGOA 3SBQA 3O9WC 2FJUB 2YAMA 1JS4A 5E9DE 2N7AA 3DROB 4XC1H 2ZNXA 2EDOA 1P0SE 1XGYL 5IBLC 1XSJA 1JWUB 4PJ9C 1FNGB 4EBQL 5J12B 1DQVA 5AOLA 3E8VA 4F9PC 4MDJB 3JTTA 1CWVA 4M93B 5ITFA 1EHAA 1GY2A 3L7EB 1UFUA 4JPVH 3MV8B 5CD5C 4FQ2L 3F8UB 1HTYA 1P6AB 1XH1A 1VA9A 3C2AH 1QRNA 4NQDB 1AGFA 1CQYA 2XNAB 2PMZA 3BD4A 1EDYA 5MEPB 5CP3H 4WRLA 3KH4A 1RUAH 1CT8A 5MEQB 3FHQA 1FWXA 3Q1SL 4YDIL 3L5JA 5I16A 1JGDA 3HG1E 1HSAA 3IDIB 1MQKL 3Q2LA 5I66A 3FQTB 3NOIA 3QS3A 3CCHA 1MIML 1QACA 2PYED 2XWRA 4Y1TA 1MJUH 2AJUH 2J8HA 2VDKB 2H0FA 3X3GH 3FQNB 4WHCA 5FYLD 2V0AA 3HI6H 1O9ZA 2WXQA 2XTSA 1NPJA 4M00A 1RZGB 3QA3A 1KT2A 2X89D 4XMLH 5DJCA 3NFNA 5T1DL 4Z7UA 1EO5A 5IB4A 1E43A 4KAQH 2PTTA 1JBJA 4JFHE 2CWRA 4Q89A 1F13A 3LRMA 4Y19A 4ODVL 4W9LC 5GSVA 1EAPB 5F88B 1AC6A 1Z3GL 3U0WL 3QWOB 4U6HA 1PMYA 1GYWA 4OF3A 2DYPD 3WD5H 4U05A 1PF3A 2F15A 4TSBL 4X7SH 1CFQA 1NSNL 3CPLB 3HEIB 5DMIL 1AE6H 2CPCA 3SBRA 4WWKD 1A6ZA 4R7LA 3B3IB 4NQTA 3PJSB 4L0YA 2CA3A 3R8QA 2J12B 3C08H 2WN2A 4G7VH 4I3RH 5EC1B 3GS4A 4KJPC 4Y5YB 1M1XA 4G8AC 4G8FA 5GQBA 5KVGL 3QFDA 3HHSB 5KYUB 3RAJH 4MNGE 1A14L 1NOAA 4N1HB 1BXXA 1NKGA 2OBGA 1P7KB 2WBXA 2CO2A 2R4SH 4BWWA 2IC2A 2ATPA 2XKNB 2HKFH 4M8UA 1U3YA 3G6AA 3Q2WA 4M48L 2ZXCA 2PPFA 1QQDA 2BVYA 3TYGL 5B38A 5J9PB 4PWIA 1D6EA 1DQMH 4ONHA 3V7MA 4RGNE 1I4FB 2DQFB 1MCWW 5C0RL 3MACH 1H0DB 3UX9B 1RZ7H 4MXVF 2PXYD 2WANA 3B8YA 3D3VB 4F7CB 4YHIB 3ZSSA 5JYMA 1G6RB 2J6EH 2FBJH 2V9QA 4UNIA 1RZQA 3QDGD 1S78D 1QFWL 4FMFA 1MWOA 4OLZL 3RFZA 4P2CG 5T5FH 2IWEA 3E2HC 4KUZH 4AKOA 3ARQA 3RP1A 4JMNA 3B2UD 3MJ9L 1KLFA 2OSXA 4PD4J 2H3XC 3X14A 4JRXD 4HOXA 1N6UA 1RK1A 2NUPA 2A4CA 2KHAA 1B0RB 4RWYH 1FO0A 4YSCA 3OKLB 2BH0A 3Q1SH 3D39E 4PJ8A 4PJ7F 5E8NA 2DJ4A 3DROA 3VXQB 4APXB 3BT2L 5I28A 1A22B 1BX2B 4JPIA 2VDQL 4HS8L 3S5LG 4Z23A 4TNEA 2K4WA 5AUMB 3DPBB 1CR9H 1TZHA 3O3EB 1XCQA 2AXFB 2BVOA 3QNYA 1GYVA 3ASOB 3I9IA 4RISH 1PU0A 2F5BH 4Y16A 1WBXB 1SM3L 4GXUM 4LLDA 3MV8A 2A74B 3NZHH 5GS1A 4R0LA 1GYUA 2AQSA 1P4LB 3L1FA 3D05A 2IGTA 3QEQA 1U8IB 3GHPA 4NEHB 4PGJA 2VO5A 4BQ8A 4RX4A 3EJZC 2CA4A 2J1WA 4NM8H 4EZJA 5I8EA 3OSKA 3T0XA 2CHNA 2XQYK 4N0RA 3BZEB 1OAKL 4YLQT 3S35H 4PI2A 1OGSA 1HSAB 1BDYA 2FCBA 2Y3AA 5E94B 2PP8A 3RGVB 1NM9A 3EJYC 1JE6A 2OTPA 2R56H 4HXAH 1PPIA 8FABA 5JIMA 2HRHA 2Z0UA 3LD8B 1A3LH 4J6IA 2A9CA 4G7RB 1BVOA 4OLWH 2DM2A 3HZMA 3KPPB 2D31A 1RZGA 3QA3B 4OCXH 4PRID 2X2HA 4QXGL 3C6SA 3V52L 4PJ5E 1T0MA 1EJ6A 3BN3B 5CR8A 1KACB 1E4KA 4BH8A 2EDJA 2NY0D 4Y5YC 4Z7WF 2PTTB 3WE6A 1U41A 3HS0B 1EAPA 2P47B 1H8SA 1ROCA 2NYKA 4M5ZH 4KNUA 4E41E 5FYJD 2WBJD 1X6LA 4X5WA 4Y7MA 5IHZB 2BHYA 2G3XA 3L3DB 3NSXA 4G5ZL 1TJIH 3WI9A 2ETWA 1T1WB 1KXTA 3U46A 3FRPB 4RFNC 3FHEA 2QHRH 4IMLB 2JTYA 3WGUB 5E1AB 1W80A 3ARRA 1XBRA 2VDLL 3E1F1 5C6WH 4FQJL 2DYRB 4RZCA 3VGDA 4Y4KB 1QNZH 2WLLB 5JR1H 5GS0D 1CFSB 3R4RA 4YX2L 3FT3A 1NOFA 2JJUA 3HHSA 3K4AA 3BRGC 5LXGL 1YEEH 1ZA6A 3GMPB 3I9PA 4M1GH 3ARBB 4QJ3B 1P7KA 3QQ9C 2N1TE 3FTGB 4NO3B 3WFDL 3LMJH 2APBA 3LN5A 1AIZA 2KC0A 5I9QB 4GAFB 5I1JL 3RWEB 5G5DA 5A2IH 4MMZA 3RTQB 2X10A 4UZGA 1CTOA 1UOWA 1U8QA 1I4FA 2BWQA 2D7QA 1EPFA 2XXCB 3TBYB 1N4XH 1K6QH 4B9KC 3LOWA 3M17B 1IEAA 2JCCF 4W6WB 5KSBE 4R90L 4XMZA 3WBDA 1Q0XL 3AMKA 3OBAA 4IS6B 1EFXB 4D0BB 4A7QA 5C7ZA 1EFQA 3CFBB 3GK8L 1JGLL 4LXFA 4JQXA 4KQ3L 2RCSH 1L9OA 1N68A 3O3AB 5FYJU 3UJIH 4NN6B 1HXKA 3K2UH 4BBWA 2ALAA 5DK2A 1FNFA 1G6RL 1KLFB 4YXLL 4CN6A 2IGFH 4KC3B 4UINH 2F58L 1KELH 2YMXL 5MI0B 3BE1L 1NC4B 2Z8WC 1Q38A 5HDOA 4XNYL 1HU8A 4W9DC 4PJ8B 4AT6B 2D4DA 3N43F 2MIZA 4ZD3H 3VXQA 4APXA 2CRMA 4KKAD 3E1ZA 2HTKC 2WXHA 3QDAA 5DF0A 1NCCL 1NGWB 4IQHA 4MQXD 2IOOA 3A5VA 1I1RA 4AC2A 3UMTA 1HL8A 1I7ZA 3C5SB 3PXHA 4Q4EA 2AXFA 1IAKB 5AKVA 3ULVC 1IAIH 1WBXA 2VDPL 1HCZA 4LLDB 4PJBF 5EIQA 3KXFE 4DP5X 5GGUB 1I1AC 2NW3A 3K80A 4R0LB 3FO2B 4I0CC 4JO8A 5D5MB 4P49A 1U8IA 4Q2ZB 1F58H 4RAUB 4IBVA 1XD1A 2MTAA 3BH4A 3X13B 3B7TA 5DCCA 1QVOA 5GRWA 4QKXB 5I8EB 5C6TL 4ZFOL 2APWA 1Z2KA 3LCYA 5GGVH 3RZCC 4B9IA 1IQWL 4OSUL 3L9YA 4M8QB 1CI5A 1A6TA 4X7TB 1A1NA 2WWNA 4OQTH 5JIKA 4H7VA 1AQHA 4X5QA 1OM3L 1DQKA 4IOSA 3VGGA 2I26N 2C3VA 7FABL 1FFTB 1QHOA 4X42A 3ZDZF 4Y9EA 5C0AB 5IF0A 1G4RA 4KFMA 5AQ0A 5DVMA 5HDLA 8FABB 2WZ6A 2F54A 3RVVD 3EO0A 3UTPE 1ZTXL 2NY7H 3HR5A 1FPTL 5F1NB 1BOYA 3QP3A 2OQJB 4RDBA 5CEZH 3FCTA 9CGTA 5FO9B 3RWFA 1DJZA 1I1FA 5CKGA 5L8LB 1KOAA 4KROB 4JDZA 1OOAA 4K7FA 1EV2E 4S1RH 4WEMB 1UM5L 3R19A 4FFYH 2Q0ZX 2DQCL 2H0PA 2C7UB 1NAKL 2ITFA 2K8MA 4P2QA 4PRBB 2VR6A 2IBGA 3QJOA 3IGUA 4DESA 3C6LD 1UJ3C 3SDYL 4A04A 2Z92B 4ZS6D 3U46B 4ZI8A 2R15A 2F53A 2N01B 5AZ2L 5CCJA 1YUHA 2DEYX 2R0ZH 5EEWA 2NZIA 1A3RH 4XNAA 5HDQH 1QUNB 2RQ8A 1DQJA 1DFXA 5E4EC 4WENB 4OI9A 2O72A 2YD9A 4CC4C 1RV6X 3B5TA 1CFSA 1DBBL 1HAWA 3FT3B 3N06B 1MH5A 2R0LL 1U4EA 3IEAA 4N2GA 3H85A 4NZTL 3X3GL 2V7HA 1URLA 5I74B 2VC2L 3ZL4H 3QPXL 1YYMH 2MOQA 4LHJB 4BDVB 2NY0C 3OKNA 4ZDHA 1R5IA 3SDCB 5IUCA 1JZ8A 4ELDA 2ROYA 2BY1A 3SGJC 2F74B 3SE4C 4JHAH 2YMXH 1KELL 3RWEA 1TEYA 5CU5A 5HI3D 4N25A 3CK0L 4L3EA 3TA4D 2GCYB 1U8QB 4PUBH 3NQIA 4IU2B 1M3JA 3NJXA 3N50A 5ANMA 3HC4H 2FGZA 5CD5D 1RPQA 5TDNA 3KYAA 5HJGA 3WV0A 2P80A 4M62H 5TDOB 1JN6A 2PO6D 5TDPA 3B9KC 25C8H 1J05A 1CN4A 3LEVH 3OKOA 3CFBA 4OUUB 4C56B 1P1VA 3P73B 2XHNA 3PWPD 5GIRB 1ZLWK 4FLHA 3DLQR 4M4PA 4RRPA 5D7JD 3VRIB 3DJTA 3GIVA 5AVRB 3BZ5A 4CADA 4S0TD 5ALBL 3CZFA 4L8DA 1I1AB 3K72B 3QFJD 4R4FL 2Y6SC 3MJGX 4MCYB 4PP1D 3S34H 4U0RB 3D7PA 4HZ1A 5DJAB 2BNRB 2VM9A 5EZLA 4S11A 2VJXA 1CZ8L 4RBPH 3LXAA 2OI9C 2Z8RA 4JAMA 4HJ1A 5ABDE 4ZUTB 1REIA 3E9TA 2UUDK 3B9EA 2FEEL 1F3DH 1MFUA 1XGPB 2HKHH 3HW7A 3IFNL 3AMLA 3LEYH 2CJUL 4DO6A 4QRRD 3L9RB 1IKFL 3VU2A 3V0EA 5MEOA 4HH9B 2G5BA 3MGAA 2VR5A 2Z65C 4ZUVA 5FWQA 4EUPA 2BHFA 3DSFH 3EFDL 1J1OL 4BFJA 3HCVA 4DKFL 2VXQH 5IOPB 4YGAB 1P6WA 1HH9B 3OAUL 4L8BA 4Q2ZA 5IFHL 3MFFA 1XBDA 3NN8B 1KTRL 5JYLA 1WP6A 4QTHA 4YUEL 4QRTA 3WTSA 1DR9A 1QVOB 4P3DB 4XXCA 4BHUA 1SN2A 3EAKA 2ESVA 2ZAGA 3G6JE 4ZMPA 1A6TB 3L6FA 1WICA 1A1NB 4MWFB 5KWYC 5EU5A 1ZCRA 4XVUC 3DTUB 1Q9WA 1YEDA 5CLXA 3IBEA 3ETBJ 3OKKB 4GQPH 3PDDA 5CEZD 2ZUVA 2YAEA 1LO2L 2IWFA 4AV5A 3CZGA 4XI5D 2OV0A 4OV6F 4XVTL 4OCXL 3HR5B 5F1NA 2UV3A 3DOIA 1UB6A 2NSMA 4JFQA 4LLWB 4F80A 3V7AE 5CIPA 1U3HB 4M9OA 4GSXA 3EDEA 1I1FB 4LRIC 5IM7B 1YEWA 4MMYB 4F7EB 1SJXA 5DLMH 1MJJA 2BMKB 2ICCA 2X4NA 3CN0A 4KXAA 4XR8C 5JMOC 2JJWA 2C7UA 2OX5B 1FH5L 3EBAA 3QUZA 5IUSA 1WBZA 5EZPA 3U7YH 3QIUA 1JV5B 4WUUB 5T1KD 3HNSH 4EOWL 3MV7B 3AG2B 2FWOA 4QAMB 2PLTA 3GC3A 3ZDZB 2E7CA 4P59L 3VG0L 3GMLA 4GMTL 5CGYD 1ZHLA 3QUXA 4JRXE 5CAYB 4S0HA 1I7RA 4P5RA 4NN5B 1QEWA 1J1OH 1HOCB 3ML8A 4WY7H 1SBSL 5E9NA 2WYHA 2OL3A 2R2CA 2XX1A 4JFDA 3AWEA 1KB9K 2H3NA 3G3LA 1BF8A 1E27A 3H42L 3EUUA 4P5MB 2NR6D 1YNTF 3EW3B 5EF0A 2WIMA 5B7EA 3H7LA 4V1DD 4XP6H 3U1SL 1R5IB 3SDCA 3VDAA 3AU1B 3UCQA 2BPBA 3V0IA 1CLOL 4AMKL 4ZFQA 2CK0H 3G5VA 2HT2D 4KK5C 3S36L 3O8XD 4LLMA 3FS9A 1THAA 4YQXL 2MNJB 2GCYA 4U0RC 2AQ2A 5DLLA 1MVUA 5HDRA 2ZUQB 4TNWF 1NBZB 2DI9A 3BZ4A 4XCYA 5C70A 4P23B 4PV9B 3TBCA 5IBTL 1BIHA 4GS7B 2E7LC 1CICC 1KB5B 2FBJL 2CH8A 4LQ1A 1HINH 4U1MA 4QUOA 1TQCC 4G1EB 4RMRA 1J05B 1CS6A 3BVDB 4MTMA 5L4MA 3HBGA 3OKOB 3FFDB 4UT6L 3GSWB 3CLFL 1FFQA 2XXGA 1X5YA 5BZXA 4XNZB 3GIVB 5DFVD 4AEHL 4XAWH 1VFBB 3ARDA 3IFLH 3L3KA 3ULAB 3P9LB 2JB5H 4N1EA 3K72A 3OJMB 3OHXC 5FHBL 1OB1A 2I32A 4Z0BH 4BH7B 2XZQL 4PLJC 3F5WA 2HUEA 2QPFA 2YMOA 4H88L 3L08A 3QH3B 4GSQA 4PJHA 1BYNA 2E7BA 2ZYHA 1B0GB 2CDEB 2EDEA 4JAMB 2IFFH 4AVJA 4MZ2A 4EXKA 4RWHA 3I3DA 2ENPA 3RVTC 5HGBA 3QPXH 1FFPA 1L0YA 1QEXA 1XGPA 3H3BC 3NEXA 4AM0B 2DL9A 4DGUA 3PHSA 4KJWD 3I02A 5KVEL 1F3RB 1S5HA 3S9DB 5D1XA 3MRPA 2WZ5A 4UT9A 4ZUVB 4WO0A 1EGJH 3S5ZA 5KSUB 1FYTE 2GJJA 4OLXL 5C0CB 1QR1A 1JGEB 4XMWA 2QFPA 4OJFH 4FQXA 2HT4C 3LPPA 5FYJL 3T04D 5LBSL 3FBQA 5C9KA 4WNSA 1OXYA 2MOGA 3ALPA 3H53A 3PQYB 3V6OE 5LBVA 3OLGA 2V2WB 3ZTCC 1IGFH 1SY6L 2V3FA 4JY5L 4AZUA 1M2VB 3DK2A 1HNYA 4RGND 2OYKA 1KIPA 4IRSA 3SE8L 1MLCA 4BCZA 1ZHKA 1XSKA 3EZJB 5EU5B 4LGPB 1JNHB 4L1HA 4GBXB 6FABL 1IJNA 2BS8A 3V5DA 4ZMZA 4Z3IA 2ZPKL 3O9WB 3CFDB 3NQKA 4N2HA 3GBNL 5DMKB 1KDIA 4JZOB 1TQWA 4LESA 4XO3A 3FUHA 5FDYA 4NO2B 3APDA 1KIQB 4I7ZC 3ULVD 4GRLD 1E9OA 4L8SA 1RUKL 1TZOA 1F11A 4PJIA 2ZOUA 3DGCR