3D08A

Human p53 core domain with hot spot mutation r249s and second-site suppressor mutation h168r
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
191
structure length
182
Chain Sequence
VPSQKTYQGSYGFRLGFLHSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQRMTEVVRRCPHHERCGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRSPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of restoring sequence-specific DNA binding and transactivation to mutant p53 by suppressor mutations
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Cellular tumor antigen p53
total genus 43
structure length 182
sequence length 191
ec nomenclature
pdb deposition date 2008-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3d08A00
3VD2A 2VUKA 4IJTA 4KVPA 2OCJA 2J1XA 2J1ZA 4GUOA 2BINA 2IOMA 3Q01A 1EANA 3WTYA 3Q05A 1GZHC 1GZHA 3US0A 3D0AA 3EXJA 3US1A 1HJBC 1E50A 2PCXA 4QO1B 1KZYA 2MEJB 5AOKA 3VD1A 2J1YA 5AB9A 2BIPA 2ADYA 3D06A 2RMNA 4AGMA 4G82A 3KZ8A 4L0YA 3KMDA 1CMOA 2X0VA 4IBTA 4MZIA 2X0UA 4IBUA 4IBWA 3ZMEA 4IBZA 3IGKA 2J6WA 3EXLA 3QYNA 1H9DA 5LGYA 2GEQA 4LOFA 3WTVA 3QYMA 5AOJA 5AOLA 3VD0A 5ECGA 4IBQA 4IBVA 2WGXA 2XWRA 2J1WA 4AGLA 3WTUA 2J21A 4XR8C 5LAPA 5G4OA 2BIQA 1HJCA 3WTTA 5BUAA 2AC0A 3WU1A 2X0WA 1T4WA 4AGNA 1HU8A 4HJEA 5G4MA 4MZRA 3D09A 1UOLA 1EAOA 5AOMA 2FEJA 3WTSA 3D08A 4L18A 3D07A 5KBDA 5AOIA 4A63A 4AGQA 2ATAA 1TSRA 2J20A 4G83A 3WTWA 2H1LM 2IOIA 4GUQA 1YCSA 1LJMA 2XWCA 4AGOA 4AGPA 5A7BA 3Q06A 1IO4C 1TUPA 1EAQA 2YBGA 4IBYA 4IBSA 3WTXA 2BIMA 2IOOA 3D05A 3TS8A 4LO9A 2AHIA 4L0ZA 5ABAA 2P52A 2BIOA 4LOEA 3IGLA 5G4NA 1CO1A
chains in the Genus database with same CATH superfamily
1OT4A 5MHSE 3IE4A 4MNGE 4CGTA 3GM0A 4HIPA 5GZND 1L5GA 4M7KH 1X7SA 2E9IA 5I73C 5IB3A 3BN9C 3E1F1 1VFOA 1W0YT 2X41A 4WHYG 4YR6B 5C0DB 4PTUB 3AW5A 3ZK0A 1PW3A 4X6DA 3Q9PA 5FYLH 1VSCA 5AW1B 5FYKH 1EEYA 2EDWA 5PCYA 5J7CC 1JAEA 7PAZA 5IQ7H 4ZFGH 4HWUA 4RAUA 5FUZH 3TWYA 1SEQH 4DVRL 4JKNA 1FZMA 3U6XS 3PWPD 1R0AL 2D7QA 4OZGA 4PG9B 1M2VB 1VZGA 3SDCA 4ZAKC 5IIEA 1IC4L 3IYLW 3DUUB 4L0YA 3FOLA 2YGVA 2B1OA 2H5UA 4N0UB 2O4EA 5JPNC 2GK0B 4K7FB 1YHPA 2YOCA 3KEHA 2XIIA 4JZJB 4ZDHB 1ZJBA 3DWTA 3FQWA 3EJTA 5AOJA 1WAEA 3VFPB 1EJ8A 4AL8H 2HX9A 4YBLC 1NOFA 2Q7YB 5D1QE 2PTTB 1OAZH 3IMSA 1WK0A 2ZWSA 2D0FA 2VUOA 2UY6B 5LAPA 3ULUL 5I71C 3V2AR 2CG9X 5JORB 5DA0B 3NZSA 4MD5A 3TZVC 3KYOA 3QDMD 2G60L 4AX3A 4ZOBA 1FH5H 3HZMB 5CSGA 4O51B 3LVTA 4A7UA 4WFGD 3L16A 4M9OA 5EBGA 2JKRM 3GB7A 4OQ1A 2Q87A 5J56B 1VRSA 3STLA 3BZ4B 3MCYA 5K93A 4PGDB 2ITCA 1YUHB 5IMLA 3QXAB 1KPUA 5AVWB 2BFVL 5E6ID 1PDKA 1SFHA 1VKXA 5KYXB 2PWFA 1DQLH 2BRRL 2H32B 3ZO9A 2A9AA 3VXRA 3MKKA 1JWUB 3PHSA 1KEML 5HYIA 3EJYD 4HC1A 1ET8A 2CKBH 1HXYB 2ZNXA 2EO7A 3FSVA 1YN7B 3QDJA 4EZLA 5I76B 4FCHA 5KBLA 1IGIH 5I8OH 2NT1A 2X6CA 5GS1B 1OKEA 2XCMC 2XQYG 1F3JB 1KJMA 3RVWD 4DVRH 2XFGB 1X9QA 3MFFB 4FMVA 4K0OA 4JN1L 1H15A 1HQ4B 1KIRB 3ATEA 4TYUA 2OZ4A 3M17B 1SY6A 1YPZF 2CSPA 3EOAA 2H2SC 4NN7B 1CD1B 4YOKA 4P46D 1KPVB 1EHNA 3EFOA 4IJTA 3QWOA 3L7EA 4NUJB 4OD3L 3U9UB 3M6DA 4UTAH 4GRWE 3OPZH 4KZEH 1I3VA 4NKIH 5LXGH 4ZQKB 2VE6A 3ET9F 4UDTA 5J5EA 4G7SB 3DXAD 5GJSH 1QI4A 1SJHB 5AQ0A 3V0WL 1J0ZA 1SZNA 4KVNL 5TF0A 3UZVA 2ZP0T 2Y5QA 1U8JB 4JO4L 3RBSA 5IR1B 4P2OB 1ZT1B 2G4EA 4HS3B 3RWEA 5I30H 2VLRB 3MOAH 5SX5K 3D51A 4LE8A 5DD3L 1RP8A 1NAMA 3W11D 3B2UC 2C3HA 1T66D 2WXLA 4O58L 1WTGT 3VXSD 1W72L 1DBBH 3T3ME 4AENA 3ZMRA 1N7ML 5HI4C 4DCQA 3SPGA 4F7TB 2XY2A 1U4FA 5HDBB 4F7PA 4BCXA 1D5IL 4KRNA 4WW2F 1RKRA 2OP4H 5CNHA 2BSRA 2Y6SD 4IRZA 1YEWA 1KEMH 5AKSA 5KYWA 3SKJL 4LDOB 3AG2B 2J6EL 1G7PB 1XVSA 2ZUWA 5DQJB 4WHTA 3EADA 4AWJC 3CFEA 2BCKB 4HUXB 1ANUA 5BUAA 2OXHA 2FWUA 3IEAA 2NSXA 1T0OA 5IQNA 4XH2A 5KSUB 4IKJA 5EIIB 4FYQA 2ICES 1Q9OB 3QPQD 5FIEA 5DO8A 2KQNA 1QFUH 3P73A 2YAEA 3HJ0A 1NICA 3NN8B 4IK7A 3V6ZB 3QIUA 1F4WL 5IEKA 5I28A 1GS8A 3K4DA 4DPAX 1KTLA 2XWTA 1ZY9A 1E5AA 5IHHA 5ACZB 4LVNC 2NY1D 4CU8A 5CGTA 5T3ZD 1EFQA 4X83A 1N19A 3W5MA 32C2B 1TQTA 4GAYA 5I74B 1NBZB 3O8XD 1M05A 4I8DA 2CLZB 2AK1H 2VDLL 1HKLL 5D96C 2VYRE 1FVDA 4B3EA 4OJFL 3K5RA 5EUKA 2DJMA 1FZJB 1ZHBB 3OZKA 4E68A 1E67A 4S0TD 1RPKA 3VRLF 4HJTA 4QRQA 3RZCB 1XF3B 3QUKA 2W94A 5IBLD 1TQUA 4EN2A 5AW0B 3QNZB 5DZNA 2FRGP 1OEZW 2ZG1A 4MDRA 3OHMB 4JE0A 4H1LG 4E41A 2EABA 3FH8A 2XWJB 5EU6A 2ROXA 2ADGA 1P4IH 4KK5C 4J23A 5EC2B 5HYSB 3IMUA 3B34A 1KN4L 1NDTA 3R06A 4XWGH 1E4WL 3T0AA 5E9DA 5D72H 4B9GA 2FJUB 1JZEA 3L7EB 5HHNB 2Y7LA 1S9VB 4ZXBB 5KVEL 4YHKH 1SM3H 5GGVH 1RUPL 3LN5A 4X7FC 4NERA 4RFNC 5IK3A 4EIGB 3N0AA 5ICYB 4F37F 1FAIH 2ZAIA 5DDHA 1CGSH 1IKNA 3BH9B 4OU3A 5C0GA 5IBTH 2IAMA 43CAA 1RZIA 1YEEL 4KTGA 5BZWB 2EDXA 1WAAE 3FYEB 5D7JA 3EYUL 5IT2H 1R34A 5L8KB 1G6RA 3CIQA 2J88L 2NPLX 2UZXA 1OTTD 4A7SA 4QRPE 3RL2A 3WIIL 2GB2A 4U1MB 5E51A 2R69A 5E1IA 3DO7B 3VFPA 5DMKA 4KY1L 4IEFB 1C7TA 3C9NA 2NZIA 1LMIA 4N9OB 4EN3A 4TNWF 2YD1A 3TJHC 3UJJH 3L5XL 5I5RA 1QVOA 3LRSA 3QXAA 1TTAA 2G30A 3I02B 1B9ZA 1E7VA 3PQYA 4AYFB 5BPPA 4HLEA 1AZNA 4JNXA 3D8MA 3X1EA 5DJZB 3U1SH 2FNBA 3QHFL 4YHLH 1RHHA 1JV5B 1JDAA 4QRBA 5MHSD 1PEWA 2QR0A 1MOEA 4MJ5A 5IHUH 4RMRA 5A6LA 4N2OA 4XHJD 4JDTL 2YZ8A 5ILTL 3NIFE 4G5AA 1OO2A 4ZMAT 2KDGA 1JPFA 3MLTA 3QUMA 3O3AB 3WKML 3SCMD 2ZUVA 4I1NB 3LZFH 4NRXB 3AQZA 2XTSA 3VFOA 4AGPA 4ZAKD 1AKJB 1L9TA 4Q4IA 5KJ7E 4JDZA 1SXZA 3J7HA 4JZOA 3WKPA 3KAAA 5T5FL 3P9MA 5JIIA 4B96A 5H4YA 4G59C 4KPHL 4RA0C 3E3QC 3KPTA 3TNNB 1DL7L 5AVXB 4PJDA 4FQQA 3MROB 3AC0A 3DSNB 3R8BB 3M7FB 3OKMA 3BVTA 1KBVA 1IKNC 4K2UL 3HBPA 2X44D 5F0MB 5HJ3B 1YEKH 1AIFB 1IFHL 1IAOB 3N50A 2CDGA 1S7SB 3PGDA 3RWFA 2JF1A 3JT2A 4F8OA 2OMVB 5HGBA 4G8GD 4JK0D 1QW8A 2WBJD 3LS4L 1YEEH 1MVUB 3LH9A 2J1XA 2DQCL 2VITA 4R4ND 2HRHA 1TITA 4N2GA 4MD4B 3BQUC 1UC6A 5JOEA 3HMXL 4JHWH 1ILSA 3FB8B 3LS5H 3GJFA 4M93B 1OGAA 1KGYE 1SJVA 3QDJE 1VLXA 4KY1H 1DEDA 5I6OA 4J3OG 2WNKA 1JD7A 2FVNA 1KY6A 1A6PA 2MMXA 2VOTA 5E8PB 3WLBA 1NOAA 4LKCB 3SE6A 4DP4X 4WFFE 3ZL4H 2LVCA 4JGJA 1BLIA 2OTWB 2NLJA 2QELA 1U3NA 4O9HH 1XF3A 3HKFA 1SYSA 4IU3A 4F27A 4UM9B 1A02N 3C12A 1MFEH 4YX2L 3EBHA 2V4LA 1S9WA 4ZMPA 1NPUA 3E3QE 1S7VB 4JDTH 1A25A 4PJDF 1MN4A 4LLUB 1FVDB 1UGNA 3FRPB 2XN2A 1QSVA 1AI1H 4AQAA 3LZFL 4F8PA 4KKLD 4ZQTA 2X2UA 2BP8A 3DA0A 3EO0B 4PJ7F 5HI3D 2VC2H 4ZTOH 4EN3B 2NNFA 4I0PA 2QFRA 3LZOA 5DUPL 5IVXE 3RL1A 5DZLA 1PS3A 3SGJA 5T5FH 5JR1H 2KHAA 2C3WA 2BXZA 3X13B 1T5XB 3IK2A 4YWGH 5B39A 5E2VL 4PD4J 4EDWH 2FL5A 1PSKH 3PP4H 1N8ZA 2ZAHA 1EO7A 3EBGA 5G4MA 4YE0A 3RTQA 1BX2A 2J44A 5ICXB 1GHFH 4WVRA 2IAMB 3WHE1 5F7DB 3MACL 2ZG2A 2PP7A 5JW4R 4DVBB 1JTPA 3ECVA 3PFQA 4A63A 4D0BA 1U8CB 2HUHA 4M62H 3VXPA 2FK9A 3EGDB 3LNFA 2AJXL 2YXFA 3LH2H 5BMFL 4CW1B 2F8VA 4OF0A 2PR4L 5AL8A 3MRCB 4JO3H 5D7SH 3CZFA 2CZNA 2QGEA 1I9RH 2ZCHL 3FNKA 5IHZB 1BQHG 2A6KB 4JO1L 2FEEL 1J1OH 1HNYA 1MCQA 3CDYA 1L7IH 3RFZB 3AU1A 3F64A 5FO7A 4A68A 4EE2A 5L0QC 1E8WA 1UH4A 1E8YA 1IGMH 2A77H 3TS8A 1A6VH 1FG2A 1N5AA 4NM8L 1A3ZA 1QBML 5JPMC 5I18L 2JKLA 1ASOA 2G2RB 2WBKA 3GMMA 3M7OA 3RUGE 2X4UA 1D5ZB 3LKPB 5CHNA 4O9HL 1TLKA 2YXMA 3PXHA 3ZOAA 9CGTA 4MSWA 2AEQH 4NRYB 1HEZB 1I75A 1AO7E 43C9B 4X6FA 5KSVB 3R0MA 4WO4D 2XZQH 4JFZH 2BK8A 4JFEE 1IBFA 5I5JA 5HGGS 4APQB 2C8NA 3QXUA 3V4UL 2DMGA 2H6OA 5EIVA 3RWIB 3L4XA 4QHMA 1AY1H 2Y7SA 2JE8A 3BP7B 4AEHL 3QH3A 3QUYB 3P11H 1S7WB 4PLKD 2FIKA 1CD9B 1W72B 3GXMA 4NC1C 1A1NA 1GAFH 3JT0A 4WY7H 1O75A 3MNZA 2FLBT 3RI5K 4KQ3H 3ML9A 3SBQA 4FDWA 4KZCA 2AI0H 1KB5A 2DQIH 5KBNC 2WXIA 4KO9A 4NNXB 5B21A 3F85A 2X0UA 1EH9A 5EU3B 3H7LA 3D0LA 3DHPA 1AQKL 4KJPC 1H6TA 1QAWA 3KPNA 5DLMH 2OMXB 2BVQB 3KEDA 1OAKH 2CMRL 4GKLA 1A7PL 3ZHNA 5C3LD 2NZ9D 4GH7B 3KR3H 3IETB 5IVZB 1XZ0B 1D9KB 5HDOA 2P5WB 4DO5A 2W9EH 5AUMA 1OCCB 3ZKNC 1IGJA 2C4XA 2PYEE 5DD0L 3V0VA 3VFUA 4F7EB 2ARJB 4DZBB 2YWYA 3UZEA 1TKWB 2WBJA 1OP5K 1JHLL 3EJJX 3UH8A 2FYYA 4P2CG 3CX2A 5HDLA 2MSPA 3DHMA 3STBA 3UTQA 1A0QL 2PF6A 3PIQB 4NAJA 2F5AL 3MRNA 1A1MB 2ZUSA 4AC4A 3U0WL 3VGBA 4XB8A 3ZU8A 1TEYA 2F74A 5IMOA 2AJVH 2Q8BH 3M86A 3GB7B 4RMUA 5I1EH 5KYYA 4NCC2 3MLYH 2VXQL 2BVEA 1F3DH 3IJEB 3QULB 4Y16D 2DMKA 3V4UH 4GMSL 4UNUA 5D1ZD 1TSRA 3DVNB 5B8CB 4AITA 3IFLH 5C7ZA 1IGCH 4XOCA 3HRZB 4LSDA 2B59A 5LAXA 1YEJL 4YJZL 3O0RL 3VFTA 3CHOA 5HYFA 5EU7C 3S96A 1CYXA 1QSEB 4HMCA 2WTOA 2AFNA 3W0WD 1GAFL 4WY7L 4MYWB 4L9DA 1NMCB 4F7CB 4G8FB 4LCCA 3EUDA 4XMVA 4ZDHA 5I66A 5E8PA 3KL0A 4HJ0D 4KQ3L 2B2XH 2YAQA 4AQ1A 5D7KE 5IQ9A 5K39B 3PQYE 5IOKA 1DDHA 1CDBA 3KJ4C 5A16A 4S1SH 3FB8A 3T3PF 3EUUA 3NIGE 3V0GA 5LG1A 1GH7A 1U0QA 2WKOA 2YA2A 1QHPA 4PRDA 3T71A 1G7QB 3QFJE 2OK0L 4N90E 4FI6A 3SGJC 3ZTNL 1OE3A 1JFHA 2WMPB 2ZOKB 4TTDC 2NTFA 3NCYP 2V5RA 1EO8L 2KPWA 1F45A 1XGQA 3QWRD 5D1XE 2EIDA 3RKDD 1UM5L 2A6DA 3HS0C 3MBWB 3I3EA 1WS8A 4X5QA 4XGZA 1SEBB 2DQTL 3IXTB 3VB8A 2VLLB 4Z78B 3W81A 1T2QL 3RNQA 4BH8B 3O4LA 2UYLA 1KJVB 2JQMA 1I8LA 1KEGL 3GIZH 2OL3L 3QFJB 2AV1A 4Q6IC 3KJ6H 2Y3NA 4AQ1C 2ED9A 2O6EA 2VDNL 3ZTJG 4NQDE 1VFAA 2EYTA 4Y1AA 5SWZB 4CMMA 5GZOC 2OZNA 3PREA 3SY0B 3GTVA 4N1CA 3RB5A 1HXKA 2XZCL 2OXGB 4G2AA 1NCDH 2D3JA 1XR8B 1OP5H 5F97E 4PJIE 1G1YA 5ECGA 4DQOL 4FN0A 5ACMA 4UCFA 2WKOF 3GSOA 3U30C 3EF4A 3NTCH 5A16B 3X14B 5IY5B 3JTSB 2CJ3A 1QI5A 1WDAA 1KENH 4FQIL 2JI3A 3U36B 1XGRB 2FTAA 3HPLA 4O2EA 4UT6L 1QG3A 2NYZA 1P6AB 4AIOA 4L23A 3MRDA 5IHLB 2DEYX 3ZQWA 1X6NA 4M7LT 3O9WB 4W1TA 2JKJA 1N67A 1MDAA 6PCYA 3UDWA 3N1PC 1M6OA 1BBJB 3V52H 5I73B 3C60C 3FDWA 4NSKA 3GBEA 4OZGB 5KAQG 2ZYRA 5IJBC 4EBQL 1T3FB 1J5IA 3F7RA 1EO8H 1NEZG 2MOGA 1GSKA 2WO4A 3K81A 4FTDA 1DCEA 4MD4A 4PRPA 3QCVH 1B4RA 4OLXH 3FQXB 2BHYA 4OZHB 1LO4L 2EIJB 3C6LC 1CICA 1TJIL 4CA4A 4FULA 2L7JA 1WPCA 4ZRGA 2IJ0C 1QACA 3EYOA 1T22B 3KWUA 1SBBA 4QXVA 4I2XA 2B08A 3D2UD 2W60B 2CO6A 2TRHA 4QYAA 4ELME 1P4UA 4GXUN 4EF3A 1K72A 4PCSA 4AH2A 3FW6A 3QR2A 4N2LA 3DURB 5SX5H 3UFIA 4C47A 4K55A 1HIML 5B7FA 1HNGA 2VCOA 5KG9B 2YC1A 3PNWA 4R0LC 3VDCA 3K71A 1PQZB 1TCMA 1XGZA 3U46B 2KZKA 3IMVA 1H3PH 3DSFL 2R2CA 4GG8A 3S5LA 1KLFB 1EHAA 3SO3C 1IRAY 4FP8L 1D6VL 4MJIA 1MCCA 1WCQA 3QWRA 3G5XB 1PLGL 2IG2L 4J4PC 4WAFA 3VI4E 1OM3H 3QUKB 4EUPG 4BM7A 1YA5A 4WHDA 4NNXA 4FGMA 2XG4A 4KFZC 4JFPB 4ODWB 3KG5A 2OR9H 1XWVA 1CD0A 2BWIA 5E00A 2CRYA 4GFXA 4PJ7B 5CBEA 5I1AA 3QJHB 2ED7A 1MFCH 3FTUA 1EJOL 3QUXB 5CP3A 4LEOA 3LYRA 5HVWA 2GTZA 4AKOA 1UCTA 3BZ5A 2HWZL 3O8XA 1RZFH 4MLSA 2X0VA 1YDPB 4QYOB 5JHLH 3WXWL 4I87A 4J3TA 5DFAA 5TGBB 4A7QA 4ANKA 5CFHA 1B0RA 3GMQB 5AZEH 5MENB 2Q3AA 4PYHA 1A7OL 5I1IH 1A7NH 3AY4C 3QZBA 1QHOA 1XH3B 3EO1B 4EBQH 2YLKA 5DI8B 1JGVL 1KIUA 3JWNC 2VQUA 4NQCB 5EH1A 4PRBA 4X6FB 1M53A 4WU7A 5D7JB 5KSVA 1TJIH 1RVFL 4IKNA 2IVFC 3VG9C 4C4BA 3SBWA 2CA3A 2HAZA 4ODSL 1U95B 5KEZA 3HLAA 4PCTA 4P9MH 3RGHA 1NL0H 3M45A 1N5AB 5IK3B 5AYUL 1ASQA 4I3SH 1DQDL 3QXDA 4TPRL 1N6UA 5E6RB 3VE0B 4F1SA 1AANA 3QQ9C 4NUGL 5SX4I 3HG1B 4PRIE 1LILA 1ODAA 2YRZA 4PJ5A 3NPSC 2F54A 2YBRA 3I3BA 5BJTB 2FSEB 5CLZA 2QDWA 3N1GC 2A0LD 3ULVH 2YJQA 3PUCA 4XZ4A 4KKBC 3GMLB 4LAQL 3P3TA 2Y1ZA 1BQSA 5A2BA 4XT1C 5DJ2A 4L37A 3QQ4B 1XGPA 3SDYH 1CL7H 1X9UA 3KGTA 3VXSA 3BAKA 5H37A 3M1BB 1AACA 2G4GA 4H26A 4Y4HA 5GGRY 1TU2B 4N20A 4DW2L 4FXGB 5DQ9B 1I8AA 4QRQB 3HMXA 4LIQH 1EZSA 5IFJA 1NCAL 3K2IA 5GJSL 3BZFB 3S34H 1B88A 3EYOB 2R29L 3B9EA 2D3NA 2PXYC 2YEVB 1GXEA 1YAIA 1O6TA 1ZV5A 4FQJH 1J8SA 3EDJA 1KT2B 5I19L 1XQ4A 1K6QH 2ZSVA 2R56L 3MRHA 3Q8BA 1PG7L 1J1XL 2CNYA 3BFWA 4EAEA 4ODBD 4HZAA 2QQLL 4X4XA 1XSIA 4P5KB 1CGTA 2MNUA 5ICUA 1KTCA 1SLUA 5ESQB 1MZYA 1MCOH 4F5CE 1WA0X 4PJAF 2R8SL 1SMAA 2H26B 4WKZB 4N8UA 5J89A 2H47C 3MRDB 3UABA 3KPMA 4OQTH 4M5YL 3ETBF 3D9AL 3MSPA 4RH4A 4M1CC 5EHFA 1MFBL 2DYPD 3T3MF 3PP3K 4G11A 3CDGA 1TO5A 2P3YA 4PLJC 1NCCL 4XH2B 2PPDA 5E70A 1N6QL 2DMBA 1OGAB 5CEZH 3L3JB 3QJHA 2E0PA 5HVGB 2HTLC 2YK1L 1R24B 4R90L 5BVPL 1TVBA 5CU5A 5DZJA 3TEUA 4Y2OA 3AS1A 4JJ5A 2W8CA 2Y2YA 1CT8A 5I1KH 4L4VA 4IOSA 3ULSA 2R23B 3S3DB 5JMRA 4NAMA 4L3EA 1E2ZA 3N3EA 3FN9A 4NZUL 3ULUH 2IBZX 3V4PA 1G6VK 4CSSA 2G5BB 1T6WA 2N3JA 1RSFA 5D70L 3FFCD 1FH5L 1T5WB 4UBDC 5ESAA 5F7UA 3II2A 2YXVA 4WWKC 4TUJA 2P49B 2VC2B 1NGQH 1VJSA 4IGBD 3T6QC 1VDGA 3P9LA 4HJEA 5DVLA 2V5MA 4OM1L 1MLCB 3MJGX 2V7NB 4U1LB 5HHMB 5DO2D 1YNLL 1NLDL 1HKLH 3D3VB 1QRND 3D50A 4J27A 4I9WD 4NO5A 3RKDC 2P1YA 5B39B 4P0DA 2VAJA 1G7LA 2CO7B 5D1QC 3UBFA 1FFQA 1M71A 3GDCA 5TE6L 3S4SG 1HCFX 1A14H 2K8MA 2WNXA 3IKCA 4L1LA 1JGEA 3V9EA 4XNDA 1IJ9A 1RZJH 4ANVA 1ZD6A 3S97C 4GI8A 4NQEE 3JWNG 4I4WA 4JDVA 3JWDH 1MCOL 1LE5B 1KGJA 1BQLL 2JKXA 3FCUB 4KFMA 3PV7A 1ACYH 1RIUL 4WNQA 2BVYA 1PU0A 4AMXA 1N59A 4FG6C 4HDIA 2Q5BA 1DBKH 5LGJB 1I1YA 3F7KA 1MHEA 1J5CA 4N0YH 4NQVB 5BVJB 1K2DB 2ICWI 3BUBA 4JJHA 2CE6A 2CUAA 1K4DB 4FXKC 3QIBC 3DO7A 1MHPL 2XX0A 1FRGH 4AJVA 2CO2A 1L0QA 1R3JA 2QMJA 4M7JL 3QJZA 3QNFA 3A4DA 4OD3H 4PVNA 1A22B 3UADA 3DPBA 3Q8EA 1FFTB 1RUPH 2CDFB 3FUMA 3IJ7A 4LB8A 3BYTA 5IVXF 4XP1H 3GMRA 3N0PB 4B9IA 5INDB 1SXSA 2BINA 4JHAH 1WIUA 3IDGA 4W9CC 3F8UB 3DV4B 1EXHA 4ORGB 2W07B 3L1EA 4JVUA 5KYNA 3TA3A 1AFVL 4PY8J 5D70H 4N8CH 5E4EB 2Y2TA 3ULAB 2VW6A 5KVGH 4KK9D 3KGUA 2E86A 3S9DB 5IM7A 2MEJB 4PEEA 3PGCB 3MRMA 4OJDH 2WUBL 3HG1E 3RHWF 4MHHI 4BSJA 3DX8B 3T0ED 1OHQA 3P1VA 4L37B 3KWWB 5C0NC 3KMDA 3QRBA 4N8VA 3Q44A 4JREB 4ZS7L 4MA3B 3LPGA 2YBRB 5EU3A 4HK0A 4DGWC 1GRWA 4N2KA 4XVUD 5ANMB 2AITA 4LBEB 3MUJA 4FQ1L 3OLEA 3TGXA 4Y2OB 4XPAH 5ERWB 3WNJA 5KW9H 4HJ1A 3VI3B 4Q58C 4MXVE 2VABA 2QPEB 2YQBA 3CWGA 4NT6A 2FEEI 5DJCA 3T77B 4HPOH 1S46A 4N2DA 3BN9D 5F3FA 3H9HA 2P44B 3L7FB 1JZ8A 1W0WB 2GYSA 3HBGA 3DX9A 3HE6D 3VD4A 1INEH 4ZMXA 3EW3B 4BZ2L 3NJNA 4DKTA 4CJ0A 4DPRA 5ITBL 5AW8B 1MF2H 4PJAE 3ME0A 1TJHL 4JM0A 3TX4A 4NFBA 4FNTA 4ISVA 4PJ8D 4JR9H 2OR7A 3O2VH 3LKRA 1I7RB 2VXTH 3DX7A 2Y1YA 3RRQA 3MRGB 4X5XB 4N1EA 3HZKA 4OJFH 3LEXA 4DGIL 2D4DA 4ZUVB 3UTPD 4LO9A 3MRNB 4PB9L 1JFQH 1FYTE 1L0YA 3FUEA 3DROA 3RX7A 3X11A 2WUBH 2X4TB 4FKHA 4TSBL 5EU6E 3PGFL 4JO2L 5F6IB 3G6AB 4GW5B 1QYGL 3IWUA 1A5FL 4AJ0A 4B9FA 1L9OA 1E4KA 4LSQH 3VD5A 4PBDA 1B4TA 5D2LA 2OCJA 2XBDA 5DJYB 5FDWA 4XVSH 3PWUB 5KUKA 4JDEA 4NNYA 1AD9B 1GS7A 1RHFA 3FYIB 2HKAA 3KGRA 4TNFA 5K1JA 3REVB 5HI5C 1XZ0A 1SYVB 3BUPA 5KW9L 3G08B 5AAPA 2RR3A 4MRCA 1ZA3A 5FFLA 3P77A 5JHDD 1E50A 3G9AB 4NJAH 4KKBD 2D03H 4Y2DD 4WEUD 4BV1A 1T5XA 4OLWH 3AADB 4JFFA 1BSIA 1JZHA 5ALCH 2WLIA 3BUQA 2FB4L 1CLOL 2EDQA 4D0DA 4GP5B 1EA9C 4LLWA 5L7XH 4YL9A 3HHMA 3VXNB 1I7UA 4QRPA 1R19A 4PJ9D 3O45A 3HZKB 1A1NB 3UO8B 4ANWA 3KPSA 1UOKA 3JYCA 3VFSB 4F33B 2LOEA 1ZDSA 4XXCA 4ODVL 1N4XH 1VZIA 4L8SA 4PREA 1CJYA 2D4FA 1A4JB 1OALA 1TZIA 3NPZB 5IB4A 2KQMA 4I0CC 3OB0K 4G70B 3MLWL 3KBEA 2AQSA 4KI5F 4UOZA 3IBOA 3JV6B 2AC0A 5BMFH 3SDDD 3CIAA 3NSDA 4IRSC 4K3EH 3P73B 4LK4A 3MV7B 3U1SL 4U49A 2HRLA 3FRUB 3QHFH 1YC7A 4P2QB 3V6OE 4JO1H 3ZTEA 2EH7L 5GGRA 4TSBH 3JZ7A 2XYBA 4WWNA 4WUUA 4IJ3B 1CFVL 1IFRA 1Z0NA 3L9EA 4JQVC 3RPIB 1FJ1A 3HVDA 4ONHB 2QADB 2TSBA 3HS8A 3T1FA 3DGGA 4ODWA 4GKSB 3NBNA 2QV2A 3N06B 4UQ3B 4WV1A 3TIEA 2NY2B 2XZAH 3QEHA 3CCHA 5KVFE 3GSXA 5C09E 3BEVB 5F3BA 3JVGC 3P2DA 4GO8A 4OLEA 5DZOA 4XC3H 3V5HB 1IBYA 1KLGB 5E0FA 1IGFH 1TETH 1QUNA 3KPQB 1CG9A 2ZKXA 4DCQB 3ARXA 5ALBH 5ETUB 1IARB 1BJMA 1LTXA 1NC4D 4YVNA 3L4YA 1AY1L 1G7JA 5HGHB 1UVQA 1YEKL 5GGUA 4KKAD 4UOQA 2AAVA 4YQXL 3LKSB 4XN2A 1CFBA 3REWA 1FN4B 4C55A 1OF0A 4P3CL 2VXSL 1DE4B 1NANH 5EZPA 1T0NA 5HGDA 5INCB 5TD4A 2JJWA 4NI3A 4CVWA 2H0JA 1JYWA 2LU4A 3T65A 3DUSB 4PJEE 5EU4A 4MMZB 3NJXA 1RIHH 2ICEC 4X6CF 3I6KB 1FLTX 1MREL 1DVFA 1J5OL 1RHHB 5D1QD 3K0WA 1ULVA 3EO9H 1NUGA 4PGCB 5CR8A 2OCCB 4MXQC 3ZDZF 2J71A 4K3EL 1OB1A 1V7MH 4W68A 5DTFB 3DO4A 2EUZA 4NQED 4HD9A 4CMHC 2ZX9A 1QPXA 4K94C 2UWEE 2AK4B 2QMKA 5DT1L 2FWOA 4JY6B 4ADGA 1NFDA 4JPIA 1GYUA 2H0FA 4HUCA 3BAWA 5K9JH 3QS2A 2FQEA 3NIFB 4WV1C 4XBMA 1B9KA 3PWPE 4WDIA 1T0MB 3UTSB 4BK8A 4QLRA 4L2LA 3OMNB 2V7HA 4B95C 2XZAL 3LKQB 3L9RA 3V6FA 2VC2L 2GJ6B 4HKJA 3HRZC 3SQBA 4JPQA 1QA9B 3CFBA 3HI1A 3AREC 1ZLDA 5K59E 3A4AA 4IDLA 4MVBD 1I4FA 5FR3A 4CU6A 3DGCR 4S1QH 2FO8A 2VXQH 3E9UA 2GHWB 4MCYB 4YSDA 5EBLB 3P69A 2ZP9A 4MWFA 2XTLA 3LEYH 1L9MA 1W80A 1YQVL 2PW2B 3PP4L 5DEFA 4BRJA 5GZNA 1YPZE 2DKMA 4UDUB 1WFMA 5KBPA 2R59A 3JUZA 4NN7C 4X6CA 5C0IB 4XPTH 3GSWA 4QRTB 4QXWA 4TXVB 1E4XL 1R5WB 4C57C 4N9GA 5AVZB 1SLVA 2GUOB 2K7PA 5DGQA 3K46A 2BVUA 3PAYA 1AQHA 2YGOA 4XGZB 3D08A 3IVKA 4KK9C 1IVLA 1Y6NR 4RNRB 1CTNA 4PJ5B 1NTDA 4AEEA 4X7TB 5C0EB 1CD8A 2PYFB 1AS7A 4GKSA 3QRGL 2NTFB 2TAAA 1YYLH 2Y72A 1FVCB 4GLRI 1OLZA 2RB8A 2TRYA 1RPQA 5F7KC 4HSCX 4Z0XB 3RZCA 1AHMA 3RPIA 1H3GA 3KPSD 2XYCA 4L8BB 1N64L 2Q6WA 3LNGA 1EFXB 4PJ9A 4H0GA 4R8WH 4XP4L 5LNGA 1JMZA 4AYFA 3AQXA 4BDVA 3RIFK 3ESVF 3UBHA 4DH2A 3PF2A 3WJMA 3O11A 4ACPA 4LCYA 4AK1A 2GHZA 4F57H 1PEZA 3SBRA 3EGSB 3QG7L 2EVHA 2VXVH 3PAZA 2ADJA 5E6IB 5H94B 4XTRD 1G7IA 4B0MB 1UEYA 4PJGA 4Z3HA 4Z7WB 4HU2A 3FULA 1S78D 1NKOA 3S36H 2WXJA 4EI5B 1OTUC 5KANI 2WLZA 5GHWL 2CO4A 1OP9A 3MV8B 4LQ1A 2JMRA 2RTTA 2APXA 4XE0A 4I9WE 3X3GL 2DQUL 1DQMH 5J11C 4GG6A 1QKZH 3VM7A 5FO2A 1S7UA 3QB7C 5J12C 1NKRA 5EWIL 5KAQF 3WBDA 1BMZA 1KIPA 4NPKA 1KC5H 2Y7NA 4YHPB 1ETZA 3A4EA 4XHJC 3NABL 1ZJAA 5TE7H 5C6PB 2VLME 1MWOA 3LEYL 2AQ3A 3B1UA 4RA3A 1KCVL 4J3OC 5J06A 3L3HA 1T66C 4XPTL 3NTCL 4JHVA 3V79C 3TYFA 1AQKH 1F4XL 5DJ0B 1HHIB 4M8QB 1UD3A 2R0ZH 3FU8A 1G87A 1HOEA 4NO2B 5ICZB 5SWQB 2ZPKH 2KPNA 3CFIC 1KOAA 1WYJA 1RUQH 5L4JA 4PP1D 1M7IB 2YJLA 3LHPH 5DJ6B 1RI8A 4AEFA 2EYRB 5E1HB 2DM7A 4LU5H 5JXAL 4ZOCA 3EJZD 2WWMC 2AABL 3RTQB 5CS7A 4GXFA 4OLVL 4XN1A 3D0LB 5F7AA 4U6TA 2VDQL 4MAYC 3GJFH 3VXMA 4F92B 4EDXB 2ZXEB 3TURA 1GGIL 1IAMA 1QLEL 1WJ3A 2IO5A 2X0WA 3AWFA 3DX0A 3FQ2A 5MENE 2FX8H 4TSAL 3RL1B 5K9QI 5IJKA 2CCWA 4QIRA 3B5HA 1IBGH 3WXVH 4KXDA 4TQEH 2NY0B 3MLUH 2UUDK 3ZDZB 4JS7A 3OAYK 5EIIG 4KRLB 1ZSHA 4J3VA 3KWXA 3O3DB 2YUZA 4FMFA 2VDML 3WUWB 3QC5X 2VZVA 5H2BB 3QORD 1QR1A 3ASWA 4GKNB 1FDLL 3COOA 1DBJL 4G9DB 1MNUL 2JNZA 3QJFB 4Z7IA 1BMWA 1KG0B 2XTJB 5FYKU 2YAFA 3B9KA 4LLVA 3WFCL 5L6YH 4Y2DC 5GS0H 4LQFL 4QWWC 4L8BA 2Q6WB 2DQUH 3NZUA 1QKZL 3T4AB 2A9BA 4ZXBC 1LVEA 1BZ7A 3M17A 2O61A 3NP3A 1H3PL 3H85A 5C0EA 1T1YB 3BKJL 5DWPA 4Y7MA 3OKOA 1J1PL 4GW1A 2N7BA 4RFNB 4ZW7A 2B2XL 4XMLH 4RNRA 2APSA 4C56A 2NNRA 4ZW6A 1U8MB 2QTEA 3EJYC 3VWKA 2R2EB 4MCZB 4M48L 3HBQA 2QKIB 3OHXC 4AG4H 4KOCA 5BS0E 1YMHB 2JCCA 4WK2B 2CIIB 2NY0C 1F4XH 3BD5A 1CLVA 5FS5A 1TJXA 4PP2B 4IS6A 5B22A 4A39A 1MI5B 5K69A 2JQZA 1EJOH 3N1FC 2ZWKA 4XO4A 5I1HH 3LHPL 1AJ7H 3K2UL 1UT2A 1A21A 2R1XB 2Y07L 3NIGF 2QPDB 4MB4A 4OY9A 1N12A 1CCZA 2F8OA 4P04A 3WJMB 4NENA 5E4AA 1UM5H 3ABKB 1U42A 2AABH 3EZ8A 1B0GA 4TQPA 5E94B 2BSCA 2VDKH 4P46C 3WMQA 3PS6A 4JVPA 3HZVB 3RGVD 2Q8AH 5I1IL 3AITA 4PY7A 4RGOL 2EUVA 1S9YB 2UY7B 3AT0A 3H0TB 3CHPA 3KL5A 4NXSA 3WE6A 5EFIA 2R2HA 1JGVH 2PO6A 1PD1A 4CN6A 1UA6L 4BSWB 5GSRB 2ICCA 5JOFA 1UKQA 4NQTA 5AG9A 1CDCA 2X6UA 4P2OA 5M95B 2KYIA 4X7TA 5F7MC 4OBRA 3RZCD 4G82A 4FZ8H 5IJVA 1RLBA 2VLRA 4HFUL 3FQWB 2FGWH 4BWUA 3FC8A 4DP1X 3EOTL 3UPAA 1SN5A 2FO4A 3B5TA 4HXAH 4X4YB 4KXCA 5EEYA 3JV4B 1GGCL 2I5YL 4BKTC 2X4OB 4I88A 4QNPE 4Z7AA 3POHA 4RDBA 4A7VA 5J3HD 4HV8B 3EYFA 3E38A 2X6MA 3TT3L 1DDHB 1ICTA 1S5HB 4J3OH 3NFNA 1M1SA 1ML0A 2KZ1B 3OTTA 3DJRA 1QFWI 1MPAH 1IC1A 4P46A 1MQ8A 3B37A 4H8WC 1YYCA 2ZT9C 1LYQA 4AOFA 5GXBB 2UVFA 5GS1A 5EF3A 4DTGL 1BGXH 1S5IL 2QSCL 1XL4A 3LB6D 4MZRA 1S7XA 5F9JB 5JDJA 1EEYB 2DIJA 1FL3B 3GLEA 3JTSA 1MVFA 4JPKH 4WWPA 4JY5H 3CD4A 5DJDB 2APBA 3V52L 3WUWG 3VXUD 1UQSA 2WIIB 1FFNB 4XPHL 1T03H 2A4ZA 1YY8A 3SQOH 4Q2ZA 1OTSC 5B3JE 3K2UH 1HXYA 4KROB 5KYYB 5FW7A 1GJWA 1XTLA 2IH1B 2UWEF 3HMWH 4PI2A 1S3KL 2YKLL 2X1OA 1P1ZA 4BE6A 2BMKB 3CDZB 3C2AH 1LQBC 5B1CA 1J1XH 3FO1A 1HH6A 1BV8A 5ID0A 5ENWB 3UTQB 2BIMA 3CDCA 2W5PA 4L48A 5D1XD 3LZRA 4FKEA 3PABB 4HUMB 4PVLA 5AVRB 3X1FA 5BCAA 5GGSY 2NNAB 4KMQA 1I3UA 4AT6B 1MSPA 2RJMA 2ZSWB 1H19A 4U0RC 5L2KA 2NY7L 4NWTH 5HYSA 3GXUB 1P6WA 2R29A 3DC0A 1ZXKA 4LDCA 2GTQA 4M5YH 5ESAB 5C8JB 3EHBC 5HHQA 3QZOA 3MGOA 4HXAL 1OCOB 2QDVA 4U2YA 1U21A 2N7SA 3BW9A 4LCUA 4OCNC 1SMDA 1N70A 2ZUTA 1FNHA 5GISH 2FO1A 3S2CA 4G6JH 1WSST 1LO3H 1N6QH 1P5UB 3CGTA 5KVDL 3VQMA 3W38A 1E5BA 4ZAKB 5GIRA 3RWCA 4Z7NB 4YSQA 5KN5B 3JWDC 1KB5B 2DJ4A 2BP0A 2PLTA 3VXOA 4ZX6A 3KXFA 4MMYB 1B6DA 1MFAH 3B9KD 3WDIA 4G6FD 5D1QA 2NYKA 1KB9K 4M7LH 3BXNA 3DMMA 5ISZA 3N1QC 3C5ZC 3OGCA 3VXQA 3OMIB 1WCBB 4L3CA 3VD1A 2QSCH 4PJCE 4D0CA 4TSCH 3PWPA 2XN9B 4XZUB 3D39A 3W82A 1OD9A 4KVCL 2EDRA 3WS3A 4P2RA 3TONA 4HKXB 4UT7H 2JI1A 1NM4A 1TZGL 2FR4B 4OSUH 1Q4NX 1DQLL 2BRRH 2FHBA 3MKGA 3P4NB 2X05A 4AE0A 2KI6A 5SWSE 2BHUA 3GSVB 5A3IC 1J8HE 1Q9OA 2R2EA 4MCZA 3BH9A 3U4BH 5C07B 2CHDA 2CH8A 3OJ2C 5CJBA 4P23C 4HEPG 1NL0L 1S78C 3SBWC 3K72A 4YPGB 1JNHA 3WFHA 5A2JH 3FHEA 4P07A 1DQDH 4TPRH 2ADIA 5LWYL 2EICA 1NUNB 3GDBA 2NY7H 2X1WL 3WO4B 1UATA 2Y36H 2WGNB 5AG8A 5AOMA 4F33A 2IWKA 1CTMA 4ALAH 1QW9A 4MA8H 4YDKH 1UH3A 1EGJA 4RRPG 3ZGIA 2ICEB 4TVSa 3H6JA 4HV8A 4ZTPH 2NUTB 3SPHA 2CNZA 2J20A 1NGYB 4MX7B 4CADB 1RFDL 1RZ8B 4MLIA 3SOBL 1LJMA 3H9SA 1BW8A 4X42A 1RK1B 2XA8L 3H53A 1KGIA 2YMXH 3CZSA 2E3VA 1JNLL 5F9AC 5IJVB 2LTQB 1F90L 4OGQC 4R5TA 5IEHB 1QQDB 2WLKA 1C5DB 3GKWH 3WNNA 5HHXH 4KOBA 2YR3A 4PIBA 1BAFL 1TQCB 4XOEA 2EXWC 3S37L 4LOUC 3G5ZB 1UG9A 3EOBA 5I0VA 4L8SB 3GS0A 4U1KA 1VCAA 4N8CL 1NWOA 4JDEB 5KVGL 3PWLA 1P4LA 3SD5A 2EVGA 1ZWIB 2O5XL 2CUHA 3CBKB 5FDYA 1PGRB 5MERA 4F1ZA 2V37A 2ADIB 2DWSA 5EZLA 4JRLA 4XO5A 3DTXB 4AUUA 1Z5HA 4D9QE 1SYSB 5FECA 5LNDA 5KJRL 1ILUA 5ERWA 1A66A 1MFBH 5HYJA 3GO1H 4GW4A 4R4NC 4E0RA 3BQUD 5B4MC 5CHNB 1XV8A 2C7FA 5EOQH 4XCCH 3B7RL 1E4JA 2J1YA 4G8EB 1URZA 3AB0B 3VG0L 4TVPL 5FGSA 3VI4B 4AGMA 4ODTH 1XEDA 2W95A 2CWRA 2BH0A 5T33L 3QQ3A 3JWOC 4DESA 5G5DA 1BA9A 2NY4C 4KQ0A 5ENWA 4G9FD 3ZDYE 4XBGA 3ZKND 2NT0A 4L3CB 1PKQB 2PPEA 4KK6C 1L4IA 2CDGB 1OGTA 2CJSA 5GRUH 1QO3B 4YHOL 1NMCC 5GGTL 3R1GH 3MNWB 1PX3A 2M1KA 1SOQA 1UQSB 2WIIA 3PPSA 2HVJB 1ZHKB 1I8KA 2NY6B 1UD5A 3S37H 2F9BT 1FL3A 1HNFA 4GAGH 4NCDA 1ZCRA 5C08E 2CO6B 3P0VL 5GRJH 3LQMA 4A6YH 4FNPA 2FX7L 3ARFB 4P2RB 3QRFM 2WTRB 1P6FA 3MNVA 3PHOA 3BRGC 1OE2A 1JFQL 1G9NC 3ZZ1A 3QJXA 2VN4A 4YSRA 5E24E 2DI7A 1BEYL 2GUOA 2EC9U 5HTSA 3BVUA 5ISZD 2P5WD 4YDMA 4QRTA 4HC1L 3QI9D 1IEAB 1F58H 2NXYC 1EDQA 2CXGA 5KJRH 3SZ6A 2I9TB 3WY3A 4XVSL 1CLZH 3WIHL 2Z91B 4LSVL 3O3BB 1JPTH 2HX7A 1H15B 1HQ4A 1KIRA 3EH3B 5KVEH 2CGZA 4OKVB 3INUL 4YHKL 1JPSL 2BIHA 3VFWA 1MHPH 2VDOH 3BD4A 4U1MA 5FW8A 3SO3B 1F4AA 3HNSH 4WCYH 1MCFA 3PHQA 3UZEC 1SDDB 1VAHA 2FYVA 3LIUA 3LNIA 1JG9A 1FSKC 1JWUA 1KXTA 3EYUH 3QJOA 2A9NH 5DRZB 1J86A 3WDJA 5I0YA 5IMMA 4LARL 3LN9A 5FKPA 2VR7A 3FFCE 4FA6A 3RY5A 2GSMB 1AFVH 3VFRA 3A24A 1BFTA 3D52A 4U3HA 4WO4C 3DETC 5GGTH 2ADJB 1OF2A 5E6IA 1N0LA 1X5LA 5GRXG 1UASA 1CLYH 4PJBA 5DRNB 5E9DD 4EVNB 2VMJA 4LEXL 4S1DD 5EO1A 2QQKL 3G6JF 4JZJC 3NJGA 4PB0L 3K0YA 3K6IA 3RBGA 3S36X 3HZMA 4F91B 2G2NA 1G9HA 2EP6A 3MRFA 5AVQB 3SQBB 4WQOA 4I4WB 5L2KE 3VNYA 3TEZA 4PLKC 4I13B 1CYWA 1QFWM 3MAWA 4ZMVA 4N0CC 2XQYA 3ZMEA 3E8UH 4GSDH 1U8PB 1I85A 4F37K 3A3YB 1T1YA 5D1XC 4HIQA 1TNNA 3FQRB 2UY6A 2WLYA 4UIMB 1ZOXA 5EN3A 1PFCA 1BQHB 1CFVH 3Q43A 5I1LB 1NUDA 5D2NC 4NIKB 1EZVY 2DRUA 3LV3B 3NCCB 3NJKA 1QLFB 3BKML 3EHBD 4K5NA 4N9GB 5C0CD 3KHQA 3CFQA 2GI0A 1VERA 1JPTL 4OZFB 2YA1A 4IIQB 4F93B 1DUYA 4JGUA 1YNKL 3INUH 3KYAA 3SDXE 3H7BA 3OR7A 3N41B 4DO6A 3RVXC 1EVUA 2BPBA 3T6VA 5DYOA 4G9FE 1O6VA 4HOWA 1MRDL 2UX6A 1Q0XH 3WMPA 3IPEA 3VFTB 4W70A 3C60D 5FCUH 4HAGA 1MCPH 1DE4A 3Q13A 2NSMA 3NFSH 3BH8A 5DMIL 3RGBA 3TN0B 3QIUB 3I75A 4KTEL 2PO6B 1U8NA 4TRPH 1Z2KA 3WSQL 3S35H 4W9KC 3OKKB 1KF9B 1BJ1J 2XFXA 5I82A 3LDBB 1ED3B 4HJGB 3VXTA 1HL8A 4J5VA 3VVVA 3KPOB 4AIEA 3H3BC 5CIPH 1ET7A 4BFIA 2PW1A 3OV6A 2XA3A 3ARDB 4QTFA 3QQNA 1QSZA 4L4TA 3MRQB 2O5YH 3VFGH 3EBAA 5C6TH 3WKYA 4ETQB 2J5LC 2X89D 4PVBA 1KBBA 4L3ED 3APMA 4QAMB 1QYGH 3VWJD 5ESQA 1A4JA 1TZIB 2AMUA 4XMZA 2XG5A 4G9DA 4L8DA 5KS9B 2AQTA 3WDHA 4ZX3A 1K5NB 2XVGA 3KYKL 1IAKA 1SBSL 1M42A 3QEQB 2P8LB 1ETZB 3FBQA 4M8RA 4Y19D 4PV8A 4N8PA 3SKUD 1ZA6A 2UZYA 2VAAA 3FU7B 4PJGF 4KI5C 1LP9A 3QFDB 1NZRA 2CJUL 2F53A 4JFFE 4XN8A 5DS2A 5FFGA 3DRQB 5CN2A 3LJ3A 1DLHA 2CGYA 3SYQA 3TV8A 3DTXA 4XNYL 1A9BA 2MTAA 4MASA 5E2VH 1T04A 1U8JA 3U7AA 4E2OA 1TZ8A 1WLHA 4OFDA 5D6DA 3SPCA 4QRPD 2YKKA 2XWBA 3GMNB 5LBSH 5JDSA 1Q0XL 2CKBB 1AD0B 1DSFH 3A6CH 4N2MA 3SY6A 2WBXA 3FZUC 3MI6A 4QHUB 5LQBH 3CXDL 2ESVE 2WXRA 1CB4A 5I1AB 3BHBA 2BERA 3ASOB 3G5ZA 2FD6H 4H88L 4DK3A 3CFUA 3NFPB 4TVUA 1HDMA 5DFTA 1AXIB 1Q94B 1IM9D 2DTSA 3QDGB 3TL5A 2XWZA 1ZK9A 2B20A 3CXFA 4DFHA 1FAKT 3AXHA 1FHGA 4UT9A 1JZ2A 3SPVA 3CX5J 1IV8A 3K5SA 3ZKXB 1E2WA 1DUZA 2BVTA 2EYRA 3MYJA 3QAZC 5I18H 3QUXD 4AQEA 3QRGH 3TBTB 3MLSH 1RK0B 3QIWA 1UWGH 5FUCC 3ROLA 5LO7A 3TBVB 3BX7C 3SYAA 1XF5B 1R47A 5MENA 4FL4B 1P5UC 1DZBA 2QHLA 2Z4QB 3SPJA 3U6RB 3ES6A 4H25B 2VZSA 5SWSB 2IGLA 3MXWL 3QPKA 4ZFOL 2IQAA 5D93C 5FA3B 1TETL 3TM6A 3KLAB 2Q86B 5L4MA 1ZLSH 4P4KA 2E7DA 1QSFB 4RGNE 3QIBB 4MJ6B 3TTYA 3FTZA 1U95A 3TYGH 3VI3E 3NMEA 4PRPB 5L9DL 1J18A 3CPLB 3QGVA 3HE7B 1UYWH 3HC3H 3K8KA 1D5MB 4IBSA 4PMEA 3HFML 2MNJB 5CP3H 2DQGH 1TENA 1CF8H 1N8ZB 4BFRA 1B90A 2MCPH 2NXZD 1X5YA 2NQCA 3FJTA 4YDJB 3IGAB 2B1AH 4L4TB 4E41E 2ZOOA 3NABH 2CM6A 1FO0A 3ARBC 2W38A 2XY1A 4LSPH 4Z18A 1ORSA 1UACH 1R5VA 3KR3L 4CAGA 2DBLL 3DX9B 4NHCL 5DD6B 5IB2A 1OT2A 3U79A 2D9QB 2HCZX 1RUAH 4NQSB 5ECJE 4N2IA 4RGMC 4LRNL 4WGVB 2DM2A 3V0FA 2VLKE 4Z7UB 1ZS8B 1IQDA 2EVJA 1E6OH 3PL6B 4GXVH 4HGMA 4JY4B 1LO2H 2YD8A 5FGBA 1ZAGA 4IOFD 2XWDA 4TOYL 4UM9A 3X11B 1JBJA 1O7DC 3SY0A 2DMCA 2R27A 4PS4L 3M46A 3QI9C 3BJ91 3O4LD 3I9GH 4YPJA 3ISRA 1VIWA 1OAYL 4IBTA 1UUSA 3VXUE 2BY0A 4ABQA 5BW7A 1GGIH 5I76A 1NANI 5F6HJ 3TF4A 1OWWA 2YD0A 5T1LB 1EERB 1KGCD 5KANG 5HJGA 1AGFB 1MI5E 1PYWB 3P3RA 1V7NH 1KBGL 5D2NE 3IFLL 1JE6A 5BUPA 2O30A 4WFGE 3VD3A 3CFKB 4O2EB 1YPZA 4IMLA 3GSXB 2Q0ZX 3CFDB 2XC8A 2AQ2A 3HIZA 2VZ1A 1YQVH 1UYWL 3HC3L 4Z7OE 4ZD3L 1ZKAA 3LKQA 4U6XA 2HMID 1UCBL 1YAZA 2QVMA 2MCPL 5CR1A 2QKIC 3OHXB 3BAXA 3FF7A 5FO9A 2WLJA 3VQ2C 1OGAD 2VSDA 2B1AL 4LVOB 4Y5YB 3GLAA 4PRAB 1VGEH 3R19A 4O2CB 2BSSB 1JNNL 4WU5B 3UGUA 5C0JA 5J9PA 3D25A 3D07A 2BZ7A 4LBAA 2J8UF 2OMZA 3HG3A 4M48H 5FWQA 3UJIL 5LHDA 3QFJA 4X6EA 2V7NA 3O8XC 4CC4C 1HHGA 1YEGH 3M07A 5FGBC 4JFTA 3EF7A 3BPCA 3FFCB 4UQBA 2NNAA 4OCSH 3OAZH 1RIVL 1NPNA 4GI6A 2JH2A 4WW2A 1LO2L 1A64A 1URIA 1KLGA 1KCUL 2DM4A 4AVHA 2C3VB 2CAKA 1B4LA 3BGMB 1OZUA 4YHML 3CCHB 3BGFB 5ID0B 1LE5A 1ZHLA 2VDKL 3WFZA 2H2PD 2WLIB 3KJ6L 4HD5A 1NBQA 4YDIH 3IGLA 3T0BA 3CJJA 2XOTA 5HDBF 1AHKA 4XCFH 1Q1JH 1MFDH 3CX5K 2FECL 1C12A 4M61A 4PWGA 3D69A 1E28B 3JXAA 4X6DB 3L3DA 4KK5D 2B0SL 3SDDC 4F9LC 4KZDL 3ALWA 1UVQB 4MA1C 4OV6F 2QPSA 1AGCB 1NCDL 4XO3A 1KBGH 3B83A 4A67A 1PCSA 3FT2A 3FT0A 3QDGE 4YN3A 2V2TA 2NYYD 5J6HA 1ZHNA 5DZVA 3P9LB 1IC7H 4PHZA 1KC5L 2H2SD 4PCYA 4NYLB 4B97A 5L4IA 3FCGA 3PHOB 3F83A 2DY2A 2MWCA 2F54D 2W88A 1P9MC 3LNEA 3X17A 3LXBA 4JG1L 3VXPB 5I8KH 1MFMA 3RVTD 2BVPA 2B4CC 4YZWA 4E9SA 3Q6GL 1V3LA 2X28A 3KGSA 2HFGH 2R0ZL 2KMWA 2WZ6A 3DYPA 1CT8B 1J9TA 3B9DA 4NQQA 4NZJA 2ZQKA 5AAWA 1VGEL 2G60H 2P8PA 2E27L 3FPXA 3V55A 2CBMA 3ULUF 4TN9A 1S5IH 4NQXB 1GGBL 5EF2A 4LAJH 3WTVA 2YQ2A 4IRSB 4JCLA 3FTYA 5JPNB 3WUZA 5I0WA 2VNCA 2IQAB 1S7WA 2XRAH 2Q10A 1ZE3H 5C71A 4P5TB 2DQFB 4W9FC 4MJ4A 5DEZA 3NGBC 4YAQA 3MV7E 5IQLA 5DMYA 4XPHH 5HVFB 4AQOA 5HPOA 1BYOA 2N0KA 4TNVF 4HUUB 3MBXH 2I26N 4RGND 3UCRA 3SJVB 3CQQA 2ARJA 3D7PA 3Q48A 4TQEL 1N0XH 5CJQH 5LNEA 3ROLB 2J8UE 2ITDB 2X88A 3WIHA 2H45A 4MZ3A 4HCRH 4LHUG 3BSZL 2KDYA 4KKPA 1IZKA 4QEGA 1OSPL 4O2FA 2BVQA 3UACA 5KYUB 1IAIM 3E2HB 3WO3B 3WE1A 4IGBC 3DSFH 2ESVA 4C59B 1SFDA 1BVNP 1E30A 2ADFL 4LCWA 5AYQA 1QBLL 5E5MB 4AM0A 3BZEB 5FO7B 1UXWA 3BZFA 3J2PA 5JW4M 2HPTA 5JIMA 4AV0A 4AYSA 4RLDA 1T7WA 1KWKA 1JJUA 4OUUA 5TFSH 4HOXA 5KSBF 3DOHA 3FZUD 2CHXA 2DI8A 1F42A 2WINA 4DP7X 5BZDB 4CRPA 1ODUA 1UZ6E 4P9HL 1MFCL 2QPFA 2VISA 4DHLA 4FERA 1T1WB 3MX0A 4KVNH 2F7QA 1I1RA 3V4VA 2FX9H 2O6CA 4JFEA 1U33A 1N5YL 4ZMYA 4EI5A 1V54B 4XN5A 2IDTA 5C0RL 2I07A 3RDTB 4A2DA 5EZOH 2MCMA 1KTDB 1I1CA 1DJYA 3OG4B 5BRZA 1MG3C 3IDIB 2P43B 1EEQA 1KPRB 3B2DC 4FI8A 4PJHE 3RPKA 3DOSA 3HAEG 1AC0A 2YD3A 1OAUH 2VR9A 4NKMA 2Q8AL 1DJXA 4X4MA 1KJ3L 3DXAA 3G5YB 3UO1L 1MZZA 4D7PA 4DP5X 3NVQA 5JW3H 3EJQA 1FVEB 5DUJA 4D94A 4APXB 2WV3A 1A3LL 5CJQL 4JFFD 1PZ3A 3VB9A 5C3TA 3GIVB 2G9HA 2J72A 4OJCA 3SHSA 4HUNB 3EOTH 4Y4HB 1L3WA 4V1DB 3CBRA 2ODHA 1GGCH 2I5YH 3PPEA 1H8NA 4P5MA 4UINL 3L8QA 4IBZA 5I8EA 2IPTH 4PW4A 3TH4T 3U7YL 2DI9A 1GS6X 1ORQA 3OAWA 4PLOB 2DKUA 3F3HA 3F7PC 3PGCA 3SODB 1W6LA 4E42B 2Y36L 4IBQA 1FL6A 1HH9A 2C9UA 4GLRH 4HWZB 1CURA 4ALAL 2NW2B 3GRWL 1KPVA 3NPSB 2OQJA 2NR6A 3CVIH 4M6MH 3FB5B 2X4PA 4DW2H 2VQ4A 2APVA 4G8GA 1XGUB 1M71B 3SB3A 3FB7B 3QUMH 4HK3N 1SHXA 1S7RA 5HDBE 3ZE2B 5ANMA 4AXWA 3ZY7A 2BNQE 2I27N 2VO8A 1PJ9A 3FO2A 4JQIH 1ZTXH 4M8VA 4NO5B 5EUOE 1FGVL 3TCTA 4ATWA 4L29B 1DJZA 1JHTB 1KJMB 2CCLA 5KSAD 3ILDA 1Z5LB 3QEGH 1JXKA 4Y5XC 4EIUA 1FC1A 4EZJA 2JCWA 4WWID 5T3ZL 3FQUA 4JRXA 4LHUB 2YEQA 4FQJL 4NSKB 3NT0A 3VXUA 3POCA 3SQOL 5FYKE 1K6QL 2IADB 4GO9A 4P06A 4PTTA 3VO0A 3VX0A 3MRKB 5CINH 1WBYB 4ZMTA 3WY2A 3DHUA 1QFHA 3O9WA 2QQLH 4FNLH 5AW7B 2E7LA 5BVJA 5I26A 3PWVB 1I7TA 2CKBL 1E8XA 1NFIA 1V8HA 1OAUL 3TO4A 3MLZH 2ZYHA 1KN2L 4KTDH 4YE4H 2WOBA 4MD0B 4WI3A 4M5SA 3H2WA 7TAAA 2RH0A 4PBWD 1D5XB 4KKQA 3VD9A 3D9AH 3SCMC 1PL3A 1HESA 4XXCC 2VLKB 4Z7UE 2GJ6A 2WUCL 4KKAC 2JIXD 4X50A 4DP0X 2OYMA 2VW4A 1WWAX 5BZXA 1S4IA 3QZLA 3C5JB 1H6FA 3V8CA 1MLBA 1E0OB 3W9EB 2ZWYA 1XBDA 2CRZA 5DRNA 1WITA 4H8VA 1IGTB 5GISL 4EVNA 3UPRA 1G9NH 1OK0A 2YGQA 3P30H 5CM1A 5IB5A 1JRHL 4X5RA 3AG3B 4BJLA 3TH3T 2BDNL 1DQKA 1ZK5A 4WFHD 2ZWZA 1DFBL 1XXDC 5E4IA 1TLMA 1KXTB 5IMMB 3K71B 1BIIB 1INDH 2VLLA 1NCNA 3K2MC 4JRXD 4WI0B 3ZT6A 2V9UA 3EH1A 1ZHNB 3V4LA 2Y7OA 1TXKA 2NY6C 3FT4A 4ALAC 7FABL 1WC7B 1WP6A 3A21A 1NUFA 4UV4L 5CKGA 1EHXA 3UBXG 4JB9H 4RAVB 4YHOH 1E9PB 4HCRA 1NMAH 2VR8A 1USQA 3DDGA 5EOCJ 2ZD0A 2EEFA 1P2CA 3R1GL 1T0NB 5HGDB 2CD0A 1SMOA 4Y9FA 1U8QB 2AEPH 5E2WL 3A6BH 3NFNB 3EYQD 3V4VL 1BVKB 1KNOA 2OP4L 3HB3B 5F1SA 1X5XA 2H3KA 3SKOB 2ENJA 1BHGA 2GC7C 2CJTA 2H2PC 4ENED 3MROA 3TASA 4JY6A 1HILB 1TQBC 1JZGA 3IXAB 4KV5E 1JL8A 2QJDA 1RIUH 2K70A 1COBA 4QXGH 3KYMA 4KO7A 4PWEA 2DWTA 1DBKL 5GS3A 1F1AA 2XSKA 1PAZA 3TA3C 3QR0A 3BE1H 3WLWD 3KD4A 5HI3C 2DQEL 3L3IA 4JFVA 1V05A 1NA8A 1O9WA 1YMMB 5EO9A 2MNWA 2CR3A 1R24A 2VDOB 2PWEA 3MLTB 1A65A 3MO1A 4G42A 1IEBB 1HWGB 4M7JH 3DXAB 1U92A 1DVFD 5D96B 2V9TA 4ZTPL 4Z3IA 1U9KA 2R1WA 2GFBB 1FVEA 3BKCH 1JRHH 3TFKD 5AOIA 3FQ1A 4U1IB 3A67L 3FRUA 4P2QA 1K3IA 2BXYA 2DYPA 5AB0A 3WTWA 3IDIA 1Z9PA 3ABGA 1EJ6A 2Y7MA 3D33A 3DYMA 3QWNA 4JHAL 1ND0A 2VLRD 5JPMA 3LKSA 1IUZA 1XF5A 3KW7A 1UA3A 1T89A 4R7NA 4LNVA 2YBGA 4LPVA 4M4RB 4Y9GA 1EEUA 3ORJA 5I9QC 1WBYA 3VXSB 2WXHA 1F4YH 4OCXL 5JMOC 3FT9A 1N26A 1LNUB 5IW1B 5J3HC 2I07B 3RDTA 2K3TA 4HEMA 5GGSB 3QIWB 4QHPA 1NMAL 2VSMB 4NC2B 3AGWA 4M43L 4OAWB 5GGQH 4HJUA 3FFOA 2JSFA 4PJXE 3NH7H 3WGVB 1N68A 5C09D 1UJ3A 3NK3A 4N5ED 1RZKH 1YNTF 3VXNA 1T5KA 1BFVL 2FZ3B 4IRJA 1ADWA 3G6DL 4RGNC 3TOPA 1B2YA 5EU6D 4ADJA 3MR9B 2LT9A 3GI9L 2NY3D 4NBXB 4GRLD 1S7RB 4HIHA 3VYNA 1MFEL 4GUOA 2L7QA 3LB6C 3MV9A 4H1LA 4JRYA 5CD3A 4WUUB 1A1MA 4HIIA 3NFPA 2D7TH 5D72L 4PRHB 2A9DA 3OSKA 2ALAA 3BAIA 1T7YA 3E8UL 4GSDL 4XNBA 4DSYA 5CEZD 2CHNA 3Q05A 3MREA 3GMNA 1KG0A 1SHWA 3WJJA 5IB2B 3ZMNA 2VXUH 2AEIT 1M1XA 4TLKA 5GGVL 3U2JA 2Q3XA 5KZCD 5CBAB 2XWBB 1I7RA 1NM9A 4AMWA 4KZ0A 2E7LC 4NP4H 5I8EB 1B0IA 5C86A 1FO0B 4MQTB 4QKTA 4LGRB 5IBTL 4DN4L 4U1JA 4P3WA 4Q9CA 2WANA 5A6IA 4YWGL 3MXVL 4APQA 3MV8E 1TJHH 4P4RB 5IT2L 3O8XB 3H9ZA 5DVOA 5C9JB 2E5EA 3S5ZA 3MV8D 2PCFB 1F18A 1PPIA 1PAMA 4X8GA 2P46B 5SV3A 4JR9L 3WIIH 2JKWA 5E7BA 4ADIA 4BQ8A 1GHFL 3LZNA 3L08A 1ZHBA 1U6AH 3T9WA 4HWEL 3UZVB 4OV5A 5JIDA 3DXAE 3AY4A 4MJ2A 4XX1E 2ZF9A 4LLQA 4EO5A 2BLFA 1CE6A 4M7ZC 1S7TB 4W6WB 4OLYL 4EN3C 4JM2F 5GRJL 3ALPA 4DKEL 1QABA 3ARRA 1XTMA 3V0HA 5CEZE 2JB5L 5IBUB 4HALA 2XUWA 3QORC 4KKRA 3GSQB 1AMXA 2EVIA 3ARGD 3AS0A 4AYDC 4JRFA 5ES4B 2DDQL 2IFFH 3PWNB 5C07E 2JELL 1R46A 2WQVA 3WN5A 3D0VB 5DJ8B 5JHBA 4AQEB 4RESB 3TBSA 4RFOL 2B3IA 2IAMC 4LSUH 4NO3B 4YVUA 3QEQE 4ZXBD 4K5MA 2BSED 3VD7A 1GYAA 2P5EB 2P7TB 3UTZB 3KYNB 4MB1A 3RJQB 1F3DJ 5I75B 4L1BA 4XCNB 1UADC 4PJGB 3WEBA 2F1EA 4LFHD 2VXUL 1DL7H 2WLMA 3LXAA 4JKPL 3WTXA 2G3MA 3H4FA 4H44C 2CO3A 1SHSA 4XX1G 1IFHH 5ALCL 5JTWA 4KKNA 5AAWC 2NY0D 5L0QB 4Q4EA 1OLLA 2QVTA 4AI7A 3GUFA 1F11A 1R5IB 3MJWA 4R7XA 4A55A 4JG0L 2J8OA 3QORB 3FFCA 1FH2A 1JV2A 4GRWF 3U9UA 2JKSA 4JM2C 4LESA 4BZ1A 2B14A 1BF2A 1CTOA 3EOAB 5E0QA 1UWXH 5HDRA 3QDME 2PYFA 3IN2A 4TMPA 3HMXH 4NO0B 2GITA 2V2XB 5DXWA 3BGAA 1GY1A 3TPKA 4Q7DA 4WSKA 1DSFL 2UXFA 2I7OA 4NC1E 2AGJH 4HDIB 3IVKB 4B5EA 3ULUC 2X4NB 3EH2A 4PAZA 1OTUD 1UD2A 5T1MB 2W9LA 3US1A 4MYPA 3BAYA 3HS9A 1ACZA 2WXFA 5JYMA 3D4CA 4JDVB 5DD0H 2VE6B 4UDTB 2PNDA 2EH7H 1YC8A 2GIXA 2JB5H 3KPPA 2G2PA 2X6AA 2R0LL 4YSOA 2Z1KA 4CMMB 3VFNB 5EO9B 4TUKL 4Y5VC 5BRQA 4TVPE 4L4VE 3ATFA 1AKJD 4LSTL 3OJDB 3DBXB 1BM3H 3M8OL 2AV1B 3SGKA 2R2BB 4G80A 3NRPA 3CFJA 4BH8A 3QYMA 2GTWA 3VFRB 5I5IA 3IBEA 2E56A 1NAMH 2WZPA 3KWWA 3EOYG 2HLFC 2WNWA 2AW2A 3KPLA 1DVYA 1FNSH 4MQ7A 3PHQB 5C09A 2QADC 3HJEA 1JV2B 5D1ZI 5EUOA 5T1LA 5IM7B 1KLUB 4M61B 4L4JA 4ZYKB 1ZLSL 2XN1A 2AKRA 1I1AB 5HYEA 2D31B 2WQWA 3G5VB 4P05A 8FABB 3VFWB 3TYGL 3AM8C 1JZFA 3D09A 3WKNA 5DWUH 3V10A 3DVIA 5FYJU 3I9AA 5E8EA 4TF4A 4U1LA 1CE1H 3GPEA 4TRPL 4PGJA 2HH0L 3S35L 3BYYA 2VDPH 4U4IA 4UMSA 2A4EA 3BGMA 4Z0BL 3WIAA 4WFED 4AGOA 1A4BA 1J1OL 4MS8D 4WW2B 3PY9A 2AQRA 4JFUA 1CU4L 3MNVB 2IH3B 4R26H 4YZFF 1IGML 1Z5YD 5JQHC 1NEUA 3KS0J 5I0ZA 4P8QA 1UA7A 2DBLH 2IV8A 4QRUA 4JDZB 1ZV2A 2EDMA 4W9JC 5A1AA 1E8ZA 2AEQL 2PXYD 1RUAL 5GQBA 3VFOB 5C2UB 4UZSA 3HR5B 2UZXB 1DSYA 2XZQL 3QXWA 3AZUA 1JZ6A 3IAGC 5IREA 1ZPUA 4ONFH 3KVDD 4LCCC 4V2BA 3B2XA 4PG2A 3CVCA 3ML8A 1NFAA 2H0PA 4MNQA 4U33A 3WL9B 4B9YA 4F2EA 4V33A 4B7IA 1J48A 2YSSA 3OHXA 5I0XA 4EI6A 1H3UA 1T7ZA 1G9MH 4AZ8A 3WFBH 3MGTB 3W37A 1MVUA 3PQYB 3NZHL 2ATKB 4FFZA 3RVUC 2WN3A 5DQDH 1YEHH 4HGKC 1MAMH 2GITB 2HRGA 1UKSA 2X2YA 4KK8C 3TBVA 4TLSA 1TTUA 5JXEC 5TQ0H 4LVNB 4Y5XB 3UYOD 2IADA 4PTTB 5LCVH 5DRZA 4XPBH 1YY8B 1BFOB 3WEMA 1TCRB 4L3FA 3MV11 4YR6A 2FT7A 5FA4A 1I8IB 1KDIA 2Y23A 5LBSL 5TTRA 3PXJA 5ANHA 3RGVC 4BFEA 5FF6A 2MOQA 5BZWA 4TUOB 2M26A 5D55A 3ILPA 4ZO6A 1WUZA 1M9WA 4GW1B 4OUUB 3UYRH 2PYEB 4GO6B 4H88H 2I25N 4HFWA 5EBWB 2HH0H 5CJXA 1YEDB 4GUPB 4OB5L 4BE5A 3BN3B 2O1AA 4DAGH 4HG4K 3NSJA 4UNVA 3NZ8B 4OT1H 3RZCC 4PN6A 3CN3A 4LPCA 5E23A 3MRPA 2QLVB 4M3JA 5HGAA 1U3HC 1SXNA 1EAPA 1YYLL 2CLRB 3V7AG 3WGUB 5E99L 1K8DA 1V3MA 4N5EC 1JNNH 5GS2H 2WAHA 4RDQF 3RWHB 5F9WB 4R8WL 4YHNB 3BC9A 4WU7B 5DD5H 2OMWA 2X4OA 1SXCA 1IMHC 3U0WH 2DICA 4LL4A 5DI8A 4OLXL 2BOCB 3QCTL 4ZUTB 1LNUA 1AG6A 3BDXA 4MDIA 1C5CH 4DPBX 3DETD 4OGZA 1UOLA 3ASNB 4N3TA 3D2TA 4MAZA 2HVKB 2FT8A 1A3RH 1ZVSA 3OG6B 4TKWA 3NJLA 3O3EA 4WNJA 1IGCL 1E65A 3DMMD 3O9WC 3F2LA 2DQDH 3MNZB 3UBXB 4ZMLA 3IRCA 3X3GH 1YEJH 3DPDA 3O0RH 1UWFA 1Y1DA 1MJUH 4MTMA 4BFFA 1BF5A 3V5KA 4ZNCD 3CXHK 3GRBA 3OLGA 4W9DC 5AL0A 3ERXA 4UT6A 1MAML 4L8DB 5TPWH 1F86A 3ABLB 2V8MA 3D4ZA 3UP1A 4J8QA 4PIRF 5IHZA 1S7VA 2LU7A 4YLCA 3OLDA 4G1MA 5E08L 4KAQH 3EIFA 2IAND 4GEJA 2HJFB 4XCEA 2PW1B 1QBAA 3BWUF 4UILL 2FJGA 3O6LL 2OR9L 1IE5A 2GJPA 2UVEA 1MCRA 3MYZA 4ZI8A 1EXUB 4KRPB 5I8KL 4AIXA 5C07A 3BSZA 4PRHE 1SVBA 3HZ3A 1IL1A 4OB5H 5EBMB 4DAGL 4NQDB 1SOSA 3MYJB 1IBBA 3OKDA 3T8MA 4R0LA 1YY9C 4NKOB 2OTPA 4Q6IB 5L4FA 2WYZA 3NGBB 5GS0C 2A6IB 3MCKA 2OL3A 1XF2A 4A2HA 1WFTA 5CUSL 5DD1H 1JYVA 2ESVB 1XH1A 1ZMYA 4AEIH 1YG9A 2FX8L 4S1RL 3WFEH 4D0BB 3MGTA 1FGNL 3VJ6B 4KDTC 4KJYB 4FG4A 3X2QB 3TO4C 3V4PH 3PWLB 3EGXA 5JO5B 3KXFB 3LRKA 2LFEA 3MBXL 1QLFA 1BAWA 4GAYB 4MNQB 4LSRH 4WI0A 5ICXA 4TQHA 3ZDZE 2YXWA 1OAXL 1MUJB 1M3JA 2DEXX 4HUUA 1TJGH 4ELMF 4LQFH 2WLLB 4MMXB 3EDKA 4PJEA 4BSVA 1OSPH 1OOAA 4R4BA 2XWEA 2CRMA 4XCYA 5EEZA 5T1KD 1NCUA 3SDXB 4YSTA 3IJSB 1FHNA 2ZCLH 3FTWA 1MXGA 4JM2D 1CICB 5I1DB 2BOCA 4DP8X 2BP8B 4DZ8B 2ZXAA 1KENL 2VL4A 4FQIH 4LAQH 2P24A 3UP6A 3WHXB 1WWWX 4D9RE 2UZYB 2VAAB 3FRPA 1R5WA 4AMKL 3BWSA 1JGDA 5B38B 4LGPB 2X9XA 2ZSWA 1X4ZA 2AP2A 5DEFB 4Y1SA 5DQJA 2VLJD 3VXRB 3L3IB 5LBSA 5IHWA 3RWFB 1SDAB 4PR5A 5LUMA 3S34L 2V33A 4Y9BA 4I48B 4JFWA 5IVOA 4PJDB 4D8OA 2RGSA 3GXIA 5EZOL 2CRIA 4FS0A 1TUPA 3F6IA 4UQEA 4YHYB 2XKNB 5IF0A 2EDNA 4OQTA 3P40A 3GJFB 4XNZB 1J9SA 4XMTA 2AERT 4AW4A 3FKUS 2XHNA 1URLA 3HI6H 4XXWC 3QDJB 4O00A 4FABH 2Z0UA 3X1GA 1WAAF 4D8PA 2BY3A 3FT1A 4HS3A 2LHAA 2E9GA 4HIXH 4HUWA 5DZ9A 3RWEB 4Z3TA 4XCFL 1MHEB 4FKKA 1AQDB 2ATKA 3VU2A 3SYCA 5LBVA 1JNJA 4X7DC 1YJDH 4Z7UA 2B0SH 5IROD 2NQDA 2CBOA 1JXJA 4FJZA 3AACA 3FT4B 4BDVB 3IWVA 1SRDA 1TJGL 4F9LA 5ISZB 3RX9A 2CBPA 3MUY1 3ZE0E 1OANA 2EE3A 1M2VA 2HT2D 4NP9A 4QT5A 3GXTA 3T65B 1U8KA 1UUNA 4KDTA 1JOIA 2YZ1A 4ICXA 2WTRA 4PJCB 2JXMB 4LGSB 4PSPA 4FNUA 5AEAA 4K5LA 4EUPA 1C9SA 4NJ9L 4BHUI 3DX6B 4O2CA 4JCWA 4E9QA 1EZUA 5CCHE 4N0UE 5TDOB 4ZNEA 3U4EA 1NCHA 2YN3A 3D12B 3QUMB 4NZUH 4XC1L 3PWJB 3WAJA 2E8ZA 5AB9A 5IZ7A 5MI0C 3LSOB 2IMNA 2AEWA 5CGMA 4PRDB 3QZWA 4R96B 4YGVA 3EKCA 1INQA 1PKOA 4R97C 1SJMA 1OARL 5IWLC 2ZXDA 5A2LH 3MLVH 3WELA 5LCVA 2C1OA 2DN7A 4HPYH 2WXGA 2JK5B 3BCDA 4I0KA 1KTJA 3KE0A 1NLDH 4KJYA 1J10A 4I18B 3FN0H 3GHBH 1DSWA 1NFIB 1PKQA 9PCYA 5E8OA 1A14L 4X9FA 5IMLB 2BIQA 2J5LB 3HI1B 1ZT4B 2GW5A 5J1AA 3UG3A 1AHWC 1N0XL 2EADA 1JGDB 1Q38A 2OMNA 2VO5A 4FL4C 4IS6B 3WU1A 2ZCKL 3MRKA 4NB7A 3RVXD 4NUPA 3RY6A 2X3CA 1RUMH 1D9KA 3MLZL 1IM3A 1IIKA 5TDPB 1CYGA 3GNML 4MAYA 5E8NA 1FFPB 4WWKB 2EDEA 2F68X 3FN3A 4UQ9A 5CSBA 1DTUA 1XGQB 1SEQL 4Y4FA 4KK8D 5EO0B 4CILA 1NGPL 3B3BA 2ZKWA 2OXHB 3O6FC 5JXED 4OI8A 1OQXA 4IOFC 1TF4A 3GSNL 1DVZA 4WEEA 2YMTA 5AVYB 3UTPE 1A7QL 3A47A 2EEDA 4LLVB 3GMOA 4CSZA 5EZLB 1TTCA 1AGEA 4G1MB 4DGUA 2XJLA 5IV2A 1P7HL 3JV5A 3EGXB 3OWEA 3R06B 5JO5A 5FM4A 4P2QE 1F8TL 4A2GA 4NJ9H 1OB0A 4PJ8C 3QXVA 3W0WE 5IVZA 1PF3A 4Y5VB 4FFYH 5JHAA 2NXYD 1TEGA 3ARFA 1SVZA 1PZSA 3T8XB 4WTXA 2RQEA 2XXCB 5C08B 3RJDA 2X40A 5SX4H 5I19H 1UWXK 3FT3B 3VYPA 3C8DA 1QTYT 2BWQA 4Z23A 2SEBB 2Z92A 1TZGH 4NKOA 2IQ9H 3D39E 1HQRA 1MCNA 3SE3C 1ZLVH 4BZ2A 4KI5D 4HMDA 5EIIA 4MXVF 4V11A 2R8SH 5E2TH 1OW0A 1XH2A 5CWSB 2WY3B 2YSTA 2X53A 3QORA 5JW3L 4NNYB 1HE8A 4M6NL 3P54A 1XCTA 1A3LH 3VMOA 3ES6B 2B5IC 1VPOH 4H25A 5SWSA 5BRZB 3ARDD 1LWHA 1PIFA 1IAIH 4Y2DA 2L3BA 5AW3B 3NRFA 5DJ0A 1UHVA 5E9AA 2RHEA 1BQ5A 3G7TA 3EGDA 4QXTA 5E9NA 1IIIA 1PY9A 3E7JA 5G5DB 2Q7AA 2QQNH 4HBQA 1D7DA 2C26A 4KXAA 1PZUB 2IPTL 1NGPH 3W9DB 4BFNA 1FORH 4S1DC 5F21B 3ISWA 1CQYA 4WW2C 4HU8A 1H9DA 2MFNA 3MV01 4PY8I 4B41A 3CSBA 2WINB 5TH2A 5L2JB 3IAPA 4NZFA 1RPUA 4OAWA 2IWGA 1UM4L 2IWEA 5GSVA 2N1TE 5J1AB 1DJGA 1QFWL 2V3EA 1XH3A 4FG2A 3IS1X 1M57B 3I2CH 5I9QB 4LLMA 4ABVA 3EDFA 5IB4B 1F8TH 3ARSA 3QVAA 4AVIA 4X7CC 2CBTA 1EAJA 2GT9B 3FCBA 2JK5A 3ZKQD 1Q9LB 3IMTA 3G6JE 3GS7A 3H54A 4XZUA 3CV5A 4RISL 4PI0A 4QRPB 4JUTA 3ZHDA 1KXHA 3DX4A 2NX5D 3K91A 5CINL 3NIDF 4ZJ9A 1PG7W 2O5XH 4QJ5B 4PJFE 1Z3GH 3OR6A 3T0VA 2VMDA 4UIMA 1CQKA 4N85A 5AW9B 1VHPA 2VN6A 4ZFGL 3PL6C 1ZIAA 3QO0B 4XXDB 5FUZL 3F7QA 4ZUWA 3W1ZA 4DQAA 2BNRD 3F7VB 4Y5VA 3ARVA 3G6DH 2XVKA 5A2CA 3QQDB 4G3YH 2XU9A 4FTVB 3SKJH 1DN2A 5CCKL 2NXZC 2JWYA 2HT4C 2EO9A 3QEQA 2IH3A 1B4JL 1XBRA 3QWQB 3D3VE 1GZPB 1Z9MA 2MHAA 3U30B 2F58H 1KCRL 4ATTA 1Y6MR 4JMNA 4ONOA 5IV2B 4PRHA 1PDKB 1XT5A 2YAPA 2FJHB 4DT2A 3KJ4B 2IH8A 3GXNA 5JLZB 2X4TA 3SE8L 2MKLC 4PLNC 3O6KL 4RX4D 3BKYH 4OLWL 1IAOA 1MXDA 3RLSA 2ZF8A 5CD5D 1F00I 2WXOA 1G94A 5D4HA 5L7XL 4B6ZA 2HFFB 2HTKD 1P1ZB 1MIEH 4XO9A 2O5ZH 3WL9A 2AKRB 2YPVA 1G7HA 1IM3D 2RCSL 5DJDA 4P2AA 2X7LA 5IB3B 2C3GA 4UUJB 2Y0SA 1ZE3C 3F00A 5ITFB 3BH8B 2BJMH 1A7RL 3H42L 2OM5A 4JQIA 4XBPB 3L2LA 1KACB 5TQ2H 4NRXA 2H32A 5AOKA 4HULB 3MRJA 3P0VH 1NCJA 1HT6A 4UQCA 4HKXA 3ZGHA 3RE0A 3LRMA 1CI5A 5ESVA 4XVJL 5E2WH 3S35X 1I9JL 3P2TA 3O3BA 3V4VH 1WCBA 4IBUA 2WCPA 3UPRB 4W4OA 3HC0B 3Q8CA 4ELDA 3WG7B 3NA9H 3IGKA 1N59B 1B3IA 2WN2A 1ZRUA 4WI8A 3DUSA 2WB1A 2FSDA 4IRZL 5DD6A 3GMPA 3SE4C 4O51A 3I02A 3KPPB 4LIQE 1DQQA 3Q5OA 4HC1H 4J3WA 4XNQA 5L2KD 5IROA 1R3KA 3QHZL 1G0DA 3BGFC 3MRRA 4KXZH 1Y0LA 3P4LA 2X6BA 4QHKJ 4UOW0 3ZYOA 4AUYA 4AV5A 7CGTA 3LQZB 1KN4H 4LRIA 4LSUL 1TT6A 2AJUH 1YO4A 4J3XA 3CSYB 3ARED 4Z3EA 2YA0A 1INEL 1G7JB 1IGFL 3QNYB 4X0KA 5EB9A 4Q74A 3ZTJH 2VWEC 3HNSL 4WCYL 3G9VA 4D3CL 1CN4A 4HUVA 2FIRT 3GSWB 4B60A 2WLHA 3AY2A 4FI7A 4U3CA 2W9DL 4Y9EA 2EJ1A 5EA0L 5FW6A 1QRNE 3O2VL 4UDUA 2A9NL 2EXYC 3LN5B 3IJ9A 4WTZG 3PABA 1W8EA 2LR4A 4KHTL 1EWHA 2O5ZL 3T1FB 4WK0B 1JHKL 1MW3A 4P3CH 4ZS6D 2BNQD 3RX8A 3U6RA 3MOBL 5HJ3A 2IH9A 3TIEB 3VVWA 1P2CB 2Y6TE 4G8GB 1F4YL 4LPXA 4XP5H 3QBTB 1E42A 2QQKH 2TSAA 2ZOTA 3VWKD 5F3HA 4JO2H 5TH2B 1MREH 1BPLB 3IPFA 3LXUX 1YQ2A 2AXJA 3Q5TA 4XVJH 5AOZA 1I9JH 1S9XB 1N18A 5B1BB 3I9IA 4ZPTA 1YEIH 3ZE0B 2FWOB 5IFAL 1J5HA 4KMLB 4NPJA 3GI9H 5AAMA 1L9PA 2FH6A 4IRZH 1KMGA 1JGIA 3UL4A 4EKXA 4FADA 2D7TL 4ES8A 2IOMA 5FGCB 1QR4A 1TNMA 4PREB 1MLBB 4XTRC 4HH9B 2AXFA 2QVFB 4KU1A 5HJBA 3VFNA 4QNPF 1P4LB 2CKBA 2ZSVB 4MMZA 1PFOA 5B1JC 4JFSA 3MA9L 4F20A 5BNXD 3QJFA 1XIWA 2PCXA 3D30A 2ADGB 4UM8A 4M6OH 1JGEB 3VFVA 1NC2B 2VMFA 3MMEB 4DN4H 1E5CA 3L54A 2HLAB 5FB8B 1ES0A 2GIMA 4KPHH 3BP6A 4HS8L 1T89C 3QNZA 4D3CH 3T3PE 3BVNB 4JG9A 1IBZA 4G9FA 4NDMB 3EXLA 3MRLB 2JTYA 4WW1A 3E6HB 5IWLA 3MJ7A 4IW4C 4F7EA 2Z7YA 3Q0HA