3D0GE

Crystal structure of spike protein receptor-binding domain from the 2002-2003 sars coronavirus human strain complexed with human-civet chimeric receptor ace2
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
179
structure length
173
Chain Sequence
PFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Angiotensin-converting enzyme 2
publication title Structural analysis of major species barriers between humans and palm civets for severe acute respiratory syndrome coronavirus infections
pubmed doi rcsb
source organism Paguma larvata
molecule tags Hydrolase
total genus 31
structure length 173
sequence length 179
chains with identical sequence F
ec nomenclature
pdb deposition date 2008-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1840 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3d0gE01
3D0IE 4ZPWR 4QZVB 4L3NA 2GHWA 4ZPVR 3SCIE 3SCKE 2DD8S 4ZPTR 4ZS6A 3SCLE 4L72B 3D0GE 3D0HE 4KQZA 2GHVC 4XAKA 2AJFE 3BGFA 3SCJE 5DO2A 4KR0B
chains in the Genus database with same CATH superfamily
2PEBA 3MM7B 2KZMA 2J9DE 4F0KA 3RB6A 3QAEA 2J7KA 3LH2S 5E41A 1HHTP 1TVRB 4DEZA 5DZ7A 3R8YA 4QYZK 4HL9A 4TU7A 1FJ7A 1FERA 1ZPVA 3MEDA 1Y10A 4DR5J 4B3MF 5KFFA 4OZJA 3DU6A 2R42A 2D3UA 1L3UA 1RT1A 4RNHA 2FVRA 1I3OB 2AJ1A 2XB2D 2Q3PA 1RISA 3H2VE 2GV1A 5AT1B 4DLGA 2QA4G 2V2QA 2B6AB 2CG8A 3BM7A 3HK2A 1S9EB 2M70A 4LRFA 4J9SA 3NCPA 3V6JA 4EEYA 2KH9A 2OPSB 2F4VF 4A48A 2GVZB 1Q8LA 1N5TA 5BXIA 2HHXA 2GIRA 2JLFA 1XMOJ 3I5CA 1FE0A 1PBUA 3BQ0A 2I5JA 2ZVIA 1SUQB 3SDEB 4QJVA 4ED6A 2BV3A 4R8UB 1URNA 2UXDF 2AU0A 1G6BA 2CPHA 4OI4A 4U67Q 2OUGA 2GAHC 2XSJB 4KHMA 1R0BG 3PRBA 4J9PA 4B9UA 3R6GB 4C8MA 4DV1F 2Y0BB 1C0TA 3CD6S 3OFHA 5F9LA 2VG6B 2U1AA 3KNGA 3JQMA 3MF5A 1SB6A 4OJHA 1PBAA 3ZZPA 4OV1A 1AYEA 2Y9HA 1K47A 4B3TJ 5LMNJ 1RTHB 2EPIA 4MIWA 1ZBTA 4ZPTR 1PYOB 3MHYA 3J80U 3A8KA 3K8WA 4MTPA 3M2RB 1WUUA 2AWZA 2XCPA 2ZDPA 2PMWA 1Q8BA 4CT8A 2JL9A 4ZVQB 3DLGA 4U8VA 2HKEA 2IYIA 4Y2AA 1T9TA 5AE3A 1UVJA 3FBBA 3M8RA 2B4OA 1SIWB 4CM2A 3MTJA 3DYAB 4C3MA 1I6JA 2OMOA 2B0GA 1K0TA 4ETXA 1CJKA 2ZH9A 4D3HA 3DRSB 2V67A 2R2RA 2DR5A 2GFFA 2Y1RI 1HBUA 3IWXA 4M63A 3E01A 2WK4A 4QPTA 2DXDA 3MUTP 4DSKA 2R7SA 2KHCA 4RUBA 1VIOA 2BW7A 1OYDA 4DMZA 3FMWA 1Q86T 3R1HA 4DL6A 4E0DA 2GVDA 3V6DB 1XN9A 4NLQA 3W65A 4I7FA 3BDPA 1UETA 2J6TA 2JOQA 1EKSA 4X65J 1L3KA 1FJGJ 4HH1A 3GR1A 3JAMY 1AW0A 2DR6A 2H5JB 4K2XA 4USKA 2ZZNA 2YBVA 2IAJB 1EP4B 4ZS6A 4J9UE 1T9VA 3CD0A 5HVGA 4F04B 1FRKA 3B78A 4MH8A 4NCAA 2EFQA 1FTCA 2FTRA 5K8MA 3CCJS 1NXIA 5KFCA 1R0AA 1VQPS 2AX1A 2H1YA 2OFGX 3G2XA 1MLAA 3DM2B 2GGPB 1YZ6A 3RBXA 4PKDB 1N36J 4DS5A 4I1TA 1U0SA 3OLAA 4AL6A 1JNZB 4UQGA 1T02A 1E6YB 3M8PB 3AODA 3V81A 2B7BB 1Q79A 4CO1A 3H5YA 1UW9A 3UN2A 2IJNA 4KPYA 5HL7Q 4CTAA 3CCWA 2A6MA 4ZLJA 3NXZA 2FJWA 4FF4A 1FO1A 3GFYA 3I6PA 2M0GB 4RZRA 3QIDA 4MKYA 1FWLA 1BMQB 3KUHA 3WQPA 4RW8B 4LF8F 4NLTA 3CJ2A 2ZDOA 2NXNA 1SBRA 5C25A 2B9YA 1LKZA 2L41A 4B3SF 5KAKA 1VISA 1J5EF 2KXHA 4HKQA 2IMOA 3KHGA 2F9JA 3D0HE 3FEXB 3EZOA 4RPFA 2YKPA 3UDVA 1SL0A 3QT6A 2LU1A 2YKMA 5HLFB 2K2PA 3L9ZA 4K0KJ 3D9BA 3QRRA 1X7VA 2B7CB 2EBGA 2XYPB 4FDFA 4AFFA 3EJMA 1HQEB 4OI6A 2P9CA 3LP0B 1S9FA 1VMBA 1OQ3A 1NK7A 4YR0A 3J7YU 2GMHA 1AUDA 3SFGA 3LGHA 4YDXA 2B56A 4DDFA 2VA2A 3DOLB 2JLEA 4ZPBA 4JOUA 1TVRA 2XZTB 5FIIA 2B43A 3G82B 1UVKA 2HNZA 3FSXA 4OHZA 1R6VA 3LUYA 3M2UB 5F3TA 4M5DA 2CZ4A 2UUCJ 5FDLB 3MM6B 2E1AA 2RUSA 4DPOA 2WVDA 4KB7A 3IN5A 4M5HA 4ECRA 2XMVA 2H5EA 1QTMA 2XGPA 3D3CJ 2AD9A 1D9DA 2B6AA 2HZCA 3DNCA 1S9EA 3QSIA 4RNOA 2W8LA 1XJWB 2ZUAA 2W2QP 4NLDA 1IM4A 3R7NB 2RRNA 3GLJA 3OXGA 2ROGA 3S01A 1SI9A 2L9DA 5GVQA 1WSRA 3I0RA 4YB6A 1U8WA 4WKYA 4F3OA 1RT5B 1FCAA 5T14A 1X31C 3UDLA 1SUQA 3QO9B 5ETTA 3K8VA 3LA0A 1IBKF 2BQ3A 5SZTA 2XSJA 3CCUS 4ATNA 3MI7X 2ZBPA 2ASYA 2ZH2A 2J0XA 1AFJA 1RT2B 1NNDA 3KLHB 1WG1A 2L9NA 2VF3A 4LUBA 4C7QA 2ATLA 1C0UB 2UUWA 5EGYA 4JP8A 1VRQC 2V94A 3PACA 1RTHA 2ZH8A 1UL3A 3CDAA 2CAJA 4DV4J 4ED7A 3M2RA 1VQ8S 1VHFA 1RLCL 1RBAA 3GYXB 1TR0A 1DLOB 4WP9A 4Y2IA 3CNQP 2W9CB 3N6MA 2LQ9A 2H4WB 2RU9A 2NR0A 3D2WA 2HFSA 4ECQA 4PQUB 1GX6A 1SJ1A 3QT8A 4QYRA 2BJ1A 3BO4A 3DYAA 2CJ9A 4XTTA 5KFVA 5RUBA 1IJEB 3DRSA 1WC1A 4ZDNA 2DNYA 4M5KA 4DLEA 4JYAF 3LOUA 4YB5A 2NXCA 2EBEA 1G4CA 1M1HA 1Q53A 6FDRA 2CZVC 3W64A 1YQHA 4EYIB 2LXIA 3DKDA 2MY8A 4WIIA 1IR0A 3BV8A 2VH7A 3ZTSA 2J9DA 1K0VA 2R7WA 4RLEA 2VODA 1SKWA 1HPZA 3EGWB 3A8IA 5CYMA 4FKXA 4Z37A 1RHQB 4A8WA 5LOQA 1U26A 2UXBJ 1KVKA 5LXYA 2M52A 3LGMA 4F2RA 4F0MA 1F1BB 1B70B 1RAGB 5MAOA 2ZHAA 2YX4A 3GIJA 3GJRB 4BWMA 1DQ8A 1VQ5S 4X4QA 5C2CA 2IAJA 1EP4A 1SV5B 4H4OB 4QW9A 2MGZB 1XMOF 2LQ5A 4F02A 1PJ7A 4YR3A 5E2QA 4OX6A 1SH2A 2AV5A 1S1VA 1WHXA 3UCUP 1TELA 4KR0B 2MQOA 5EWEA 2UVVA 4GO7X 2HS3A 4ECUA 3QLHA 2C3MA 4X66J 3DM2A 2KU7A 2GGPA 2YH0A 3FBFA 3PW7A 4B9VA 2LFVA 2QV6A 2C1EB 1FF2A 4UZCA 1NKEA 3WHIA 4UOGA 4UTGA 3M8PA 3OSPA 3VGTA 2DYAA 2HZAA 1KSPA 5LMNF 3M7VA 2KZZA 3WX4A 2GHVC 3L4BC 2BE7D 1I51B 4NLYA 2VQFJ 1XMQF 5KT7A 3R7SB 4QWCA 1KFSA 3NOGA 1HI1A 3TI0A 3FCWA 1DRZA 3Q8PB 2SXLA 3CDEA 2KYZA 2DGXA 1EQMA 3GSDA 3CUNA 1HD1A 3OR2B 3MPUB 4ELTA 3V2UC 1S76D 1UZDA 1N34J 4ECXA 3EVOA 1RAJA 4RJVA 4XIUA 4WKRA 4BLGA 1VQYA 2XMWA 4HYKA 4LRBA 2W1BA 3TEGA 2BABA 3JS9A 5CCMA 3U27A 3TQ1A 2GMLA 2LA6A 2ZC4A 1KWMA 3PO5A 2ZEJA 2HURA 1HNZJ 3RRGA 4WTYA 2I9SA 3BH6B 1ZA1B 3W9HA 1V9OA 2DNHA 1WORA 2RHSB 5KFDA 4CCHA 1UCNA 3ENQA 1XK8A 1UFLA 2NREA 2FZCB 2RSQA 3NL0A 5C42B 2HHUA 1RT7A 1KRPA 5DQGA 3OJUA 3D1HA 1HQEA 3LP0A 3TA2A 3C46A 2NLWA 3GG0A 2M8HA 4X65F 2D69A 2FZGB 1RTDB 4B3RJ 2OP5A 4X4NA 3BPSP 3SFUA 3ZNUA 4GKKF 3C14B 5DLGA 3DOLA 1G1XA 3K0JA 2NZCA 1I1GA 1CQMA 1UPMB 3C19A 2QEXS 4K2JA 3LTOA 1CQNA 2RDDA 3M2UA 1YKWA 5FDLA 5CYQB 5GMDA 4USMA 3OT9A 2DBBA 8RUCA 2HVDA 3FK4A 1HNXJ 2V4JA 3H42A 3K5OA 2C22A 2KO1A 2E9RX 3HM9A 4USTA 1N36F 1RAOA 1YVFA 1F6TA 1FDDA 2XTJP 3NCQA 1TP7A 3DRYA 4IFVA 4C4WA 2HK3A 3BO3A 2VKZG 5B0DA 4YR2A 1Q5VA 1RT5A 2G0CA 1VQLS 1UA0A 1ZM3A 1TL7B 2EC2A 3QO9A 1OY6A 2RDIA 2XNRA 5J2MB 3FEYB 4JUZA 3CCES 1YDLA 2BQUA 2W2MP 2YVSA 4N41A 3HULA 4I6AA 3HVTB 4C0OC 2VG7B 4WP8A 1CJUB 3CJ4A 2GNKA 4NCBA 5HJXA 2QMWA 3DXSX 3BYRA 4Q44A 1QVGR 1C0UA 2VJVA 2HPUA 3VAHA 3W5ZA 4UUWA 3KLGB 2WBMA 4NZ6A 3W9IA 1XERA 2QT7A 4F3QA 4B08A 4JV2A 4J9NA 1FFGB 5D0HA 2BOPA 1IQTA 1X4DA 2ZH3A 4B02A 3RB0A 4DL5A 1D1UA 1RT6B 4HHJA 1DLOA 3OSNA 2YX7A 2W9CA 1J5OB 4LF9J 3A3NB 3TVKA 2C3PA 2JX2A 3NEKA 2Z58B 2XC9A 1GEHA 2FLNA 2HHVA 4P2SA 4KYZA 2DR9A 2MQ8A 4K0KF 3SYZA 2YWGA 1TUWA 1S6UA 2X1GA 3T1AA 4ZLPA 4K4TA 2WBRA 1PAUB 1T9XA 5ETKA 4P73A 2OSQA 4FYVB 3MEEB 2NPFA 2XGQA 4A8YA 1WC5A 4DG1B 4OQJA 4DJBA 3S8SA 1BQXA 1QSYA 2ERRA 1F60B 5HO4A 4U95A 3UCZP 1H7XA 3G86A 4ED4A 3MAHA 3AOAA 2UUCF 3DRRB 3D0IE 4DV5J 4IO9Q 2DHXA 2IVFB 5KG6A 4MIBA 2HFVA 3GCXP 2HRUA 2BM0A 3R97A 4MIAA 3C15B 1W25A 2VG5B 1KOHA 1NZ8A 2X1AA 1S77D 5HK4A 3IXQA 2ZNYA 2XWXA 3ZZUA 4H4OA 2V5HG 2MGZA 5E3CA 2HNDB 1JLGB 1U1QA 2B8QA 1NDCA 3MMCB 4TYBA 3TWZA 4ZVSB 4O23A 2ZH6A 4ZCMA 3DMJB 3D0GE 3HSJA 1JJ4A 1Y5NB 1OPZA 2VC1A 4LFBJ 3GMGA 2JVRA 2IRUA 2JVOA 4RX6A 2NZ4A 3KLIB 5F8IA 4TU8A 2FD2A 3R27A 1NDPA 3PFEA 1YJ7A 3TR5A 2R8JA 2BDPA 4A8XA 4PWWA 2NPIA 2DRDA 1NHUA 3GIKA 3HHNB 4ECWA 1DBDA 1MU2A 2ZH1A 4XO0A 4DV6J 2IDLA 2XWYA 4KQZA 2YWWA 3EPGA 1U2FA 2RKIB 3MPVA 4R0JA 1IKXA 2K8GA 3DRPB 2XLJA 4M5IA 2CJYB 4DL0C 1M90T 3OR2A 3UD3P 5KTQA 3QIPB 4TXSA 1REVB 1FRLA 2AYBA 4NZ0A 2MLYA 3MTKA 1SXLA 3Q8RB 2XULA 3NG8A 5KG1A 3POTB 1T95A 2E7VA 1OWXA 1R8CA 4O4GA 2AEFA 1TK0A 1U6ZA 2HSEB 1B0TA 3NMRA 3GP9A 1D8YA 3MEKA 4XPEA 3O1LA 4L3KA 2MZ1A 2ACYA 5DO2A 3TVZA 1UJ5A 1B4SA 4ZVGA 3G71S 2BJ9A 5C42A 3HF5A 5AXKA 2VJUA 2VFRA 2LQ8A 4WF9Q 4NLSA 2GMJA 1NK0A 2M9KA 2UXBF 2XZWA 4RW9B 5F41A 2HHSA 1WKKA 1XMBA 1RTDA 4F3MA 2AQ4A 1RABB 2I1RA 5K14B 5B0BA 4GMKA 1LK7A 1URRA 3UVJB 2FJXA 2J6SA 3CJ0A 1A6LA 1LWEB 4P9SA 4AXJA 2ZWPA 3H0PA 4PXEA 4KHPF 6FD1A 3KJVB 5F0WA 2WB1D 2A18A 5CYQA 3BYPA 3LAKA 1FX4A 4ES2A 3GIMA 2IIHA 4P6QA 2HLTA 1H72C 3THPA 1B0PA 4LQ9A 3TANA 4ZVPB 4X84A 3D1QA 3F44A 1GMUA 4O3OA 1FKAF 2IBOA 4DR1J 2OTLS 2ZM6F 3IBCB 1XR7A 2BACA 4FVMA 4K4SA 4DFMA 1Q4RA 1W2IA 4NYPA 2COLA 1TL7A 1Y3JA 2K7JA 4HDGA 2MB0B 1S4EA 4DR4J 2E9TA 4DSJA 2L08A 5J2MA 1HYSB 3IA0A 2NYIA 1X60A 2AX0A 2FHKA 2AW0A 2O1PA 3HVTA 4WYWA 4JBCA 1U2RA 4QCLA 2VG7A 5T41A 1CJUA 2IJRA 2CUYA 1HW9A 2RRAA 2E66A 1RT3B 2R7VA 4X4VA 3SCIE 1VOMA 1MNEA 1NPPA 3KLGA 1N34F 5GAGU 4PABA 2V69A 1ULRA 4NMXA 2MDAA 1JWWA 4N8NA 1WEXA 1RT6A 1NKCA 4LJMA 2J8SA 1HNZF 2Q43A 3TJAA 3WDOA 1J5OA 4YFUA 4OYOA 2OD6A 3FKBA 2HBRB 3FUYA 1RA6A 2FVPA 4DBQA 5HROB 4EFAC 4ED5A 1U2CA 1ZTWA 1XTZA 1M5OC 5A6PA 1UVNA 2KXFA 1M5KC 4B3RF 3GE9A 3P45B 1RWPB 1NDKA 1P1TA 4DCJB 1IKYB 4DG1A 3H8YA 3QPIA 2AZ1A 2CJAA 5HP1A 1ZAVA 4OX7A 1H74A 2CQ2A 1DTQB 2FY1A 2LECA 2PN6A 4KJIA 2QMUB 4JV5F 1C4CA 1TL4A 2BKOA 4ZOSA 1KVIA 1EJ7L 2M7SA 2HBQB 4QR1A 3C15A 2VG5A 4IG0A 3E8OA 4GVBB 3IM9A 2WW8A 3MGJA 2MY7A 2XI3A 3HT0A 3SCLE 1F0XA 3BQ2A 1NJZA 2XMKA 3JSBA 5IXUA 4K8RA 1S1TB 1V3ZA 3N5BA 1RWMB 2VFVA 3KDNA 2V2KA 5ETMA 1NK8A 4YHHF 2XMMA 1H73A 4O3RA 2OPQA 5DDQC 3OHAA 4A8FA 3M2VB 4Y3CA 2GA7A 3UFCX 4LF5F 2D3ZA 2XCAA 2CPJA 1Q8IA 4PPDA 3DMJA 2MHEA 4WJBA 2LDYA 3ET6B 4ID5A 3GWCA 3OTOF 2VBXA 3H4DA 2A2DA 3OV7A 4L72B 4LF7J 5A8KA 4IFYB 3GV8B 1FRHA 4OLPA 1IBLJ 1S1XB 1Y9OA 2YNHB 3KG1A 4OHYA 3UPFA 4PQAA 3N9UC 4LBHA 4U7CA 2BW2A 2OEKA 3D6FB 5B7WA 5I3QA 2KRRA 5IM0A 1UAWA 2LXUA 2RKIA 4LF9F 3HFZB 4ANCA 3EPIA 1R89A 2CPYA 1KLMB 1YJ9S 4J9QA 1S9GA 1GTHA 1REVA 2HFZA 3ZTQA 2I0XA 2IPOB 1ZAWA 4J91A 1S1WA 2M8DB 2C2KB 2H65B 5F9NA 7FDRA 3MMBA 2V68A 3MM9B 4KH1B 3VAJA 4ELVA 3ETOA 4DR7F 3S6EA 3KLEB 4W90B 2E9ZA 3I0SB 2IC3B 3KDOA 3FSIA 3W5XA 3HVWA 4W92B 1NB7A 1X9MA 2G2OA 3VGSA 3CC2S 2APOA 4DV5F 3HHLC 2OGUA 1KTQA 1OSCA 2HQGA 4F4XA 2LKZA 1TKZB 3DXBA 5KFUA 1N5SA 1VJWA 2W4DA 5K14A 1KVJA 2CDRB 4X4TA 3ISND 4I69A 3UVJA 3IFEA 2ATCB 4U9RA 1LWEA 4K5RA 3KXDA 3G96A 3KJVA 2EWHA 3VVTA 3OJSA 4RBUA 2QMXA 2LU2A 1D09B 4EZ6A 4M5JA 2IVMA 4CDIA 1RADB 1VHIA 1WI6A 2CQPA 2DNQA 4UZBA 1VQ7S 2Y1IA 1S7HA 4LFBF 4NXNJ 1QJHA 3TZYA 3P3DA 3KK1B 4NCGB 1JLCA 3GSIA 3SSQA 4ANEA 3SV4A 2DB1A 4OHXA 2WVFA 4K4ZA 1HYSA 4ZK7M 1WTFA 3N28A 1BQNB 5F0UA 1HR0J 2DGWA 3V4MA 1C1CB 5J2QB 4DV6F 3ULHA 3KOAA 4ERDA 4FPIA 2EFNA 4ZVTB 4H4KC 2V9KA 1TV6B 1S59A 5IQ6A 1DZ5A 2DNNA 3VAFA 2P5VA 2AJ2A 2CA9A 3KMSA 4NZ7A 1PCAA 3HHLB 4KKOA 2KT3A 3QATA 2VIHA 1VQ6S 3KLFB 4DU7A 1VQOS 2HHWA 1FKOB 1VS3A 4Q2LA 1KNZA 1HQ2A 3HD2A 3MR5A 2N3LA 2QFIA 4ED8A 3M9MB 3EM1A 4IH5A 3DOMB 5D6GA 5HI7A 4ZCKA 1PAEX 5HQMA 4F4ZA 2KJWA 3RYLA 1VQKS 1K1QA 4LIRA 1JMTA 2WRMA 4MFBB 4AL7A 1U0HA 4EWTA 3KTQA 3MECB 1IKYA 3AA9A 3W3SA 1VI7A 2BKPA 1S7IA 5B08A 3I56S 2AMCB 1S99A 3W8PA 3OL6A 3C66A 1U6BA 1JKHB 1KKHA 1HWUA 5ETLA 2E1MC 2C28A 5D0EA 2R2UA 4JI5F 1CULA 3RGIA 4WBFA 3QBCA 1EKRA 1G3OA 1IWGA 4DPTA 1UVLA 3T5JA 1F5AA 3SBMA 1YJUA 1Y7PA 2E5HA 2YKAA 1ZZFA 3DLKB 3A12A 3AAWB 4GVBA 4TN2A 3X1LB 5KOWA 4ZVEA 3OL8A 3NNCA 2QO3A 4DUYJ 4DR1F 3MR2A 4DV0J 2QSFA 2V8VA 4X4OA 1WKLA 3M8QB 3M2VA 3R1LA 3DDKA 2QL9B 2YWHA 1S6QA 2ZKUA 2VFUA 5CD4A 4DR4F 3PEHA 1NB2A 4MAKA 2YNIB 2VL1A 3HVAA 2HQCA 2MQNA 3ET6A 1QE1B 3GIIA 3VZHA 3FFIA 3M8YA 4X4RA 5DG9A 1CVJA 2HBZB 4IFYA 1DURA 2EVZA 1H2TZ 2WHOA 4I64A 2RILA 4H4MB 2QLFB 1S1XA 4RWWA 2YPYA 4EO8A 4Y28C 4B3MJ 1N52B 3MCOA 1FKPB 3C6TB 1RA7A 1WJ9A 2C2EA 5J2PA 1HNWF 3RAXA 4NASA 2R7RA 2B4VA 1NLKL 4FYXB 3CF5Q 1RU1A 3AD9C 3CCTA 4KHRA 4ECVA 2F4VJ 3QJLA 1KLMA 1BUXA 4DR3J 4Z2XA 4OZ3A 3I55S 1S6PA 2DNMA 3BDEA 2CQGA 3BGFA 3KFWX 2FB0A 1F2GA 4P2FA 3KJNB 2ZNZA 2MKCA 2YKNB 1I94J 1OS5A 3CDWA 2DNRA 4O3NA 4NLUA 4ER8A 3US5A 3FC9A 1U02A 3KK2A 3MM9A 3T19A 3D28A 2ALZA 2CQ1A 4OX9F 3RU0A 4RUHA 2JLGA 4DV1J 5D3GA 3I0SA 3O2IA 2IC3A 2KKHA 3QT7A 4V1Ak 1UKUA 2DTJA 4DZ6A 1SJQA 4HTJA 1LW0B 3TZZA 1CPZA 3C6UA 2AKWB 3RR7A 3JYTB 2KTQA 2WVEA 3OHBA 1IBMF 5E3RA 3GPAA 3HMJG 1HI8A 3W1YC 3IRXA 3CE8A 5E3QA 4V19X 2H48B 2I2YA 1IUJA 3RZAA 2BEFA 1BQMB 3PZPA 2AGOA 1N32J 2F1FA 1RYSA 4QWEA 5LMUF 3V6KA 2NUUG 2G4BA 4IG3A 5GAEU 2MKJA 1SKUB 1A0OB 3N4WA 5KFRA 2HS0A 2NCKL 1KDNA 2MHNA 4NLGA 3NLCA 2I38A 3QGPA 2UV8G 1QUPA 3DC2A 3KK3A 2DR7A 2HHQA 1IBLF 3HLUA 3ZTPA 4UUXA 3KK1A 4NCGA 3T6JA 2CPEA 5AE2A 3GJSB 4CO0A 1JLAB 1UTAA 1VJQA 4JI2J 5LSLA 4MYUA 3PEJA 3CSKA 1MN7A 3M6WA 3OQ2A 3R2DJ 1W2BR 3TJ8A 4RNNA 1C1CA 1UZHA 5J2QA 4ZJLA 2YNFA 2XBPA 2XS2A 4HR2A 1TV6A 3H98A 1DQ9A 1RACB 5IC4B 2PDAA 4QIVA 1T0TV 4FXVA 3VQSA 1XR5A 2DGQA 4NXMJ 2D9OA 1RAEB 3KLFA 2Q6BA 3KHRA 4UOFA 4URGA 4ZITA 1OMSA 1FKOA 3LWLA 1X4AA 3EDQB 1FXDA 5ETRA 2CVEA 2VHGA 4TYAA 2MKYA 5IT9U 2R2SA 5ETSA 3LAMA 1RYRA 2GQCA 2PMHA 4NPOA 1RGVA 5D4NA 4I68A 4O3QA 4X62J 2XY7A 3EGVA 3QWUA 4KGKA 5THWA 3C2PA 5IV4A 5AE1A 2D41A 4K4YA 2YQ1A 4MFBA 3IR7B 1TFYA 3NWRA 3GQCA 2QYGA 1F9EB 1KR4A 1S57A 1CJTB 2YWEA 1WTBA 4WP3A 4QU6A 3LQVA 1E6VB 1JKHA 4MKVA 5J2NB 4YB1P 4DZDA 1NSPA 3MWBA 5LJ5Y 3TOQA 4PAAA 5KOXA 4X4PA 1Y3KA 1OYEA 2UUBJ 3LP2A 3NWGA 2BBEA 1JJ2R 3W8GA 3R9LA 3OFEA 4A8MP 2R8HA 2VB6A 2AT1B 1F9HA 5K20B 1J5EJ 4IOCQ 2LEAA 4CLYA 5KT6A 2DH9A 2JC1A 1QD1A 3PX6A 3EE3A 3QGGA 1FRMA 2FJEB 1AUSL 2CXEA 3MCMA 2EG2A 2Y1JA 2DO0A 3TUZC 1ZS6A 3BR9A 4CO3A 3UW1A 2HMIA 2XMJA 4ANDA 3IS9B 1RT4B 2RU3A 3OL7A 3M8QA 1SQEA 3FCHA 5HJYA 5SUHA 4UW2A 4OYWA 4Y00A 4WPAA 1R27B 4EBEA 1YX2A 2YNIA 1OY9A 5E3AA 4P2XA 1QE1A 4LSZB 4ZN1A 4PEOA 3OR1A 1Q7LB 3LWMA 4MKBA 4DV2J 2QTWA 5IOLA 1X5SA 1PC4A 4U96A 2RNEA 3T9NA 4DXLA 3OVAA 3Q83A 4EBCA 2AGPA 4LR8A 2BE2B 2JFKA 2R8GA 2BX6A 3HI9A 1VQNS 2MKKA 3C6TA 3MR7A 3O5TB 4TQSA 3ITHB 2V8DA 3H5UA 3HKZD 1FVSA 2FY8A 2VD3A 2E5LJ 3KJFB 4USUA 2QYCA 4ECZA 2G2YA 1T9WA 1MW7A 3UDEA 1NK5A 2FLPA 1XIQA 4J9MA 1S12A 4YB7A 2JEFA 5KFHA 1D3WA 1NM2A 5KFKA 4C0BA 4LR9A 4CLPA 1RCOB 1HBMB 1LXNA 2WW4A 2N82B 3VAGA 3EXCX 3BBFA 2R7QA 5AXMA 5DGAA 3IMQJ 2YKNA 1FNXH 1TL1B 3X3UA 2R2TA 1BGXT 1SQGA 1VCTA 2DHAA 4DUTA 1FJEB 2V6AA 4FF2A 2LP4A 4AE5A 2C2DA 3W2VB 2HK2A 3J80Y 3MPYA 3SXLA 2A2CA 4KPCA 2OHDA 3PTWA 2KVIA 3DLLQ 4KY3A 2NS1B 2F4FA 4ZMMA 1PGZA 3ENWA 3ZO7A 1VQSA 3CPWR 2BJ3A 3JYTA 2LQJA 2CNKB 3LO3A 2O67A 2FC8A 4YUDA 2QX0A 1UWAA 2EXUA 1Y11A 4URSA 2ZZTA 5MLCV 2W2OP 1IBCB 2OPRA 1JLFB 2NXUA 5K9FA 3UE2A 3N6NA 3N0VA 1VQMS 4DV0F 2RJZA 4C2MA 1RWXB 1HNVA 3N5FA 1OQ6A 2ZVSA 2R7UA 2IA6A 3CJQA 4EYHB 1XNQF 2KJVA 3ILLA 5L8RC 2K7KA 4JYAJ 4ECTA 5B0EA 2CJKA 4F4WA 3VR1A 5D4PA 5HQ8A 4DN9A 3HXMA 2Q1LA 1HD0A 2Z2YB 5HMWA 4B3OA 3M9OB 2ZH5A 3I87A 2ZJPQ 4Y65A 3NRBA 5K8OA 2YNGB 3THTA 3U7JA 4I0WA 1TTHB 3OTBA 3PKMA 7AT1B 4LSLB 3O3LA 4N5SA 3JTPA 4J9RA 1T03A 1S4FA 4ZIWA 1YGYA 1K8AT 1PJ6A 1RTIB 3J7YI 4CLLA 3UN5A 3HFVA 4ZLLA 1UA1A 3CCSS 4QIFA 3FNNA 3BKTA 3BJYA 1TFWA 4DR3F 3VGVA 4LT6A 1DTTB 4DL7A 3QGIA 4HACA 2M5YA 2LDIA 2Z2LA 1V6HA 2E5IA 2GO9A 2PA3A 3KLVA 4ZCLA 2A10A 2VBZA 2XYGB 5GADU 2QSWA 1I94F 4UOHA 2AJ4A 3ILIA 8ATCB 2ASDA 4X2BA 1FESA 1SC1B 2E5GA 3BQ1A 2HGNA 1AT1B 4JI1J 5KFWA 4F7VA 3AJDA 5A8RB 3SEOA 4CT9A 5KFBA 4YMEA 3BZQA 2QIFA 1RK8A 2LEBA 1TK5A 1HL6A 2BRKA 1XMQJ 1RI7A 4YEAA 2FVCA 2CQHA 5F8GA 2PD1A 3TO8A 1SJRA 2PI4A 2N4DA 3DLEB 2N3OA 1E6VA 4WYLA 5J2NA 4RU9A 3PW0A 1YJVA 2XMTA 5CA5A 1NK4A 3BSCA 3PCOB 2AZ3A 4LRCA 1N32F 4WE1B 2DCUB 4C98A 3MXHP 1KEKA 4Q0BB 3PHTA 4P74A 3SSRA 2QE5A 3HP6A 2R7TA 2R9LA 3TVYA 3MMAB 2EK1A 2GZOA 3DN9A 1TL3B 4YN3B 3CTRA 4WU2A 2Y8WA 2LVWA 2HG4A 4FNHA 5J1PA 1KD1T 3AA8A 3IWNC 3A8JA 3NS6A 2QA1A 1RT4A 4C6AA 1UEKA 1O8BA 1FWPA 1CEZA 1PO6A 2PC6A 3AOCA 3BB5A 2AIRB 4JI2F 2F7VA 2MPUA 3NGSA 1FXRA 1RDRA 1WC0A 2ZE2B 5E3PA 1T05B 4KRWA 3RBDA 3H2UB 4P75A 4GKKJ 1GQEA 4RBVA 4AD6A 2OFHX 1RBOB 3AFGA 3H5SA 1YJRA 2HQDA 4A8QA 2CIMA 2BE2A 4OZNA 2MQMA 4EUVA 2X7IA 3NGRA 2ZC3A 2B4PA 4NXMF 3RAQA 3OXLA 4ILRA 3ITHA 3THVA 4KV8B 4K4VA 4C11A 3D6HB 1XC9A 1JLBB 1AXQA 4JV1A 1TK8A 2X3GA 1ZZNA 2K3IA 2XLKA 1CC7A 4UY8T 3KKFA 2YKQA 1YRXA 2UU9F 1P9YA 1FDNA 3FVYA 5I3UB 4RNFA 1UFWA 2GJ2A 1L5UA 2EK6A 5JMNA 3DI6A 2X3DA 3F41A 4X62F 3HHKA 3CULA 3ZZOA 2ZHOA 2JZ5A 3M30B 1HQUA 2ZD1A 1VC0A 2JEIA 1RUSA 3H40A 2CVIA 3JSYA 1G7CB 4OJGA 3G6XA 4KE5A 5KFJA 4ES1A 4OMFG 2OJ3A 5E7OB 1DFDA 2F8EX 1S1UB 1N0VC 3ONQA 4J9VA 2IRYA 2EFOA 3ISZA 3NNAA 3T6BA 1NAQA 2WSEC 4CLUA 3DOKB 2Z8QA 4IDKB 4LVOP 1Z2ZA 4MK9A 3ZFVA 2UUBF 4L76A 2DGVA 1LWFA 2L3MA 3LP1B 3UR0A 3AT1B 4LRAA 4WIQA 2H5IB 3TYTA 1OY8A 2A3JA 2JEJA 2QLJB 3RAMA 1T8EA 3CCLS 4JV0A 1UFKA 5BJRA 1ZH5A 2PMZD 1FT8A 4EBDA 3CO9A 3VAIA 3AD8C 2CJQA 2MMYA 3DLBA 2DGSA 1KOOA 1S97A 4WXWA 3C16B 4JI3J 1FK9B 3L09A 3MCSA 4OYIA 4PG5A 5BR8F 2XY5A 5AXNA 3W62A 5KFTA 2FVSA 1HKAA 2HVEA 2MSTA 3MM7A 1WOOA 1GT8A 3J7ZT 1SC6A 3DDNA 4DV2F 4F8RA 2AJQA 3A4TA 4QZVB 2ILYA 2ZITA 1RWNB 1CG2A 2WOMB 4OJ1A 4CH7A 4LSLA 5IWAF 4J5OA 1BE4A 1N4LA 3PR5B 4DS4A 3D68A 3OTCA 1XWLA 3CC4S 1SJ4P 1FEEA 3IGNA 2E5LF 3ADAC 1N5YB 2JWNA 3V4IB 1ZM2A 4J9OA 4ECYA 2PA8D 2OPSA 2J8AA 2RB7A 2DT9A 4B9NA 2RVJA 2BZ2A 3MM8B 2GVZA 1DTTA 3VVUA 2HYIB 3VF0B 3N79A 3GTYX 4DU8A 2WONB 3QNWB 3EVWA 1T9UA 3SDEA 4R8UA 4KO0B 2BVZA 4PR6A 2K1RB 4F4AA 1TMMA 3PKYA 3PW4A 3H4BA 2KT5A 4ITSA 5F8MA 3PR4A 2PEHA 1RCXB 4I67A 3D6TB 4IOBA 2DGOA 2YH1A 1WHWA 1VBYA 2VG6A 2R3VA 3VAMA 4NRUA 5A8RA 5T7LB 2Q79A 3U02A 1N5VA 1F5CA 1YK9A 2ZOMA 2RS8A 3NMAA 2LQBA 3H2LA 3P4UB 2J0SD 4MK8A 4P71A 5F8HA 3J7AN 3HDSA 3O44A 1JIHA 2FJBB 3BGUA 3CDBA 3KG4A 1VBZA 4AXIA 3R5CA 3MFIA 4FNIA 3NS7B 4TKTA 3DLEA 1GMWD 3JQKA 4O4RA 2E29A 1QAXA 4LQ3A 3D3BJ 1NMEB 1PC5A 5BYRA 5JXSA 1UW4A 2HHTA 2ASLA 2HFNA 1BLUA 2DGTA 4TNOA 1M5SA 4WE1A 2MZQA 4M5GA 2MSSA 1MWZA 2IDEA 1U1MA 4Q0BA 2VONA 1RWOB 2G1HA 3PFOA 4BWJA 1VR6A 2CFXA 4HHUA 4EU0A 4ECSA 2KL8A 4TY8B 1TL3A 3B6BA 2CNNB 2A0FB 1S48A 5A2QU 1L3VA 5JJBA 1S0NA 1RT1B 4CM0A 3V6DA 2A6OA 1T9YA 1WDDA 2F8HA 2LA4A 1IR1A 4DX7A 1KLNA 4F25A 2W2PP 4OYAA 2VPYB 3HKWA 5C5JA 2RF2B 1WELA 4DX5A 2QLWA 2ZE2A 5FLXU 3HZEA 1JJHA 1T05A 1NH7A 5J1EB 5ADZA 5HSPA 1RHRB 1Y0HA 5KG7A 2K3KA 2M88A 2LYVA 4UT4A 2X1BA 3Q8VA 2FPHX 3MAQA 5DM7Q 3E3XA 5LT5A 1P1LA 4NLOA 3M32B 5KG2A 4CIOA 1FRXA 1RAIB 3GR0A 4ZVFA 1BC6A 4Y2MA 2VQEF 4CI0B 1M5HA 3AH6A 4KHPJ 4K5SA 4C97A 3MD1A 5CHCB 2QG9B 4KV8A 1OO0B 4OX8A 1FRJA 3B54A 1X4CA 2HVHA 2CRLA 2YQ0A 1C0TB 3CJTA 1F3FA 2OI2A 3FQKA 1WNEA 5DG8A 4WFAQ 3UR3C 2CNOB 5I3UA 2DNKA 3IR6B 1U09A 4JI1F 3IBFB 2IHR1 3TUJC 2ZM6J 3IR5B 2KG0A 1Q16B 1E6YA 2ASJA 4ZP8A 3P49B 3Q24A 1BWVA 3T3FA 4B9LA 5B0CA 2BJEA 2MKSA 3JB9k 1S1UA 3ILJA 4CWBA 3MMJA 1NHVA 3QJJA 4M95A 1QSSA 3GJQB 3T1HJ 2RQCA 4JI7F 3CCVS 3DOKA 4IDKA 2HAFA 2OLWA 2CPXA 4G3IA 3QQCD 5I4MA 4RW8A 3CO0P 4KSEB 4PWDB 3HCXA 3F0NA 2BJDA 3LP1A 2MEWA 4CLSA 4ZPCA 5HBMB 5D0GA 1X0FA 1FWKA 2IA0A 1Q5YA 2DY1A 1IKVB 4IOAQ 2EI5A 5HANA 6AT1B 3TRGA 2J76E 3Q8UA 4DPUA 1WC6A 4UOCA 5IT0A 4XK8C 4M1KA 5HLFA 2AEJA 1RAHB 4EK2A 3SQGB 1U1KA 3C16A 2JNJA 2VV5A 2B3TB 1VK3A 2OELA 1NJXA 1FK9A 2Z57B 2FHOB 1QAYA 1SJ3P 3WIUA 3MURP 3H7HB 3M4XA 3LANA 2VOPA 4PYAA 4FS2A 3Q23A 1UVIA 1IVZA 4ALZA 3EYZA 1B99A 2F63A 3GB0A 3UCGA 2CQ4A 1NEEA 4ED3A 5HQLA 3G82A 1RHJB 1R0AB 1RU2A 3AQPA 4OZ0A 3CT9A 3P8BB 3CIMA 3CEDA 5B09A 1WOSA 3MR6A 4JV5J 2C2NA 5F8JA 3MM6A 2YX1A 4IR9A 4K50A 4C9DA 2XYHB 3NS5A 3CJRA 3J7A1 5E0OA 4DFJA 3GFXA 1XNRJ 3AJ2A 1TKDA 1MG7A 4KT0C 4QWDA 4LF4J 3I4HX 4Q8EA 2EG1A 4GC6A 4WTOB 1QAIA 4BS2A 1WC4A 3CMAS 2Z2ZA 3NP5A 2P9EA 3V81B 4CO5A 1EETB 3ZZYA 4A47A 1FFWB 4YHHJ 1IXKA 2WONA 1R6YA 3UO0A 5LXRA 3Q2TC 5H9EJ 4LF5J 3D5MA 4G6VB 4CTAB 4KO0A 2MKIA 2KG1A 4NWBA 4LBIA 4PXBA 3Q86A 5KFGA 3OTOJ 1APSA 2J0QD 1WHVA 5BYQA 1RT2A 3KLHA 4IR1A 4K4WA 4I6YA 2QGFB 1O0PA 2BR0A 2ZOGA 2HHHJ 4OFZA 2U2FA 1RKJA 4OYMA 4DQRA 3NGKA 5H9EK 4FYWB 4YQWA 2GHPA 3J81U 1DAXA 1JLEB 4IKAA 4HH0A 1WI8A 5HN0A 4QYZJ 2DGUA 2UUTA 1RHUB 2KI2A 1L3TA 2FJAB 4FF3A 2YKMB 4OIXA 5C7PA 2VA3A 2OAUA 3EUNA 3HFKA 4DSIA 1LV5A 2MQLA 1MWYA 4PQUA 3AD7C 1YTYA 2V8HA 4X4UA 1PG5B 4MJKA 1GMWA 4NEYA 4A8KA 4JI3F 5GAGI 1VFJA 2VC0A 1LFWA 3D6MB 5KFPA 2C2RA 4LR7A 4Y2CA 5IV3A 4TY8A 2D3O1 2HNZB 3QWPA 2ROPA 2RDJA 4DR7J 3MFHA 1Y00A 1MN9A 4M5DB 2DHHA 2LMIA 4IH6A 2HQIA 4DF8A 2IFXA 2KFYA 5DG7A 4KAIA 1FJCA 2QFJA 5DM6Q 2FHJA 3TAMB 1Q8KA 5ETNA 5D78A 2RF2A 2FGCA 5J1NA 3EMTA 1JQGA 2V2ZA 3RRKA 1HI0P 5J1EA 4EMDA 1U4BA 2GC8A 3I0RB 4QW8A 2EKNA 4KGZB 1R8BA 3DU5A 4KIAA 4DFPA 4GKJJ 5A8WB 3M32A 1LW2B 1SV5A 2DRBA 3SQOP 3HO1A 4FXWA 4JB8B 1GX5A 2D7SA 1T94A 4Q8FA 2C3OA 1FE4A 3I5BA 1WG5A 4RW6B 3UNYA 4WFYA 1ACMB 2KVQE 3HHEA 2FVQA 2ILZA 3WIVA 3JTOA 3G8SA 3Q89A 3NCRA 3VWSA 3CJ3A 1RHMB 3OVSA 1R3NA 4DX8H 5EDWA 1DHMA 3IO1A 2RHQB 3CCMS 2D1CA 4JI8F 1JXEA 1Q1KA 2B8PA 4IRCA 5IQQA 2EFGA 5FD1A 3CB4A 1NJWA 1N5QA 1W26A 2QA4S 1AZSB 2C42A 2KM8C 1JLQB 4F26A 1L3SA 2XHCA 4IRDA 5ETOA 3SI8A 1YBTA 4B9SA 4KTQA 1WC3A 3I96A 4F2SA 4PWDA 3NKYA 3QJPA 1UPPA 1KFDA 5I42B 3ZC4A 4K4UA 5HBMA 5E5NA 1B7FA 3MCNA 2HEKA 2AJ0A 3OTDA 5H1SV 5GAHU 4N47A 1IKVA 2PFFB 2VPWB 1D9FA 3MPWA 5KFNA 3OFFA 2KXNB 1HPZB 5CYMB 1Q0NA 1R7IA 2OTJS 3PY8A 3QT5A 2KT2A 2VDIA 3SQGA 1AA1B 3TUIC 4DPWA 2ZHBA 1LXJA 2AYEA 2IYGA 2CG4A 1T7PA 1ZAXA 1HWLA 2P6SA 3CIZA 2CJXB 5HVHA 3EGNA 2F8MA 5KG5A 1F9FA 3G87A 5DJBA 1RLDA 3ETMA 2B51A 3C14A 1K9MT 2J9CA 4GC7A 2D3OR 4Y2KA 3RBZA 1ELOA 3OFGA 5IC6B 2KN4A 3I9V9 5DDPC 2YWKA 5LL6d 4XDDA 2HWTA 3W66A 3I32A 5CQGA 2FQQB 1VK8A 4JI5J 1S1VB 1TZ0A 1YITS 1N88A 2YKOA 2FUG9 3FSYA 1RWVB 3MUVP 1OSDA 3UWTA 3QLHB 2KM8B 3LGNA 3TAPA 1RZMA 3NAIA 2MQQA 3Q2SC 3DRXA 4HI1A 1UWBB 4Z7CA 2RUGA 1JK9B 1P27B 2CKWA 3TARA 3F56A 4ZVOB 3PXGa 3M1VB 2HIQA 1EETA 1X4GA 3VZIA 1UEVA 3PIPQ 3KMQA 1BD6A 5K8NA 4BDPA 3G9CA 2PSZA 3L7UA 3R5AA 2CYYA 3MAAB 5CH7B 5F8LA 2NXEA 3A8EA 4DV3F 3K5NA 4PXCA 3DLJA 4DCPB 1VBKA 4C3LA 3MM5B 3JXOA 1NJIT 4X64F 3Q8QB 3TQEA 4PPZA 3VQTA 4WFNQ 2ZJQQ 4QIGA 3T1HF 2IMWP 2DXFA 1NZAA 2NSBA 3JSRA 1HWIA 1IR2A 2CPFA 2ADBA 4PG7A 2BRLA 1JLEA 2C2OB 1C2PA 2GIQA 1S79A 1FXLA 1HNWJ 3ENAA 4A8SA 4O0NA 3CCZA 4Y0FA 4QU7A 2HQ3A 5KFLA 1RT7B 5L46A 2PFDA 2O5DA 4DSFA 3D54A 4ES3A 4TVAB 4ZPVR 1X5OA 5A0YB 3OLBA 1HFEL 2FLLA 2DIVA 5BYSA 4OZ1A 3SCJE 1NSAA 3BSOA 1ITPA 5G0RB 3MEEA 3RW6A 4P2MA 4LFCF 2VASA 4OX9J 1U49A 1QDUB 4YP3A 5A6WA 4DSLA 4RBTA 3JAMU 2ZOFA 1GXLA 4ZHRB 1EB0A 4OI0A 3EX7B 3NBPB 2V4JB 4G65A 3FRZA 4ZP7A 3DRRA 4QR2A 3TAMA 4DUZJ 1O51A 3TJ9A 1R8AA 2BYCA 2GW8A 5LSRA 3AQOA 2CPIA 1S10A 1LEOA 1IBMJ 4WK3A 2POKA 2ZBQA 4XPCA 1KP6A 2QC3A 1LOUA 4CYUB 1XNRF 4P72A 4DL3A 4IFVB 5CCLA 4F4YA 3WX8A 4LF4F 2EFPA 5IFMA 2RT3A 3BREA 3W2WB 4ZP6A 5A8WA 1LW2A 2MJUA 4CZCA 1UP1A 1B0VA 2HNDA 1JLGA 4DR2F 2DK2A 2MLXA 4PCQA 3SIPB 3MMCA 2H4YB 4LRDA 4NLWA 5LMUJ 4OYBA 1TU0B 2Y0SD 2DEJA 4RW6A 2HLUA 2EEYA 3VALA 3CMES 1IWAA 5KG3A 1FI4A 3NGUA 3GZ7A 5KT4A 3PX4A 2XY6A 5KFEA 2MZJA 1NH8A 2HFOA 1SQFA 5JVGQ 3R3TA 4LSNB 2WSCC 1NBEB 3QRQA 3T5LA 3CJ5A 2HHHF 3KLIA 1RP5A 3HJVA 4HEA9 4R25A 1JNRB 1V5IB 2HGLA 1IQZA 1YG0A 1WG4A 4DPXA 2UVUA 2G1DA 2AYMA 3BO2A 4N76A 4WFXA 4NLRA 2JFDA 3FRYA 1HWJA 3R2CJ 1AZSA 4DN0A 3A1YG 1JLQA 3EVMA 1VDHA 2UP1A 1EIYB 3DRPA 4O3SA 3NGTA 1VBXA 4LF6F 5GMKa 1CBKA 3QIPA 2YXLA 3FEZA 5L1LA 3FZ2A 3T1YJ 3TX8A 2DXEA 2CPDA 2D9PA 5I42A 1RTZA 4LVNP 4URQU 4F0HA 3POTA 3A3PB 3DGPB 5D8HB 5LSOA 2MQPA 3ZNJ1 1X4HA 3IGVA 5H9FJ 5IS2A 4Q43A 3GYGA 4DR5F 2EW9A 4W98A 5HATA 4LMZA 4P52A 4PUOB 1PKUA 3JTNA 5D4OA 2G9OA 2LLZA 2O3DA 1NCLA 3CWJA 2R7XA 3GFHA 4RL1A 2VPXB 4ZN3A 1F3VA 1B64A 4RW9A 3H59A 3I4PA 3NY0A 2IM3A 1KN6A 2QZ8A 3IBWA 4USJC 5H9FK 2MXYA 4PYDA 4YDDB 1QSLA 2XS7A 5IT4A 1VQ9S 4GKJF 3PO4A 2GIFA 1ZA2B 1H0HB 4USHA 1YLXA 1FVQA 4OYZA 2LCWA 4EO6A 3IP0A 1VRUB 1LQ9A 1RWWB 2NYHA 2CQDA 5ETPA 2Q66A 3G6VA 4MT1A 1AROP 1K1SA 5E33A 3V5RA 3AJ1A 1VIXA 3PJXA 5FJ4A 4JI6J 2X1FA 2IJFA 3FBCA 1UWBA 2BA9A 4L75A 2HVZA 4O44B 5L39A 2VDHA 1CLFA 4NX9A 2CWKA 3M1VA 1K73T 2QRRA 2UXCJ 2K06A 4B3TF 3CXCR 1LFPA 1GFWB 3ZXWA 2RQMA 1MU2B 3BGRB 4QWAA 2JSXA 3M6XA 5L9XA 2V0NA 2XI2A 4OZ5A 5ETVA 4QPXA 3MAAA 4UQTA 5HMYA 3R5DA 4LFAJ 4K4XA 4ENOA 1HNIB 2J0WA 3HZGA 5GAEI 1IKXB 1EQ0A 1ROFA 3HHLD 3MM5A 1V3SA 3AB2B 2RQKA 2W4PA 3PYDA 4L6V3 3HHDA 2YQ3A 4OZ2A 1QTNB 3PRVA 1RWUA 2PIIA 1RT3A 1FD8A 4ZP9A 5AXLA 4CLKA 4JI4J 2ACMA 1XEZA 2IM0A 4O4GB 4DQSA 1GMVA 4Q5VA 2JC0A 1QUVA 3TX0A 2Z4PA 1X4FA 1J2VA 4JI0J 4P7VA 2YWFA 3H5XA 2DPIA 1M5VC 4GVLA 5HMZA 2BANB 4F67A 3RB3A 2G0JA 1F5BA 3RRHA 5KFYA 4FYYB 4P7TA 3Q22A 2CQIA 5HROA 5A0YA 1KTVA 5CAAA 3KYLA 3EWGA 1FJGF 5CXTA 2N4CA 2HAIA 3M8WA 4EGLA 2UVWA 4U7UK 5G0RA 4PXDA 2G13A 3S7RA 3TA1A 3BF4A 1TAUA 5C24B 4FYDA 4ZHRA 3L7PA 1DTQA 3NBPA 2XG8A 3AOBA 2R7OA 2EC0A 1JJCB 3RUBL 5L1JA 1D0EA 4K7QA 4NA1A 3A13A 2AYGA 2JH3A 1TMJA 2B5JB 3FQLA 4CYUA 2DPJA 4DOZA 1H98A 3W2WA 2ZKTA 3M6UA 4RU2A 1S1TA 4G1IA 1RAAB 2MTLA 3ZTRA 1M0SA 2B9EA 2XNQA 1XQIA 1NU4A 1X8DA 3KNAA 2FYXA 5DGBA 2M2BA 3MUMP 1XNQJ 3AXMA 4K59A 2GHWA 5DZ6A 1IN0A 1UJ6A 2DR8A 2BMBA 2HVIA 2RH3A 4WCEQ 3NAHA 1Q78A 2Y8YA 4ZVHA 4R0EA 2DH7A 4PG4A 1RXOB 1J27A 1OPIA 2HQFA 2LXFA 2NXJA 4LSNA 2F3JA 5IZHA 4HT7A 1IJFB 4NRTA 2EKYA 2NUHA 3UDCA 2YY3A 1WF0A 4YY3J 3BEGB 2YNHA 2UVRA 2IRXA 3T5KA 3FBEA 3CJ8A 4YS2A 4CO4A 3TNVA 1QLNA 2ZBCA 4A4JA 4PZVA 4ZA1A 1RHKB 1Q81T 2ABYA 4L3NA 1EAYC 2DNPA 1WEYA 1ZM9A 3G6ES 4ZIVA 4G1QB 3DLHA 4DF4A 3QFWA 2E5JA 3GYNA 2XSFA 3BSAA 2W9BB 1BXNA 2DNZA 3DGPA 3K7RA 4OL8A 4ILMA 5IT9Y 1S0VA 4RKUC 3N6LA 2BXJA 5HP1B 2MKHA 2VICA 2HNYB 2CQ3A 2IM2A 4ILLA 3B4MA 2RMLA 2UV8A 1GNKA 5KFZA 3KLEA 2C3YA 1X5TA 3BR8A 2ZJRQ 1TAQA 4FXDA 1ZM4A 1CC8A 4ZJOA 4PUOA 1WACA 4HDHA 4Q7AA 2FJDB 4B9TA 3L3CA 3BH7B 4DUZF 1SIZA 4IG0B 3AB4B 4TLRA 2Z56B 2KB2A 3D67A 3RW7A 3M05A 2ADCA 1TKZA 3PYGA 2GQ2A 5L1IA 1FD2A 1LWCB 1T11A 1JXLA 3IM8A 2GJIA 3JQJA 2OEMA 3LW5C 3WZ0A 4XAKA 2OPQB 1NJYA 2W24A 2MZRA 4DR6J 4NYZA 2V9WA 1SC3B 3W61A 4UF4A 2BKNA 1VRUA 3N01A 3RBEA 4ID5B 4FKYA 3PNIA 4HHHA 1O6XA 2ZBRA 1PIEA 2G2ZA 2FHMA 5A8KB 3PJ9A 3U1MA 3T9ZA 1RSCA 4O44A 3EGZA 4OHWA 1HLWA 1Q82T 2BQRA 2F9DA 2FLOA 3BN7A 4KC5A 3BGRA 4HVZA 3O8WA 4DV4F 2V8GA 5D0RA 2HGMA 3IG1B 4PRFA 4V19J 3FZBA 5IM0B 4FN5A 1HNIA 4QWBA 1BQNA 3B8HA 2BOAA 2OO4A 4I2QB 3KWMA 5KG4A 2XMUA 3GILA 2GO8A 1S9GB 3KG0A 2HW3A 2A1BA 4I56A 3E51A 1PILA 3HHLA 4AT1B 1S1WB 8AT1B 4Z7YA 4O3PA 3SV3A 4FZVA 1NPKA 2BJ7A 4WFZA 3T1YF 2QJ3A 4NA2A 1U6FA 3VV2B 3LALA 3MMBB 2E1PA 1FX2A 3B4DA 2HWIA 3PW5A 2V4RA 2P2CB 3OXFA 4C48A 3R7BB 4N8OA 2BANA 5D4LA 3JSMB 3WBZA 2KYXA 5I3PA 1C1BB 1N56A 2UU9J 4I4BA 4J7CA 5HVFA 2DH8A 2OEJA 3DOMA 4I2PB 3FJ2A 3HVRA 4IQXA 2JRSA 1NKBA 3GV5B 1QVFR 4M5MA 3T41A 4E98A 1JXVA 5GADI 4QQBA 1P6TA 2D74B 4IQMA 3K5PA 5EN1A 4MYTA 4NI2B 1N54B 2UZAA 3MECA 1XBWA 3QZ7A 4FS1A 2CJBA 5C24A 1MROB 1LK5A 1X0PA 1SCJB 2QL7B 1BWEA 2B9WA 4OI3A 5LJ3Y 3GV7B 1U47A 4ZVRB 2JDJA 4CLZA 3HT3A 4OHVA 3GG1A 3K17A 4X66F 4H4KA 3RTVA 2HRYA 4M8LA 3I9ZA 2B5JA 4JI6F 3DLKA 2RAQA 3K59A 2W01A 4LBPA 2HS4A 3RB4A 4A8OA 1HHSA 2YTCA 2IVYA 1JLCB 2C2ZB 1RJJA 1IKWB 2UXCF 3BKFA 3F73A 5KT3A 3OD2A 2CADA 2H54B 2AEMA 4TQRA 3PV8A 4ID8A 2VQFF 3D7SB 5DETA 2AHOB 1ZOTA 5BR8J 1SC4B 4OI1A 1EZZB 1WHYA 4LFAF 2H51B 1NK9A 2J5AA 5C2GA 4YOEA 3FMBA 4ZCIA 3C8YA 4KKOB 1TL5A 1YRTA 3G8TA 4E8UA 1T3OA 4DQPA 4FPRA 4I6WA 3BN4A 4QOTA 4DV7J 2AP6A 3UN3A 1PJ5A 4H4MA 1U1PA 1HBNB 3CJKB 3MPDA 5L38A 1TUGB 4JI4F 1RQ0A 2GS8A 1FKPA 5IWAJ 1YZ7A 3R5BA 3MEGB 9ATCB 1YJNS 2MZTA 1SKRA 2RRBA 4BC7A 4USWA 4N56A 4JI0F 4USVA 3EXYA 3CJSA 1N33J 4L74A 4NLPA 1W7WA 1AB8A 2O01C 4C8YA 3LF0A 3V6HA 1FNOA 2W7AA 3QGHA 1U8SA 2FIUA 4G1QA 2DISA 3PG9A 3LPYA 3UD5A 2DRAA 3TEHB 1U0HB 2AF6A 4KH0B 1KONA 2W9BA 3QSYB 1MMLA 2ZWOA 4QR0A 1MWQA 2DNOA 5D77A 2HNYA 3OBIA 1RWKB 4L73A 3CW2C 4TLQA 5U47A 1CULB 4AQYJ 2Q6CA 3AY0A 2E7WA 4GO5X 1T3NA 1X4EA 1HNXF 4H54A 1LW0A 3MOJB 1VLOA 2OPPB 2J6UA 3SCKE 1JX4A 4IRKA 1HMVB 4MK7A 4M5LA 3ILOA 1UMJA 3D4JA 4FBUA 3CD5A 1LWCA 3PRDA 2VOOA 3GJTB 1O5JA 1RAFB 3EZUA 1WKJA 3QRPA 1RE1B 1BQMA 1S6QB 4ETZA 4ZLNA 3DHXA 1SJFA 2C3UA 1KQSR 3IC1A 4CLWA 4NA3A 3NNHA 1UJ4A 3FFIB 2DCLA 3BGOP 1VC6A 1MSWD 3W63A 2ZFHA 3KHHA 3HSZA 1Z2LA 3W5YA 1B3TA 3DHWC 1RB0A 3ZZZA 3BBCA 5J2PB 1R43A 3ISNC 4YY3F 4BC9A 1U1RA 3I5AA 1R31A 2KFZA 3IG1A 1JLAA 3DCAA 4BHQA 2WVBA 4FVCA 1TQLA 2UUAJ 3CVKA 4GRSA 3K5LA 4I2QA 4OV6A 1SL2A 3P5BP 2N7CA 5HAOA 5CYJA 4DQQA 3P5TL 4DPYA 1S0OA 1S6PB 4EI2A 4PG8A 3K5MA 4C0HA 3I31A 2XM3A 2VQEJ 3PHEA 4RW4B 2Z0GA 3KUGA 2VBWA 1WDTA 2MLZA 3KK2B 1NDLA 4NYOA 4J9LA 2RQ4A 3KJQB 1H7WA 2HZVA 5KG0A 5D3GB 1NSKL 3JSMA 1NHKL 4DL2A 3SZ2A 1C1BA 3HD1A 4CQ1A 2OMLA 1PYTA 3M6VA 2XO7A 3SMZA 2MZSA 1MMDA 3PJWA 3C6UB 1XR6A 1VRTB 4I2PA 4J9KA 2GCFA 4PWUA 1KC8T 1KQFB 3DFEA 4ZPWR 5DDOC 1HARA 3OUYB 4WU3A 3IRXB 5JVHQ 1YWXA 3VAKA 4NI2A 3VCDA 1CJTA 4S0MA 3M8SA 3H25A 1TKXB 3HSDA 2G0IA 5HMXA 5CABA 5DQIA 1MROA 3CDUA 4CO2A 5EUHA 4JI7J 1SVDA 1WF1A 4DR6F 2WTFA 3QMQA 1N6QB 1V5VA 2AGQA 4IG3B 2ZH4A 3IAS9 4OYPA 4RUAA 1CS4B 2CNLB 5DS7A 2Z30B 2VU5A 3DGVA 2DD8S 2I8EA 1YIJS 1KHWA 3KK3B 1OJ4A 4O0IA 3BS9A 1ICEB 1SH0A 2XEXA 3PYFA 2KRBA 4LF2A 1NRKA 5KFMA 1IKWA 2W8KA 3HPOA 3CMQA 4ICLB 4R5PB 2E44A 5EX3A 3EICA 3IS9A 2MYFA 2HHPA 3GIRA 4NE9C 2OD4A 4CNZA 2YNFB 2E1RA 2VFTA 1WSVA 2P8IA 1S72S 3K89A 5F3ZA 2R4FA 1WD6A 4AYBD 1MMNA 5KT5A 3SSSA 1KQGB 1BHNA 2XZDB 4NOHA 3B82A 3K2YA 1VGYA 1RTJB 3EDRB 2WCXA 1X4BA 1UEUA 2CQ0A 4BBYA 1HBNA 4WZQA 5L9NA 3CJKA 3H20A 1FHTA 1EX8A 3MEGA 1S5ZA 3Q0AA 1S49A 1P8GA 2DHSA 1ZYQA 3HJFA 2QLBB 4NLXA 1Z4UA 3CC7S 1EHWA 1HBMA 2PI5A 1VQ4S 1FFSB 1ZETA 4TY9A 4CLTA 1B7YB 4KGXB 3GFZA 4RW7B 3PX0A 2V34A 3W7BA 2W4CA 3AHPA 4TU9A 1H3DA 5D15A 3TA0A 2BM1A 3R5GA 3NOCA 1TL1A 2Z2MA 2XLIA 3G6YA 1KBRA 1NK6A 4FP9A 4C3KA 2EFVA 7FD1A 3PW2A 3W2VA 3LP2B 3L95X 3M9NB 1TUVA 2P9GA 2WVCA 2CQCA 2B4UA 4Y34A 2OPPA 5ETQA 1KHVA 3UQSA 3CCQS 1HMVA 3KUEA 3PVXA 2XMAA 1SPBP 5AJ3J 4CP5A 3ZTOA 3PYEA 2OH2A 3IRWP 2HMIB 3T5HA 2DVIA 2GJFA 2HIYA 2RE1A 1JLFA 1VLYA 4CH1A 5KFIA 1GH8A 2DNLA 4CRJA 5B0GA 1Q7YT 2FC9A 2KFNA 3D66A 1DQAA 1JB0C 2M4MA 2GX8A 2R8IA 2Y3YA 3VHQA 2RS2A 3PM9A 3OR1B 5A2QY 2VKRA 3M8ZA 1TKTB 1OIAA 5DLFA 2GAGC 1S0MA 1R8PA 2JEGA 1H2VZ 4Q45A 1Z1ZA 1N8RT 2BE9B 4DQIA 3BPDA 3PIOQ 3RJMB 1GXUA 2AJFE 4DV7F 2P6TA 3MR3A 1UVMA 2YNGA 3TAQA 3VTIA 4C8OA 4KFBB 4KBIA 4OYXA 5FLXY 5A76A 1G2EA 4ZVUB 4NEZA 2XQCA 2ROEA 3L7OA 1SH3A 2QA2A 2CWXA 1RTIA 2ALYB 4FBTA 4N77A 2IM1A 1HBOB 2CZ9A 1S6OA 2L48A 1N33F 3BBBA 2XHWA 2F40A 1H6KX 1M1KT 3ENVA 4OZLA 2W25A 2RD5C 2UXDJ 2HFUA 4RW4A 2QL5B 1CJVB 1YJTA 3OVBA 1VYAA 3CCRS 4LREA 5CD4H 2HRTA 3A3OB 1NPRA 2J7UA 4F50A 3MD3A 2QLXA 2ZUGA 2Y1LB 3UD4P 4AQYF 3EZ5A 1D9AA 1VRTA 2J9EA 1QAJA 2VFSA 1WF2A 4IO1A 4Q2MA 4NMLA 2DJWA 5KT2A 4HTIA 1FNMA 3AXKA 3OUYA 1GXTA 4DFKA 1U1OA 4JI8J 1YRUA 2WZ1A 1FRIA 1GK8A 2PE8A 2OPRB 3I82A 1KS2A 2B9XA 2V63A 4CNYA 4B17A 1HIYA 5EWGA 1TKXA 1HNVB 5EHHA 5K5MA 4NL5A 3TZWA 4DX6A 1N6QA 2J7WA 3U1LA 4P10A 2C2MB 4FF1A 1CS4A 4HT5A 4IYQA 2N7YA 1R0CB 3BSNA 2R8KA 2YPZA 1QY7A 3FGVA 1CSJA 5CZXA 2F65A 4OI2A 2DHGA 2PT0A 3MDFA 3ZZ0A 4LF7F 4B3OB 2OIHA 3WC2A 3FCVA 2PO4A 3MMAA 3RG6A 2FGOA 3W9JA 4ZPAA 4U8YA 3UNGC 1X9WA 2ZZMA 1YBAA 3MEDB 2IY5B 1X5PA 4U6PA 1WWHA 2FHJD 1YI2S 4ICLA 4PG6A 4M94A 4R5PA 1U24A 4X4SA 4AUKA 1T03B 3W60A 4D3GA 1N0UA 4BCAA 3GCWP 1P9QC 5JUMA 2I6WA 4F36A 4WXOA 2UUAF 1H2UX 5F8NA 4ELUA 4RNMA 1AFIA 3S1TA 1F2HA 2KDOA 3H90A 4C8LA 4OLOA 2CPZA 1FTRA 1EARA 4HACB 5DDRC 1RTJA 2I5JB 5EWFA 4C8NA 4HI2A 4KGMA 3CD7A 3TZXA 1M1GA 3D1OA 1I5OB 1WEZA 4EZ9A 4QIEA 4RO0A 1LNQA 5DRKA 4DHVA 4N7TA 3R5JB 4NLVA 2ZH7A 1JLBA 1YSJA 2NSCA 5DQHA 4U7UD 3CGIA 1QM9A 4QIWD 1REGX 3OPKA 2BJ8A 3GU0A 2W7PA 2F5GA 4MKAA 3P96A 2CQBA 1A7GE 4WFBQ 4CLFA 4IUFA 2JHEA 1SL1A 4B9MA 4HLBA 3G4SS 3RR8A 4RW7A 5GMEA 3M30A 1YHQS 1YBUA 1GTEA 3ICLA 4J37A 1Y5LB 3DLGB 1LWXA 3O6QA 5ITHA 4DV3J 2WSFC 3TW0A 3MZIA 4C8KA 5L1KA 3QFHA 4X64J 4C8ZA 4ZKAA 2V8PA 1FDBA 3TP2A 4LF8J 2H3EB 4RUCA 3J81Y 1CJKB 2IBKA 2OSRA 2QN6B 1NSQA 1K44A 1V3RA 3QAUA 4B3SJ 3C3LA 3PDNA 1DY3A 1D8ZA 1HWKA 3G8QA 2VZ9A 2WAQD 4OJ3A 4F4KA 3FDSA 1HBUB 3E01B 2FDNA 5B0FA 3K57A 3E2EA 4ED1A 4E2FB 4IH7A 2DNGA 4XDCA 4NXNF 4DWIA 2HWHA 1WOPA 5KFXA 3OW2R 2GVDB 2DIUA 4I7FB 3IAM9 4A46A 2W7OA 3QZ8A 4RR5A 2VBYA 3Q8SB 1DJ0A 4W4MA 1HR0F 3Q8YA 4ED2A 3ELHA 2DEIA 1U25A 2DKOB 3U1NA 4WZMA 2W2NP 1TKTA 5KFAA 1HW8A 4WK1A 1RBLA 1ZPWX 3DDIA 3K58A 4UY85 4J90A 5B0AA 1M5PC 2JJ4D 3MOZA 1Q95G 5GAHI 2VUGA 4LFCJ 1GAOA 1U1NA 5G4DA 3VGUA 4QBUA 2DY9A 9RUBA 3UI3A 4M5NA 3OL9A 4KFBA 1VC5A 3HSGA 2WOMA 2XS5A 4C11B 2HBYB 2NQPA 5CZVA 1HHQA 4G1PA 4ZPDA 3J81j 1X9SA 2XO6A 1C4AA 1NO8A 2LEPA 4DL4A 4RWXA 5M2RA 5KFSA 1Y4ZB 1DARA 1N5YA 3V4IA 3TUPA 1HBOA 1FEHA 3R6LB 1IM6A 3DI6B 2V2VA 1A9NB 2MJNA 1BY9A 2V4QA 1H38A 3MM8A 1R8HA 4ZJQA 1HQUB 2ZD1B 2O66A 5K8PA 3IWLA 4DR2J 3ZZRA 2PGCA 4KGVB 1CJVA 1IBKJ 5LM7E 1Y5IB 5M2PA 4DI6A 2W9AA 4DCOB 3KHLA 1HA1A 2K1RA 1U7LA 2FJVA 3P6YC 3OTEA 3WC0A 1ZTTA 2BUNA 2KHDA 3QYYA 4Y6IA 1YJWS 3GONA 3BGLA 1RKIA 2ZBIA 1LWFB 5T7LA 5C25B 5KFOA 4DSEA 4ED0A 3NGDA 1N48A 4CH0S 4MMOA 3ZZTA 2L9WA 4LF1A 3HX9A 1U1LA 1PSDA 2V50A 1FA0A 5AJ3F 5M2UA 2M3DA 3J7Z5 1FDAA 1U45A 4DUYF 2VPZB 2WB4A 2X51A 1KQKA 2RIJA 4USIA 2DO4A 2FZKB 1NUEA 2CDQA 4WWSA 2DITA 3LPEA 4LF6J 2H9ZA 1SKSA 4AL5A 3BKUA 2OKQA 1U48A 2E1CA 2E7XA 5EX0A 5KFQA 2GQQA 1PYSB 4LIWA
chains in the Genus database with same CATH topology
2XSFA 4PR6A 2K1RB 2LDYA 3BSAA 3MM7B 2W9BB 2KZMA 2J9DE 2DNZA 3DGPA 3K7RA 4ID5A 3PKYA 3GWCA 3PW4A 4OL8A 4ILMA 3OTOF 5IT9Y 3H4BA 2KT5A 3RB6A 1S0VA 3QAEA 4ITSA 2VBXA 4RKUC 2R7TA 3H4DA 2A2DA 3N6LA 5F8MA 3PR4A 3OV7A 2J7KA 2BXJA 5HP1B 2MKHA 2HNYB 2PEHA 2CQ3A 3LH2S 2IM2A 4L72B 5E41A 1TVRB 1HHTP 4DEZA 4ILLA 4I67A 5A8KA 4IOBA 4HL9A 2DGOA 4IFYB 4TU7A 1FERA 3B4MA 2RMLA 1ZPVA 1FRHA 3GV8B 1FJ7A 2UV8A 3MEDA 4OLPA 1GNKA 2YH1A 5KFZA 1WHWA 3KLEA 2C3YA 1VBYA 1X5TA 3BR8A 2VG6A 2ZJRQ 4B3MF 3VAMA 1TAQA 4FXDA 1ZM4A 1S1XB 1CC8A 4NRUA 5KFFA 5A8RA 4OZJA 3DU6A 5T7LB 4PUOA 1Y9OA 2D3UA 2Q79A 2YNHB 1N5VA 1RT1A 1F5CA 4RNHA 3U02A 1WACA 2ZOMA 3KG1A 4HDHA 1L3UA 2FVRA 4OHYA 2RS8A 3UPFA 3NMAA 2LQBA 4Q7AA 2AJ1A 4PQAA 3H2LA 2FJDB 3N9UC 4B9TA 2Q3PA 1RISA 2J0SD 2XB2D 4MK8A 3H2VE 2GV1A 5F8HA 4U7CA 3L3CA 4DUZF 4DLGA 1SIZA 2BW2A 2QA4G 3HDSA 4IG0B 3O44A 2B6AB 3BM7A 3HK2A 1S9EB 1JIHA 3AB4B 2M70A 2FJBB 4TLRA 5B7WA 2KB2A 4J9SA 3RW7A 5I3QA 3M05A 3BGUA 3CDBA 3KG4A 2ADCA 1TKZA 1VBZA 4AXIA 2KRRA 3R5CA 2GQ2A 1UAWA 5IM0A 5L1IA 2LXUA 1FD2A 3NCPA 3V6JA 4EEYA 2RKIA 2KH9A 2OPSB 4LF9F 2F4VF 3MFIA 1LWCB 4FNIA 3EPIA 1JXLA 1R89A 2CPYA 4A48A 2GJIA 4TKTA 3DLEA 1Q8LA 4O4RA 1KLMB 1N5TA 2E29A 1QAXA 1YJ9S 2HHXA 3LW5C 3WZ0A 4J9QA 2GIRA 2JLFA 2OPQB 4XAKA 3I5CA 1FE0A 1NJYA 4LQ3A 1S9GA 1GTHA 1REVA 2W24A 2MZRA 1PC5A 5BYRA 4NYZA 2HFZA 5JXSA 1UW4A 3BQ0A 2V9WA 2I5JA 2HHTA 2ASLA 2HFNA 1BLUA 2DGTA 1SUQB 4TNOA 3SDEB 4QJVA 4ED6A 2BV3A 4R8UB 1M5SA 2I0XA 2M8DB 1ZAWA 1VRUA 1S1WA 2MZQA 4WE1A 3N01A 1URNA 2UXDF 3RBEA 2MSSA 2AU0A 1G6BA 1MWZA 4ID5B 1U1MA 4Q0BA 2CPHA 3PNIA 4OI4A 4U67Q 2VONA 3PFOA 2XSJB 4BWJA 4KHMA 2CFXA 5F9NA 2FHMA 3PRBA 7FDRA 4J9PA 3MMBA 4B9UA 4ECSA 4EU0A 4TY8B 5A8KB 3MM9B 4C8MA 1TL3A 3U1MA 3VAJA 4ELVA 4DV1F 3ETOA 3T9ZA 4DR7F 1C0TA 3S6EA 3CD6S 1S48A 3OFHA 3KLEB 5F9LA 4W90B 2E9ZA 2VG6B 2U1AA 3KNGA 4O44A 3EGZA 3I0SB 2IC3B 1L3VA 4OHWA 5JJBA 3MF5A 3FSIA 1S0NA 1SB6A 4OJHA 1RT1B 1Q82T 3ZZPA 4OV1A 3HVWA 2BQRA 2F9DA 2FLOA 3BN7A 3V6DA 4W92B 1NB7A 1X9MA 4KC5A 2F8HA 2LA4A 1RTHB 2EPIA 4MIWA 3CC2S 2APOA 3BGRA 4DV5F 3HHLC 1ZBTA 4ZPTR 4HVZA 3O8WA 3MHYA 1KTQA 1OSCA 4DV4F 4F4XA 2V8GA 1KLNA 2LKZA 2HGMA 4F25A 3IG1B 2VPYB 3HKWA 1TKZB 3K8WA 4MTPA 3M2RB 2RF2B 5C5JA 4V19J 3FZBA 4PRFA 5IM0B 1WELA 2AWZA 3DXBA 4FN5A 2XCPA 2ZDPA 1Q8BA 2QLWA 2ZE2A 5KFUA 3HZEA 4CT8A 2JL9A 1HNIA 4QWBA 1BQNA 1JJHA 1T05A 1N5SA 3B8HA 1NH7A 5J1EB 1VJWA 2W4DA 3DLGA 5K14A 5ADZA 1KVJA 2OO4A 1Y0HA 4X4TA 3ISND 4I2QB 2IYIA 4I69A 4Y2AA 3KWMA 5KG4A 2XMUA 5AE3A 5KG7A 2K3KA 3IFEA 2M88A 3GILA 2LYVA 2X1BA 1UVJA 4U9RA 2GO8A 1S9GB 1LWEA 3KG0A 2B4OA 3M8RA 2HW3A 2FPHX 3MAQA 1SIWB 5DM7Q 3E3XA 5LT5A 1P1LA 4NLOA 3M32B 3MTJA 3DYAB 5KG2A 2A1BA 4K5RA 4I56A 4CIOA 4C3MA 1I6JA 2OMOA 3E51A 3G96A 1FRXA 2B0GA 1PILA 3GR0A 3HHLA 4ZVFA 3KJVA 2EWHA 1BC6A 1K0TA 1S1WB 4ETXA 4Y2MA 3OJSA 2VQEF 4CI0B 1M5HA 4O3PA 2ZH9A 3AH6A 4D3HA 3SV3A 3DRSB 4FZVA 4RBUA 4K5SA 4C97A 2QMXA 3MD1A 5CHCB 4WFZA 3T1YF 2LU2A 2R2RA 4KV8A 1OO0B 4EZ6A 4NA2A 4OX8A 1FRJA 1X4CA 2DR5A 2GFFA 1U6FA 2IVMA 2HVHA 2CRLA 2Y1RI 3LALA 3MMBB 1HBUA 3IWXA 4M63A 3B4DA 3E01A 2WK4A 4QPTA 1WI6A 2CQPA 2HWIA 1C0TB 3MUTP 4DSKA 3PW5A 2KHCA 2R7SA 2V4RA 2DNQA 1VIOA 1VQ7S 3OXFA 3FQKA 4N8OA 2BANA 4DMZA 2Y1IA 1WNEA 5DG8A 1S7HA 3FMWA 5D4LA 4DR4F 3JSMB 1Q86T 3R1HA 4DL6A 3WBZA 2KYXA 5I3PA 1C1BB 3UR3C 4WFAQ 5I3UA 1N56A 4E0DA 2DNKA 3IR6B 4I4BA 1QJHA 1U09A 3V6DB 1XN9A 4NLQA 4JI1F 2IHR1 3TUJC 4I7FA 3IR5B 3BDPA 2KG0A 3P3DA 3KK1B 2DH8A 4NCGB 1JLCA 1E6YA 1Q16B 1UETA 2ASJA 3DOMA 2J6TA 4ZP8A 3SSQA 4I2PB 3P49B 3Q24A 2JOQA 3SV4A 2DB1A 4OHXA 3T3FA 3FJ2A 1L3KA 4B9LA 4K4ZA 3HVRA 4IQXA 1HYSA 2JRSA 4ZK7M 1NKBA 1WTFA 3N28A 5B0CA 2BJEA 3GV5B 1BQNB 2MKSA 1QVFR 5F0UA 2DGWA 3V4MA 4E98A 4HH1A 3JB9k 1C1CB 5J2QB 3GR1A 5GADI 4DV6F 3ULHA 3KOAA 4ERDA 2EFNA 4QQBA 1P6TA 2D74B 4H4KC 3K5PA 4IQMA 2V9KA 1S1UA 1TV6B 5IQ6A 5EN1A 3JAMY 4MYTA 1DZ5A 3MMJA 1NHVA 2DNNA 3VAFA 3QJJA 1AW0A 1N54B 2UZAA 3MECA 4M95A 4K2XA 2P5VA 2ZZNA 2IAJB 1EP4B 4ZS6A 3KMSA 1QSSA 4NZ7A 3CD0A 1XBWA 3QZ7A 4FS1A 2CJBA 2RQCA 5C24A 4JI7F 3HHLB 1MROB 1LK5A 3DOKA 4KKOA 3CCVS 1X0PA 1BWEA 4IDKA 1FRKA 3B78A 2OLWA 4MH8A 4NCAA 2B9WA 2CPXA 4G3IA 2EFQA 1FTCA 2FTRA 5K8MA 4OI3A 5I4MA 2KT3A 4RW8A 5LJ3Y 4KSEB 3GV7B 4PWDB 3CCJS 1VQ6S 5KFCA 1R0AA 1U47A 3KLFB 1VQPS 2AX1A 2BJDA 3LP1A 2JDJA 2OFGX 1VQOS 4ZPCA 3HT3A 4OHVA 5HBMB 2HHWA 3GG1A 1FKOB 4X66F 4H4KA 1VS3A 3RTVA 4Q2LA 2HRYA 4M8LA 1X0FA 3DM2B 1KNZA 2IA0A 3I9ZA 2GGPB 2B5JA 4JI6F 3DLKA 3MR5A 3K59A 1IKVB 4PKDB 2N3LA 4ED8A 2EI5A 4IOAQ 3M9MB 4DS5A 2HS4A 3RB4A 4I1TA 3TRGA 2J76E 4A8OA 1HHSA 3OLAA 2YTCA 4UOCA 5IT0A 1JNZB 4UQGA 4AL6A 1T02A 2IVYA 4IH5A 1JLCB 1E6YB 4XK8C 1RJJA 5D6GA 4M1KA 1IKWB 2UXCF 3M8PB 5HI7A 5HLFA 4ZCKA 3V81A 3SQGB 5KT3A 3F73A 4F4ZA 2KJWA 1U1KA 3RYLA 2B7BB 4TQRA 2VV5A 2B3TB 3PV8A 1VQKS 1VK3A 1Q79A 1NJXA 1FK9A 4ID8A 4CO1A 2FHOB 1K1QA 1QAYA 2VQFF 4LIRA 1SJ3P 5DETA 3H5YA 1JMTA 2WRMA 2IJNA 4MFBB 4KPYA 1ZOTA 5HL7Q 4AL7A 4CTAA 3CCWA 4EWTA 4OI1A 2FJWA 3KTQA 4FF4A 4LFAF 1WHYA 3MURP 1FO1A 1NK9A 2J5AA 3M4XA 3LANA 3MECB 2VOPA 4YOEA 1IKYA 3AA9A 3GFYA 4FS2A 3I6PA 3W3SA 1VI7A 3FMBA 4ZCIA 3Q23A 3C8YA 1UVIA 2M0GB 5B08A 4KKOB 3I56S 1TL5A 1YRTA 3G8TA 1S99A 3OL6A 4RZRA 3C66A 1U6BA 4ALZA 3QIDA 1T3OA 4E8UA 3EYZA 1JKHB 4DQPA 4FPRA 4I6WA 4MKYA 3GB0A 3BN4A 3UCGA 1HWUA 2CQ4A 4QOTA 2E1MC 1NEEA 4ED3A 2C28A 2AP6A 4RW8B 4LF8F 2R2UA 4NLTA 3CJ2A 1R0AB 4H4MA 4JI5F 2ZDOA 1U1PA 3AQPA 4OZ0A 3CT9A 1HBNB 3CIMA 3CEDA 1SBRA 3CJKB 5C25A 5B09A 5L38A 2B9YA 3MR6A 1G3OA 1LKZA 1UVLA 4JI4F 3T5JA 3MM6A 5F8JA 2YX1A 2L41A 4IR9A 4B3SF 1RQ0A 5KAKA 4K50A 1F5AA 1FKPA 2KXHA 3R5BA 3MEGB 1J5EF 4HKQA 1YJUA 4C9DA 2IMOA 3NS5A 1YJNS 2MZTA 1Y7PA 2E5HA 1SKRA 3KHGA 2RRBA 2YKAA 1ZZFA 2F9JA 4BC7A 3DLKB 3J7A1 4N56A 3D0HE 5E0OA 3FEXB 3AAWB 4TN2A 4JI0F 4DFJA 3X1LB 3GFXA 5KOWA 3AJ2A 1TKDA 4KT0C 4QWDA 3EXYA 3I4HX 4ZVEA 4Q8EA 2EG1A 4GC6A 1QAIA 3OL8A 2YKPA 1SL0A 4BS2A 3CMAS 2LU1A 2YKMA 5HLFB 2QO3A 3NNCA 2K2PA 3NP5A 3MR2A 4DR1F 4NLPA 2QSFA 2P9EA 3V81B 4CO5A 2O01C 1EETB 3ZZYA 4C8YA 2V8VA 1X7VA 3LF0A 3V6HA 4A47A 4X4OA 1FNOA 2B7CB 3M8QB 3M2VA 2EBGA 3R1LA 3DDKA 1IXKA 2W7AA 2WONA 2YWHA 1R6YA 1S6QA 3QGHA 4AFFA 1HQEB 1U8SA 2FIUA 5LXRA 3Q2TC 4OI6A 2ZKUA 2VFUA 2P9CA 2DISA 3LP0B 4G1QA 5H9EJ 1VMBA 1OQ3A 3LPYA 4YR0A 3PEHA 3D5MA 1S9FA 4MAKA 1NK7A 2DRAA 4G6VB 2YNIB 3J7YU 2GMHA 4CTAB 1AUDA 4KO0A 3SFGA 2VL1A 3HVAA 2AF6A 2MKIA 4YDXA 2MQNA 1KONA 2W9BA 1QE1B 3GIIA 2KG1A 3VZHA 4NWBA 2B56A 3FFIA 1MMLA 4PXBA 4X4RA 4DDFA 2VA2A 3DOLB 4QR0A 5D77A 2DNOA 5DG9A 1CVJA 2JLEA 2HNYA 3OBIA 5KFGA 4ZPBA 4JOUA 1TVRA 1APSA 2J0QD 4IFYA 1WHVA 5BYQA 5FIIA 1RT2A 1DURA 2B43A 3KLHA 2EVZA 4IR1A 4K4WA 4I6YA 1H2TZ 1UVKA 2HNZA 2WHOA 3FSXA 4TLQA 4OHZA 4I64A 2RILA 4H4MB 1O0PA 5U47A 2BR0A 2ZOGA 1S1XA 4OFZA 2Q6CA 4RWWA 3LUYA 3M2UB 4EO8A 2U2FA 3AY0A 4Y28C 5F3TA 4M5DA 2CZ4A 1RKJA 2E7WA 4GO5X 1T3NA 4DQRA 5FDLB 3MM6B 2E1AA 1N52B 1X4EA 4DPOA 3NGKA 4KB7A 3IN5A 1HNXF 1FKPB 4ECRA 2XMVA 3C6TB 1RA7A 2H5EA 4H54A 1QTMA 1LW0A 2C2EA 2XGPA 4YQWA 5J2PA 3MOJB 2AD9A 1D9DA 2B6AA 2HZCA 2GHPA 2OPPB 1DAXA 1JLEB 3DNCA 2J6UA 1S9EA 3SCKE 1HNWF 4RNOA 1JX4A 4IKAA 2W8LA 3RAXA 4IRKA 1HMVB 4NLDA 1IM4A 2R7RA 2B4VA 4MK7A 4HH0A 2RRNA 3CF5Q 1UMJA 3OXGA 1WI8A 2ROGA 5HN0A 4QYZJ 2DGUA 3CCTA 2UUTA 4KHRA 2KI2A 3S01A 1L3TA 4FBUA 2FJAB 3CD5A 4ECVA 4FF3A 1LWCA 2YKMB 3PRDA 4OIXA 1SI9A 2L9DA 2VA3A 5GVQA 3QJLA 1KLMA 2OAUA 3EUNA 3I0RA 2VOOA 3HFKA 4YB6A 4DSIA 1LV5A 2MQLA 4Z2XA 4WKYA 1MWYA 1O5JA 4PQUA 1YTYA 2V8HA 3EZUA 4F3OA 3I55S 1BQMA 1RT5B 1S6QB 4X4UA 1FCAA 5T14A 4MJKA 1S6PA 3UDLA 1SUQA 3QO9B 4ETZA 2DNMA 3BDEA 2CQGA 3BGFA 3KFWX 4A8KA 3DHXA 2FB0A 3K8VA 1F2GA 1SJFA 2C3UA 2ZNZA 3IC1A 2MKCA 1KQSR 4JI3F 5GAGI 2YKNB 4NA3A 1VFJA 2VC0A 3NNHA 1LFWA 1OS5A 1IBKF 1UJ4A 3CDWA 3FFIB 2BQ3A 2DNRA 4O3NA 5KFPA 5SZTA 2C2RA 2XSJA 4NLUA 2DCLA 3CCUS 3US5A 4Y2CA 4ATNA 3MI7X 2ASYA 2ZH2A 4TY8A 3KK2A 3MM9A 3T19A 2J0XA 3D28A 1AFJA 2ALZA 1RT2B 2CQ1A 1NNDA 1VC6A 1MSWD 3KLHB 4OX9F 3RU0A 2ZFHA 3KHHA 4RUHA 2HNZB 2JLGA 3QWPA 2ROPA 1WG1A 2L9NA 2RDJA 5D3GA 4LUBA 4C7QA 3I0SA 1Z2LA 3O2IA 3MFHA 2ATLA 2IC3A 1Y00A 1C0UB 2KKHA 1UKUA 2UUWA 2DTJA 4M5DB 5EGYA 2LMIA 4IH6A 2HQIA 1SJQA 4DF8A 4HTJA 2IFXA 2V94A 3DHWC 3PACA 2KFYA 3ZZZA 1RTHA 1LW0B 5DG7A 4KAIA 5J2PB 1FJCA 1R43A 2ZH8A 3ISNC 1UL3A 4YY3F 1CPZA 3C6UA 2QFJA 5DM6Q 2FHJA 4BC9A 1U1RA 3TAMB 3I5AA 3CDAA 1R31A 2KFZA 3RR7A 3IG1A 1JLAA 3JYTB 2KTQA 5D78A 4ED7A 3DCAA 3M2RA 2RF2A 3OHBA 4BHQA 1IBMF 1VHFA 1VQ8S 5E3RA 4FVCA 3GYXB 2FGCA 1TQLA 1TR0A 5J1NA 1DLOB 3HMJG 3RRKA 3CVKA 1HI0P 4Y2IA 1HI8A 5J1EA 2W9CB 1U4BA 3IRXA 2GC8A 3CE8A 3K5LA 3N6MA 5E3QA 2LQ9A 4V19X 4I2QA 3I0RB