3D0GE

Crystal structure of spike protein receptor-binding domain from the 2002-2003 sars coronavirus human strain complexed with human-civet chimeric receptor ace2
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
179
structure length
173
Chain Sequence
PFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of major species barriers between humans and palm civets for severe acute respiratory syndrome coronavirus infections
pubmed doi rcsb
source organism Paguma larvata
molecule tags Hydrolase
molecule keywords Angiotensin-converting enzyme 2
total genus 31
structure length 173
sequence length 179
chains with identical sequence F
ec nomenclature
pdb deposition date 2008-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1840 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3d0gE01
2GHWA 4L3NA 2AJFE 4XAKA 4QZVB 5DO2A 2DD8S 4ZPTR 3D0IE 4ZPVR 3D0GE 2GHVC 3SCJE 4L72B 3SCKE 3BGFA 3SCLE 3SCIE 4KR0B 4ZPWR 3D0HE 4ZS6A 4KQZA
chains in the Genus database with same CATH superfamily
1U09A 2UZAA 3AB2B 4YP3A 4JYAJ 5FDLA 4RUAA 1R0CB 1R7IA 2ZZNA 4HACA 3ZXWA 2IMOA 2CQ1A 4I2QA 2DGOA 5I3QA 2DIUA 1WKKA 4PPZA 4P74A 3ZZ0A 1S57A 3M9OB 1TP7A 1AXQA 1ZA2B 5KFUA 1HQUB 1RABB 2XYGB 2VICA 4Q2LA 1N34J 1UCNA 2F1FA 3Q83A 4FVCA 4PG8A 3BKFA 4G6VB 5EDWA 1OQ3A 3GIJA 1YIJS 2G2OA 4RR5A 2AW0A 2E7XA 4R0EA 3J81U 1RAIB 4XK8C 1UVKA 1IR1A 2LU1A 3W64A 3VVTA 4XO0A 1LXNA 2XMWA 1RTDB 3DRXA 1N33J 2AHOB 4EUVA 2Q3PA 2M52A 3D1HA 3MEDB 1M5KC 2BM0A 3ELHA 4NMXA 3M1VA 3D54A 5HLFB 3TJ9A 1C4AA 2VIHA 5KFGA 1QY7A 3QPIA 1FKOA 4U7UK 5EHHA 2HK3A 2L9WA 2C1EB 2XLKA 4DEZA 1YBTA 3MEGA 3DLEA 2PFDA 3M30B 1RWVB 4GVLA 3QFWA 4B08A 2XYPB 1NHUA 3H2VE 4M1KA 1V5VA 2KJWA 3QRQA 3IRWP 2ZBIA 3DC2A 3LOUA 2J0XA 4QJVA 2DNOA 7FD1A 1TU0B 1DQ9A 4RNNA 2FJDB 3TQEA 3OW2R 4USJC 1W25A 4PZVA 1U1QA 4DFJA 3D4JA 5D3GB 5HVHA 3BR9A 3LAMA 5D6GA 3G96A 2V68A 1HNVA 2GFFA 3JSBA 3Q8QB 3LWLA 1KQSR 3ET6B 1LK5A 1RBAA 2GO8A 4DOZA 1UVMA 4KHPJ 2OFHX 5IV3A 1AT1B 4TYAA 5KG3A 3TZYA 2LQ5A 5HK4A 3E51A 4NCGB 3P4UB 5IC6B 2PMZD 2YWFA 4QQBA 2HQGA 2B5JB 2ZH1A 2KT2A 3OR2A 1RA7A 2QIFA 4OHYA 2NLWA 4EEYA 3GLJA 5HQMA 3ENVA 1WOOA 2HMIB 1U8WA 2B6AB 4J90A 3V2UC 1XTZA 4IOAQ 1OSCA 3MCMA 4G1QB 2FLPA 1SL2A 1E6YA 2VDHA 4NYOA 2IAJB 4BBYA 1RKIA 2D3ZA 2F8HA 3JQKA 3DU6A 4NE9C 1UZDA 1BQXA 3OR1A 4HI1A 5AT1B 4ZLPA 5K8MA 1CS4A 5KAKA 3T3FA 2DRBA 3M9MB 2DK2A 2Y1IA 3PO4A 3QGHA 2AYBA 3WZ0A 5L39A 2X1FA 5CH7B 4UT4A 1T7PA 5LL6d 2PI5A 4YN3B 3FMBA 1NAQA 1Y10A 3PZPA 1QVGR 4CLPA 4CIOA 4D3GA 2QEXS 3K58A 5T7LB 2UXCJ 5E0OA 2MYFA 2UUTA 3PO5A 4UTGA 1NUEA 2V6AA 1X0PA 3RG6A 4DPTA 3OTCA 1CSJA 2V5HG 3D6HB 3W5ZA 4ZMMA 5DG9A 4O3NA 3GILA 1S7HA 1CLFA 1IBKJ 4RW9B 3IXQA 5M2PA 4IR9A 3T1AA 4C8KA 4KKOA 4UOFA 3MMCB 1S99A 3HI9A 2VFTA 3BS9A 4CWBA 3NP5A 5D0RA 1ZM9A 3ZZYA 2MKYA 4ES2A 2G1HA 1BD6A 4HLBA 4RBTA 4X62F 3A1YG 1TQLA 4GKJJ 1FDDA 3CC2S 2WTFA 1VRUB 3DGPB 5IM0A 2MGZB 1K9MT 4NCAA 5IWAF 2KM8C 4RNOA 1XR7A 3VV2B 4F2SA 5G4DA 2E9TA 1R0BG 4O3RA 4GKKJ 2L3MA 1I1GA 1RTHB 3OFHA 2CRLA 3R6GB 3I5CA 1TMJA 3RUBL 5KFSA 3FFIB 1CULB 2E7WA 2RDIA 3G86A 4LRBA 4P2MA 4UW2A 4B9UA 4DR6F 4DR6J 2VOPA 3TOQA 3JTOA 3ILIA 3IP0A 4KE5A 2XGPA 2COLA 3CCSS 4J9SA 2FY8A 2A2DA 3D6MB 2YKAA 2ZOMA 3VR1A 1ZM4A 3MAQA 4DV5F 2KXNB 2G2YA 4WF9Q 2LQBA 2QC3A 3WC0A 1S1VA 1QE1A 1YRTA 1ZA1B 4DUZF 1N5TA 4DV7J 1HNVB 6FD1A 2XMTA 2HFVA 2XS2A 3W65A 3D0GE 1IXKA 1R89A 3D3BJ 4HEA9 4WFZA 2PO4A 2RF2A 1PKUA 1REGX 4JI6F 3AAWB 1F9EB 1OO0B 3JSRA 5LT5A 1UTAA 1N56A 1ZM3A 2CDQA 3X1LB 1Q5VA 2N7YA 2DIVA 4HHHA 3TZZA 4Y2KA 3IWXA 1RT2B 4IRCA 3FEXB 2M9KA 3LGNA 2LEBA 2LECA 3LP2B 2YNIB 2ZE2B 3POTA 1YTYA 4UY8T 5LMNJ 2VOOA 2ZZMA 2KHCA 4QR1A 3ITHB 2KH9A 5F0WA 3T1HF 2OSQA 3T1HJ 1TL4A 3I0RB 3LWMA 3IAS9 2AGQA 1FNOA 1FEEA 4P10A 1S48A 5KFBA 4UOCA 3GV8B 4ERDA 2DNLA 1NDCA 2HHPA 4I4BA 2HKEA 1TKTA 4LF8F 3PYGA 1PC5A 3SZ2A 3FSYA 2CPEA 3HCXA 1XNQF 3OVBA 2HHXA 2ZZTA 2K2PA 4PXCA 5B0FA 1FVSA 3SCKE 3T5KA 2I0XA 1VQMS 2ADCA 2MHNA 3IMQJ 2OO4A 3FCVA 4JI2J 3D28A 3UD3P 3W62A 5AE3A 3CO9A 4TYBA 5H9FJ 2KO1A 1VK3A 2FLOA 2C2RA 2IA6A 3QQCD 4IDKB 3LPEA 1UPMB 3IGNA 3BEGB 4R8UA 5KG5A 1I5OB 4KRWA 2BA9A 1PJ6A 2HBQB 3MFHA 4Q45A 1K73T 4CH0S 1D1UA 1KDNA 3SFUA 4LF2A 4WFAQ 2EW9A 3H4BA 3QGIA 3BDEA 4OYXA 2C22A 1REVA 2AV5A 4LF4F 2OSRA 3CJ0A 3LP0B 3F44A 2ZHAA 1HNIB 5KT7A 5IWAJ 1U1PA 3KTQA 4JI5F 3E01B 5DG7A 4FF4A 2E1RA 4LSLA 1UJ5A 1B99A 2G2ZA 5DDQC 1FKPB 5KOWA 3CXCR 1PILA 2GJFA 1U1MA 4ELVA 4K0KF 1UW4A 5A6WA 3HHLB 5EWGA 1HW9A 4JBCA 2N3OA 4KHPF 2DHSA 3D0HE 2W1BA 1D3WA 2J7WA 3J80U 4L74A 3K7RA 2HBRB 2KTQA 1ZS6A 2BE9B 1GMUA 3T1YF 1N6QB 2E5LJ 1U48A 1FXRA 1X9MA 3C15B 3AJ2A 4XDCA 4CH1A 3H5SA 4MKVA 1WORA 5L9XA 5LXRA 1TKZB 3QT6A 2PFFB 4RPFA 4RU2A 3RYLA 2J8AA 4ED7A 1NDLA 3EPIA 1SV5A 1U6BA 4P2XA 4CLZA 1L3SA 2HVIA 2FC9A 2OMOA 5K14A 4EI2A 5GAHU 3GFXA 4G3IA 4EYHB 1XWLA 4ICLA 2MSTA 2W9BB 4O4GA 4YHHF 3GSDA 4H4MB 1UFKA 5KFJA 4ZPAA 5BYQA 4LBPA 4ZVHA 3SMZA 1YJUA 2AP6A 3BYRA 3S01A 3MUTP 5IS2A 1F3VA 1KKHA 5MAOA 4C8ZA 3FEYB 1KFDA 3BSOA 1LWFA 1NCLA 4DR3J 2GHPA 4XDDA 1UWBB 2WOMA 2OPRA 3TUZC 2DEIA 2XG8A 4KT0C 3NLCA 2ZBRA 2R42A 1NNDA 2HFUA 2MLYA 4TU7A 3HVAA 3TVYA 4WFXA 1VQ8S 1IM6A 2Q6CA 3VAMA 3O1LA 4U7UD 2VKZG 2BRKA 3HX9A 4FYXB 1JXVA 4YR0A 1FDNA 4EBCA 1WI8A 4KH1B 2CQDA 1BMQB 2RNEA 5IXUA 1HA1A 2FGOA 1WC0A 4EBDA 3OXLA 2UXDF 1DQAA 2KXFA 2YH0A 4CNZA 5C25A 1H2UX 2CDRB 4S0MA 3UN3A 2XMMA 5IFMA 5E2QA 2JSXA 4M8LA 1E6VB 2H5IB 4HDGA 5HROA 1SVDA 3GPAA 5BR8F 1X8DA 2CQCA 2ZDOA 4HDHA 4ZHRA 2MTLA 4FYDA 1R27B 3NY0A 3CDWA 1FRIA 3CJ2A 3D3CJ 5E3QA 3RRKA 1FTCA 3KG0A 4I7FA 2B4VA 4IFYA 1HHSA 2CAJA 4NRUA 3OHBA 4CLSA 3M9NB 1NKCA 1I94J 5FLXU 3CSKA 3R5JB 2DR8A 4ED0A 4J9VA 4N76A 2DGXA 3ET6A 1YK9A 1NU4A 1O6XA 4OZ3A 2ZNYA 3RR7A 3VQSA 3MTKA 4OJ1A 1U2FA 4URSA 1FE4A 1T9VA 1UWAA 5C24A 1Y7PA 2EWHA 1YJ9S 1HWUA 4Y6IA 1YDLA 3JYTA 3L9ZA 5KFVA 4MH8A 2H4WB 4GKKF 5HANA 5C7PA 3GV5B 1MN9A 1IM4A 3DOLA 3PEJA 4TNOA 3PXGa 1S72S 1VBXA 1KD1T 2X3GA 3CJQA 5F8GA 3DYAA 1KTVA 1TL5A 2DHXA 4KO0A 5C42B 5J2MA 1Q8KA 2M70A 1BXNA 1F0XA 2KT5A 2RILA 2WBMA 4L73A 4WU2A 1NK4A 2HHWA 3EJMA 1GMWA 1IWAA 1YLXA 2H48B 3EXYA 3IBWA 1B0VA 2HG4A 2OFGX 3QWPA 3VQTA 4JI6J 1WACA 4RNHA 4DR1F 4WFNQ 3GYGA 1NJZA 2CWKA 1QUVA 3RBEA 1HR0F 2DRAA 1X0FA 2ZVIA 3BGRB 2MEWA 2YPZA 5JVGQ 1T9XA 3CTRA 4UOGA 4ZIWA 1IBCB 2SXLA 1RLCL 1TVRB 2HIQA 2L41A 2IC3A 4P9SA 4B9SA 4R5PB 2HZAA 2OPQA 4YDXA 4C9DA 2MLXA 1Y5LB 9RUBA 1FJGF 1RT4A 3A3NB 1KBRA 3VZIA 3HHEA 2UXCF 4O3PA 1U7LA 4IUFA 2D7SA 4JI8F 4JI2F 4LVNP 2EFOA 2YNHA 1S10A 4I68A 4NLVA 1JLFB 4FS1A 4C3KA 1RT1B 2B8QA 2YKNB 2J7KA 2RB7A 3OFGA 2HFOA 1UJ4A 2P9GA 5BR8J 1S1TB 3M8ZA 4RKUC 2BABA 3JS9A 3FBEA 1OSDA 3U1MA 1ICEB 3QZ7A 2X1BA 1JQGA 5ETNA 5F9NA 2HQIA 1L3TA 4U7CA 1JLQB 2LDYA 3H4DA 3GG1A 4DU7A 4X4VA 3CIMA 2PEHA 3FBFA 2I5JA 3PHEA 2EKYA 4TQSA 3KMSA 1IVZA 2CJBA 4C97A 3TYTA 4ETZA 1CQMA 2AZ3A 1FF2A 1VQ7S 3DMJB 2BJ7A 4I67A 3Q89A 2GJIA 3BKUA 2FJAB 3TUJC 3B4MA 3TUIC 3LPYA 2ZJPQ 3DXSX 4PWUA 2CZVC 4L3KA 2DGSA 1M90T 2C2NA 4BS2A 3NBPA 1B3TA 3K0JA 1EZZB 4RW7A 4L3NA 3MD3A 1NB2A 3C16B 3AD7C 1DLOA 2HHUA 1HNWF 2AJ2A 4U8YA 1N36F 4YMEA 4KHRA 3N01A 1M5OC 3FCHA 2UUWA 2FHKA 3NG8A 3RZAA 2FJXA 1IKXB 1NHVA 2HNZB 1DRZA 1RAHB 2V8GA 1SB6A 1VC5A 3JXOA 3B54A 2D41A 2H3EB 3M2UB 3TQ1A 4OZ1A 4R0JA 1DLOB 2E5JA 3ZNUA 5HROB 3NGRA 1P1LA 5KG6A 4RW8B 2R8GA 4OYPA 2JEIA 1HQEB 1X4CA 1X5SA 1IKWB 3SQGA 3MR6A 1SKRA 5HMZA 3CJRA 1BQNA 3BKTA 4YB7A 5SZTA 4OYBA 2ZOGA 5ETTA 3THTA 2YNFB 2FLNA 1HMVA 1HPZA 4G1QA 4Q2MA 1FX2A 3VCDA 4DV6J 3DMJA 3T1YJ 5H9EK 2KFNA 2H5EA 4F8RA 2XO7A 4OHZA 1HQEA 1KONA 2F8MA 4KGXB 1ZZNA 3NGTA 1R0AA 3VHQA 2HQCA 3A13A 4FNIA 1HWIA 3CO0P 3PW4A 1GMVA 3EVWA 2VBYA 3PJWA 2ZOFA 5CYMB 3RU0A 2C2DA 3M2VA 2ATLA 1BLUA 5KFNA 3L7PA 4ID8A 5I3UB 2BJ3A 3C16A 1NKEA 2FHJD 1GX5A 5A8WB 2N4DA 3OUYB 5LMUF 3HHLA 1PO6A 1GXLA 4QWEA 4ZPCA 2OHDA 2OPSA 3HKWA 3N5FA 2BQRA 1URRA 1VR6A 3BPDA 1F9HA 4DJBA 1S9EB 1YG0A 2W8KA 1ZTWA 3O6QA 1TFYA 1PJ7A 3M6VA 4M5HA 4ECUA 5EWFA 4FYYB 4P2FA 2PA8D 3ULHA 4TU9A 2FVRA 2AD9A 1X4HA 1TL1B 2R3VA 2J8SA 2F5GA 1PC4A 3C14A 4ZVUB 1K0TA 4M5IA 2ROEA 4K4UA 2DB1A 2HEKA 1UZHA 3T41A 1WTBA 2JC1A 3CMQA 3K5LA 3QFHA 5KG1A 4DL4A 1JLCB 3E3XA 2E1AA 3LP0A 2FC8A 2CJ9A 5AE1A 4DF8A 3OSPA 2K8GA 4DV0J 1N36J 2ZH9A 5AE2A 1GXUA 3MM8A 3PX0A 2HLTA 4OYIA 3B82A 1FK9A 4NXMJ 5L46A 3QYYA 4OX7A 1XMQJ 3R5DA 2HVEA 3H42A 4U67Q 1S97A 4MKBA 1UFLA 2LYVA 2IRYA 5KFZA 4JV1A 2DNKA 1YKWA 1RT1A 2IYIA 4PG6A 4DR2F 2XWYA 3MM5A 1RAJA 1AZSA 2JZ5A 4HTJA 1U45A 2LQJA 2UVUA 2ILYA 1ZBTA 2HAIA 2G4BA 4X4OA 2HK2A 2KHDA 2YPYA 4ZN1A 4ENOA 4LFBF 2M3DA 4FZVA 1FA0A 4P72A 3MCNA 2BANA 4Y2CA 4FP9A 3C3LA 4HT5A 1U02A 7FDRA 3TA1A 1M0SA 1N88A 4PEOA 4ZPBA 4Y00A 4CM0A 3SBMA 4RU9A 1TL7B 2E1MC 3B4DA 2XLJA 1T05B 4DV4J 2IMWP 3GWCA 2CPFA 1GEHA 3Q0AA 3PYDA 2AJ1A 4URQU 3NL0A 2G0IA 4TQRA 1MWQA 4Y28C 5F8IA 1LWEA 3ENQA 3OPKA 2N3LA 3KK3B 1J5OB 1JKHA 5DLFA 4DR4J 2DGTA 3KOAA 1P1TA 3Q8VA 2DT9A 2RVJA 3V5RA 1H98A 2QG9B 2BACA 3U02A 3PW5A 2UXBF 2Y1JA 4WBFA 2VPYB 4ECVA 4KPCA 4XIUA 2BE2B 2D3UA 4Y2MA 5A8RA 3UNYA 3IN5A 4LREA 2QL9B 2WAQD 2M0GB 3PR5B 1FK9B 2R8KA 3CIZA 4NLOA 3W60A 5BYSA 4DV5J 1MW7A 1SL1A 1DAXA 2YH1A 4J9OA 5IT9U 2LA6A 1HI1A 4WXOA 2MQ8A 1RGVA 4P7VA 4ZPWR 1KLMB 4C3MA 4ZDNA 1P9YA 2V8PA 4PQAA 5DQIA 1T95A 2HS4A 3LTOA 1HYSB 2CQ4A 1RU1A 1BY9A 4I6AA 2HZCA 4TY9A 2JLGA 1VGYA 3QSIA 5KG7A 1KHWA 4BHQA 4CYUA 4OJ3A 2VZ9A 3OTDA 2W01A 1XMQF 2H5JB 5HLFA 2RU9A 3MMBA 2XULA 4ZPVR 4AE5A 2NUUG 4HHJA 5IOLA 4WP8A 3NGKA 2W2OP 3UDEA 4DWIA 3QLHA 4HH1A 2R8IA 2Q6BA 3NCQA 1A7GE 4QPTA 1TV6B 4MFBA 3T6JA 3BH7B 5T14A 3MM7A 1SJQA 4O3OA 3Q23A 1RT6B 2CIMA 3L7UA 3KHRA 4M5DA 3PIPQ 4A4JA 4O23A 2CZ4A 3DI6B 1IJFB 3KMQA 3GP9A 2WB4A 3LUYA 2OH2A 1MLAA 3NNCA 2YKPA 2BV3A 1VQYA 3KJNB 2ERRA 1L3VA 1TFWA 1AZSB 3HSZA 3ZTQA 5LXYA 2BR0A 2AF6A 5AJ3F 4ER8A 4MAKA 4ED3A 4ZN3A 2JH3A 2H54B 3UN5A 2BKNA 2RE1A 3CJ8A 4Y2IA 2DEJA 1X5PA 1G3OA 1JJHA 4IQMA 5IQQA 4B3MF 4F50A 2KG1A 2AKWB 2WOMB 3EWGA 3HULA 3NGUA 1HNWJ 2QL7B 2AEMA 4O0IA 2DR7A 2FZCB 3NEKA 2QV6A 1BQMB 5GVQA 3WBZA 2I2YA 1MG7A 2FPHX 4AYBD 4NA1A 1M5VC 1GTEA 5E33A 5KFKA 1EQMA 2HWIA 3C8YA 4RL1A 1JMTA 1RBLA 1OMSA 2IM2A 4UQTA 1XBWA 5J1EA 3K5NA 1TK8A 3L7OA 2VF3A 1C1BB 4PCQA 2IRUA 4KGVB 1JWWA 4LR8A 4Z7YA 2KU7A 4DL2A 2MMYA 3BF4A 2XMAA 2C3PA 2VA2A 3P8BB 3CJ5A 2WZ1A 3KHLA 4NA3A 2ZJRQ 1HBOA 4RUCA 2IM0A 5DM7Q 3W3SA 1W2IA 2HGLA 1JLAA 3AOBA 2MQQA 3V4IB 3JAMU 2BKOA 2WVFA 3UR3C 1WTFA 1Y11A 2GNKA 3SXLA 4CT8A 2IFXA 3L3CA 4ELUA 4AXIA 2B5JA 4DQQA 2DH9A 3OJUA 3BH6B 5G0RA 5F8NA 2YKMA 4B9LA 3DOKB 4J7CA 4WYLA 3UVJA 4LQ9A 2FD2A 3F0NA 1UVIA 1R8CA 3D5MA 2GCFA 4JI8J 4K2XA 4A8SA 5KFDA 1RA6A 3FQLA 2B8PA 4DL5A 2GQCA 1NK6A 4Z7CA 1RT5B 1OQ6A 4WP9A 2DNPA 4CO1A 2AWZA 4B17A 1VQ9S 1M5SA 5JXSA 3QZ8A 2B7CB 4JP8A 4UZBA 2Z0GA 3SQOP 3IM8A 1ZYQA 4WU3A 4W92B 4MMOA 1FFSB 2QMWA 3IA0A 1RACB 4ZLLA 1T3NA 2IVMA 3IO1A 1H38A 3BQ1A 4X4UA 2B9WA 4X64F 3RBDA 1R8HA 3M1VB 1V3ZA 1Q95G 1VBKA 5D4OA 3LP2A 3Q24A 2VONA 5C5JA 4C8LA 1CG2A 4QU7A 4A8MP 1RYRA 4YB1P 1DJ0A 3SCIE 2VC0A 1LEOA 4KR0B 1EARA 3M2RA 4OZ0A 2ROPA 4QR2A 4IO9Q 3DM2B 3S6EA 4DCJB 3I0SA 1QUPA 1MROB 3CMAS 3AY0A 1WG1A 2DKOB 1RHMB 2CQ3A 1RISA 4RUBA 3W63A 2Y0BB 1HNZF 5EUHA 3DRYA 2EFQA 3W2WA 2XBPA 1KC8T 3CWJA 1RTIA 1V3RA 5DO2A 1WELA 1B0TA 1TV6A 2NYIA 1EIYB 1SJ1A 2IDEA 1KQFB 4A46A 4F2RA 3LAKA 1VFJA 1FVQA 1MROA 5ETLA 4OIXA 2GAHC 4IG0A 1QTNB 3U7JA 5HVFA 1N0UA 2MQNA 4ILLA 4DQSA 1XR6A 1PIEA 2FYXA 2HIYA 1R8BA 3DRRB 2FZKB 3HMJG 4FF3A 4TLRA 3CCJS 4O44A 1WF1A 1IBMF 5HI7A 1FWPA 1NM2A 2HGNA 2MXYA 4C6AA 4MTPA 3DLKA 4OHVA 3AXKA 4NYPA 2HNDB 1PCAA 4ECWA 3QIPA 1XNQJ 2OUGA 2A3JA 2AT1B 3M8PB 2DY9A 3SIPB 5T41A 4X66F 1QD1A 2WONA 3MM5B 1NRKA 4PAAA 4YDDB 3HHKA 5D4NA 4CTAB 2HBZB 3OTOJ 4ALZA 5G0RB 3IRXB 4PRFA 1S0NA 3H59A 2VFRA 4DDFA 2FJEB 5K8OA 1Q7YT 2OTLS 4TLQA 1WHYA 1VYAA 2M5YA 1CJVB 3D67A 2G9OA 3CULA 2HAFA 3GZ7A 1JLCA 2OEMA 3F73A 3PDNA 1HD0A 1PYSB 4DR3F 3R2CJ 1S49A 2HLUA 3GFZA 4LRAA 2XS5A 4DSIA 4PABA 2E29A 3ILLA 3HFVA 3MR2A 2CPYA 4DV7F 1HBNB 3CB4A 1J2VA 3EVOA 2H1YA 2O01C 2QL5B 3AXMA 4WXWA 4HT7A 3K57A 4FF2A 3GTYX 4C8OA 1GMWD 5D78A 3U1NA 5HP1A 3DDIA 3K5PA 4LF1A 2R7WA 2A1BA 2VJUA 4DUYF 4NWBA 4QZVB 4CLKA 3PX6A 4NXNF 1VQSA 3C66A 4K2JA 2PD1A 4USUA 2QGFB 3NNAA 4C4WA 1HBNA 2OELA 2VG5A 5J1EB 1UW9A 3KLEB 4OX9J 2PEBA 4DXLA 4PG7A 3OLBA 2HVHA 3H2LA 4I7FB 4DQRA 1TTHB 2M4MA 3QAUA 4QU6A 1NXIA 4JB8B 5KFAA 4F4KA 2HHQA 1H0HB 4F67A 2J0WA 1SBRA 2V4JB 4KFBA 3T19A 4QWCA 1IBMJ 4JI1F 3NAIA 4JI1J 4G1IA 2IY5B 1QTMA 2HNZA 1YVFA 3CJTA 1XEZA 3KG1A 2QSFA 3VWSA 1UFWA 4CO2A 3OV7A 1NK7A 4V1Ak 2FJVA 2YQ1A 3C46A 4X4PA 4JI3J 5K14B 2IYGA 2BJ1A 4PG5A 3M8SA 4FBUA 3MR5A 4ZJLA 1NO8A 2W2MP 3FMWA 3FSXA 1VK8A 3GFHA 1JJCB 2UXDJ 2V2VA 3UN2A 3SQGB 2R8JA 2HSEB 1V9OA 3BBFA 4O3SA 1HHTP 1WEYA 4X4RA 5IT4A 1M5PC 1IN0A 4NI2B 3OLAA 2IJRA 1Y3KA 4IO1A 2ALZA 2ASDA 1PGZA 1VLOA 1T3OA 5DRKA 1Y9OA 2LQ9A 4KHMA 1RT7B 2EXUA 2HFSA 2WCXA 2XNRA 4ZVOB 2LU2A 3DDKA 1WUUA 1M1GA 1MWYA 1S6QB 2YBVA 2RMLA 4FBTA 4WK3A 3HVTB 1DTQA 1WC1A 5J1PA 2YNGA 3PM9A 1RUSA 1ZM2A 4B3SF 4C48A 1FD2A 2BJDA 1NEEA 5DZ6A 1SQEA 3MM9A 2Q43A 3GU0A 1PBAA 3ZTOA 3QT7A 1FKPA 2GIQA 2IJNA 3DU5A 3A8JA 2M88A 4E8UA 3RAMA 3PRBA 4DCPB 1TK5A 2BQUA 4LF6J 4USIA 2BMBA 5DDPC 2DVIA 3LA0A 2WSCC 2MZSA 5B09A 1PAEX 2X51A 3I0SB 5A8KA 4X4QA 3JYTB 2VH7A 2WB1D 1QDUB 3KG4A 4KGZB 3TZXA 2RQCA 5CABA 2YWKA 3MR3A 4OX6A 5KOXA 1LFPA 3FK4A 3K8VA 4TY8A 1TELA 3ZC4A 3RB4A 3PKYA 2XY7A 2Y3YA 4N8OA 3P5TL 1IUJA 2BW7A 4QBUA 3G71S 3M30A 2H51B 1IKXA 4DUTA 1HD1A 3EUNA 4RW6A 1CJKB 2CNKB 3I5AA 4PWDA 5J1NA 3CCVS 2AMCB 2QLXA 2Z58B 1S9GB 4HTIA 3ZZTA 4ZITA 2AZ1A 4DR7J 1Q53A 1WSVA 2B4OA 3W9JA 3H40A 2H9ZA 1U6ZA 2CJXB 5B0BA 3MPWA 5D0EA 3T5JA 3O44A 4WKYA 2MZQA 1D9AA 2VKRA 5U47A 1YJNS 4K0KJ 2IDLA 4A8FA 1ZAXA 3DLKB 1PBUA 1RU2A 2QYCA 1APSA 3IS9B 5DGAA 4DG1A 1WSRA 3ISZA 2EK6A 1NK0A 1WG4A 4W98A 1TKDA 2VG6A 3ITHA 1U1KA 1JB0C 1HI0P 3KNGA 4I2QB 5IC4B 3W61A 2KG0A 4I2PA 4HVZA 4R8UB 1U26A 1QAYA 2A0FB 4DU8A 1GQEA 3UFCX 3KJQB 3MM8B 4DX8H 2FUG9 4DX7A 4AL5A 2NZ4A 4YFUA 1T03B 2C3OA 3MFIA 4JI7F 3BGUA 2GZOA 2IM3A 5J2NB 2JJ4D 1Z4UA 2HPUA 2BQ3A 1T9YA 1EAYC 1TUGB 3WDOA 2ILZA 4B3MJ 1URNA 1S1UA 4TXSA 1CJUB 3DLLQ 2J6SA 4DR5F 3D2WA 3BSNA 2PIIA 4M5JA 3DLGB 3OJSA 5DQGA 4WWSA 2PSZA 2O67A 2YNFA 3CGIA 3DOMB 3RJMB 1Q8BA 3UVJB 2CFXA 3ZTRA 4E98A 3EDRB 1AYEA 2W2PP 1BC6A 2EFGA 2BRLA 4CLFA 3TW0A 3R9LA 1JLEA 3A3PB 4C0BA 1KEKA 2ZITA 2N7CA 4WTYA 2V2QA 5KFWA 2HMIA 3V6DA 1Q5YA 1Y5NB 4N7TA 1NBEB 3T9ZA 5HBMB 2ZM6F 3ZZRA 3RW7A 4KKOB 4A8OA 4Q0BA 4LSNB 4IG3B 4M63A 4KSEB 2FVCA 5KFPA 1EQ0A 3G82B 1EETB 2ZVSA 1ZOTA 1CC7A 2ZBCA 2NXJA 4NA2A 4Z37A 1C1CA 5CCLA 2UVVA 4ZLJA 1RCXB 2AIRB 2GIRA 2G0JA 5LM7E 2KVIA 2RF2B 3CCES 1QSYA 4OV6A 4ED8A 4K7QA 3NNHA 2V2KA 2F4FA 3R8YA 2W9BA 2MDAA 1FWKA 1YJVA 3EMTA 1R6YA 4ZP8A 5HQLA 2R4FA 1XIQA 5THWA 3TRGA 3ZZOA 4ZVPB 4A8YA 3HVTA 1B7FA 4XTTA 2DHAA 2JDJA 4YB6A 4F26A 4OI0A 4NL5A 1LNQA 1H72C 2GO9A 2ZC4A 2UU9F 3O8WA 3OHAA 2HGMA 4DV0F 2QRRA 1N33F 4LR7A 1X4EA 3OTEA 3DLEB 3UDCA 2OMLA 1JLQA 4USHA 3GG0A 3W9IA 3BQ0A 2UUCF 3CMES 2UUCJ 1RWOB 4P75A 4CRJA 2JRSA 3PR4A 2FJWA 4HYKA 2CVIA 1J5EF 1UMJA 1SC6A 2ZWOA 4CLYA 2WRMA 3KLIB 2DNMA 2XY6A 4NX9A 3N79A 3H98A 5F8JA 2OPPB 3LQVA 4EO6A 4QWDA 2Y1LB 2F40A 2V34A 3MURP 3LH2S 3KUHA 1Z1ZA 1RJJA 2K1RB 3BM7A 3JAMY 2V94A 3UPFA 4ZCMA 2RUSA 1S12A 4F4WA 4ECRA 5ETOA 3QRRA 1VJQA 5K9FA 4UUWA 4QIVA 2GQ2A 2Z30B 4LRDA 3MEGB 5MLCV 3GSIA 5KG2A 1S0OA 1F2GA 1N5YB 1SKWA 4I69A 2FB0A 2BVZA 3VF0B 2D1CA 2DGQA 3TJAA 3TR5A 1OS5A 2HQDA 5KT5A 3UW1A 3CJ4A 3O3LA 1P8GA 1VHFA 2CQGA 2GAGC 3LGHA 3AQOA 3MMBB 2RU3A 3PVXA 3GIIA 2KL8A 2Q1LA 4ZVSB 3AT1B 3VGVA 3J81Y 3DRRA 1HKAA 2MJUA 4H4MA 3MMJA 3PJXA 1NSPA 1N54B 5CZVA 1NHKL 1S1XA 4OI6A 2LXUA 4RW4B 5EWEA 4ZP7A 3MPUB 5CD4A 3J81j 4QCLA 1RHUB 4MIBA 2R8HA 3W9HA 4B9VA 2JEFA 4FYVB 1U8SA 1RTIB 4LF4J 2FQQB 1SKUB 1PG5B 2HS0A 3C6TA 3V81B 1NH7A 4LVOP 2YWEA 4M5LA 2VQEF 1ZZFA 3P3DA 1JXLA 1D8YA 3I32A 2J6TA 4DV3J 1B70B 2F7VA 3J7YU 2XMVA 3KK2A 4LF9F 1UL3A 3L4BC 4DLEA 4F25A 2EFNA 1LWEB 2W7AA 2XS7A 2P5VA 3IR7B 4WE1B 3HHLD 2CJYB 2IRXA 1RXOB 2C3MA 3NS7B 4FN5A 1T8EA 1NMEB 5HJXA 4RW6B 2CJAA 1GT8A 1JJ4A 3HM9A 1T94A 4BC9A 3HD1A 2AYMA 3J7Z5 2NXCA 5GADU 2A10A 3VAHA 1T02A 4LFCJ 1JXEA 2ACYA 3M6UA 3QNWB 3BB5A 1JLBA 3P49B 4OMFG 1VQLS 2XCPA 2VPZB 3DYAB 4KO0B 1N34F 4LFAF 2EBEA 1NJYA 2HWHA 3IG1A 3MMAB 1AW0A 5FD1A 2B4PA 1KVKA 1TMMA 3HLUA 2QMXA 2ASJA 1RT5A 3MEEA 3RBZA 1S1XB 2DGUA 2EK1A 3W1YC 2MQLA 1XERA 1LWCB 1S4FA 1ZH5A 2GW8A 3AFGA 4HHUA 2VQFF 4B9NA 1G6BA 1NLKL 1A0OB 4OX9F 2CYYA 3UQSA 2VG7B 1NPPA 1SL0A 3FNNA 5A8KB 2DNQA 3MZIA 1IBLJ 1L3UA 1TAQA 3PFOA 3VAKA 2OKQA 4A8QA 4DX6A 1KFSA 1FJGJ 4WZQA 4ZVEA 3K5OA 3WIUA 2DNGA 4MKYA 2R7QA 1RAAB 2XYHB 5B0AA 4DZDA 5HAOA 2X3DA 2QFIA 2OIHA 5D0GA 3N0VA 5C25B 4OZ2A 4IH5A 4PXEA 1WKLA 2HFZA 2PN6A 2QLWA 2EC0A 2NR0A 1UPPA 3KLIA 3B6BA 5HN0A 3EGWB 2MKJA 4OZ5A 1CVJA 2FJBB 2JL9A 3OSNA 3C19A 4ZLNA 2W9AA 1U1NA 4ILRA 1U2RA 4QW8A 2CA9A 2CG8A 2OPRB 3HVRA 2KFZA 4MK8A 1X5OA 3BV8A 3SI8A 4PYAA 1HIYA 3OXFA 1FI4A 4QOTA 1YITS 1VISA 3OL9A 3HF5A 3N6LA 5KFTA 4KPYA 5L1JA 4JYAF 1PYOB 1SQGA 3F41A 3CD5A 3QT5A 2UUAJ 1XR5A 2JEGA 2J5AA 3UE2A 2AGOA 3ADAC 2FGCA 2K7JA 3KLHB 1Q4RA 3GJQB 2Q66A 4NLSA 2QA4S 3B78A 4CO0A 2GV1A 3UDLA 4AL6A 2UP1A 3PFEA 4CP5A 4DV2J 1HPZB 4DL6A 3T9NA 2KRRA 4AQYJ 5KG0A 4JI3F 2C2MB 3M8QB 1U47A 1HNXJ 5F41A 2XB2D 3GR1A 1X60A 4H4KA 1YZ7A 3KLFB 2X7IA 1S1UB 1VQ5S 4N5SA 3NRBA 1H3DA 3R5GA 3J7AN 1OYDA 2A18A 1AB8A 2FZGB 2GGPB 3OD2A 3P45B 4K4XA 1NK5A 1N32F 1VQKS 1RP5A 3W8GA 2KB2A 3TX0A 2B6AA 1OWXA 4DF4A 2BE2A 4KIAA 2R7UA 4XPCA 3BQ2A 3TEGA 2XMKA 2VG5B 2D9PA 2ZBQA 3SDEA 2AJFE 5GAGU 2Y1RI 3JTPA 4CLWA 5K20B 2W9CA 2CJQA 1N5VA 2P9EA 3K89A 4YY3F 3MEEB 4KJIA 4DR1J 2HWTA 2Z57B 1YJRA 2WSFC 1SC4B 4Q44A 4F4XA 2Z56B 2E9ZA 4RBUA 1FX4A 2W2NP 4FKYA 1Q0NA 3QIPB 2DISA 5KFXA 4EO8A 4ED5A 4GO5X 1U1LA 2YTCA 4KGKA 5KG4A 4CH7A 2FHMA 1SH0A 3H90A 2Z2YB 3RAQA 5DM6Q 1X9SA 1P6TA 4NLGA 4ZJQA 3PTWA 2KKHA 1RAGB 3OVSA 1WD6A 2AEFA 2OGUA 2XSJB 3DLGA 2HW3A 1U49A 2P2CB 5GAEI 2RDJA 2ZJQQ 1QSLA 1WC4A 2YQ0A 2R2UA 1NB7A 4EZ9A 5DZ7A 1FERA 3QBCA 4ECXA 1JJ2R 3HK2A 2NSCA 3CT9A 2QLBB 3S1TA 4AFFA 2CJKA 5KFIA 3TNVA 2WVDA 4NYZA 3PYFA 5L8RC 1IBKF 3ZFVA 1WC6A 5B0CA 3H0PA 5RUBA 4DL7A 3FJ2A 1SJ4P 1D0EA 2VV5A 4Y3CA 1C0UB 3B8HA 1I3OB 1S6PA 2B4UA 1R3NA 4RLEA 5HJYA 5D4LA 1X5TA 1LW2B 1VIXA 2XMJA 5KTQA 2CPXA 5L38A 3CJSA 5E41A 4DL0C 4CO4A 3C6UA 4EFAC 3RAXA 5IT0A 1CBKA 4NLRA 2KYZA 5ETSA 2CNNB 4QW9A 3GIRA 3GCWP 2CNLB 2ZM6J 2ZWPA 1ULRA 2DTJA 4OYAA 1N32J 1LW0B 1S79A 1FRKA 4Z2XA 3EE3A 3O2IA 1FCAA 2FHJA 2OPSB 5KFLA 5KFCA 3VAGA 4Y34A 1HWLA 3KLGB 3QO9A 2V4QA 1TL3A 1R43A 1EB0A 2XI2A 2AYGA 2XMUA 2C42A 5E3CA 5LSLA 4OYOA 4PXBA 1LWCA 3GMGA 2QLJB 1AROP 4NCBA 4C8YA 1RTHA 2W4CA 2LA4A 1RTDA 5FJ4A 3CDEA 2PMHA 2O3DA 3BN4A 3DHWC 4HH0A 1LQ9A 2FIUA 5ETQA 3MCSA 3VAJA 3MF5A 5DDOC 2IA0A 4K5RA 2BYCA 4GVBB 1WEZA 2GVZB 2HRYA 1HMVB 3P5BP 4EZ6A 3BPSP 2V69A 3W2WB 5GAEU 2NPIA 3SSQA 4X66J 2GQQA 5C2CA 4LF9J 5GMDA 1QAJA 1X4FA 5KFFA 5JVHQ 1FRXA 3N28A 2PGCA 3KLHA 3CCRS 1IR0A 1C4CA 3HKZD 4I0WA 4UZCA 4OI4A 3VGTA 3R1HA 4EGLA 1O8BA 2F4VJ 3H7HB 2ASLA 1C0TA 2AEJA 1BUXA 4ZK7M 3MECA 2MZTA 2VBXA 4CO3A 2JNJA 1ITPA 2EPIA 3BO3A 4DPYA 3KJVB 1XK8A 1FDBA 4E2FB 1S6OA 3C6TB 3G2XA 1FFGB 2IVFB 1HBUA 2RRBA 5DGBA 1CULA 1X7VA 4LFAJ 4PQUB 4DV6F 2DHHA 4CZCA 2M8HA 1SKSA 1CJTB 2W7PA 1EJ7L 1H73A 3DOLB 3TARA 4FS2A 3NWGA 3EGVA 2VFSA 2Z2ZA 4KV8B 3G4SS 3E8OA 3ICLA 3MPVA 2C2ZB 2W9CB 2N82B 1QLNA 1AFIA 1UKUA 4ZIVA 5J2QA 3MR7A 2QMUB 3FCWA 2AGPA 4CCHA 2B0GA 4IOBA 2E9RX 3AA8A 2Z2MA 2QA1A 3DN9A 1OPZA 3M2VB 3M2UA 2LEPA 1VQOS 5IT9Y 3FGVA 4H54A 4CLUA 2DNHA 3UCUP 2F9JA 3UD4P 3QLHB 3NWRA 3M7VA 2ZHOA 3MAAA 5LJ3Y 2ZUGA 3M32A 4G65A 2QYGA 1WC3A 3DLJA 2BJEA 1ZTTA 1HWKA 1Z2LA 4P52A 3I56S 5F9LA 5F3TA 2XSJA 1NKBA 3NXZA 5IV4A 3CE8A 2HHSA 2V50A 2XHWA 3HT0A 4ZVRB 4BWJA 3HDSA 3EZOA 5GMEA 4C8MA 4B3SJ 4CQ1A 1JLFA 2R7VA 5HP1B 1NSAA 3AD8C 3IC1A 5EGYA 1IQZA 3W2VB 1C1CB 1NDPA 2Z2LA 2B3TB 3Q8PB 3QJLA 5ITHA 1H7XA 2BJ8A 3VTIA 1WNEA 1WJ9A 4PQUA 1CC8A 1U25A 3H8YA 4KH0B 2HQ3A 2DJWA 1H7WA 2HQFA 3MMCA 3MCOA 2HRUA 4ZS6A 1OPIA 1B0PA 1B64A 4DQIA 4X2BA 4C7QA 5F8HA 3PW7A 4UY85 4H4OB 4Q43A 3CCQS 4ED6A 1NPKA 2DH8A 1FTRA 5E3RA 1MNEA 2VHGA 1NDKA 1ZPVA 4E0DA 1G4CA 1QJHA 4OLPA 3TA2A 1DBDA 4IKAA 3CCWA 3DI6A 4LMZA 4QIFA 2DYAA 1Q16B 3IBCB 4X62J 2VODA 4WFYA 4ES3A 1WKJA 5B0DA 1NH8A 1SH2A 1WDDA 1RHJB 4KYZA 1KLMA 3RB3A 1GFWB 1TL7A 4KY3A 1S1TA 2BJ9A 1OYEA 5KFYA 2MQOA 4DV1J 4DMZA 3Q8YA 4LIWA 3SV4A 3PYEA 3V6JA 2YQ3A 5HATA 1FRLA 1LW2A 3AOAA 3R2DJ 1WHWA 5GAGI 1N8RT 1QAXA 1UEKA 1K1QA 1BWVA 1SJFA 3W7BA 3FRZA 2Y9HA 2VL1A 1YBUA 3VGSA 1F5AA 2M7SA 1LWXA 2UV8A 4OX8A 2FVPA 2R7XA 2KXHA 4ZA1A 2V4RA 5HBMA 1R8AA 3LALA 2HNYA 4DBQA 3I82A 1PYTA 3Q8RB 4USVA 4DV3F 1MN7A 4DR4F 3KLVA 3BSAA 2PDAA 2H65B 2YNHB 5FIIA 3M8RA 4ECSA 4KGMA 4QWAA 1JK9B 2QA2A 3MM6A 5ETPA 4Q7AA 2VD3A 4ZVGA 4FPIA 3A4TA 2WVEA 4NLDA 4P6QA 2GMJA 4V19J 2M8DB 1UEVA 2HZVA 2Y8YA 1S1WA 2A6MA 3THPA 4DZ6A 3IR5B 1ELOA 3M8PA 4UQGA 1V6HA 4MT1A 2NYHA 3R5CA 1JX4A 1UP1A 3UDVA 4LF7J 1S6UA 3VAIA 4A8WA 2AJ4A 2V0NA 2CVEA 4KQZA 3SSSA 4CI0B 2F8EX 2DXEA 1Q7LB 3I4PA 2E1CA 4USWA 4TKTA 4F0KA 2E5LF 3JSMA 2DITA 3M6WA 2OLWA 2YX1A 2DGWA 3FKBA 4IYQA 1NK9A 4D3HA 4O3QA 2D69A 2PC6A 3I87A 3MHYA 2DGVA 4I2PB 4J37A 3NS6A 1U1OA 5IZHA 4YOEA 4WIIA 2KDOA 2OAUA 4OV1A 3J7YI 3TVZA 3KK2B 3ZO7A 1Y00A 1SCJB 1YRUA 2DR6A 1F6TA 2NSBA 5GAHI 4GC7A 4PKDB 4DV2F 1AUDA 1VC6A 5A76A 5M2UA 1U0HA 1HQ2A 2VB6A 4QIGA 4ZHRB 2JVRA 2W4DA 2HHVA 3EXCX 5AXKA 2UUAF 2YX7A 2IJFA 4L76A 4OJGA 2OPPA 1F2HA 3M05A 4FXDA 4QYZK 2KVQE 3R3TA 4CM2A 1S0MA 4JI0J 4NPOA 1T0TV 1DQ8A 4N41A 4ZJOA 1RKJA 2IIHA 4DR2J 3CCUS 2ATCB 1RT7A 2HBYB 4FYWB 3BBCA 1N5YA 2W4PA 1CJKA 3MWBA 1LXJA 4OL8A 1J27A 3AHPA 3W8PA 2EEYA 2FVSA 3ILJA 4ZPTR 4AXJA 1TKXB 2V8VA 4NXMF 1HR0J 2VA3A 1RT2A 2ZKUA 2XGQA 1L3KA 1RWUA 2LLZA 2YWWA 3C14B 3QWUA 3WIVA 3KFWX 2UXBJ 1LWFB 4KTQA 3I9V9 4FKXA 5E5NA 2CPIA 2WSEC 4NLWA 5I3PA 4DR5J 3KUGA 2FY1A 5F3ZA 5EN1A 1KLNA 1M1HA 1IKYA 2DNNA 2MQMA 4NZ6A 1QSSA 3UI3A 2WVBA 2K1RA 3I5BA 1BWEA 2ALYB 5B08A 1XJWB 2KYXA 2RAQA 3BDPA 3CDBA 4WPAA 3E2EA 1E6YB 5D77A 5A8WA 3OUYA 3FDSA 2A6OA 4NLYA 4LT6A 2LKZA 5HMXA 4MFBB 5DQHA 2HHTA 1WDTA 2QZ8A 4RJVA 1MMNA 2B9EA 1U6FA 4ETXA 4Y65A 1RT3A 5CCMA 3QT8A 2MKHA 4LIRA 5F8MA 2HYIB 2V4JA 4KFBB 2LEAA 3BYPA 2ZH3A 4IFVA 2LMIA 4ANEA 2PT0A 1B4SA 5ETKA 2HHHJ 3MAAB 1WF0A 4Y0FA 3BSCA 4PWWA 5T7LA 3CJ3A 1Q82T 2RSQA 5AXNA 4U8VA 2V2ZA 2Y0SD 4QYRA 3GIMA 2BBEA 1N6QA 1HBMA 1SJRA 3R6LB 4DLGA 3WHIA 5J2PA 1HYSA 2VBZA 3DOMA 4CLTA 1UA0A 1UVJA 1MMLA 2LXFA 3D6FB 4C0OC 2XCAA 2LP4A 4X84A 1TKZA 3DLBA 4J91A 2OP5A 3RW6A 5KFEA 3A12A 2NXNA 5LMNF 4J9RA 1HNIA 4DHVA 1BQMA 1Q1KA 1CJTA 1UETA 3PJ9A 4JI4F 1PJ5A 2KZMA 2HRTA 1RSCA 4BDPA 2GX8A 4P2SA 3TAMA 1LK7A 3OT9A 3ISNC 3TP2A 4WE1A 2RUGA 5CZXA 2DR5A 2DNRA 3CPWR 3MOJB 2RHSB 1EKRA 2D3O1 3HD2A 1BGXT 3EGNA 3MEDA 2GMHA 2Z4PA 4P7TA 4U6PA 1C0TB 2NXEA 2CPHA 1B7YB 4B02A 1D9DA 1NPRA 3V6HA 2J9EA 5M2RA 3EYZA 2CUYA 3T5HA 1CQNA 3EVMA 1VRTA 1EKSA 2Q79A 4NLXA 4X4TA 2C3UA 4F3QA 2CWXA 4B9MA 3Q8SB 1TVRA 1KOOA 4I1TA 4J9UE 1T9WA 3R97A 1F60B 2V67A 3AB4B 2U2FA 4YR2A 2NXUA 1YGYA 1LFWA 1ROFA 1RT4B 2GJ2A 3H25A 1HW8A 4WZMA 2V9WA 2DBBA 2VC1A 4OYZA 3UO0A 3D1QA 3HSGA 2ZH2A 2L08A 3RRGA 4DPWA 3PACA 3LANA 5AJ3J 2AQ4A 4NEYA 1AUSL 1GTHA 3VVUA 1HHQA 2KI2A 2UV8G 1KVJA 2V9KA 4MK7A 3SFGA 3SEOA 2F9DA 1OY6A 2B9YA 4DPXA 3G8TA 1TZ0A 4DSKA 4YR3A 3A3OB 2LFVA 2F4VF 2G13A 2NQPA 1RZMA 2WW8A 4PG4A 5C42A 1VQ6S 2B43A 3HHDA 2RIJA 2QA4G 1JLGB 4DUYJ 3M4XA 3W66A 6FDRA 4F4ZA 4Q8EA 5KFQA 3CCLS 3CCTA 1N4LA 2EKNA 4RZRA 2L9DA 1NJIT 3IBFB 2XHCA 3MPDA 3FSIA 2IPOB 3NOCA 1RWXB 1FHTA 1ZAVA 3AA9A 3ZNJ1 3GV7B 1S1WB 3CF5Q 2JWNA 3OXGA 2LCWA 3HZEA 2BM1A 4UF4A 3NCRA 1T9TA 1F1BB 3KUEA 3GYNA 2ZH8A 1MMDA 1XMOF 3FBCA 4V19X 2HFNA 1UJ6A 3PIOQ 3BO4A 3RGIA 4P71A 3NGDA 3KK1A 3GJTB 3CW2C 3H5XA 1KWMA 1KHVA 5F0UA 1WWHA 1TUVA 4WJBA 4CDIA 1XQIA 4IH7A 5J2MB 5KFHA 3KYLA 4JV5J 1GAOA 3NAHA 2O5DA 1FE0A 1Q79A 3GYXB 3I9ZA 2FVQA 4HI2A 4ZVQB 4IR1A 4NOHA 4RW4A 3PNIA 5EX0A 2D3OR 4Y2AA 3CDAA 2XY5A 3NMRA 4OI3A 4QPXA 2CKWA 2ZBPA 2RRAA 4ECTA 2LQ8A 2MKCA 1YBAA 3GCXP 3QGGA 4FVMA 3D9BA 5B0EA 4C98A 2ZUAA 3MI7X 4KB7A 3TX8A 1X4BA 2RQKA 5DLGA 3HP6A 1VI7A 1IKWA 4RO0A 2DR9A 5KT4A 3MM6B 2YKOA 1FRJA 1SV5B 2AX1A 5KFOA 3PKMA 2GVDB 2ACMA 3DRPB 2J0QD 3OTBA 1I94F 4ANCA 1IWGA 1EHWA 2NCKL 4DL3A 4Q0BB 2RDDA 2UVRA 3AODA 4IOCQ 1SQFA 4C0HA 1SC1B 4B3OB 4CT9A 2XI3A 1DTTA 2FDNA 5D15A 4JI5J 4RX6A 4WYWA 1HBOB 4LFBJ 3G87A 5CYQA 3ETMA 3IWNC 1XC9A 3HZGA 4OZNA 2QTWA 4EYIB 2QLFB 4C3LA 1R8PA 3OR1B 4WFBQ 3ENWA 1GXTA 3KKFA 3BREA 3BGLA 4EK2A 3S8SA 5C2GA 4B3OA 5J2PB 3GFYA 2VJVA 2XZDB 4U96A 4PUOB 2R7TA 1DARA 1MU2A 5CYQB 4AUKA 4X65F 1WF2A 2MKIA 3GIKA 5J2NA 4M5GA 4B3TF 1YI2S 1BHNA 1EX8A 1F5BA 1U2CA 2K06A 3D1OA 3IR6B 2K7KA 3MPYA 4LBIA 4B3TJ 4ATNA 2GVDA 3FRYA 4O4RA 3JTNA 2MSSA 1E6VA 4QWBA 1I51B 4PXDA 2XO6A 2EVZA 2RHQB 4PR6A 4ZCLA 3BO2A 4K4TA 2NREA 3EGZA 3KNAA 1D09B 2F65A 4YHHJ 2WONB 3K8WA 1K0VA 5BXIA 3SYZA 2ZH6A 4NEZA 4GVBA 4N77A 5GADI 3RB6A 3OVAA 5DG8A 2AYEA 1T9UA 1Q86T 1GK8A 2MKKA 1SIWB 4RW8A 2PA3A 2QFJA 4J9KA 2F63A 1JLGA 4LRFA 3QAEA 2RT3A 1VQNS 4Q8FA 4O44B 4ZPDA 3M2RB 3FVYA 4EBEA 2VDIA 3G82A 5CA5A 2UUBF 3ZZPA 4B3RJ 2RD5C 2OD6A 4ZCIA 2G1DA 2J76E 3D0IE 3AJ1A 4R25A 4DN0A 3K5MA 4DPUA 2D9OA 3KDOA 3M8WA 5L1IA 3QJJA 1YHQS 2W25A 1RWMB 2DO4A 1G7CB 2IBKA 4USMA 4IRDA 5LOQA 1MWZA 4JUZA 1DZ5A 4A8KA 4LF7F 4CLLA 2JLFA 4NLPA 1T11A 3PY8A 5E3PA 2KN4A 3MD1A 3G6VA 1JLBB 5DDRC 5B0GA 2RS2A 3AD9C 3NGSA 1FRHA 1TKTB 2IAJA 2RQMA 2NS1B 3FBBA 5JMNA 3RTVA 3HXMA 4EWTA 1HNXF 1FESA 1NJWA 1Q8IA 4M5NA 2DY1A 1RAEB 4LF5F 3DDNA 1KN6A 4ANDA 4CO5A 2OPQB 5D4PA 1P27B 1DTQB 2NZCA 1R31A 1RTJA 4K4WA 4B3RF 3CNQP 2YKMB 1UVNA 1RAOA 4ZVFA 4K4SA 3W5YA 5CHCB 1M1KT 1LW0A 4K8RA 4L75A 3WX8A 4JV0A 3CCMS 4CYUB 1TL3B 2A2CA 4KAIA 2GS8A 2W24A 1T05A 3F56A 3ILOA 2U1AA 3DGVA 4U9RA 1YJWS 1RHQB 2JHEA 4RWXA 2DXDA 3L95X 1Q8LA 4J5OA 2ZFHA 2WVCA 1X4GA 1RWWB 2AX0A 1RWNB 1YZ6A 2DPIA 1RWPB 1W7WA 4A48A 3RR8A 5C24B 1REVB 5H1SV 3NS5A 1AA1B 2ZNZA 3FC9A 1N0VC 2KT3A 3ISND 1RYSA 4DSLA 4RUHA 4O0NA 2I8EA 4R5PA 1HBMB 2XQCA 4J9QA 4URGA 2VPXB 1VLYA 2IM1A 4W4MA 3UCGA 2OEJA 4Q5VA 1G2EA 2YNIA 2ZE2A 3POTB 1N5SA 4DSEA 2WW4A 2J9CA 4YEAA 2MLZA 3MXHP 3DXBA 2JLEA 3LW5C 1WI6A 3BN7A 2MQPA 4ED2A 3QRPA 4K4ZA 2Z8QA 1H2TZ 1TR0A 2XWXA 1XN9A 3ZTPA 3H5YA 3DLHA 1FWLA 3HHNB 2I9SA 2ROGA 3I6PA 5LSOA 3N4WA 3OL6A 1I6JA 1IQTA 1PSDA 4C11B 4K50A 4M5MA 3MUMP 2JEJA 2IBOA 1ZETA 4FXVA 2WHOA 3FZ2A 4C8NA 5LMUJ 1N5QA 3C6UB 4FDFA 1HQUA 3NMAA 1SUQA 3DNCA 4DS4A 3P6YC 1HFEL 3PG9A 4ICLB 2XLIA 4WKRA 1V3SA 1HI8A 1U24A 3R5AA 5HVGA 1VBZA 1KQGB 3KWMA 4PWDB 1SPBP 3I96A 3FFIA 3THVA 4WTOB 2W2QP 4DI6A 3CVKA 4NASA 1IBLF 3MTJA 2ZD1B 3I31A 2PI4A 3NOGA 4JI4J 3PW2A 4PUOA 3TAMB 4IFVB 4UOHA 4YY3J 3R7BB 3BBBA 3QIDA 1U1RA 4J9NA 3RB0A 3W5XA 4FPRA 2JOQA 2POKA 4M95A 1DY3A 2IVYA 4OLOA 3HO1A 4IQXA 3KHHA 3UCZP 4W90B 1FXDA 4ED4A 3MOZA 4NXNJ 4JOUA 3OL7A 4LR9A 4XAKA 4LF5J 3R27A 1WOSA 5KT6A 4J9LA 1WOPA 2CG4A 5FLXY 1ZPWX 1KTQA 3MEKA 1S9EA 4K4VA 1BQNB 3CC4S 4OFZA 1M5HA 2VBWA 2ZH5A 4NZ0A 1VHIA 2ASYA 2MB0B 5H9FK 2B51A 1JNRB 4DPOA 5I42B 1MSWD 3CEDA 1T03A 1SI9A 4OZJA 4FF1A 3JB9k 1CPZA 4DV4F 3D66A 2M2BA 3QGPA 3JSMB 1RE1B 4F0MA 1R0AB 5KT2A 5KT3A 2VUGA 1GNKA 3TUPA 4X65J 1WHVA 3FQKA 2ZH4A 1S5ZA 2P6SA 4DX5A 3IS9A 2MHEA 4F36A 4ZCKA 3D68A 4C2MA 1SJ3P 1HNZJ 3QJPA 2CXEA 1ZAWA 4F02A 1FXLA 3IG1B 1UEUA 3JQJA 3MMAA 4A8XA 3Q22A 3HJFA 2VQEJ 1CS4B 3P96A 2DCUB 4WIQA 2GA7A 2HVDA 1K47A 3QSYB 1RADB 2BDPA 3KHGA 2B7BB 4ID5B 4ES1A 3OL8A 3GE9A 3MECB 2HNDA 5D0HA 4J9MA 2XZTB 2XZWA 4HACB 4RNFA 2VASA 5A0YA 1O51A 5A2QY 1L5UA 4X4NA 3M32B 3NKYA 3LO3A 4IDKA 1VJWA 1S7IA 5BJRA 3QO9B 2GIFA 2RH3A 2I1RA 1DURA 2WK4A 3ETOA 3QMQA 4OYMA 5CYJA 3BGFA 4CTAA 2WBRA 3EZ5A 4ECYA 1F9FA 1P9QC 3TZWA 5CXTA 3PCOB 3C2PA 4M5KA 5AXMA 4TY8B 3FZBA 3H2UB 3U1LA 3UNGC 1IJEB 1K44A 3US5A 4ECZA 5KFRA 1Y0HA 1KOHA 4OHXA 1GH8A 2E44A 4MYTA 3RRHA 3TO8A 3ZZUA 2J7UA 2BUNA 2FLLA 2UU9J 4JV2A 2EG2A 1OY8A 2IC3B 3KXDA 1D8ZA 1LV5A 2UVWA 2EFPA 1DTTB 4TU8A 5A8RB 3K2YA 2ZHBA 4IH6A 4LJMA 1XMBA 1FKOB 4F3MA 2C2EA 3UWTA 4IG3A 4JV5F 2BKPA 4NCGA 1RB0A 5DJBA 3KLGA 3TA0A 2J9DA 4GO7X 3PRDA 5K5MA 1RAFB 2ZH7A 3LP1B 4IFYB 2J0SD 3G9CA 3HT3A 1Y4ZB 3Q2SC 1XNRF 3ENAA 1RTJB 4TN2A 2IHR1 2KRBA 3HJVA 5FDLB 3KK1B 1NSKL 2BOAA 3MUVP 1QVFR 1S0VA 2MZRA 1VC0A 4MJKA 4BCAA 1JLAB 4NLUA 4ZOSA 1RBOB 1Y3JA 4G1PA 3DCAA 1JNZB 1YSJA 3GB0A 4MIWA 3G8SA 1WHXA 3CJKA 1SC3B 1OY9A 2LDIA 4DV1F 2MGZA 2LXIA 1TL1A 2EI5A 2DXFA 4FXWA 3SSRA 2RJZA 2DNZA 2CPDA 4LSZB 3I55S 3MAHA 1S6QA 1N52B 3AH6A 3DM2A 1RHRB 1W2BR 5AXLA 3EX7B 2YWGA 3QATA 2FTRA 4YUDA 2E5HA 2GHVC 1UVLA 2V63A 3VAFA 3PW0A 1NZ8A 3G6XA 2V8DA 2HNYB 4L72B 4NMLA 1G1XA 1FJ7A 3V4IA 3BGOP 5CQGA 5HL7Q 1F3FA 2EG1A 1ACMB 5GMKa 1DFDA 1Q81T 4JI7J 3J80Y 3HPOA 2OTJS 2O66A 2QX0A 4WP3A 2R2RA 1KSPA 2JFKA 1FJCA 2E5IA 4NI2A 4GMKA 4ZVTB 2RKIB 3A8IA 1VRUA 2BE7D 3DGPA 2AJ0A 4YS2A 5IM0B 2W7OA 3PRVA 2R2SA 1RI7A 3PV8A 3V4MA 2X1AA 2ZC3A 2DCLA 2BANB 1QAIA 4LF6F 1VRTB 1X31C 3VGUA 5ADZA 2CADA 4F4YA 1IKYB 2AJQA 2P8IA 1FD8A 1RQ0A 2QN6B 4M5DB 4DQPA 1X4DA 1S9GA 2DPJA 5ETVA 2RKIA 2B56A 4YQWA 4XPEA 4H4KC 4ZP6A 3IAM9 1RWKB 3TANA 2J6UA 4N8NA 4WCEQ 2O1PA 4DFKA 2EBGA 4EU0A 4MYUA 4DFMA 3EM1A 3O5TB 1O0PA 2YY3A 4BWMA 2BZ2A 4HKQA 4F0HA 3RBXA 2BEFA 3DRPA 3X3UA 4ID5A 4AT1B 1N48A 4EMDA 3CD6S 1J5EJ 3WQPA 1KQKA 5F8LA 2K3IA 3GR0A 3WX4A 2GMLA 3EPGA 1A6LA 1S76D 1KNZA 1S4EA 2E5GA 3KDNA 4USKA 3IWLA 1WG5A 3HFZB 2QJ3A 4PYDA 2MZ1A 4DS5A 3K17A 3DOKA 4OYWA 7AT1B 3OFEA 5HMWA 4C11A 3VALA 1FNXH 2JX2A 1Y5IB 2R7OA 4LSNA 1HLWA 3KJVA 4BC7A 8RUCA 1X9WA 1D9FA 2QT7A 3GQCA 2MY8A 4I64A 2X1GA 3CD7A 4H4OA 1FDAA 1HBUB 2YX4A 2AU0A 5I4MA 1KVIA 4FNHA 4DN9A 3Q2TC 2ADBA 4F3OA 2CPZA 2OD4A 5KFMA 3BR8A 5CD4H 3R1LA 2C3YA 3UR0A 2OI2A 2VG6B 2DNYA 4KV8A 1CJVA 2N4CA 1VMBA 5L1KA 3TI0A 1YJTA 1YJ7A 3UD5A 1VBYA 3DRSA 4NLTA 3R7SB 2KZZA 1FKAF 4DSFA 1RT6A 4KBIA 1OIAA 2FHOB 2GVZA 4GRSA 2MJNA 3HSDA 4I6WA 3EDQB 4RBVA 4ZP9A 2K3KA 3LGMA 1LOUA 2EFVA 1NK8A 4QYZJ 2OEKA 4B9TA 4U95A 1S59A 2F3JA 8AT1B 2VG7A 2H4YB 2PMWA 4CNYA 3DFEA 1RCOB 2YVSA 4RNMA 2W8LA 1Q78A 1A9NB 2MY7A 2JC0A 3L09A 2P6TA 1H74A 1HWJA 1JKHB 3GJSB 3GJRB 3CDUA 4LQ3A 2C2KB 1RHKB 3Q86A 2CZ9A 2HHHF 4DSJA 1VOMA 1UA1A 4DR7F 3V81A 4HR2A 3G6YA 2PE8A 3LP1A 2CNOB 2APOA 3VZHA 2L48A 5DS7A 2CQHA 1AFJA 1U0HB 4OI1A 1C2PA 1HARA 1BE4A 4L6V3 4OZLA 3T6BA 3AQPA 4MKAA 4UUXA 4JI0F 1FJEB 3J7A1 2P9CA 3M8YA 3R5BA 4M94A 5B7WA 5HQ8A 3MM7B 3HVWA 3TJ8A 5H9EJ 1UAWA 1FRMA 1V5IB 2I6WA 4DFPA 2YNGB 4WK1A 4AL7A 2BW2A 3N9UC 2KFYA 3SV3A 4RWWA 2YXLA 1S6PB 2RQ4A 3FUYA 4ITSA 4TVAB 3KK3A 1FNMA 3V6KA 1J5OA 2G0CA 4OHWA 5K8NA 4USTA 2R7RA 2CQ2A 3FEZA 4AD6A 3K59A 4OJHA 4ILMA 2R2TA 5CYMA 3IRXA 3CD0A 2QO3A 5I42A 1K1SA 1GX6A 1WEXA 3A8KA 3MDFA 4DG1B 3H5UA 2BXJA 1LKZA 5A0YB 2JVOA 1FT8A 2JFDA 1Z2ZA 4K5SA 2E7VA 2R9LA 4ELTA 2XNQA 3N6MA 5ETRA 1IR2A 1VQ4S 2Y8WA 3R7NB 3W2VA 3CCZA 3IGVA 3IM9A 3IFEA 3A8EA 3HSJA 1O5JA 1RLDA 4YB5A 2YKQA 1H2VZ 2QSWA 5IQ6A 2R7SA 1RDRA 4QIEA 3DRSB 3I0RA 2NPFA 1QE1B 2HVZA 2XM3A 2VQFJ 3MGJA 5LSRA 1SIZA 1NSQA 1F5CA 2LVWA 5E3AA 8ATCB 4J9PA 1KR4A 1RT3B 3JSYA 1YQHA 2I38A 2ZD1A 2ZDPA 3PEHA 4X64J 1FFWB 2GHWA 1RTZA 3JQMA 3KLFA 4GC6A 3J7ZT 4MIAA 3KJFB 5ETMA 4OQJA 2CPJA 3BJYA 1DHMA 1CEZA 3ONQA 2DD8S 2ABYA 3N5BA 1IKVA 9ATCB 4RW7B 4KC5A 5JUMA 1S9FA 3LF0A 2XTJP 5E7OB 4LSLB 5HSPA 3D7SB 4QR0A 2V8HA 1PAUB 3MM9B 3M6XA 4LUBA 3TVKA 2DHGA 5HMYA 5LJ5Y 2MKSA 5D8HB 3SDEB 1C1BA 3PHTA 3ZTSA 2DO0A 4K59A 2YWHA 2GC8A 1U0SA 1W26A 2VFUA 3OFFA 3SCJE 1EP4B 1YRXA 1YWXA 3TWZA 3TAPA 1SH3A 1TKXA 2MZJA 5L9NA 1RK8A 3DHXA 4NLQA 4HL9A 4OI2A 5I3UA 1MU2B 3G8QA 4LBHA 4X4SA 3PX4A 3WC2A 2E1PA 2VU5A 1KS2A 1HL6A 2HURA 2MPUA 1KP6A 5BYRA 3HFKA 3OBIA 3KLEA 4NZ7A 4K4YA 1KRPA 4GKJF 1X4AA 1JLEB 5J2QB 2GGPA 4QIWD 3CC7S 5D3GA 2VPWB 3NCPA 4ECQA 4LFCF 1YX2A 2C28A 2CQ0A 5EX3A 2XSFA 3TAQA 1TK0A 1VIOA 1VDHA 2E66A 1FO1A 2RS8A 4LRCA 4P73A 4F7VA 1EETA 3DKDA 1CJUA 2VFVA 3GONA 3NBPB 3ZZZA 3CUNA 3CJKB 2OJ3A 3OR2B 1QM9A 1SUQB 2EC2A 5HO4A 1IKVB 1VRQC 4ED1A 2QE5A 1NJXA 1XNRJ 3C15A 3Q8UA 4RW9A 3SCLE 2RRNA 4ZKAA 3TEHB 3OTOF 2CQBA 5L1LA 4BLGA 3U27A 1UWBA 3BGRA 3H20A 2UUBJ 5A6PA 4MK9A 6AT1B 3T5LA 4NRTA 2B9XA 3S7RA 4N47A 2I5JB 2J9DE 2KJVA 2BX6A 1EP4A 4IG0B 2HS3A 2KM8B 2DH7A 3V6DB 3AJDA 3E01A 5A2QU 4I6YA 1VS3A 3M8QA 3N6NA 4PPDA 2L9NA 1R6VA 4O4GB 2BOPA 5SUHA 4DUZJ 1H6KX 1JIHA 1NZAA 2NUHA 3I4HX 1U4BA 2CQPA 3HHLC 1S77D 2YKNA 3AOCA 2DRDA 4F04B 4A47A 4LF8J 4AQYF 1FEHA 3G6ES 1TUWA 4IRKA 2D74B 4DCOB 2XEXA 2ZKTA 2CQIA 1C0UA 3D6TB 5DETA 1XMOJ 5CAAA 1TAUA 4F4AA 1WC5A 2XC9A 1VCTA 3EICA 3OQ2A 3BZQA 1S1VB 5K8PA 4N56A 1SXLA 2C2OB 2ZEJA 1K8AT 3EZUA 5JJBA 1OJ4A 4I56A 1VQPS
chains in the Genus database with same CATH topology
1U09A 2UZAA 3AB2B 4YP3A 5FDLA 4RUAA 1R7IA 2ZZNA 2IMOA 2CQ1A 4I2QA 2DGOA 5I3QA 2DIUA 4PPZA 3ZZ0A 3M9OB 1TP7A 1AXQA 5KFUA 1HQUB 4Q2LA 2F1FA 4FVCA 4PG8A 5EDWA 4G6VB 1OQ3A 3GIJA 1YIJS 2AW0A 2E7XA 4R0EA 4XK8C 1UVKA 2LU1A 4XO0A 1LXNA 2XMWA 1RTDB 3DRXA 4EUVA 2Q3PA 2M52A 3D1HA 3MEDB 1M5KC 2BM0A 3M1VA 3D54A 5HLFB 1C4AA 5KFGA 1QY7A 3QPIA 1FKOA 4U7UK 5EHHA 2L9WA 2XLKA 4DEZA 3MEGA 3DLEA 3M30B 4B08A 3H2VE 1NHUA 4M1KA 2KJWA 3IRWP 2ZBIA 3DC2A 3LOUA 2J0XA 4QJVA 2DNOA 7FD1A 1DQ9A 4RNNA 2FJDB 3OW2R 4USJC 1W25A 1U1QA 4DFJA 5D3GB 5D6GA 3BR9A 3LAMA 3G96A 2ASJA 2OJ3A 1HNVA 2GFFA 3JSBA 3Q8QB 3LWLA 1KQSR 1LK5A 2GO8A 4DOZA 1UVMA 2OFHX 4TYAA 5KG3A 2LQ5A 3E51A 4NCGB 2PMZD 2YWFA 4QQBA 2ZH1A 2B5JB 2KT2A 3OR2A 1RA7A 2QIFA 4OHYA 2NLWA 4EEYA 2HMIB 3ENVA 2B6AB 3V2UC 4IOAQ 1XTZA 1OSCA 4G1QB 2FLPA 1SL2A 1E6YA 4NYOA 2IAJB 4BBYA 1RKIA 2D3ZA 2F8HA 4ZLPA 3DU6A 3D2WA 3OR1A 1BQXA 4HI1A 5K8MA 3T3FA 3PX0A 5KAKA 2DRBA 3M9MB 2DK2A 2Y1IA 3PO4A 3QGHA 2AYBA 3WZ0A 5L39A 2X1FA 5CH7B 2PI5A 1T7PA 5LL6d 3FMBA 1NAQA 3PZPA 1QVGR 4CIOA 4D3GA 2QEXS 3K58A 5T7LB 5E0OA 2MYFA 2UUTA 3PO5A 1X0PA 4ZMMA 3OTCA 1CSJA 2V5HG 1CLFA 5DG9A 3GILA 4O3NA 1S7HA 4RW9B 3IXQA 5M2PA 3T1AA 4C8KA 4KKOA 3MMCB 1S99A 3HI9A 2VFTA 3BS9A 3NP5A 1ZM9A 3ZZYA 4ES2A 4HLBA 1BD6A 4RBTA 4X62F 3A1YG 1TQLA 1FDDA 3CC2S 2WTFA 1VRUB 5IM0A 2MGZB 1K9MT 4NCAA 5IWAF 2KM8C 4RNOA 1XR7A 2E9TA 4F2SA 5G4DA 4O3RA 2L3MA 1I1GA 1RTHB 3OFHA 2CRLA 3I5CA 5KFSA 3FFIB 3G86A 2E7WA 2RDIA 4DR6F 4UW2A 4B9UA 2VOPA 3TOQA 3JTOA 4KE5A 2XGPA 3CCSS 4J9SA 2COLA 2A2DA 2YKAA 2ZOMA 3VR1A 1ZM4A 3MAQA 4DV5F 2KXNB 4WF9Q 2LQBA 3WC0A 1S1VA 1QE1A 1YRTA 4DUZF 1N5TA 1HNVB 6FD1A 2XMTA 2XS2A 3D0GE 1IXKA 1R89A 4HEA9 4WFZA 2PO4A 2RF2A 4JI6F 3AAWB 1OO0B 3JSRA 5LT5A 1N56A 1ZM3A 2CDQA 3X1LB 2N7YA 2DIVA 4Y2KA 3IWXA 1RT2B 4IRCA 3FEXB 2M9KA 3LGNA 2LEBA 2LECA 3LP2B 2YNIB 2ZE2B 3POTA 1YTYA 4UY8T 2VOOA 2ZZMA 2KHCA 4QR1A 3ITHB 2KH9A 5F0WA 3T1HF 2OSQA 1TL4A 3I0RB 3LWMA 3IAS9 2AGQA 1FNOA 1FEEA 1S48A 5KFBA 4UOCA 3GV8B 4ERDA 2DNLA 4I4BA 2HHPA 1TKTA 4LF8F 1PC5A 3SZ2A 3FSYA 2CPEA 1XNQF 3OVBA 2HHXA 2K2PA 4PXCA 5B0FA 1FVSA 3SCKE 3T5KA 2I0XA 1VQMS 2ADCA 2MHNA 2OO4A 3D28A 3UD3P 5AE3A 3CO9A 4TYBA 5H9FJ 2KO1A 1VK3A 2FLOA 2C2RA 2IA6A 4IDKB 3IGNA 3BEGB 4R8UA 5KG5A 4KRWA 2BA9A 3MFHA 4Q45A 1K73T 4CH0S 1D1UA 3SFUA 3H4BA 4WFAQ 2EW9A 3QGIA 3BDEA 2C22A 1REVA 2AV5A 4LF4F 2OSRA 3CJ0A 3LP0B 3F44A 2ZHAA 1HNIB 5KT7A 1U1PA 3KTQA 4JI5F 3E01B 5DG7A 4FF4A 2E1RA 4LSLA 1UJ5A 5DDQC 3CXCR 1U1MA 1FKPB 5KOWA 4K0KF 1PILA 4ELVA 1UW4A 5A6WA 3HHLB 5EWGA 1HW9A 4JBCA 2N3OA 4KHPF 2DHSA 3D0HE 1D3WA 2J7WA 3K7RA 2KTQA 3T1YF 1N6QB 1U48A 1FXRA 1X9MA 3AJ2A 4XDCA 4CH1A 3H5SA 5L9XA 5LXRA 1TKZB 2PFFB 4RU2A 3RYLA 2J8AA 4ED7A 1U6BA 3EPIA 1SV5A 2HVIA 1L3SA 2FC9A 2OMOA 5K14A 5GAHU 4G3IA 3GFXA 4EYHB 1XWLA 4ICLA 2MSTA 2W9BB 4O4GA 4YHHF 3GSDA 4H4MB 5KFJA 4ZPAA 5BYQA 4ZVHA 3SMZA 1YJUA 2AP6A 3S01A 3MUTP 5IS2A 5MAOA 4C8ZA 3FEYB 1KFDA 3BSOA 1LWFA 2GHPA 4XDDA 1UWBB 2WOMA 2OPRA 3TUZC 2XG8A 4KT0C 3NLCA 1NNDA 4TU7A 3HVAA 3TVYA 4WFXA 1VQ8S 2Q6CA 3VAMA 3O1LA 2VKZG 2BRKA 3HX9A 4YR0A 1FDNA 4EBCA 1WI8A 2CQDA 5IXUA 2RNEA 1HA1A 2FGOA 4EBDA 3OXLA 2UXDF 1DQAA 2KXFA 2YH0A 4CNZA 5C25A 1H2UX 5IFMA 2XMMA 5E2QA 2JSXA 4M8LA 1E6VB 4HDGA 5HROA 5BR8F 1X8DA 2CQCA 2ZDOA 4HDHA 4ZHRA 4FYDA 1R27B 3CDWA 1FRIA 3CJ2A 3RRKA 5E3QA 1FTCA 3KG0A 4I7FA 2B4VA 4IFYA 1HHSA 3OHBA 4NRUA 3M9NB 1NKCA 3CSKA 2DR8A 4ED0A 4N76A 2DGXA 1NU4A 2ZNYA 3RR7A 3VQSA 3MTKA 4OJ1A 1U2FA 4URSA 1FE4A 5C24A 1Y7PA 2EWHA 1YJ9S 1HWUA 4Y6IA 3JYTA 5KFVA 4MH8A 4GKKF 3GV5B 1IM4A 3DOLA 3PEJA 4TNOA 3PXGa 1S72S 1VBXA 1KD1T 2X3GA 5F8GA 5J2MA 3DYAA 1KTVA 1TL5A 2DHXA 4KO0A 5C42B 2M70A 2RILA 1F0XA 2KT5A 2WBMA 4WU2A 1NK4A 2HHWA 3EXYA 3IBWA 3QWPA 1B0VA 2HG4A 2OFGX 3VQTA 1WACA 4RNHA 4DR1F 4WFNQ 1NJZA 1QUVA 3RBEA 1HR0F 2DRAA 1X0FA 3BGRB 5JVGQ 3CTRA 2L41A 2SXLA 1TVRB 2HIQA 4B9SA 2IC3A 4R5PB 2OPQA 4YDXA 4C9DA 1Y5LB 1FJGF 1RT4A 3VZIA 2UXCF 3HHEA 4O3PA 1U7LA 4IUFA 2D7SA 4JI8F 4JI2F 4LVNP 2EFOA 2YNHA 1S10A 4I68A 4NLVA 1JLFB 4FS1A 4C3KA 1RT1B 2YKNB 2RB7A 2J7KA 3OFGA 2HFOA 1UJ4A 2P9GA 1S1TB 4RKUC 2BABA 1OSDA 3U1MA 3QZ7A 2X1BA 5F9NA 2HQIA 1L3TA 4U7CA 1JLQB 2LDYA 3H4DA 3GG1A 4X4VA 3CIMA 2PEHA 2I5JA 3PHEA 2EKYA 4TQSA 3KMSA 2CJBA 4C97A 3TYTA 4ETZA 1CQMA 1FF2A 1VQ7S 3DMJB 4I67A 2GJIA 2FJAB 3TUJC 3B4MA 3TUIC 3LPYA 2ZJPQ 3DXSX 4PWUA 2CZVC 1M90T 2DGSA 4BS2A 3NBPA 3K0JA 4RW7A 4L3NA 3MD3A 2HHUA 1DLOA 1HNWF 1N36F 4YMEA 4KHRA 3N01A 1M5OC 3FCHA 2UUWA 2FHKA 3NG8A 3RZAA 2FJXA 1IKXB 1NHVA 2HNZB 1DRZA 2V8GA 1VC5A 1SB6A 2D41A 3M2UB 3TQ1A 4OZ1A 4R0JA 1DLOB 2E5JA 5HROB 1P1LA 5KG6A 4RW8B 2R8GA 2JEIA 1HQEB 1X4CA 1X5SA 1IKWB 3SQGA 3MR6A 1SKRA 5HMZA 1BQNA 4YB7A 5SZTA 2ZOGA 3THTA 2FLNA 2YNFB 1HMVA 1HPZA 4G1QA 4Q2MA 3VCDA 3DMJA 2KFNA 2H5EA 4F8RA 2XO7A 4OHZA 1HQEA 1KONA 2F8MA 1ZZNA 1R0AA 4FNIA 1HWIA 3PW4A 3RU0A 2C2DA 2VBYA 3PJWA 2ZOFA 5CYMB 3M2VA 2ATLA 1BLUA 5KFNA 3L7PA 4ID8A 5I3UB 1NKEA 2FHJD 1GX5A 5A8WB 2N4DA 3OUYB 5LMUF 3HHLA 1PO6A 1GXLA 4QWEA 4ZPCA 3N5FA 2OPSA 3HKWA 2BQRA 1URRA 1ZTWA 4DJBA 2W8KA 1S9EB 1YG0A 1TFYA 3O6QA 3M6VA 4ECUA 5EWFA 2PA8D 3ULHA 4TU9A 2FVRA 2AD9A 1X4HA 1TL1B 1PC4A 1K0TA 2ROEA 4K4UA 2DB1A 1WTBA 2JC1A 3K5LA 5KG1A 4DL4A 1JLCB 3E3XA 2E1AA 3LP0A 2FC8A 2CJ9A 5AE1A 4DF8A 3OSPA 2K8GA 2ZH9A 5AE2A 1GXUA 3MM8A 2HLTA 3B82A 1FK9A 3QYYA 4OX7A 3R5DA 4U67Q 1S97A 4MKBA 1UFLA 2LYVA 2IRYA 5KFZA 4JV1A 2DNKA 2IYIA 1RT1A 4PG6A 4DR2F 2XWYA 3MM5A 1RAJA 2JZ5A 4HTJA 1U45A 2LQJA 2UVUA 2ILYA 1ZBTA 2HAIA 2G4BA 4X4OA 2KHDA 4LFBF 2M3DA 4FZVA 1FA0A 2BANA 4Y2CA 4FP9A 3C3LA 4HT5A 7FDRA 3TA1A 1M0SA 1N88A 4ZPBA 4Y00A 4RU9A 3B4DA 2E1MC 1T05B 2XLJA 2IMWP 3GWCA 2CPFA 3NL0A 3Q0AA 2AJ1A 4URQU 4TQRA 4Y28C 5F8IA 1LWEA 3ENQA 3OPKA 2N3LA 3KK3B 1J5OB 1JKHA 5DLFA 2DGTA 3KOAA 1P1TA 3V5RA 2DT9A 2RVJA 1H98A 2BACA 3U02A 3PW5A 2UXBF 2Y1JA 2VPYB 4ECVA 4XIUA 2BE2B 2D3UA 4Y2MA 5A8RA 3IN5A 2WAQD 3PR5B 2M0GB 1FK9B 2R8KA 3CIZA 4NLOA 5BYSA 1MW7A 1SL1A 1DAXA 2YH1A 4J9OA 2LA6A 1HI1A 4WXOA 1RGVA 4P7VA 4ZPWR 1KLMB 4C3MA 4ZDNA 5DQIA 4PQAA 1T95A 2HS4A 1HYSB 2CQ4A 1BY9A 4I6AA 2HZCA 4TY9A 2JLGA 1VGYA 5KG7A 1KHWA 4BHQA 4OJ3A 2VZ9A 3OTDA 1XMQF 5HLFA 2RU9A 3MMBA 2XULA 4ZPVR 4AE5A 2NUUG 4HHJA 4DWIA 3NGKA 3QLHA 4HH1A 2R8IA 2Q6BA 3NCQA 1A7GE 4QPTA 1TV6B 4MFBA 3T6JA 5T14A 3MM7A 1SJQA 4O3OA 3Q23A 1RT6B 2CIMA 3KHRA 4M5DA 3PIPQ 4A4JA 4O23A 2CZ4A 3DI6B 1IJFB 3KMQA 2WB4A 3LUYA 2OH2A 3NNCA 2YKPA 2BV3A 1VQYA 2ERRA 1L3VA 1TFWA 5LXYA 2BR0A 2AF6A 5AJ3F 4MAKA 4ED3A 2JH3A 2RE1A 4Y2IA 1X5PA 1G3OA 1JJHA 4IQMA 5IQQA 4B3MF 4F50A 2KG1A 2WOMB 4O0IA 2DR7A 2QV6A 1BQMB 5GVQA 3WBZA 2I2YA 2FPHX 4AYBD 4NA1A 1M5VC 1GTEA 5E33A 5KFKA 2HWIA 4B9VA 3C8YA 4UQTA 1JMTA 2IM2A 1XBWA 5J1EA 3K5NA 1TK8A 3L7OA 4PCQA 1C1BB 2IRUA 1JWWA 2KU7A 4DL2A 2MMYA 3BF4A 2C3PA 2VA2A 2ZJRQ 3CJ5A 3KHLA 4NA3A 1HBOA 4RUCA 2IM0A 5DM7Q 3W3SA 1W2IA 2HGLA 1JLAA 3V4IB 2MQQA 3UR3C 1WTFA 2GNKA 3SXLA 4CT8A 3L3CA 2IFXA 4ELUA 4AXIA 2B5JA 4DQQA 2DH9A 3OJUA 5G0RA 5F8NA 2YKMA 4B9LA 3DOKB 4WYLA 4LQ9A 2FD2A 1UVIA 1R8CA 3D5MA 2GCFA 4K2XA 4A8SA 5KFDA 1RA6A 3FQLA 4DL5A 2GQCA 1NK6A 1RT5B 1OQ6A 2DNPA 4CO1A 2AWZA 4B17A 1VQ9S 1M5SA 5JXSA 3QZ8A 2B7CB 1ZYQA 4W92B 2Z0GA 4WU3A 4MMOA 2QMWA 3IA0A 1T3NA 2IVMA 3IO1A 1H38A 3BQ1A 4X4UA 2B9WA 4X64F 3RBDA 1R8HA 3M1VB 1V3ZA 5D4OA 3LP2A 3Q24A 2VONA 5C5JA 4C8LA 1CG2A 4QU7A 4A8MP 1RYRA 4YB1P 1DJ0A 3SCIE 2VC0A 4KR0B 4QR2A 4IO9Q 3M2RA 4OZ0A 2ROPA 2M8DB 3DM2B 3S6EA 3I0SA 1QUPA 1MROB 3CMAS 3AY0A 1WG1A 2CQ3A 1RISA 1HNZF 5EUHA 3DRYA 2EFQA 3W2WA 2XBPA 1KC8T 3CWJA 1RTIA 1V3RA 5DO2A 1WELA 1B0TA 1TV6A 2NYIA 1SJ1A 1KQFB 4A46A 4F2RA 3LAKA 1VFJA 1FVQA 1MROA 4OIXA 4IG0A 3U7JA 1N0UA 2MQNA 4ILLA 4DQSA 1XR6A 3DRRB 4FF3A 3HMJG 1R8BA 4TLRA 3CCJS 4O44A 1WF1A 1IBMF 5HI7A 2HGNA 2MXYA 4MTPA 3DLKA 4OHVA 4NYPA 2HNDB 4ECWA 3QIPA 2A3JA 3M8PB 5T41A 4X66F 2WONA 3MM5B 1NRKA 4YDDB 3HHKA 5D4NA 4CTAB 4ALZA 5G0RB 3IRXB 4PRFA 1S0NA 3H59A 2VFRA 4DDFA 2FJEB 5K8OA 1Q7YT 2OTLS 4TLQA 1WHYA 2M5YA 2G9OA 3CULA 3GZ7A 1JLCA 3F73A 3PDNA 1HD0A 4DR3F 1S49A 2HLUA 3GFZA 2XS5A 4DSIA 2E29A 3MR2A 2CPYA 4DV7F 1HBNB 3CB4A 1J2VA 1LV5A 2O01C 4WXWA 4HT7A 3K57A 4FF2A 4C8OA 5D78A 3U1NA 5HP1A 3K5PA 2R7WA 2A1BA 4DUYF 4NXNF 4NWBA 4QZVB 3PX6A 1VQSA 3C66A 2PD1A 3NNAA 4C4WA 1HBNA 2VG5A 5J1EB 3KLEB 3OLBA 4PG7A 2HVHA 3H2LA 4I7FB 4DQRA 3QAUA 2M4MA 4QU6A 5KFAA 4F4KA 2HHQA 1H0HB 4F67A 2J0WA 1SBRA 2V4JB 4KFBA 3T19A 4QWCA 4JI1F 3NAIA 4G1IA 1QTMA 2HNZA 1YVFA 1XEZA 3KG1A 2QSFA 3VWSA 1UFWA 4CO2A 3OV7A 1NK7A 2FJVA 4O3SA 3C46A 4X4PA 5K14B 2IYGA 4PG5A 3M8SA 4FBUA 3MR5A 1NO8A 3FSXA 3FMWA 1VK8A 3GFHA 3SQGB 2R8JA 1V9OA 1HHTP 1WEYA 4X4RA 5IT4A 1M5PC 1IN0A 3OLAA 1Y3KA <