3D0GE

Crystal structure of spike protein receptor-binding domain from the 2002-2003 sars coronavirus human strain complexed with human-civet chimeric receptor ace2
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
179
structure length
173
Chain Sequence
b'PFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Angiotensin-converting enzyme 2
publication title Structural analysis of major species barriers between humans and palm civets for severe acute respiratory syndrome coronavirus infections
pubmed doi rcsb
source organism Paguma larvata
molecule tags Hydrolase
total genus 31
structure length 173
sequence length 179
chains with identical sequence F
ec nomenclature
pdb deposition date 2008-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1840 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3d0gE01
4ZPWR 4ZPVR 4QZVB 4XAKA 2DD8S 3SCKE 3SCIE 5DO2A 4L3NA 4L72B 2GHWA 3D0IE 4KR0B 4ZS6A 3SCJE 3D0GE 4ZPTR 2AJFE 3BGFA 3SCLE 4KQZA 2GHVC 3D0HE
chains in the Genus database with same CATH superfamily
2IJNA 5LL6d 3CJ5A 1TK8A 2ABYA 2EEYA 2KKHA 1BQNB 4KRWA 4U7CA 4GKKF 2VC0A 3LPYA 3VVTA 4M5GA 1ZAWA 1X9SA 4USHA 3BPSP 1KHVA 5L1JA 2FYXA 2EI5A 2BKOA 1NEEA 1FERA 1ZOTA 2HBYB 5DG9A 3HFVA 1F3VA 3P5TL 1LXJA 1TK0A 3IM8A 4B9UA 3A3OB 1SL1A 3QRRA 1JWWA 1YJNS 1U0HB 1FWLA 1AROP 5DDPC 4R25A 3MEGA 3KXDA 2VFTA 3VF0B 1WSVA 3BGRA 2XGQA 4DV1J 3AD9C 1UWBA 4ICLB 2Y8WA 3N9UC 3TAMB 5IWAJ 4DX7A 1RYSA 3QJPA 2DHHA 4QWCA 3P5BP 3D1QA 2RE1A 1PAUB 3PEJA 2GA7A 4ID5A 4AL5A 3HSJA 2CFXA 2D9PA 3PRVA 4JBCA 3RZAA 1O0PA 2LA4A 5L39A 4K4YA 2OFGX 2MHEA 3G9CA 1U6ZA 1ACMB 5ETTA 1GMWD 1ZM3A 2ZJPQ 2IBKA 1YJVA 3E51A 4LVOP 3VZIA 1N5SA 3K57A 1X0PA 3PKMA 4TY9A 1FK9A 4ATNA 3IG1A 5A76A 3X3UA 4UY8T 5HJYA 4YS2A 1ZETA 4FYXB 4GRSA 4EO8A 2NXNA 1NJXA 3I0SA 1J27A 1RAHB 1Q5YA 5LJ3Y 4DSKA 3QBCA 3Q83A 4WFBQ 2AW0A 5AE1A 3VGVA 4I56A 2ZBIA 4MMOA 3KK3B 3ETOA 5ETVA 3LANA 1R8BA 5KFLA 2VJUA 5G0RA 1S77D 3H25A 2C3YA 3UD5A 2ROEA 4YY3F 3K7RA 3TOQA 1V5IB 2GAHC 3WX4A 2UXCF 3S1TA 3M8WA 5HMZA 4JI5F 4IRKA 2IY5B 5KFPA 1B70B 2KFZA 4WK3A 3ZZOA 5HROA 1LFPA 5F9NA 2WCXA 3MMBB 3BKFA 4LRDA 2VHGA 1TL3B 1SJ4P 4NCBA 1FFSB 1MWYA 2IVYA 2OI2A 2DGWA 3V6DA 5IS2A 4J9LA 2RMLA 3QGGA 1YHQS 2HHHF 1QTMA 1IM4A 1TL7B 4K4WA 2E9RX 5CAAA 3BGFA 3LP0A 3SIPB 5HP1A 5GMKa 4URGA 3CCES 4QIGA 1B0VA 2WOMB 3CCMS 4UOHA 1HNIA 1JJHA 5L1KA 1WC0A 2CQDA 1GT8A 3DGPB 4DZDA 4H54A 1R6YA 4MIAA 3IO1A 4MKYA 3Q0AA 2ILZA 4Y2MA 3EGWB 2ZH9A 4ECVA 4OI6A 2HQIA 4ZHRB 2YVSA 2UVVA 3R7NB 2J9DE 1RBOB 4LF2A 1XR7A 4PQAA 1FNOA 3VTIA 3MR2A 3D6TB 1RWVB 2J9EA 5GMEA 2GIRA 2VA3A 1UA1A 1GTHA 3RB6A 4LF9J 3KLGB 1EP4A 3T1AA 3GR1A 4UTGA 1WG5A 3N01A 2VFVA 4I7FB 4HT7A 4DG1B 1D3WA 4FXDA 3MR5A 2JVOA 2HRTA 1JXLA 2IBOA 1WEZA 4ZVTB 3A3PB 2JLGA 5KFEA 1OS5A 2ADCA 1ZZNA 2R3VA 2BRKA 2JNJA 2W4CA 3LTOA 3MTJA 1N34F 2XSJB 1Y11A 2HWHA 1FNXH 2AV5A 2RH3A 3M8RA 1LW0A 5FIIA 4BHQA 1S9EB 1QUPA 3B4MA 1QY7A 3UN2A 4GKJJ 2HQCA 4B17A 1VC6A 1F5AA 5DM7Q 3E3XA 4RZRA 3NGDA 2P9GA 2HMIB 1O5JA 4C8LA 3KHLA 3UWTA 4OZNA 1PGZA 1S7IA 2QE5A 1OO0B 3JB9k 1QLNA 1EX8A 1PSDA 2A0FB 3HX9A 3KK2B 2KM8C 4UZCA 3IGNA 2EFQA 4ZPAA 3MMCA 1FRMA 2QL7B 4LJMA 4OV1A 3KYLA 4UQGA 3MPDA 4FN5A 3ZC4A 2EC0A 3L95X 4AT1B 5ETQA 2V2ZA 4PXCA 3M4XA 4XIUA 2XO6A 1YZ6A 2RS2A 2ZC3A 4C6AA 3O3LA 4OYWA 2E7XA 2R42A 5D3GB 4NA1A 2W2OP 1AZSA 1NKCA 1C4CA 1V3ZA 4J9VA 4B9SA 1RT6B 5J2PB 2A2DA 2CXEA 1YK9A 2ZBPA 4MIBA 2ZH3A 1NPKA 1CJUA 3T5KA 2RSQA 3M2UB 2BV3A 4DUYJ 1IBLF 1RI7A 2Y1IA 5IV3A 2HHTA 2G2YA 1R7IA 4BDPA 1P1TA 1SKUB 3AFGA 2D1CA 1EQMA 4ED4A 1KP6A 2RRBA 1PJ6A 2E5GA 3LQVA 3BEGB 3EGNA 4QWBA 3NMRA 3QZ7A 2GW8A 1H38A 3GONA 1B4SA 4LR8A 2YKNB 3EXCX 1HBMB 1S6OA 2ROGA 4RWXA 1G6BA 1L3SA 3GJQB 4B3TF 1KSPA 5DDRC 2Z56B 2N7YA 3QAUA 3ZO7A 1MU2B 1VRTB 2HFOA 4LIRA 4FBUA 2BE2B 1VQ8S 2J5AA 4KGXB 1DRZA 3M05A 4NA2A 2GVDA 1HQEA 1NDPA 1CG2A 5KFVA 4EI2A 1H2TZ 2DNKA 2W1BA 3UVJA 3IMQJ 2C3PA 2IYIA 1HQUB 4OI4A 1RWOB 4A47A 2MGZB 2XGPA 1M5PC 3BV8A 2RF2B 2KYZA 4F0MA 1X9MA 3J7A1 1N88A 1FKOA 2VFUA 4DXLA 2R7VA 4CT9A 2IRYA 4OIXA 3ZZ0A 3EZOA 5J1PA 1ROFA 1U6BA 2VBYA 3GFHA 3T1HF 3KWMA 3BO2A 1SKRA 2HWIA 4NLGA 3AT1B 1KOOA 3SV4A 3IGVA 1QSYA 3ILLA 1GXTA 2OSRA 2LU2A 5KT5A 1ZAVA 1HW9A 4F7VA 3PG9A 1NU4A 2KHCA 2V2VA 3P96A 2ILYA 1YRXA 3GV8B 2DKOB 1GAOA 2DRDA 1JLEA 3FZ2A 1HA1A 4X4VA 5HMWA 3GFYA 5K8MA 5ETOA 1ITPA 1H0HB 3DLBA 3QRPA 1FJGF 1YBAA 5KG4A 4IFVB 4B3MF 4OX9J 3C14A 1S0VA 1JLBA 3D68A 5U47A 1RTDB 1B99A 2BJ1A 3NBPA 5J2NA 3C16A 3UNGC 3W7BA 4P2SA 4QWDA 2NUHA 3MHYA 2ZKTA 1NK7A 4WU2A 3MD3A 1WEXA 1UVJA 3N4WA 2BYCA 3EPIA 4CO2A 3NEKA 2CQBA 4FXVA 4JYAJ 4LSNB 1FA0A 4TU9A 1I5OB 2W9CB 3JSMB 2QYGA 1U47A 3LAKA 2C2ZB 2VKZG 5D0RA 3OQ2A 4KE5A 4JI6F 2JC0A 2XMJA 4P10A 1RU1A 1VK8A 3GG0A 1R8PA 3EVOA 4ZITA 3BYPA 1IXKA 3E01A 3BO4A 2GJIA 4K7QA 4PYAA 5LSLA 2NCKL 4KFBA 5CD4H 2JC1A 1T03A 2YNHA 4DSIA 3CCLS 1KRPA 4E98A 2XC9A 2BBEA 3TVKA 2RAQA 1VQ5S 4KAIA 1LNQA 2PT0A 2GJFA 5C42A 2LECA 3EGZA 1S0OA 2F4VJ 2HPUA 1TVRB 2RIJA 1YVFA 3CD0A 3C6UA 4PCQA 2Y8YA 2CJKA 1NZ8A 4X62F 2XMMA 1W26A 2FVCA 5D8HB 2J6UA 2COLA 3WC2A 3DOLA 3GB0A 1JXVA 2YNIA 1RZMA 3RB0A 2HNYA 1IBMF 2A10A 1VQ6S 2FJXA 4BC7A 3W60A 1TK5A 4PAAA 3W3SA 1J5EJ 1SUQA 4HDHA 4JP8A 2GX8A 3MDFA 4DX5A 3D5MA 1SIWB 5F3TA 4IG3B 3GFXA 3SSQA 3MM8A 1YJ9S 2UUCJ 5HMYA 1NJIT 2H5EA 1ZPVA 3N5FA 1KTQA 2B4PA 4NOHA 3R7BB 1Q5VA 4F50A 3F56A 3RR8A 3QJJA 4ZPWR 4FF4A 4J9NA 3Q8SB 2V6AA 1PBAA 1X4BA 3Q2SC 4O0NA 3KLHA 1U0HA 1UFKA 4M5MA 4JI2J 2DGTA 3NAHA 1SPBP 4B02A 3RU0A 1VQYA 2GCFA 4LF1A 3NMAA 1MG7A 2BW7A 3PXGa 3ZTRA 3QYYA 1Z4UA 2R7QA 2QIFA 5B0GA 3OD2A 2XI2A 2OH2A 2AEJA 3AOAA 5G4DA 2CQ2A 1PCAA 4QIVA 3GJRB 1K1SA 1TFWA 3MD1A 2V9WA 1O6XA 3AXKA 2AYBA 1JLCB 3RRHA 1NJZA 4MKAA 3MEEA 4AQYJ 4DV2F 3DKDA 4W90B 2AHOB 3C8YA 3LAMA 4Q5VA 1HR0F 4ELTA 4CZCA 1HARA 3U02A 1FESA 2E7WA 2V2KA 1K47A 4CYUB 4Y0FA 1N6QA 4XPCA 2NYHA 4Y2CA 1MW7A 3DDNA 1IJEB 1WF1A 2MKIA 4I0WA 2RQCA 1SI9A 3TI0A 1X4FA 1Q82T 4DL0C 2ALZA 4YQWA 3J81U 2R7OA 3D1HA 2CQ0A 4JI4F 3H42A 4F26A 1PO6A 4I6YA 2XY6A 2KL8A 4RBVA 3OUYB 3DXBA 2C3OA 5DQIA 1Y9OA 2JEFA 3CMQA 1YIJS 4DL6A 1IKWA 2N3LA 1RT3B 3KK3A 3ZTPA 7FDRA 2DH8A 3MM6B 2Z2ZA 5IM0B 3OHAA 4C8KA 4K50A 2U2FA 2B43A 4QIWD 2OPSA 1FJEB 1Q8IA 4ZLLA 2NSCA 5LOQA 4CLYA 3HCXA 4DV3J 3NWRA 2CWXA 2AZ1A 2FGOA 2AX1A 4LBPA 2ZC4A 1RP5A 4NI2B 4ZP6A 3K59A 5HBMB 4DL3A 1U49A 2HK2A 2K06A 3I82A 1D8ZA 1VFJA 4OJ3A 3GILA 2JLFA 3TVZA 4ZVGA 3SXLA 1D0EA 5F0UA 3PX0A 3PDNA 2MJUA 4M5HA 2QLBB 4P6QA 4DV5F 2UU9F 3CO0P 2FIUA 4OJ1A 2K1RB 1UTAA 3QO9B 1REVA 1KTVA 2KVQE 4OHXA 4BCAA 3H90A 1S49A 3B82A 1SB6A 3FBEA 2VG7B 4CH0S 3I55S 4LFAF 3CT9A 3K5LA 3AD8C 2NQPA 3FUYA 3F73A 5L38A 3RR7A 3UDLA 3U1NA 4Q8FA 4EZ6A 1SQFA 4ZHRA 4RBTA 4YR0A 2XSFA 4PUOB 1GX6A 4USJC 2CQIA 1P1LA 2W9BA 2FC8A 4CRJA 3QFWA 1P6TA 1T02A 4CNZA 4A8FA 4L3NA 4KGZB 1M1HA 1U45A 1KFDA 2DNYA 3DDIA 4ECYA 2VJVA 1NK9A 1QSSA 3KLGA 4ZN3A 1YRUA 4ECRA 1AW0A 3M8ZA 3PHTA 2M5YA 1HNWF 2PFFB 4LBIA 1AUDA 4DFKA 3O5TB 4KYZA 1VIXA 2HWTA 3NGRA 1B7FA 3HLUA 2C2NA 3J7Z5 4A4JA 3ILIA 3W2VA 2P6TA 3CJRA 1RT1B 1E6YB 3KOAA 4G65A 3SSRA 3MUMP 4F3OA 3D54A 2HNZB 2ASDA 1K0VA 2CZ4A 3BH7B 2XSJA 1NCLA 2XLIA 3J80U 4IR9A 1JLQB 3KUEA 1C2PA 3CEDA 5HQLA 1S9EA 4WXOA 5CHCB 4C0HA 3CDEA 5HN0A 2OD6A 4B9VA 4PG8A 4URQU 5L8RC 3PW7A 2BR0A 3QPIA 1ICEB 2HMIA 3J7AN 1HHSA 3PNIA 1WOSA 1Q81T 3JSBA 1DARA 1TFYA 4F4AA 5KFBA 1FEEA 2Z57B 2MLYA 2HBZB 1NB2A 1UVKA 4ZVUB 3KK2A 4OI2A 1WELA 2EFOA 3QMQA 4P74A 1XBWA 1FJCA 1W2BR 1SC4B 5KT4A 4DWIA 3MMJA 4ETZA 4WJBA 1NAQA 1NH7A 3U1LA 3HT3A 3OVBA 4OYZA 2ZUGA 1S10A 1S6QB 2GJ2A 5RUBA 2KRBA 1BLUA 4K0KJ 1OPZA 1G7CB 3E2EA 2CZVC 4DV4J 4IQMA 2YWHA 5J2PA 2LU1A 3G8QA 1XEZA 3MM5B 3PX6A 2HHPA 1N54B 4ES1A 2DVIA 2D3UA 4JI8F 3IRWP 3M2UA 3DHWC 2FHJA 4QPXA 3K5NA 3DMJB 4HT5A 2YNGB 3TJ8A 1HNXJ 1WHVA 2HYIB 2KZMA 1XNQF 1C0UB 3TVYA 1UVLA 4ZVQB 2RNEA 3M2VB 4B3OA 1U1OA 4F2SA 2DIVA 1JLGB 3T5HA 3R5CA 3TEGA 3ZZRA 5CD4A 4X64F 2J9CA 2Z30B 1UPPA 2DO4A 2X7IA 5KFZA 5LMUF 2DNMA 2UXBJ 1VJWA 1NLKL 1CPZA 1T0TV 3MM7A 2GAGC 4NLWA 2ZE2A 2JEJA 3I6PA 2BE2A 3TAQA 2W24A 3SFGA 2LXUA 1URRA 4JV1A 4U67Q 2F8HA 2B9EA 3VAHA 3ENAA 5B0AA 3DU6A 4O4RA 2C2EA 1HQUA 2F65A 2M9KA 2NR0A 3IA0A 2WZ1A 3ET6B 3OJSA 3H4BA 4LSLB 5HK4A 9ATCB 4RU9A 4IG0B 1R8AA 4MAKA 1N5TA 5I3UB 4AD6A 4KHMA 4ECUA 3PACA 3K5MA 2DNOA 5C24B 4UQTA 1WHXA 2I0XA 2V9KA 2XLKA 2C3MA 5DRKA 2XZWA 4WFZA 1L3UA 3R1LA 1ZM9A 4C11A 2QL9B 4YN3B 4PWUA 3K8VA 1R0AA 1B7YB 4FYVB 3OJUA 2ZHAA 1RT5B 3CD7A 5HVGA 4V19X 2ZZMA 3LP1A 4PQUA 3FVYA 2BVZA 4DSJA 1F5CA 5D4NA 1YX2A 2NXJA 4JV5J 3W9HA 1S4FA 2N4CA 3D4JA 4G1QB 3CDWA 2W25A 4O44B 2YPYA 1RTHB 1ZYQA 4HI1A 5GAGU 3OTEA 1GMWA 3JAMY 1Y00A 1RTDA 4UW2A 4DHVA 2VOPA 1RK8A 4NLUA 4Z2XA 1RGVA 4M5NA 1N5VA 2AYEA 4ZPTR 3I4PA 1MNEA 5I3PA 2CYYA 4F4KA 3H5XA 4LSNA 1SCJB 3M9MB 3JSMA 4YB1P 2B6AA 4OYPA 1SC1B 1I94F 2WSCC 3A13A 4Q45A 1SV5B 3Q8YA 1S79A 3LF0A 4LF7J 3CJ3A 3D6MB 5DLFA 1VC0A 1HBUA 2J76E 2C42A 3M8SA 3M1VB 1CULA 4TU8A 3T6JA 2XWYA 2FLOA 2B56A 4G3IA 3CCSS 1H2VZ 2Z4PA 1KQFB 3UCGA 2IFXA 2W2QP 3BPDA 2BMBA 2CG4A 2MQ8A 3M2RB 1W25A 1EARA 4DQSA 3PW2A 4U8VA 2WHOA 2XMKA 3AOBA 1DTTB 1S7HA 2ZH4A 2BJEA 3HVWA 3KJQB 4DN9A 5B0BA 4FS1A 4D3HA 1MMDA 2RT3A 3O2IA 3WIUA 1FDAA 1B64A 4K4TA 5F8HA 3DLLQ 1IM6A 3T3FA 1Q0NA 1YBTA 1KWMA 4CLPA 4WYLA 3M30A 4J9RA 3ZZTA 1YQHA 2CRLA 3AJ1A 1UW9A 4JI3J 2WB4A 3BSOA 4XO0A 4ZVFA 4KH0B 2QN6B 4CO0A 5CABA 4P7VA 4IG3A 3OL6A 5J1EB 4OQJA 5A8WB 2DD8S 3CNQP 2YWGA 3BJYA 2NUUG 4IKAA 2XTJP 4TU7A 1FNMA 3R1HA 4R5PB 3KG4A 4EU0A 1P27B 3DOMA 4JV0A 3QSYB 2EK1A 2DY1A 3CUNA 3I96A 1S12A 1U2CA 1NSKL 2QLWA 3PKYA 3Q24A 1VDHA 3OSNA 3RBZA 1AUSL 2BW2A 2YKMB 1WKLA 1XTZA 2RDJA 3POTA 4PABA 2OP5A 5LXRA 1KLNA 1RUSA 4BBYA 3FQLA 3IWLA 2MLZA 3NOGA 2XMUA 4H4MB 4CO3A 3D6HB 2YWWA 3OPKA 3TR5A 4ZVRB 2OO4A 3R27A 5MLCV 4BWMA 3R3TA 1RAAB 3QGPA 1NHVA 1X8DA 5CCMA 2M70A 3MAAA 4ED8A 5GAHU 2ASYA 3RJMB 2JDJA 4JV2A 4KGMA 5D78A 3VGUA 3M8QB 3QFHA 1HL6A 1HYSA 3DLGB 4DV6F 3U7JA 2PD1A 3VALA 4RX6A 4MKBA 3CE8A 1S57A 1TL5A 2EKYA 4RUHA 1YJ7A 1E6VB 2D3OR 1JKHB 1D9FA 3NCQA 3MURP 4J5OA 4CYUA 5A0YB 4E0DA 2V63A 4TYBA 1FI4A 5IZHA 3R9LA 2WVCA 1SBRA 2DXEA 1CJTB 2DNGA 4LF8J 3DRYA 4ZKAA 1HI1A 2VIHA 3R6LB 2UVWA 3OUYA 2RUSA 5E3AA 3Q8RB 3MR3A 3HSDA 1OQ6A 2UUBJ 1RT3A 2DIUA 4ECWA 1ELOA 1BMQB 2JL9A 3H5SA 2JHEA 2CG8A 4PXEA 2PSZA 4NL5A 1QVFR 3C6TB 3PFEA 3GPAA 3CC7S 2DEJA 4DR6J 4QYZK 4WZQA 1TKXB 1NSAA 3T1YJ 1WJ9A 4B3SJ 5CQGA 4OV6A 3U1MA 1XK8A 2EK6A 3FJ2A 8RUCA 1UVIA 1TKTB 2QG9B 2FY1A 5E3CA 4L72B 4WE1B 2HFUA 5HBMA 1W2IA 4M5JA 3MPWA 4DI6A 3GIMA 1OY8A 1TL1A 1KEKA 2V8HA 2RHQB 4URSA 4NZ0A 2YQ3A 3PJXA 4KJIA 3BQ1A 4K2JA 1QE1B 2HS3A 5D6GA 1WSRA 2YPZA 2N82B 2R2RA 4YFUA 2K1RA 2E1AA 1RTIB 2DR9A 4P71A 1UPMB 3PJWA 4ZA1A 5I42B 3SV3A 4BWJA 2VG7A 5HL7Q 2LA6A 3OVAA 1OYDA 4EMDA 4RW4B 3W1YC 4DLGA 4DV1F 2LXFA 1LK7A 5F0WA 4F2RA 3GWCA 4ECTA 2HAFA 4OX6A 2ZZNA 1ZZFA 2CDQA 4PUOA 5IWAF 3FRYA 3OHBA 2LDYA 1WACA 4PG6A 2VDHA 1LOUA 4CQ1A 4OYIA 2APOA 3A3NB 1WNEA 1NKBA 5A2QU 3RUBL 3OTBA 2KYXA 1VRQC 2O1PA 1SJQA 3IS9A 5F8LA 5J2MB 2VG5B 3DGVA 4DR1J 2WBRA 3TA1A 4DUTA 1B0TA 1DBDA 2FPHX 4RW6B 2IIHA 4RR5A 2IDEA 3CGIA 4DQIA 3V2UC 1RAGB 2GZOA 3EUNA 1E6YA 4RKUC 5EHHA 2HNZA 2MDAA 2OMOA 2JJ4D 3R5GA 1RWMB 2MXYA 2ZITA 1JLFA 7AT1B 2EBEA 2F5GA 4QJVA 1JLQA 2AJ0A 2NPIA 1UETA 4KHPJ 1RWWB 1J2VA 3GP9A 8ATCB 3BR9A 1RTJB 1JIHA 3FEYB 3UO0A 1T9XA 2WVEA 2BKPA 4RO0A 1NHUA 5IT9U 1VLYA 1M1GA 4M8LA 4PEOA 2VQFJ 3NGUA 3DRRB 3CJ0A 1Q1KA 4X4SA 4Y2IA 2FLLA 2KXFA 1NK6A 2BJDA 4LRAA 2SXLA 3C19A 2DYAA 3H7HB 1J5OB 2QSWA 4ELVA 2IJFA 1VISA 4KKOA 4ANDA 4MYTA 3SSSA 3DYAA 4BLGA 2Y9HA 4Y28C 3DI6B 3KUHA 2RS8A 4J7CA 1SH3A 2XMAA 3RRGA 1Q95G 1SJFA 2B5JA 1K0TA 5L9XA 4NLQA 4N8OA 1JJ4A 1F0XA 1S97A 2VPWB 2ZH2A 3M8YA 4DS5A 1WD6A 1UVNA 1FX4A 3A8EA 2YNGA 3MFIA 1C0UA 2BJ3A 3DLKB 2ZM6J 1LFWA 1S9GB 3M2VA 3HFKA 2KFYA 1KN6A 2YKAA 3TANA 1JLGA 1YI2S 1T11A 1OQ3A 3V4IA 4EYIB 2D41A 1SL0A 5THWA 1LXNA 2E7VA 2NYIA 1X4DA 3OLBA 5HAOA 1X5OA 2VPZB 1WC3A 4C8OA 2VPYB 3R5JB 1V6HA 5GAGI 4CM2A 1UZDA 2QMXA 3MECB 1Q16B 3W65A 4A8WA 3Q8UA 4LF9F 2XY7A 3OFGA 2IA6A 3NS6A 4NYPA 2UXDJ 4U9RA 1FXDA 2I6WA 1AT1B 2R8IA 3WX8A 4IO1A 3ET6A 3NKYA 1I3OB 2J9DA 4C8MA 3G96A 1TV6A 1KHWA 3MPYA 4WKRA 1VLOA 2ZH6A 4FBTA 1NK4A 2ZZTA 4MJKA 1RWUA 1UZHA 4S0MA 2YH0A 1UMJA 1OYEA 4O3RA 1YTYA 3TJAA 2U1AA 3VHQA 2XHWA 2ZFHA 4GKJF 3NGSA 4NXMJ 2DHXA 3O6QA 4OJGA 5KFWA 2L9WA 1QM9A 2LQ8A 3CCQS 1EETA 4U96A 3QSIA 1VQ7S 3NY0A 3CF5Q 1PKUA 2R7SA 4FNHA 1G2EA 3PVXA 4Q2LA 3NCPA 4L75A 3UQSA 3MCMA 4YR2A 4LF6J 1W7WA 2RDIA 3BBCA 3RW7A 1FRXA 1HKAA 4G1QA 4JI1J 1TQLA 1RTHA 2BRLA 3NL0A 3CJSA 2DR8A 2OEMA 2YKOA 1X5TA 1FD2A 2AJ2A 4KHRA 2HFZA 4ZN1A 1RKJA 1U1NA 3M9NB 1IWAA 2L48A 3A8JA 1RHJB 1TKZA 2C2KB 2V67A 2H4WB 4CCHA 1LWEB 2BJ8A 2QZ8A 3FSIA 3US5A 4EK2A 4KQZA 3OTCA 2F9DA 3ITHB 4L73A 3D0HE 2DB1A 5JVHQ 4RW9B 2WVBA 4DUYF 2IDLA 3PYFA 2V8GA 2OHDA 2XYGB 3BN7A 2CPYA 1HNVB 4CLFA 2QMWA 2JWNA 3AY0A 4DL7A 3DFEA 4C3LA 3HDSA 2R2TA 2HURA 3MOZA 5CYMB 2GVZB 1S1WA 3VZHA 1HW8A 1TELA 4Z7CA 5KFOA 3G82B 2R2UA 1RAEB 2BDPA 3PIOQ 2CQ4A 4LREA 3K5PA 8AT1B 1GTEA 1UCNA 3KHHA 4O3QA 1DTQA 2MSSA 3M2RA 2N7CA 5HLFB 3LOUA 3L09A 2H5IB 3UE2A 3D7SB 4KO0A 3FMBA 2HS0A 4WP3A 3HF5A 2L9NA 2IRXA 5DG7A 3Q23A 4N5SA 2AWZA 3OXFA 2CQCA 4F36A 4F67A 5KFKA 2UV8G 5F3ZA 5IQQA 2FZKB 1YRTA 4RUCA 4F4ZA 2WONB 5GAHI 3QWPA 2V5HG 3R7SB 3TZZA 3D2WA 3FCHA 3SQGB 5H9EJ 1YWXA 2OSQA 1LKZA 1F9EB 1A6LA 2CQGA 4FYWB 1F3FA 2IHR1 1T9UA 2J6SA 4PPDA 4QWEA 1WC5A 5H9FJ 1RADB 5EX3A 3THVA 3OBIA 4NMXA 5DETA 1OIAA 1WDTA 4X4RA 2R7TA 3MMAA 4ZVOB 3KK1A 5HQ8A 4ED1A 1FHTA 5J1EA 5KTQA 5A8WA 1RWPB 2MYFA 3UR0A 4FNIA 2H65B 4MTPA 2E9TA 3G8TA 1NSQA 2BANB 1IBCB 4MKVA 5AJ3J 4ZP9A 2IM2A 2RKIB 2VASA 3CMAS 2QA1A 4HACA 3HP6A 3PX4A 3UNYA 2WSEC 2VU5A 1CS4B 3MEKA 2XS2A 2GIQA 1RBAA 2IRUA 3PO4A 2R7XA 2IM0A 1N0VC 4OX9F 3M8PA 2YKMA 2LCWA 3FMWA 2OTJS 3HJVA 1L3VA 4RNOA 4DL5A 3CJ4A 4NCGB 4H4MA 1RHKB 3H40A 2A3JA 3N6NA 2D3O1 2V69A 1RABB 2ALYB 1HWJA 2DTJA 4ED3A 3RAMA 4JYAF 1U1RA 1HD0A 2PFDA 4WTOB 4LRCA 2L41A 2AEFA 1FD8A 3RW6A 4TY8B 5IFMA 2M8DB 2EC2A 4L6V3 1IN0A 2ZHBA 1VRUB 2EPIA 2OLWA 2E5LJ 3VCDA 4NE9C 1WDDA 2QT7A 2VH7A 4ILMA 2QLFB 2DGXA 2KN4A 4WCEQ 2YBVA 3L3CA 4GC7A 3EWGA 3MZIA 3DRSB 4LR9A 2JH3A 4GVBA 1S1UB 3CJKA 1T05B 3J81Y 5F41A 2AYMA 5A0YA 4ECQA 1S76D 1GNKA 1N36J 1CJTA 1BHNA 2F40A 1A0OB 4E2FB 3NGKA 1GK8A 2HVIA 4Y2AA 3G6YA 2E5HA 4YEAA 1BWEA 2F4VF 3KJVB 4KT0C 1CQMA 1N48A 4CH1A 1AA1B 3G87A 2KFNA 4RBUA 1Z2LA 1P9QC 2VBZA 3MCSA 3SEOA 3HHLB 4FZVA 4LUBA 3S01A 3C6TA 2K7KA 4E8UA 1CJVB 2P6SA 1XN9A 2EWHA 4FS2A 4RW8B 2B8PA 3GYXB 5E3QA 2Z8QA 3EVMA 3R97A 5ITHA 2RQ4A 4R0EA 6AT1B 1YDLA 1RT2A 1FRLA 4WE1A 1J5EF 2CJAA 4NRUA 2MKHA 2JFKA 3KFWX 2X1FA 4EUVA 2AGQA 4KPYA 1Q8KA 1LV5A 2E44A 4KV8B 2R8HA 5C25B 2RILA 3PYDA 2UUCF 1TMJA 4O0IA 1CBKA 3L7OA 1B3TA 1QE1A 2RVJA 3VAGA 4ZMMA 1DLOB 3HULA 2HKEA 1S59A 3KDNA 1T9VA 1FXLA 1RTIA 4ZVHA 1U8WA 4DR7J 2HHXA 2MKSA 1FRIA 3IWXA 2XY5A 3H0PA 5DDOC 4JI2F 2DPIA 2RD5C 4OLOA 1S1VA 3SZ2A 4L3KA 5K14B 3H5UA 2N3OA 1HPZA 2V68A 1KD1T 4ENOA 2HIYA 3JQKA 3TYTA 1WC6A 1NDKA 1IKYB 3I0RB 3A1YG 4IR1A 5KFAA 3WC0A 1RWKB 4XDDA 4A8OA 4P52A 1RBLA 5KFHA 2VG5A 2AU0A 3HHEA 5E7OB 4AQYF 3BGRB 1U6FA 3I5BA 4TNOA 3DHXA 4EBDA 1OPIA 2QLXA 3RB4A 3HD2A 3HK2A 2GMHA 2FD2A 3Q22A 1LWCA 3VV2B 2OMLA 1WI6A 3ICLA 3PY8A 4ANCA 2XYPB 1IR2A 1S48A 2WW8A 3IR7B 2ZKUA 1RAJA 3MXHP 2PEHA 1N5QA 3V6JA 3VAMA 4C2MA 2A6OA 5FLXU 1S0MA 4JI7J 5EWFA 1FKPB 1WKKA 2FJVA 2OJ3A 1RTJA 3D66A 3LUYA 3QWUA 1LW2A 3G71S 2OPRB 3ETMA 5HQMA 2CIMA 4HI2A 1S6PA 3DRRA 4DV7J 2KHDA 2G0IA 2E5IA 4LF4J 3PZPA 4LF5J 4CLSA 2RQKA 3CB4A 1FK9B 1FVSA 1Y10A 4RJVA 4X4TA 4ED7A 1N33J 4RWWA 4DCJB 4Q8EA 4NA3A 3NXZA 1SH0A 3I0SB 5ETMA 4W92B 1Y7PA 3P49B 4YHHJ 4DV3F 2RUGA 1J5OA 4P2FA 3BBFA 3MEDA 3FQKA 4ILRA 2OEKA 4HR2A 4ZCIA 1SJ1A 1NKEA 4FXWA 3D3CJ 2VD3A 5KFRA 3DI6A 4O23A 4KGVB 4CLZA 3CIMA 1JK9B 1SQGA 3VAJA 3W64A 2X51A 4PRFA 2W2MP 1U48A 2DNLA 3BDEA 1UP1A 2VFRA 2EBGA 2QFIA 1SL2A 4RW7A 4C48A 2Q66A 1KBRA 2VOOA 2V4QA 4WFAQ 5I4MA 4PWWA 5KFUA 3SCIE 2CJBA 3CIZA 2DJWA 4CTAB 4Y65A 1F6TA 1X60A 2IAJA 3DLKA 5BR8J 1SKWA 3JS9A 3I4HX 2BE7D 1HI0P 2EFGA 2YTCA 3O8WA 4G1PA 3LP0B 4CDIA 5DQGA 1IVZA 3QNWB 4QR1A 4ELUA 2CQHA 1IKXB 4RLEA 3EXYA 4ED6A 2VG6B 2UVUA 3L4BC 3K5OA 5BJRA 1C0TA 5KT2A 4MK8A 3CD6S 2LEAA 3BKUA 3OFHA 4XPEA 3FEZA 4USIA 1KNZA 4DFMA 3MECA 2AP6A 4DR5J 3IWNC 2BJ7A 4DR4J 4OYAA 3TJ9A 3P3DA 3PJ9A 3OXGA 3GJSB 4FP9A 5LJ5Y 1SJ3P 4DOZA 3MOJB 4WYWA 2X3DA 4PG4A 1U7LA 1BWVA 3CTRA 2DCLA 4V19J 2V4JB 1U02A 2Y1RI 4N47A 2DH9A 1JQGA 2VBWA 3ILJA 4F0HA 4V1Ak 3KJFB 3IR5B 3SI8A 5M2UA 2QSFA 1UJ5A 1C1CB 2HIQA 3QIDA 1KLMA 1EP4B 2JOQA 3JQMA 1MN7A 2F7VA 5DZ6A 4PWDA 3R8YA 1R89A 3KMQA 2NPFA 4OZLA 4DUZJ 5KT6A 2AKWB 4ZCKA 4JI0J 2EFPA 1H72C 1VQNS 1X31C 3BH6B 2R7UA 2DXDA 3HM9A 4Q2MA 4ZPVR 3K58A 2KT3A 1LW0B 2WW4A 4YB6A 1T8EA 4OYBA 3IFEA 2MKYA 4I2QA 3V81B 2CPIA 2Y1LB 2LEPA 2FB0A 3EPGA 4F04B 2QL5B 5ETPA 3PM9A 1X7VA 3DRPB 4K0KF 3ILOA 4B9MA 1FJ7A 3FBBA 1LWEA 4DV4F 4KY3A 3IAM9 4GO5X 2HVHA 1VCTA 2ZVSA 3ISZA 1D8YA 3K8WA 2OEJA 3J81j 2DT9A 1VGYA 3HHNB 1XMBA 5F8IA 5KFSA 5EN1A 1RHRB 1HNXF 4ANEA 4USUA 4OFZA 3JTOA 4G1IA 4UOGA 4ALZA 4N41A 3IC1A 3MF5A 1AZSB 4BC9A 4M63A 2EVZA 1S1XB 1PG5B 4K5SA 2W2PP 2D69A 3G82A 4DU8A 1OJ4A 2LXIA 2V34A 4WK1A 2UXBF 3ZTOA 3TUJC 3GTYX 2B4UA 3GU0A 5HLFA 3OXLA 5L46A 4DU7A 1HBOB 2XCPA 5D4LA 2C2DA 1VBKA 1U24A 3GV7B 3MM9A 5LMNJ 2EG2A 1K73T 4NLSA 2LKZA 1BQMB 2AJ4A 4NXNJ 2PN6A 3UPFA 1FF2A 3CC2S 5L9NA 5GVQA 2HHWA 3KNAA 3O44A 4K4XA 1K44A 3Q8PB 1Y3JA 1NUEA 2CPJA 3DLJA 2XS5A 2QJ3A 2FTRA 1YJWS 1RKIA 3WHIA 5BYRA 3IP0A 1U0SA 1RHQB 4U8YA 4K4ZA 3PRBA 4J90A 1H98A 1X4EA 4DEZA 1ZBTA 5CA5A 4DPOA 1CJKB 4NZ7A 1R27B 2GHVC 2CJYB 2WSFC 4Z7YA 1RA7A 2KO1A 1OMSA 3I87A 4AL7A 3M6UA 1BY9A 2RKIA 1YJTA 3JTPA 1ULRA 4HKQA 4X4NA 3J7ZT 1JNRB 1D9DA 4X65J 4N56A 4RPFA 1PYTA 2XG8A 4CH7A 4JV5F 3H2VE 2X1BA 1H6KX 1WORA 3JXOA 4J9KA 2DK2A 4P73A 4WFNQ 3HO1A 1S1TB 3NGTA 2KI2A 3RAQA 1MWZA 2C2OB 5JXSA 1XMQJ 3QT5A 2GHPA 4NCGA 2J8SA 3BSAA 4K5RA 1REGX 1T95A 1U2FA 4RNNA 3B4DA 2ZH7A 2OUGA 2PC6A 1CLFA 2OGUA 2GIFA 1V3SA 4TQSA 1JLEB 2FJEB 4I2PB 2EFNA 2IC3B 3OTOJ 2ZHOA 1BQNA 2EW9A 4TY8A 4ZIWA 2FY8A 1WOPA 3GCWP 5A8KB 1VRUA 3G8SA 5DM6Q 3MPVA 3FZBA 5CZVA 4PPZA 4YUDA 1M5VC 2XQCA 1V3RA 2X3GA 3NBPB 3DRSA 5L1LA 5J2NB 2IVFB 3C16B 4LF7F 5GMDA 3C3LA 1R6VA 2MTLA 3T9ZA 1YG0A 3G86A 1V5VA 2XCAA 4OZ5A 4Q7AA 4OYXA 3KTQA 4R8UB 1VS3A 2AGOA 3CCZA 3LP2B 4ZJOA 3KHRA 3H59A 4ICLA 2DRAA 1PAEX 1VQ4S 3PW5A 3TAMA 2GQCA 1RAIB 3BGOP 3KJVA 5FDLB 2WK4A 2MSTA 1TUGB 2CQ1A 1ZAXA 3DU5A 3E01B 3VR1A 4ZVSB 2RU3A 3HHLA 2O01C 4ES3A 2NREA 1P9YA 1FKAF 4P9SA 4LFBJ 4IH6A 2MZ1A 3LWMA 2CUYA 3DNCA 4F8RA 1CJVA 1GEHA 4EEYA 3AB2B 2ZEJA 4TXSA 3KLFB 2ZOMA 4DBQA 2F3JA 2UUAJ 3GMGA 2P5VA 1ZTTA 3JYTB 3WIVA 1VJQA 2NSBA 2FHJD 2DNZA 3N5BA 5F8NA 1N4LA 4ETXA 3NLCA 3PO5A 2H54B 5KFNA 2V0NA 4DPXA 3B54A 4JI3F 5HI7A 3UFCX 4DV0J 4N77A 3M7VA 4OZ0A 3C6UB 4KV8A 5C25A 4WP8A 4IFYB 2P9CA 2LMIA 1PBUA 4ZS6A 2C2MB 3FC9A 4DN0A 1VQKS 5KFDA 3D3BJ 3OW2R 4AUKA 1DFDA 1Z1ZA 3EDQB 3TX0A 2D9OA 4IH5A 5KFFA 3FGVA 1TTHB 4U95A 1RHUB 1UFWA 4FVMA 2C22A 3ZXWA 2MQLA 5K14A 3BSCA 3MM8B 1R0BG 4C7QA 2M52A 5A2QY 3PW4A 3MMBA 1IKYA 4KTQA 1TL3A 5BYSA 3AH6A 1FTCA 3I0RA 3Q2TC 5EWGA 3VGTA 5KOXA 4F0KA 3KLIB 4TVAB 1TL7A 4F3QA 3KLHB 3Q86A 3HFZB 3IRXB 4LMZA 2YX7A 2BOPA 2FVPA 3FNNA 3RBDA 2KRRA 4F25A 2ROPA 3FCWA 2WOMA 2HSEB 3OL8A 5HO4A 1JJCB 1FRJA 1N5YB 1F2HA 4WFYA 3CCVS 3PV8A 2M3DA 4DQRA 4ES2A 1IR1A 3DGPA 4D3GA 3HJFA 4K4SA 3SDEB 3Q8QB 1T3NA 4F3MA 4LF8F 5IT9Y 4C0OC 2ACYA 1DURA 2HHSA 1FKPA 3MEEB 1SXLA 2B9WA 1HBNB 2XEXA 3ZTSA 3W66A 3KG0A 2OPRA 2UUBF 3NAIA 2F63A 5KFMA 3AODA 3THTA 3VQSA 3DDKA 1TMMA 3DN9A 1Q78A 5T7LB 1N6QB 1CVJA 1ZA2B 3QIPB 2H4YB 2DY9A 4DPYA 2RDDA 1C4AA 4WIQA 3BF4A 1M5KC 1HI8A 5SZTA 4I69A 4DR6F 1KONA 3T1YF 1VBXA 2XLJA 4B3SF 4QIFA 4GVLA 2V50A 2LYVA 2DO0A 1FWPA 2CAJA 4I7FA 4DG1A 1C1BB 1X4CA 2B7BB 1OWXA 1IKWB 3KLEB 2G4BA 5HATA 3AOCA 2HQGA 4X66J 2M0GB 1U1PA 2KB2A 2FVRA 2K2PA 1AYEA 2FZCB 4C3MA 4GO7X 3W8PA 1NDLA 2KG1A 4ZVPB 2FQQB 4P2MA 4ECXA 1UEVA 2OPSB 1ZTWA 1Q7YT 3FFIB 2RB7A 5E3PA 4A48A 3MGJA 4J9QA 3R2CJ 4F4WA 3M6VA 3WBZA 1UVMA 3GIRA 3VAFA 1XNRJ 4C9DA 4LFCJ 1FX2A 2HNDB 4GMKA 4RNMA 4J9MA 2BEFA 4CTAA 4X84A 1JX4A 1X4GA 2CPHA 4CNYA 2FJAB 4ZDNA 4DR2J 4HHJA 3AQPA 1HWUA 4M5DB 2HBRB 3AA8A 1BQXA 2B7CB 2KVIA 4I68A 4MK9A 3KDOA 4TLRA 4LR7A 5BXIA 1WTBA 3QGHA 3L7PA 2VA2A 2ZD1B 1IKXA 4ED2A 1MWQA 3UCZP 1I6JA 1PJ7A 2VG6A 1S99A 2ATCB 4JOUA 4A8YA 1DQAA 2UUTA 3EICA 1S0NA 1REVB 3VVUA 4IO9Q 2ZJQQ 3GV5B 5D3GA 5AXNA 1IBKJ 2CVEA 2PMHA 4UUXA 4FVCA 1KS2A 3W9JA 3PTWA 1FDDA 1HQ2A 1QAJA 4W98A 2C3UA 1UJ4A 1RT6A 4DR1F 2GV1A 5T14A 2BM0A 3BKTA 2OAUA 1YSJA 5HANA 3EYZA 2HG4A 3SCKE 4MH8A 1VR6A 2AEMA 2F9JA 4OX8A 4OZJA 2W9BB 4J9PA 2V4JA 4CLUA 1RCXB 5HJXA 1N32J 1ZH5A 2BABA 1C1CA 3ZZUA 2KT2A 2B4VA 3D0IE 4KHPF 3TZYA 4DDFA 3KNGA 2B9XA 3ISNC 3UDVA 5KFTA 2IM3A 2DNQA 2YKNA 1HBMA 1XMOJ 3I5AA 3C46A 1ZM2A 1DY3A 7FD1A 4RNFA 4I6AA 2VQFF 4ZLJA 4ITSA 4TLQA 2DISA 2I5JB 4ZCMA 1WHYA 5CXTA 4OJHA 1MU2A 1VRTA 1VQ9S 3W2VB 2HGMA 2YXLA 1NB7A 3HVTB 3H5YA 1NNDA 2OPPB 5ETSA 2QC3A 2DGQA 5B08A 2MGZA 4DCPB 2RF2A 4USVA 3V81A 1GH8A 3CMES 3TQEA 3TO8A 4J37A 2GS8A 3GR0A 3W5XA 3J7YU 1YJUA 3W9IA 3ADAC 1SVDA 3K89A 2XHCA 2B9YA 1LWXA 2IPOB 2O5DA 2HRUA 3P6YC 1BD6A 3DRPA 4DFPA 2XNQA 4NWBA 3TX8A 2AGPA 1SC6A 3RTVA 2ZDOA 2MZJA 3QT7A 4OL8A 4I67A 2QX0A 1YLXA 3TP2A 3EJMA 2F8MA 1L3KA 4DFJA 1NZAA 4KBIA 1WTFA 3V6KA 1RQ0A 1FTRA 2MQOA 4PZVA 5DGBA 3T6BA 3RG6A 3V6HA 3LGMA 4B08A 1HNZJ 2HHQA 1U09A 1H73A 2ZM6F 2B51A 2JEGA 2B8QA 1M90T 2R8KA 1NO8A 1S1XA 3G6ES 2W7AA 4DJBA 4DX6A 1Y4ZB 4MT1A 4P72A 1YZ7A 4IFVA 5ETKA 1F9HA 2WRMA 3AQOA 3X1LB 4HDGA 4HYKA 1HBOA 1N0UA 3CULA 3KG1A 4B3RJ 4U7UK 2DCUB 5HVFA 1U1KA 1HD1A 2MZRA 1BQMA 2HZCA 2CNOB 3NP5A 4B3OB 2V2QA 4U7UD 3W2WB 2ATLA 2UXDF 4F4XA 2POKA 3AB4B 3D9BA 2NLWA 4QZVB 1S72S 2OIHA 2G2OA 3NRBA 5EUHA 2W9CA 1SJRA 2L9DA 1NHKL 2CPFA 4ZPDA 2CPEA 1T7PA 4QU7A 3MM7B 4KH1B 2ZE2B 3Q89A 4WWSA 4DF8A 2BZ2A 4KIAA 5JJBA 1KKHA 4UY85 5AXMA 4XDCA 4O3NA 1EQ0A 4HEA9 5AE3A 1XC9A 2MKJA 4Q43A 1XJWB 3MUTP 1CJKA 4NYOA 4NMLA 2PIIA 4EWTA 2VQEJ 2A2CA 4B9TA 4CI0B 1SQEA 2OTLS 3EZUA 4NXMF 5JVGQ 3PR4A 1VHIA 2CPDA 3UI3A 5DDQC 1XWLA 3A4TA 2N4DA 3I9V9 1FWKA 3UN3A 1QAYA 3N79A 2QTWA 1TVRA 1KQSR 1AFIA 4OMFG 3SBMA 1N56A 2CADA 1NJWA 5DJBA 2C28A 1QAXA 4LF6F 1RWXB 1PYOB 2Z2YB 2KXHA 4PKDB 3FSXA 1DAXA 4LQ9A 4JI1F 2NXEA 3TWZA 5GAEU 4C11B 1S6UA 4C4WA 3HKWA 4USKA 1S1TA 1RACB 4PR6A 2H51B 3NS7B 3L7UA 1R0AB 1LWFB 5KG2A 5E33A 3FSYA 5A8RB 3G4SS 5KG3A 2ZVIA 2OFHX 3LP1B 4PQUB 2K8GA 5IC6B 3A12A 1I1GA 2PMWA 2VFSA 4I2PA 3GYNA 1FE0A 2IC3A 3F44A 3EVWA 4UT4A 1H2UX 5MAOA 4EBCA 5A8KA 2GNKA 3UR3C 4WZMA 5AT1B 2VONA 3SCJE 2CZ9A 2HGNA 3JSRA 2Q1LA 2YY3A 3UDEA 1WEYA 4C8NA 1TKDA 2D3ZA 4DR3J 3I31A 1NSPA 3MUVP 3BGUA 2A1BA 3SMZA 2FJDB 2CPXA 1P8GA 4O4GB 3QLHB 4RUAA 4CIOA 1Y5LB 4R8UA 3LP2A 1MSWD 3M32B 2R8GA 4GKKJ 1DHMA 2B6AB 4A8SA 1G3OA 3OLAA 3AAWB 2DITA 2RRAA 4O3SA 3HD1A 4QPTA 5C7PA 4KPCA 5FDLA 3IM9A 5EDWA 4CLKA 2RJZA 5D77A 1HBUB 2P9EA 1GXUA 4KC5A 1RB0A 4QOTA 4ZIVA 1CULB 4UZBA 1VYAA 1WOOA 1JLCA 4NLVA 5HSPA 3KLFA 4DZ6A 5ETRA 3JYTA 3MAHA 1RU2A 1RT4B 2MQMA 4DPWA 2JLEA 3C66A 2PDAA 3M6XA 3WQPA 2W4PA 4C3KA 5AE2A 3JTNA 2P2CB 1KOHA 2PI4A 1Y3KA 3BO3A 1EKSA 4QWAA 2IM1A 2Q43A 4J9SA 5CH7B 2AF6A 5C2GA 3EDRB 4A8MP 3HHLC 4IFYA 1OY6A 2W4DA 3G2XA 3CDUA 3QGIA 4UF4A 4O3OA 1AB8A 2J0SD 3M30B 1G4CA 3PFOA 5AJ3F 3NOCA 2XNRA 3MM6A 4NLXA 5IM0A 1TUWA 2VODA 1KC8T 4X4QA 3PHEA 3T19A 4OLPA 2OPQB 5A6WA 1T94A 3NNCA 2W7OA 4K4VA 1VQSA 2IJRA 2PO4A 3L9ZA 3I5CA 4NLYA 4NI2A 1JXEA 2F8EX 4CLWA 3M9OB 1T3OA 1GMUA 1TZ0A 3MAQA 2VL1A 3DOMB 4YY3J 3KLIA 4QYRA 1LK5A 4ERDA 3IRXA 3UW1A 2LQJA 2UXCJ 3IBFB 4JI5J 1PILA 2DHAA 2E5LF 2GFFA 2BOAA 3I9ZA 1Q7LB 1GX5A 1DJ0A 3W62A 4WP9A 3POTB 1H7XA 1UA0A 5E0OA 2M88A 1Q79A 1N5YA 4DSLA 5M2PA 1KDNA 3QO9A 2HVZA 5D15A 4Y34A 5FLXY 3MAAB 4OI0A 2HHHJ 3DLHA 3SDEA 1N36F 2I9SA 3PR5B 3S8SA 5E41A 5K8OA 3SYZA 1XR6A 2FVSA 5KG0A 4WTYA 1HYSB 1M5SA 1RCOB 1HBNA 1SH2A 2DBBA 4QR2A 2C1EB 4M94A 2GMLA 3EE3A 3H8YA 2V8DA 4A46A 5T7LA 3QIPA 1VI7A 1UJ6A 2MKCA 3BN4A 4ZP7A 1XERA 1U1MA 4F4YA 1R3NA 3Q8VA 4I64A 4A8KA 4USMA 1NK5A 4CO5A 4G6VB 3SCLE 2HEKA 3T5LA 1C1BA 1EB0A 1IJFB 5IT0A 1SKSA 3CSKA 3KLEA 4ID8A 1PJ5A 1YBUA 3IAS9 1RT1A 3W61A 1HWIA 3CXCR 2H48B 2HAIA 4X4UA 2H9ZA 2VC1A 3RB3A 4C8ZA 2K7JA 1EKRA 3QQCD 2R8JA 1ZS6A 4FPRA 5DZ7A 3FFIA 3GE9A 3K17A 1NMEB 2XI3A 2BA9A 1VQOS 1KQKA 2J0WA 5F9LA 1RA6A 3VGSA 2HNDA 2G1HA 4HTJA 1X9WA 1BE4A 4DR7F 5JUMA 2AD9A 3TEHB 1U1QA 3PW0A 4OZ2A 1M5OC 2MB0B 3UN5A 3IBCB 1TL1B 1NK8A 4M5DA 4NZ6A 1N34J 3GYGA 2DHSA 3B78A 4FKYA 2P8IA 2H1YA 2ZD1A 3D67A 4AXJA 1IR0A 1U2RA 3JSYA 3TZXA 1QJHA 2J7KA 1S6QA 4KSEB 5KAKA 1X4AA 2Q6BA 1RLDA 2MHNA 4HL9A 2XYHB 5DQHA 1QVGR 4OI1A 4W4MA 3J7YI 1KR4A 3GFZA 1HIYA 5KG7A 2QLJB 3DLEB 1RE1B 1Q4RA 2AYGA 2ERRA 1GQEA 3MM5A 3QT8A 4ZLPA 2FLPA 1OY9A 4DLEA 3FK4A 4EO6A 4FYYB 4O3PA 3N6MA 6FDRA 1TP7A 4J9UE 4RNHA 2Q3PA 3DMJA 2LVWA 6FD1A 5T41A 3GIIA 1Y5NB 3O1LA 2B0GA 2LDIA 2QV6A 1Q86T 2IA0A 2PE8A 4LIWA 1A7GE 5HVHA 5GADU 4BS2A 3A8KA 3CVKA 3IS9B 3CO9A 1TAUA 2PEBA 1SIZA 4JI7F 2VF3A 2HBQB 1WWHA 2CDRB 5D0EA 1JLAB 5IT4A 2FLNA 4NLTA 2DR7A 4IYQA 3ZTQA 4IOCQ 5SUHA 1EAYC 2FC9A 1IBLJ 3C2PA 3BYRA 2FVQA 4DV7F 1H7WA 1GFWB 2IYGA 1CC7A 3GJTB 2I5JA 2A18A 3NG8A 3HSGA 4LF4F 4LF5F 3HVTA 4CLTA 1N33F 4DSFA 2FDNA 4IRDA 3BZQA 2OPPA 5BYQA 4QBUA 1JLFB 4L74A 4YHHF 2WTFA 4MFBB 5EX0A 4LSLA 2AT1B 4NLRA 1R8HA 4IG0A 1TUVA 4B3TJ 5IOLA 4F02A 1PC5A 3B6BA 4Q0BB 5I3UA 3LA0A 2CPZA 4J9OA 2LEBA 1F1BB 3MWBA 3ZNJ1 3ZZPA 5C24A 5C5JA 4Z37A 2C2RA 2VUGA 2GQQA 3DOKB 3DXSX 1MROB 1S5ZA 5LXYA 3H4DA 1UW4A 1F5BA 4WKYA 1HFEL 3ELHA 3EZ5A 3I32A 3MR7A 1IKVB 1R8CA 4KKOB 3QATA 3HZGA 3DYAB 4TYAA 1RT5A 2KM8B 2J7UA 3RAXA 2BE9B 2W2NP 2DNRA 5BR8F 3LO3A 3T1HJ 2VDIA 1YITS 2WVDA 2B5JB 4RUBA 4O44A 2YX4A 2HW3A 4PXDA 3LGNA 4QW9A 1VMBA 1LQ9A 5IV4A 5GAEI 3C15B 2HS4A 2RU9A 2MY8A 2VV5A 5KG6A 2FHMA 1NK0A 2ADBA 2G13A 2H5JB 4IDKB 4DR5F 4DR4F 1ZA1B 2XZDB 3CJ2A 3W2WA 3OR1B 2F4FA 4DPTA 3CWJA 4H4OB 4M5KA 3V4IB 5C2CA 4P2XA 3ZZYA 5K20B 2B3TB 1FJGJ 2ZBCA 2CQPA 2KU7A 4B3MJ 2CKWA 3FKBA 1NM2A 4QQBA 3K0JA 1BUXA 1SV5A 2BXJA 3D0GE 4C98A 4Y00A 1LEOA 4EBEA 2CVIA 5CYQB 2CWKA 4EZ9A 3M1VA 1V9OA 2O67A 2F1FA 5AXLA 2EFVA 1WG4A 3ZZZA 2NS1B 3LH2S 4YB7A 3RYLA 2ZH1A 1WF2A 2ASLA 2ASJA 4DUZF 4DL2A 1TL4A 1L3TA 2RHSB 3WZ0A 1TV6B 4YB5A 4JI6J 1VK3A 3K2YA 4JI0F 2FJWA 4CP5A 1DTTA 3FEXB 1WI8A 3GIKA 2BACA 3HT0A 5IQ6A 3TAPA 1WF0A 1JMTA 1TAQA 4XAKA 2HGLA 3TZWA 4LT6A 2KG0A 2ZOGA 3QZ8A 5FJ4A 1PC4A 1A9NB 4NRTA 4EYHB 2E5JA 3LW5C 3KMSA 2YH1A 2HK3A 2QMUB 2AQ4A 1CC8A 1LWFA 1U4BA 4N76A 5A8RA 3NS5A 4H4KA 2KZZA 2HRYA 1UKUA 4FKXA 5CYJA 3QAEA 1EETB 1D9AA 2FHOB 1SC3B 1F60B 2G9OA 2ZWOA 1HMVB 1TU0B 4LQ3A 2I2YA 4EFAC 5J2QB 2E1PA 2JZ5A 2XS7A 5KOWA 2HFNA 3VAKA 4X62J 4CM0A 2PGCA 3D6FB 2NZCA 5LT5A 4R5PA 1IBMJ 2ZUAA 2KXNB 3IN5A 2KJVA 3QRQA 4ZOSA 3GSDA 1CEZA 4ZK7M 4O4GA 1TKZB 4HTIA 1BC6A 3QLHA 2PA8D 4QCLA 3WDOA 2K3KA 4QIEA 2Z2LA 2RQMA 3OR2B 2FUG9 2M4MA 3HHKA 3M32A 3GG1A 3W5YA 2DR6A 1FFWB 3DCAA 2D74B 5ADZA 3GZ7A 4KB7A 3I56S 2I38A 1XQIA 3THPA 5KFGA 3D28A 1Z2ZA 4NLOA 5LMNF 4M1KA 3CPWR 1FXRA 3N6LA 3OSPA 4NXNF 4LRFA 1FT8A 3IXQA 1S1WB 1JB0C 3CCWA 3M8QA 4I6WA 1Q8LA 2O66A 4ZPCA 1X0FA 3DLGA 4OYMA 2H3EB 3DM2B 2LFVA 3RGIA 1DTQB 2ZJRQ 3ULHA 3OT9A 2YX1A 2ZWPA 1MLAA 4OX7A 1E6VA 1RT4A 2HQ3A 4KO0B 2BQUA 1JKHA 1WC4A 1WC1A 3MI7X 2CJQA 1Q53A 4OI3A 2XBPA 5H9EK 4UOCA 2VB6A 4USWA 4Y3CA 4QR0A 1GXLA 3ZFVA 3PRDA 2MY7A 3BDPA 4DV2J 2K3IA 1VQMS 5H9FK 4DQQA 1NRKA 1HR0J 2XM3A 3ENQA 4DMZA 3HMJG 1HWKA 2Q79A 2HHVA 4DQPA 4QW8A 1RJJA 4X65F 4LSZB 4DCOB 4WIIA 4OHVA 3MMAB 3T9NA 4ZLNA 3ISND 1APSA 5E5NA 4TN2A 4HLBA 3KK1B 5B0EA 2MZQA 2OPQA 1TKXA 5KFQA 1RT7B 2HHUA 4JI4J 1X4HA 2WAQD 2QA4G 4KR0B 2DH7A 3GCXP 2YNFB 2OKQA 1VBYA 1XMQF 4QYZJ 1TKTA 4WF9Q 4I4BA 3KUGA 4HACB 1AXQA 5KT7A 1RYRA 1AFJA 2UP1A 1DQ9A 3CCJS 3OTOF 2GGPB 2BM1A 1FRHA 5L1IA 4QU6A 1NDCA 4HHUA 5IXUA 3M8PB 1K1QA 2LP4A 4NCAA 2J6TA 3A8IA 3HVAA 4U6PA 5LSRA 9RUBA 1T9WA 1GMVA 2UV8A 1TR0A 4RU2A 4DF4A 3OL9A 2EG1A 4P7TA 4PG7A 4K4UA 2M8HA 5I42A 1VOMA 2VKRA 1KVJA 3DRXA 4RW4A 1ZPWX 2PA3A 1U1LA 3F41A 5KFCA 2HFSA 3T5JA 3NNHA 2HZVA 4DV5J 3TARA 2UU9J 1FDNA 2DPJA 3BSNA 3P8BB 4HH0A 2GC8A 1KVKA 2DRBA 4GVBB 4USTA 3CJKB 1RTZA 5EGYA 2Y0SD 2XB2D 4LVNP 1OSCA 1M1KT 2MJNA 1FCAA 4GC6A 3QJLA 4LFBF 3AXMA 2BQ3A 2B4OA 2AX0A 1QTNB 3MEGB 4LFAJ 5J2MA 2LQ5A 4DX8H 1EHWA 3HSZA 2M7SA 3TRGA 2KTQA 3TNVA 2UUAF 4N7TA 2DNNA 1UWBB 4JB8B 2MKKA 2DNHA 3W5ZA 3PYGA 4YMEA 3VWSA 2YKPA 3ENVA 3R5AA 4RW6A 4YDXA 5K8NA 3R2DJ 2BQRA 2QYCA 2AJFE 1EZZB 5D4OA 3J80Y 3D1OA 1XIQA 5CZXA 4FDFA 2DGOA 4DV0F 4ID5B 2EXUA 2VBXA 3AA9A 2XO7A 3TA0A 2XULA 1VQPS 2OD4A 2MQQA 2W9AA 3AJDA 3H2LA 1FO1A 1UL3A 3CJTA 1RWNB 5GADI 4DL4A 4HVZA 2WVFA 1HNWJ 5M2RA 4PG5A 2MZTA 2W7PA 4CO4A 4Q44A 3GQCA 5B0DA 1Y5IB 3CD5A 2Q6CA 2JRSA 2WB1D 1RT2B 4UUWA 4TQRA 5KG5A 2E9ZA 4YOEA 1QUVA 1VBZA 4FYDA 2MQPA 2J0QD 2O3DA 2KT5A 3FRZA 3IG1B 1K8AT 4OZ1A 4NEZA 3VAIA 4RL1A 2XWXA 3IBWA 2V4RA 2VZ9A 5F8JA 4OZ3A 5E2QA 5DO2A 4WFXA 5JMNA 2AIRB 2IMOA 5G0RB 3OL7A 2HFVA 4ZP8A 1UAWA 3UD3P 1I51B 2CQ3A 1R0CB 2R4FA 2E66A 4WXWA 1DQ8A 3DLEA 5KFXA 3FBCA 1URNA 1S1VB 1XR5A 1HPZB 3CJ8A 5HROB 2R9LA 3CCTA 4AE5A 2JEIA 2Z58B 4AFFA 3N0VA 1NH8A 2I8EA 2NXCA 2G2ZA 1VIOA 2FJBB 2ZNZA 3V6DB 3MR6A 2CJXB 1S9GA 4OHYA 3ZNUA 2GMJA 5D0GA 2DGVA 3B8HA 1CSJA 2LQ9A 2BKNA 2QA2A 5B0FA 4WU3A 3LPEA 5HP1B 2YQ0A 1MMNA 1T9TA 3OFEA 4OYOA 4JI8J 1JLAA 3F0NA 3H2UB 2QRRA 4NLPA 4B9NA 5FD1A 2RRNA 1HNIB 2KJWA 4FPIA 3P4UB 1LWCB 1O51A 3OVSA 5AXKA 1KVIA 1XNQJ 3HVRA 2E29A 3AHPA 4IOBA 3BBBA 1Y0HA 3QT6A 3CCUS 2FGCA 4B9LA 3UDCA 1U26A 2JVRA 2E1MC 2IMWP 3MFHA 4X64J 3FDSA 1CQNA 4MFBA 2E1CA 3KJNB 3IR6B 3CJQA 3OTDA 3BS9A 2XZTB 5LMUJ 4XTTA 4MYUA 1ZM4A 3MCOA 1LW2B 2DHGA 2V8PA 2GQ2A 3CDAA 2ZH8A 4M95A 1S6PB 3CDBA 4X66F 4Q0BA 2VPXB 4DSEA 2W8LA 2HQFA 1YKWA 4NX9A 3RRKA 2CA9A 3DOKA 4NYZA 1MROA 4AL6A 2Z2MA 4YP3A 3BB5A 1PIEA 1NPPA 3S6EA 1U25A 4AYBD 2GHWA 4ILLA 4IRCA 2MLXA 3ONQA 4OHWA 3MEDB 3CW2C 1IKVA 3PEHA 1XNRF 1FRKA 4LFCF 2AZ3A 2JX2A 3RBXA 3H20A 4ECZA 4X2BA 1HWLA 1JNZB 4DR2F 4ZCLA 2X1AA 3U27A 2ZH5A 4WPAA 3HHLD 3LWLA 2HVDA 3HI9A 4A8QA 3NWGA 4JUZA 3NNAA 2DR5A 4RW7B 4NLDA 5B7WA 2EKNA 2KH9A 3C15A 2GO9A 1M5HA 1RHMB 2QFJA 3ENWA 1O8BA 2AJQA 4NEYA 2IAJB 2XMTA 1IBKF 4FF1A 3TUIC 1UEUA 3TUZC 4IDKA 3TA2A 4Y6IA 2BX6A 3OR1A 3MMCB 4H4OA 1VQLS 1HLWA 2G0JA 5CCLA 2DXFA 3GLJA 3ITHA 3G6VA 4RW9A 5LM7E 4A8XA 4CO1A 2JFDA 3HZEA 5DGAA 1HNVA 4LRBA 1C0TB 1RDRA 2AJ1A 2E1RA 4MIWA 4K59A 2Y0BB 5KFIA 2AMCB 2HQDA 1N32F 5CYQA 5K5MA 1D1UA 3LGHA 2ZNYA 3N28A 5CYMA 2GVZA 2JSXA 2HZAA 3EM1A 3FCVA 3HPOA 2UZAA 4ED5A 1M0SA 4OHZA 3DC2A 2R2SA 2ZBQA 3BREA 2YWFA 2MMYA 5KFYA 2NXUA 5F8GA 3VQTA 1XMOF 1UWAA 5B09A 1CJUB 1H74A 5D0HA 4FF2A 3KHGA 1RSCA 4CLLA 1I94J 1OSDA 2MPUA 1Q8BA 2LQBA 3PCOB 3NCRA 1S9FA 3GSIA 2CNLB 2WBMA 2Z0GA 4M5IA 2BUNA 1U8SA 3R6GB 3OFFA 1L5UA 3KKFA 1EIYB 3T41A 3BR8A 1KLMB 2G0CA 2WONA 1QD1A 1H3DA 2V94A 3LALA 3SQGA 3PIPQ 3TQ1A 4PWDB 4YR3A 2BJ9A 3OV7A 4IH7A 3BQ0A 3H98A 4X4OA 1WG1A 1EJ7L 4CWBA 2XMWA 3HHDA 2DEIA 4NPOA 1R31A 4AXIA 1RLCL 1IWGA 1HHQA 4ZJLA 1FDBA 2XMVA 1KFSA 2CNNB 5B0CA 2KDOA 5KG1A 5K8PA 1HMVA 2HVEA 2GVDB 1HQEB 1RAFB 2L3MA 5J2QA 4IQXA 2FZGB 3UVJB 4UOFA 3W8GA 2W01A 1BGXT 1X5SA 4I2QB 2QGFB 2BANA 5E3RA 1NXIA 2YWEA 1NJYA 2ACMA 1HNZF 2MQNA 1D09B 4DS4A 3JQJA 1FKOB 2FHKA 4FF3A 5DLGA 3MTKA 4HH1A 1MN9A 1CS4A 1RISA 4K2XA 4H4KC 3EX7B 4X4PA 4C8YA 1IQZA 2R7RA 4CT8A 3UD4P 4YDDB 2NZ4A 3OR2A 5KFJA 1HHTP 4ECSA 1N8RT 3AJ2A 5F8MA 1VHFA 5DG8A 1IUJA 1UEKA 1K9MT 1FE4A 4B3RF 1B0PA 3R5DA 2PI5A 2YQ1A 2DNPA 4XK8C 5EWEA 1F2GA 2MEWA 4IUFA 4ZJQA 3MCNA 1G1XA 4K8RA 4Y2KA 2I1RA 1YGYA 3BGLA 1R43A 2R7WA 1N52B 3G6XA 2UVRA 2QA4S 4TKTA 4P75A 3R5BA 2YWKA 2UUWA 3DM2A 1BXNA 4LBHA 3C14B 4IOAQ 1JLBB 5LSOA 2CJ9A 5I3QA 3HKZD 1DZ5A 2J0XA 1QDUB 2PMZD 1S1UA 1T05A 4ER8A 3MM9B 2Y3YA 2GO8A 4KGKA 2MZSA 3TUPA 3JAMU 1QSLA 3RBEA 3V5RA 3V4MA 4PYDA 2LLZA 5IC4B 2VQEF 4MK7A 1IQTA 2ZBRA 4EGLA 3GIJA 1JJ2R 4DPUA 5J1NA 4DV6J 1QAIA 5A6PA 1UFLA 4ZPBA 4L76A 4I1TA 4J91A 2OELA 3W63A 4HHHA 3AD7C 1WKJA 4N8NA 1RXOB 3EMTA 2A6MA 4R0JA 1FVQA 4KFBB 3BM7A 1X5PA 1T03B 5DS7A 4ZVEA 4ED0A 2YNHB 3S7RA 3TW0A 1FFGB 5H1SV 3SQOP 2ZDPA 4M5LA 2HLUA 2G1DA 3E8OA 2Y1JA 4RW8A 1VC5A 1RT7A 2YKQA 3BQ2A 5ETNA 2YNFA 2M2BA 3M6WA 2IVMA 2X1GA 5C42B 2CNKB 3KLVA 2L08A 2J8AA 3CCRS 1T9YA 5ETLA 2QEXS 2DGUA 1FEHA 3EGVA 2J7WA 3MPUB 4C97A 5K9FA 1WHWA 3SFUA 2HLTA 2D7SA 1MMLA 1PYSB 2GGPA 2V8VA 4WBFA 1S4EA 4PXBA 4NASA 2ZOFA 2QO3A 1NBEB 1KQGB 3DOLB 3FBFA 1F9FA 2YNIB 1DLOA 1WUUA 3HXMA 2HNYB 5D4PA 1YJRA 4DR3F 1NPRA 4C0BA 2DGSA 1SUQB 2W8KA 5KT3A 3UCUP 5HMXA 3CC4S 3P45B 2VICA 3PYEA 1RAOA
chains in the Genus database with same CATH topology
2HIQA 1I94F 5F9LA 2IJNA 3QIDA 1RA6A 5LL6d 3CJ5A 2HNDA 1KLMA 2WSCC 2ABYA 4Q45A 1TK8A 1EP4B 1SV5B 2JOQA 4HTJA 2KKHA 1BQNB 4KRWA 1X9WA 4U7CA 4GKKF 1S79A 3LF0A 4DR7F 3CJ3A 2F7VA 2VC0A 5JUMA 5DLFA 1VC0A 2AD9A 1HBUA 3LPYA 1U1QA 3PW0A 2J76E 1ZAWA 2C42A 1M5OC 2MB0B 1X9SA 4PWDA 1TL1B 1R89A 4USHA 3KMQA 3M8SA 1KHVA 3M1VB 2NPFA 1NK8A 5L1JA 4M5DA 4OZLA 4TU8A 4NZ6A 2EI5A 3T6JA 5KT6A 2XWYA 4ZCKA 2FLOA 1NEEA 2DHSA 3B78A 2B56A 4G3IA 3CCSS 1H2VZ 2Z4PA 1FERA 1ZOTA 2EFPA 2ZD1A 5DG9A 1KQFB 3UCGA 3P5TL 1LXJA 1VQNS 2IFXA 1IR0A 4AXJA 1TK0A 1U2RA 2CG4A 3M2RB 4B9UA 1W25A 3JSYA 1SL1A 1JWWA 4DQSA 1YJNS 3PW2A 2R7UA 1AROP 5DDPC 3HM9A 1QJHA 4R25A 2J7KA 1S6QA 4KSEB 4Q2MA 2WHOA 5KAKA 3MEGA 4ZPVR 1X4AA 3K58A 2KT3A 2Q6BA 2VFTA 2XMKA 3VF0B 1DTTB 2MHNA 3BGRA 4HL9A 2XGQA 1LW0B 4YB6A 1S7HA 5DQHA 1T8EA 1QVGR 4OI1A 2ZH4A 2BJEA 3HVWA 1UWBA 3IFEA 4ICLB 4I2QA 3J7YI 1KR4A 3GFZA 2CPIA 3V81B 4DN9A 2LEPA 5KG7A 3N9UC 2FB0A 5B0BA 4FS1A 3TAMB 3EPGA 3DLEB 4D3HA 1Q4RA 1MMDA 1RYSA 2AYGA 2RT3A 3O2IA 2ERRA 1GQEA 3MM5A 4ZLPA 2FLPA 1FDAA 3QJPA 1B64A 4DLEA 4QWCA 4K4TA 3D1QA 5F8HA 4EO6A 3DLLQ 4O3PA 2RE1A 3PEJA 3PM9A 3T3FA 2GA7A 4ID5A 1X7VA 3DRPB 3N6MA 6FDRA 4AL5A 2CFXA 4K0KF 1TP7A 2D9PA 4WYLA 4JBCA 3RZAA 4B9MA 3M30A 1FJ7A 4J9RA 4RNHA 1LWEA 4DV4F 1O0PA 2Q3PA 3DMJA 3IAM9 2LVWA 6FD1A 4GO5X 2HVHA 2LA4A 5T41A 5L39A 4K4YA 2OFGX 3GIIA 2ZVSA 3ISZA 1D8YA 1Y5NB 3ZZTA 3K8WA 1YQHA 3O1LA 2CRLA 3AJ1A 2MHEA 3G9CA 2B0GA 2LDIA 2QV6A 1Q86T 2WB4A 2IA0A 3BSOA 2DT9A 1U6ZA 1VGYA 4XO0A 2PE8A 3HHNB 4ZVFA 1XMBA 4CO0A 1ZM3A 4LIWA 5F8IA 2ZJPQ 1A7GE 4P7VA 5GADU 5KFSA 4BS2A 5EN1A 2IBKA 3CVKA 3IS9B 1HNXF 1YJVA 3CO9A 3E51A 4IG3A 3OL6A 4LVOP 1TAUA 5J1EB 3VZIA 4OFZA 1SIZA 3JTOA 4JI7F 1N5SA 3K57A 4OQJA 1X0PA 5A8WB 4TY9A 3PKMA 2DD8S 2YWGA 4G1IA 1FK9A 4ATNA 4ALZA 4N41A 3IC1A 3BJYA 3MF5A 1WWHA 5IT4A 1JLAB 2FLNA 2NUUG 4NLTA 4IYQA 2DR7A 3IG1A 4IKAA 4BC9A 4M63A 2EVZA 3X3UA 5SUHA 1S1XB 4IOCQ 2FC9A 4TU7A 4UY8T 3C2PA 1FNMA 4K5SA 2FVQA 4DV7F 3R1HA 4R5PB 2IYGA 1H7WA 3KG4A 1CC7A 1ZETA 2I5JA 4EO8A 4EU0A 2A18A 1P27B 1NJXA 3NG8A 3I0SA 2LXIA 4LF4F 4LF5F 4WK1A 3DOMA 2UXBF 4JV0A 5LJ3Y 3TUJC 2EK1A 4DSKA 3HVTA 4WFBQ 1N33F 4DSFA 2FDNA 2B4UA 2AW0A 5HLFA 4IRDA 3OXLA 3BZQA 1HBOB 2OPPA 5BYQA 5AE1A 3CUNA 4QBUA 2XCPA 3I96A 4I56A 1JLFB 2ZBIA 2J0QD 4MMOA 5D4LA 3KK3B 3ETOA 2C2DA 3GV7B 1U24A 3LANA 3MM9A 2QLWA 3PKYA 1R8BA 5KFLA 2EG2A 4YHHF 2WTFA 4MFBB 3Q24A 5G0RA 3OSNA 5EX0A 1S77D 3H25A 1K73T 2C3YA 2ROEA 4NLSA 3K7RA 2BW2A 4LSLA 2YKMB 4YY3F 2LKZA 3TOQA 1BQMB 1XTZA 2AJ4A 4NLRA 1R8HA 2RDJA 3POTA 2PN6A 2OP5A 4IG0A 3WX4A 5LXRA 1TUVA 3S1TA 3UPFA 1KLNA 2UXCF 4BBYA 1FF2A 3CC2S 3FQLA 3IWLA 2XMUA 5HMZA 5L9NA 4JI5F 1PC5A 4F02A 4H4MB 5GVQA 4CO3A 3OPKA 5I3UA 4IRKA 3O44A 3TR5A 5KFPA 3KNAA 4Q0BB 2OO4A 3R27A 5MLCV 4BWMA 2CPZA 3R3TA 4K4XA 2KFZA 3Q8PB 1Y3JA 4WK3A 3ZZOA 4J9OA 2LEBA 3QGPA 5HROA 3MWBA 2CPJA 3DLJA 1NHVA 1X8DA 2XS5A 1LFPA 3ZZPA 5CCMA 5C24A 2M70A 2FTRA 4ED8A 5GAHU 5C5JA 4Z37A 2ASYA 2C2RA 2VUGA 5F9NA 2JDJA 2GQQA 1YJWS 4JV2A 1RKIA 3DOKB 3DXSX 1MROB 2WCXA 3MMBB 5BYRA 5LXYA 4KGMA 3H4DA 1UW4A 5D78A 1F5BA 4WKYA 3M8QB 1TL3B 1HFEL 1SJ4P 1HL6A 4NCBA 1HYSA 1MWYA 4K4ZA 2IVYA 3DLGB 4DV6F 3U7JA 2DGWA 3EZ5A 2PD1A 3V6DA 3VALA 3I32A 5IS2A 4RX6A 4J9LA 4MKBA 2RMLA 3CE8A 3QGGA 1YHQS 3PRBA 1H98A 2HHHF 1X4EA 1QTMA 4DEZA 1IM4A 1TL5A 1IKVB 1ZBTA 2EKYA 5CA5A 4K4WA 2E9RX 4RUHA 1R8CA 4KKOB 1E6VB 4DPOA 2D3OR 3HZGA 3DYAB 4NZ7A 4TYAA 3BGFA 1RT5A 1R27B 3LP0A 1JKHB 1D9FA 2KM8B 3NCQA 2GHVC 5GMKa 3MURP 4J5OA 5HP1A 4URGA 2WSFC 2J7UA 3RAXA 3CCES 5A0YB 4E0DA 4QIGA 2DNRA 4TYBA 1B0VA 5BR8F 1RA7A 5IZHA 3LO3A 2WOMB 2KO1A 3CCMS 1SBRA 1HNIA 3I87A 2DNGA 4AL7A 1JJHA 1YITS 5L1KA 3M6UA 3DRYA 1BY9A 2RKIA 2B5JB 2CQDA 4ZKAA 1YJTA 1HI1A 3JTPA 1ULRA 4HKQA 4X4NA 1GT8A 3J7ZT 1JNRB 4O44A 1D9DA 4H54A 2UVWA 3OUYA 2YX4A 2HW3A 4PXDA 3LGNA 4QW9A 5E3AA 3Q8RB 3MR3A 1OQ6A 1VMBA 4N56A 2XG8A 4CH7A 1LQ9A 1R6YA 3H2VE 4JV5F 4MIAA 2X1BA 1RT3A 3IO1A 4MKYA 5GAEI 1H6KX 2DIUA 2HS4A 3Q0AA 4ECWA 2ILZA 4J9KA 4Y2MA 2HHWA 2RU9A 2MY8A 2VV5A 2DK2A 1ELOA 2JL9A 3EGWB 5KG6A 2ZH9A 4ECVA 3H5SA 2FHMA 1NK0A 4WFNQ 2JHEA 2ADBA 3HO1A 1S1TB 2G13A 4OI6A 4IDKB 2HQIA 2KI2A 4PXEA 4ZHRB 4DR5F 3RAQA 4DR4F 2PSZA 2YVSA 3CJ2A 1MWZA 4NL5A 2UVVA 3W2WA 2J9DE 1QVFR 3OR1B 3CWJA 5JXSA 4H4OB 3C6TB 3PFEA 2GHPA 4NCGA 3BSAA 4K5RA 3CC7S 3V4IB 1T95A 1XR7A 3ZZYA 4WZQA 1TKXB 1U2FA 4RNNA 4PQAA 1FNOA 3B4DA 3VTIA 2ZH7A 5CQGA 3U1MA 3MR2A 1XK8A 2B3TB 2EK6A 2PC6A 2ZBCA 2CQPA 3FJ2A 2KU7A 1CLFA 2CKWA 1V3SA 2GIRA 2J9EA 4TQSA 1UVIA 2VA3A 1UA1A 1TKTB 1JLEB 2FJEB 1GTHA 4I2PB 3RB6A 2FY1A 4QQBA 2EFNA 2IC3B 5E3CA 4L72B 3K0JA 4WE1B 3KLGB 1EP4A 1SV5A 2ZHOA 1BQNA 2BXJA 3D0GE 4C98A 4Y00A 2EW9A 3T1AA 4TY8A 3GR1A 5HBMA 1W2IA 3MPWA 5A8KB 1WG5A 1VRUA 3N01A 3G8SA 3GIMA 4EBEA 2CVIA 5CYQB 5DM6Q 1TL1A 3MPVA 2VFVA 4I7FB 4HT7A 4DG1B 3FZBA 5CZVA 4PPZA 4YUDA 1KEKA 2V8HA 3M1VA 4EZ9A 1M5VC 1D3WA 4FXDA 3MR5A 1V3RA 1V9OA 2JVOA 2O67A 2F1FA 4URSA 2X3GA 4NZ0A 5AXLA 3NBPB 1JXLA 3DRSA 2EFVA 5L1LA 2YQ3A 1WG4A 2IBOA 5J2NB 2IVFB 1WEZA 3ZZZA 2NS1B 4LF7F 3LH2S 3C3LA 3PJXA 4YB7A 3RYLA 2JLGA 5KFEA 1OS5A 2ZH1A 1WF2A 2ADCA 4KJIA 3BQ1A 1ZZNA 3T9ZA 1YG0A 2ASLA 1QE1B 2BRKA 3G86A 2ASJA 2HS3A 2W4CA 5D6GA 3MTJA 2XCAA 4OZ5A 4Q7AA 1N34F 4DUZF 4DL2A 2N82B 1TL4A 3KTQA 2XSJB 4R8UB 1L3TA 2HWHA 3WZ0A 2R2RA 1TV6B 1VS3A 4YB5A 4YFUA 1VK3A 3K2YA 1FNXH 2K1RA 4JI0F 3CCZA 2AGOA 3LP2B 2FJWA 2E1AA 1RTIB 1DTTA 2DR9A 3FEXB 2AV5A 2RH3A 3M8RA 1WI8A 1LW0A 5FIIA 4BHQA 3GIKA 1S9EB 2BACA 3KHRA 3H59A 1QUPA 3B4MA 3PJWA 4ZA1A 1QY7A 5IQ6A 4ICLA 3TAPA 2DRAA 1WF0A 1JMTA 1TAQA 4B17A 5I42B 3SV3A 1F5AA 1VC6A 5DM7Q 4BWJA 1VQ4S 2VG7A 3E3XA 3PW5A 4XAKA 3TAMA 2LA6A 5HL7Q 4RZRA 3NGDA 2HGLA 3OVAA 2P9GA 2GQCA 4LT6A 2KG0A 3KJVA 4RW4B 1O5JA 2ZOGA 3QZ8A 2HMIB 4C8LA 4DLGA 3KHLA 3UWTA 5FJ4A 1PC4A 2LXFA 4DV1F 1LK7A 1A9NB 5FDLB 2WK4A 5F0WA 2MSTA 4F2RA 3GWCA 2CQ1A 1ZAXA 3DU5A 3E01B 3VR1A 4OZNA 4NRTA 2RU3A 4EYHB 1PGZA 2E5JA 2QE5A 1OO0B 3JB9k 1QLNA 3HHLA 2O01C 3LW5C 4ES3A 3KMSA 4OX6A 4ECTA 1PSDA 1ZZFA 3HX9A 2YH1A 3KK2B 2NREA 2CDQA 2KM8C 4PUOA 5IWAF 3FRYA 2AQ4A 3OHBA 1CC8A 1LWFA 2EFQA 3IGNA 4ZPAA 4IH6A 3MMCA 2LDYA 2MZ1A 3LWMA 1WACA 1FRMA 1U4BA 3DNCA 4PG6A 5A8RA 4N76A 4F8RA 3NS5A 4H4KA 2KZZA 4LJMA 4OV1A 2HRYA 1LOUA 4EEYA 4CQ1A 1UKUA 3AB2B 2APOA 4TXSA 3KLFB 2ZOMA 4DBQA 5CYJA 2F3JA 3QAEA 3KYLA 1EETB 4UQGA 1D9AA 2FHOB 4FN5A 1WNEA 1F60B 3GMGA 2P5VA 3ZC4A 1ZTTA 1NKBA 3JYTB 2EC0A 3L95X 2G9OA 2NSBA 1HMVB 2FHJD 3OTBA 4LQ3A 2DNZA 2I2YA 3N5BA 2KYXA 2O1PA 4PXCA 1SJQA 5F8NA 1N4LA 4EFAC 3IS9A 5J2QB 5F8LA 3M4XA 5J2MB 4XIUA 4ETXA 2VG5B 2JZ5A 2RS2A 3NLCA 3PO5A 2XS7A 2ZC3A 5KOWA 2HFNA 2WBRA 3TA1A 5KFNA 2V0NA 3VAKA 3O3LA 2E7XA 4JI3F 5HI7A 5D3GB 2PGCA 4NA1A 3UFCX 1B0TA 1DBDA 5LT5A 1NKCA 1C4CA 1V3ZA 2FPHX 4N77A 4RW6B 4OZ0A 4DQIA 3CGIA 3C6UB 4R5PA 4KV8A 3V2UC 4B9SA 1RT6B 5C25A 5J2PB 2A2DA 4IFYB 2KXNB 2P9CA 2LMIA 3IN5A 3EUNA 2KJVA 4MIBA 1E6YA 4ZS6A 2ZH3A 4ZOSA 4RKUC 3GSDA 4DN0A 5EHHA 4ZK7M 1CEZA 4O4GA 2HNZA 1TKZB 3T5KA 4HTIA 2MDAA 2RSQA 3M2UB 1BC6A 3QLHA 2BV3A 2PA8D 1VQKS 5KFDA 1IBLF 2OMOA 4QCLA 1RI7A 2K3KA 4QIEA 3WDOA 3OW2R 2Y1IA 2Z2LA 4AUKA 2JJ4D 2HHTA 2MXYA 2RQMA 2ZITA 1JLFA 3OR2B 1R7IA 2FUG9 2EBEA 2M4MA 4QJVA 4BDPA 1JLQA 1P1TA 2AJ0A 2NPIA 3HHKA 1DFDA 3M32A 1UETA 3GG1A 2D1CA 1J2VA 3DCAA 1Z1ZA 2D74B 5ADZA 3GZ7A 3BR9A 2D9OA 1RTJB 4KB7A 1JIHA 3FEYB 4IH5A 2RRBA 5KFFA 3FGVA 3I56S 2I38A 2E5GA 1NHUA 1VLYA 3LQVA 3BEGB 3THPA 1UFWA 3EGNA 5KFGA 3D28A 4FVMA 4QWBA 2C22A 4M8LA 3DRRB 1Z2ZA 3NMRA 2MQLA 4NLOA 5LMNF 3QZ7A 3CJ0A 5K14A 3BSCA 4M1KA 3CPWR 1Q1KA 2GW8A 3MM8B 1H38A 1FXRA 4X4SA 2YKNB 3EXCX 3N6LA 4Y2IA 1HBMB 3OSPA 1S6OA 2FLLA 2ROGA 4NXNF 2KXFA 4RWXA 4C7QA 1NK6A 1FT8A 1G6BA 1S1WB 3IXQA 1JB0C 2BJDA 1L3SA 2M52A 3CCWA 4B3TF 1KSPA 5DDRC 5A2QY 3PW4A 3MMBA 2N7YA 3QAUA 1IKYA 4KTQA 3M8QA 1TL3A 5BYSA 2SXLA 3AH6A 4I6WA 1Q8LA 2O66A 4ZPCA 1X0FA 1MU2B 1VRTB 2HFOA 3DLGA 1FTCA 3I0RA 4LIRA 3Q2TC 4FBUA 2BE2B 5EWGA 3DM2B 1VQ8S 2J5AA 5KOXA 1J5OB 1DTQB 2QSWA 2ZJRQ 3ULHA 2YX1A 4ELVA 1DRZA 2IJFA 3KLIB 4F3QA 4OX7A 3M05A 4NA2A 3KLHB 4KKOA 1E6VA 1HQEA 3IRXB 4MYTA 4LMZA 1RT4A 2HQ3A 4KO0B 3SSSA 3DYAA 1CG2A 2BQUA 5KFVA 1H2TZ 2YX7A 2BOPA 1JKHA 2DNKA 4Y28C 2FVPA 3DI6B 2C3PA 2IYIA 1HQUB 3FNNA 4OI4A 3RBDA 2KRRA 4A47A 2MGZB 2XGPA 1M5PC 4F25A 2ROPA 2RF2B 2WOMA 3MI7X 3OL8A 2RS8A 2KYZA 2CJQA 5HO4A 1Q53A 4OI3A 1FRJA 2XBPA 1SH3A 1X9MA 1N5YB 3RRGA 4WFYA 3J7A1 4UOCA 2VB6A 3CCVS 4Y3CA 3PV8A 4QR0A 1SJFA 2B5JA 1N88A 2M3DA 1FKOA 1K0TA 4DQRA 2VFUA 1GXLA 5L9XA 4ES2A 4NLQA 4CT9A 4N8OA 2R7VA 3ZFVA 3DGPA 2IRYA 3PRDA 1F0XA 4OIXA 1JJ4A 2MY7A 4D3GA 3BDPA 3ZZ0A 5J1PA 1ROFA 1S97A 2K3IA 1VQMS 1U6BA