3D0HE

Crystal structure of spike protein receptor-binding domain from the 2002-2003 sars coronavirus civet strain complexed with human-civet chimeric receptor ace2
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
179
structure length
173
Chain Sequence
PFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLKDYGFYTTSGIGYQPYRVVVLSFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of major species barriers between humans and palm civets for severe acute respiratory syndrome coronavirus infections
pubmed doi rcsb
source organism Paguma larvata
molecule tags Hydrolase
molecule keywords Angiotensin-converting enzyme 2
total genus 30
structure length 173
sequence length 179
chains with identical sequence F
ec nomenclature
pdb deposition date 2008-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1840 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3d0hE01
3D0HE 2DD8S 5DO2A 4KQZA 3BGFA 3D0GE 3SCIE 4ZS6A 4XAKA 2GHVC 4QZVB 4ZPTR 3SCLE 4L72B 2AJFE 2GHWA 4ZPWR 4ZPVR 3SCJE 3D0IE 3SCKE 4KR0B 4L3NA
chains in the Genus database with same CATH superfamily
3OLBA 3I82A 1FXRA 2FVPA 4O44B 3MMAB 2VG5B 3HHLA 1U2RA 1CVJA 1HD0A 2E1RA 3CCWA 4MJKA 3QSIA 3ZC4A 2B0GA 4AFFA 1S0OA 5D0RA 2MKHA 5KFLA 3W62A 3H8YA 3HHLC 3M2RB 4PG8A 2E5HA 2DGWA 4UY8T 3O1LA 4A8MP 4J7CA 3BGRA 4KV8A 3MEEB 2GX8A 4M8LA 2FHOB 3M9OB 3TUIC 2P9EA 4OZNA 5K9FA 3SQOP 5DS7A 3WC2A 4OFZA 4OYOA 1FKPA 3JSBA 5DGBA 4TVAB 3IAM9 1QVGR 4NCGB 4LFCJ 2HK3A 2HQGA 4PCQA 1VC5A 3AQOA 4MYTA 5G0RA 3C16A 1Y10A 1WG5A 3OTBA 2EFVA 3THTA 4L3KA 4JI2F 4LRAA 1T9TA 4FVMA 1C0TB 2HBQB 2PI4A 3R5CA 4LF9F 1E6VB 1FKOB 1S1WA 3IMQJ 3N79A 1VK8A 2GJ2A 1KFDA 3PHTA 3AJ2A 4NMXA 3RZAA 3CCJS 1S9FA 1SBRA 5K14A 2R7QA 3W8PA 1QE1B 2ZD1A 2RDIA 3KJQB 2B4PA 4ELTA 3C6UB 1CPZA 2XB2D 4NEZA 5HROB 4F2SA 4JI8F 2MY7A 1X4EA 2XYHB 1N5SA 3C15B 3GPAA 2A6MA 4PYDA 2DJWA 3HT3A 1D1UA 1TFWA 3FCVA 2MKCA 4I64A 3QATA 1ZAVA 2G1DA 4YQWA 2BV3A 5D0EA 4XIUA 4ZPVR 3EVMA 1P9QC 1HWJA 1MWQA 3G8QA 3MMBA 1YBAA 3R7NB 4FPRA 4C11B 3Q8RB 2DGSA 2C2DA 5T7LA 4EZ6A 4WP3A 3U1NA 1UVKA 3RBZA 4AQYF 4DV2J 1CQNA 1VHFA 3DN9A 4RJVA 4DR3F 2KVQE 1EETA 3CUNA 1HNWJ 2V8HA 4F02A 2KT3A 4J9RA 2CG8A 3KK3B 2CAJA 4V19X 2V8GA 1B99A 1H38A 2BRKA 4BHQA 3V6DB 4Y28C 4KTQA 4IFVA 4PXBA 5LSOA 2Q79A 3KLHB 3RGIA 3CMAS 3IM8A 4X66F 4M5DB 4NZ6A 4ZHRA 1ROFA 3MZIA 5CHCB 4LBPA 1OY9A 1RLCL 2FYXA 2GMLA 1JLQA 1JKHB 2RAQA 2V5HG 4ZP7A 1KQFB 1Q8LA 1Q5VA 2PMWA 3PRDA 3TW0A 3WX4A 1SJ3P 3PNIA 3J7Z5 2QFJA 2HHSA 2RUGA 1AT1B 1Q8BA 4F4XA 1KD1T 4QU7A 4L3NA 4OJGA 3BJYA 3UI3A 1R0CB 1SQFA 5K8OA 4DV6F 2DHHA 4C4WA 5M2UA 2V94A 1OIAA 2M4MA 3CW2C 4USJC 4ZK7M 3CCSS 3ZZRA 3G6VA 1Y3JA 2PEBA 2XMJA 3PYDA 1GEHA 1YJ7A 2EVZA 2LEPA 1RTHB 2M7SA 5IM0B 3HO1A 8AT1B 1N8RT 5JUMA 3QO9B 4RUAA 1HFEL 1M1GA 3JQMA 2XGQA 2AV5A 2E7VA 1SKRA 4JI5J 1OS5A 4I1TA 5LJ3Y 4Z37A 2FC9A 2BKPA 4LF4F 1EIYB 4OZ5A 4WF9Q 2YKOA 1OO0B 2P8IA 3PEHA 2CA9A 3R9LA 2B9WA 3R5JB 5B0FA 3LP2A 2HRTA 2GJIA 4USMA 1JLGA 5BXIA 4CLSA 2KTQA 4OX6A 1X4DA 3SCJE 4Y2CA 1K1SA 3BPDA 3HT0A 3KLVA 3QJPA 4CLTA 1HI8A 2GMJA 2RQMA 3RAXA 4H4KC 3DRRB 4UOHA 5KFWA 1JLBA 2DR6A 1CJVB 2R42A 1S59A 3FBCA 3V4IB 1NO8A 4IH7A 2NSBA 3ILOA 4OZLA 2DPJA 4PPDA 3BH6B 3NNAA 2NPFA 5CH7B 5BR8F 4FXVA 4CO5A 4ED4A 1Z4UA 3BGFA 4KYZA 2OSRA 3G86A 2MPUA 3M30B 1VISA 4UF4A 4WFXA 4I2PB 2Y8WA 1R8AA 2IYGA 4JV0A 3HCXA 1Y5NB 3KK2A 3P96A 3M6XA 5CZVA 1WJ9A 3FGVA 3GV5B 2ASJA 5C2GA 3OR1B 2E44A 1IXKA 2FZGB 2F63A 1U1MA 4U7UD 4NLWA 1JLEB 1XR6A 2YKMB 3EDQB 3NOCA 4I7FA 2E9ZA 3G2XA 4M5LA 3SCKE 5KFXA 2OI2A 3I0SB 3EXYA 1LWCA 3P49B 2Z2MA 1ULRA 1IKXA 1MROA 1B3TA 5C42A 1FA0A 3RW6A 3UDEA 4CIOA 3VVUA 1KVKA 2GVZA 3ENAA 1YDLA 1T9XA 4NI2B 4RBUA 4IRKA 4RW4B 1WTFA 4RW6A 5B08A 3QZ8A 1IBLF 2Y1JA 1AFIA 4DV3F 2EFQA 4DN9A 2C2RA 2HHVA 1SH3A 3MOJB 4A8WA 1T9VA 4DZDA 3DRSB 1LV5A 1HBMB 1OJ4A 5D4LA 1CS4A 2X1BA 3FRYA 3UCZP 3CDEA 2M88A 2N3LA 5DG9A 9RUBA 2ZC3A 1S6QB 4LIRA 3G8SA 2HFNA 2RF2A 4AQYJ 1IJFB 4KH1B 4NRUA 2OTJS 2E7XA 3T3FA 2BE2B 3KJVA 2OFGX 4HYKA 2NQPA 1VDHA 4QYRA 5D78A 1RGVA 2AX0A 2QO3A 3EZOA 3QGHA 1I5OB 1FRXA 3CJKA 1YJNS 2F5GA 2GFFA 3EPGA 2HHPA 4GKJJ 2C2MB 4K4XA 2RQKA 2ZUGA 2FY8A 2L9DA 3W66A 1VMBA 2E5IA 1KEKA 5DDPC 4ZN3A 2E5LF 2YNGB 3H5YA 1TL7B 1SKUB 1VJQA 3CO9A 2CJXB 4X66J 4X4VA 2W7PA 5LMUJ 1KHWA 4C3MA 3A8EA 2PIIA 2UUWA 1HR0J 3KHGA 2DNNA 1C1BA 1S6PA 1HNXJ 1NXIA 4O0NA 5E5NA 5DQHA 4KO0A 2ZH8A 2DR8A 4C3KA 4X4PA 1DTQB 1SVDA 3I9V9 2MXYA 3NL0A 5AE2A 1ZAWA 1L3TA 2FLPA 4RNOA 5JXSA 5HQMA 3TUZC 1NUEA 4LF2A 2BKNA 2FY1A 1DTTB 4EZ9A 2GIFA 1RTDA 4LF8J 3E8OA 1AUSL 3ILJA 1JK9B 3QQCD 2ZKTA 3AAWB 1FXLA 1BLUA 1ZZNA 1FESA 3BBBA 2Q1LA 2V0NA 4TNOA 3VCDA 4F4AA 3OL8A 4K4YA 2CPFA 3LP0A 4HKQA 3O6QA 1U2FA 1MMLA 3BYRA 4PAAA 1WC3A 2XYPB 4CH7A 4U6PA 4JI4J 2YX7A 4DPTA 2VC1A 3A13A 3DC2A 1RDRA 3M1VA 3IAS9 5K20B 3PJXA 2UVUA 3HM9A 3BKUA 1T7PA 2MJUA 2GQQA 1KONA 2B43A 2FTRA 4H4OA 1Q8KA 1S1WB 4J9PA 3SV4A 4LR9A 3C14B 5HSPA 2QFIA 3PFEA 4G1QA 1SXLA 2CQBA 2JZ5A 4NX9A 5DZ6A 5KG0A 5J2MB 2BJDA 1H74A 3GG0A 3MECA 3NGKA 1R0AA 3TNVA 5HMZA 4P71A 1RSCA 2B4VA 2GS8A 3GIKA 4A8FA 1FFSB 2AJ0A 3TUJC 2XHWA 1F2HA 3LW5C 2A6OA 1T3NA 2DNOA 2C2KB 3LWLA 1RK8A 1OQ3A 1PO6A 2YPYA 4CO4A 1D8YA 4FYYB 1NK8A 1T05A 2JH3A 1RU2A 4P6QA 3KUGA 3A8KA 2U2FA 4EUVA 1HARA 1KTVA 2G0IA 2FJDB 3AOAA 3VAMA 3VAHA 1F1BB 4YOEA 3GR1A 2XULA 5H9FJ 3B54A 4DCOB 1TU0B 2HQIA 3IM9A 4RW8A 5KFIA 2HLUA 3H59A 1WKLA 3NBPB 2F4VF 3R6GB 1A7GE 2AYEA 2EK1A 3DMJB 3GLJA 3DCAA 3HVTB 4Q44A 3PKYA 3WBZA 1H3DA 3ET6A 3MTJA 3ZZYA 2DVIA 2IAJB 2DBBA 1VQ7S 4Q0BB 4F3OA 1R3NA 1O5JA 1KRPA 4DSJA 1RE1B 4M5IA 1VI7A 2IC3B 2ADBA 4DPYA 3BSOA 2VQFJ 3QYYA 1F0XA 4IG3B 5I42A 1VQLS 2R8JA 2EKYA 1IWGA 1RTIA 3BREA 3NS7B 5E0OA 3OFFA 1IQTA 2FPHX 3U1LA 4NMLA 1LK7A 3MM8A 2LXFA 5KFHA 2EG1A 3NMAA 2NR0A 2I0XA 2HBRB 1RCOB 3P5BP 2H3EB 1DZ5A 2ROGA 2NXNA 1ZTTA 4PWDB 2BJ9A 3UR0A 5D3GB 5CZXA 2HNYA 2J7UA 2VG7A 3W2WA 4DG1B 3N4WA 4QWAA 4DUYJ 3O8WA 1XMOF 1NDPA 4ATNA 3H5UA 3MMAA 1TUWA 2YWGA 5DLGA 4CLPA 1N36J 2DNGA 3PR4A 3RB0A 1Q8IA 2A18A 3IO1A 3P8BB 3MPDA 1NJZA 1VQOS 1PJ6A 1RTJA 2VUGA 5A76A 3M8SA 4B3SJ 4ZPCA 2GO8A 2V68A 4DEZA 4DV4J 4EU0A 2KZZA 4GC6A 5FJ4A 4F3MA 4I69A 4ZDNA 4LJMA 2C2ZB 5L1JA 4AE5A 1RHKB 2AKWB 1VQ6S 2OEKA 4M94A 1SI9A 2IVFB 4QU6A 4O3RA 2XTJP 4P73A 1N32J 4DR4J 4B3MJ 5ITHA 1CJUB 2CZ9A 1RB0A 4J9VA 1J5EF 2VB6A 1IBKJ 4NLRA 1LW2A 3VQSA 3UWTA 4LQ9A 3DOLB 5J1EA 4DR7F 3RUBL 4PQUB 2IJRA 2V6AA 4YY3J 3HHLD 1KVJA 5ETVA 5T7LB 2B6AA 4ANCA 4DHVA 1WOPA 3T19A 2Z2ZA 4IH5A 4FNIA 3C3LA 2QZ8A 3IR7B 4GO7X 4EO6A 2BABA 2KHDA 3ZZ0A 3RAQA 1YG0A 1GMUA 2VBWA 4DX8H 2MKIA 3JYTB 2FC8A 4ZKAA 4PXCA 4B9UA 3QNWB 2OP5A 2AF6A 3CJ0A 1JWWA 4NYZA 5RUBA 4JV1A 4USVA 2VDIA 5D4OA 3FFIB 1RT7B 4OYZA 1QAXA 3N5BA 1T8EA 2HHHJ 5AT1B 2LXUA 3W3SA 1HNIB 6FDRA 5D6GA 3W63A 4RW6B 1XERA 1FTCA 4RW4A 3CULA 3BS9A 4WTYA 3D6HB 1Q86T 4DL5A 1QSLA 1RKIA 3G82B 1VIOA 2NYHA 2DGUA 4JI3F 3OUYA 2C3OA 2BE7D 2OMLA 1KQGB 3HD2A 2WB1D 4YB7A 3BPSP 3R5AA 5IZHA 3M4XA 3EVWA 2JFDA 1UKUA 1RAJA 4U8YA 1JXVA 1JLCA 4KIAA 2KM8C 2LEBA 3R97A 4X4RA 3FC9A 1X7VA 3DM2A 2W9CB 4J9KA 1TVRB 1JXEA 1VC0A 3RB4A 3OL9A 1QUPA 2V9KA 5J1NA 3CJKB 1MLAA 2CJYB 1GMVA 1N48A 4DOZA 3Q24A 2R7SA 2IJNA 4U8VA 1S48A 1H2UX 4YUDA 5IQ6A 2Y1LB 4G1PA 2OPSB 1YHQS 1S9EB 1V3ZA 1X4HA 3EUNA 1PJ5A 1YZ6A 2V8VA 3FEZA 4LVNP 4TY8B 4Y0FA 3LWMA 1S10A 2V67A 4ZVHA 2FVRA 1C1BB 4LMZA 5A0YB 2ZBQA 4N41A 2XSJA 3KJNB 2ASLA 3CJ2A 3IRXB 2XCAA 2VONA 2ROEA 4ILRA 1F9HA 3UVJA 3JSMB 2IBKA 1JLAA 1MWZA 2GGPA 1R7IA 1DQAA 2G2ZA 4ZP6A 4IR9A 3JB9k 1Q4RA 5F0UA 4R0EA 2XM3A 2XG8A 1Z2LA 3QFHA 1QM9A 2ADCA 2BJ7A 4RBTA 3ZFVA 2VPYB 4IFYA 3UDVA 1JLBB 2E5JA 1YITS 4E98A 2H54B 1YRTA 4DU8A 4TU7A 2P6TA 4X64J 3A3NB 2FLLA 4ELUA 3HK2A 3QBCA 1TV6B 2RQ4A 2ZVSA 3AXMA 3P45B 4DS4A 2M70A 3OLAA 3U7JA 3CTRA 1AXQA 1N0VC 1YTYA 3LPEA 5IWAJ 3M30A 4G1QB 4YB5A 2W9BA 3PV8A 2ZKUA 4DSKA 3EGWB 4JV5F 2AD9A 1Y3KA 1UA1A 1XR7A 2EKNA 1XBWA 2HS4A 3KDOA 1TKTB 2FZKB 2WW8A 3QWPA 3GYGA 4FP9A 4HDHA 3GFYA 5JMNA 5DM7Q 2JHEA 2PE8A 3MMJA 2D3OR 4EMDA 4WKRA 1S6QA 3K8WA 1PC5A 3M8RA 5IV3A 3VAKA 1JB0C 1VQPS 4B9SA 4C8NA 2YQ0A 4K4WA 2L48A 2MQOA 4OI2A 1EP4B 1D9AA 2AX1A 4X62F 1CG2A 1KOHA 1X5PA 3FQLA 5H9FK 1S1VA 3IG1A 2EFGA 5KFGA 3QRQA 3HLUA 3OTEA 1UEKA 4OYWA 1FF2A 3HZGA 3C66A 4AXIA 2DGVA 1K73T 4LRFA 5BR8J 2F7VA 2DGOA 3SSQA 1P1TA 2X3DA 1RJJA 4LVOP 5EHHA 3K8VA 4HH0A 3M8PB 3C16B 3B78A 3MHYA 4OYXA 4F50A 3TP2A 4S0MA 5IT9U 1N56A 6AT1B 3OVSA 3DLLQ 4A46A 4DSLA 2KL8A 3OTCA 2YNFB 3CCES 4H4MA 2ATLA 2QL9B 1JMTA 5CABA 3B6BA 3HHEA 1YJ9S 2BW2A 2YH1A 1NH7A 1SQGA 3JTPA 4LREA 1LFWA 2G2YA 3IR5B 3R5DA 4LT6A 2FJAB 1QY7A 2HAIA 2UV8G 4FXDA 4L76A 4OI1A 2R7WA 4J9QA 2CPZA 1RTDB 3L7UA 3MM8B 5IT9Y 2BW7A 3HSZA 5B0CA 2J5AA 2AT1B 1WHXA 2W1BA 4RNHA 1BE4A 1R8BA 2UZAA 3PCOB 4ES1A 4G6VB 4ZVEA 3W9IA 2K7JA 5KFKA 2R8GA 2WRMA 3MF5A 3L09A 1V5VA 3BN7A 4ELVA 2JRSA 5EWFA 2V2ZA 4PR6A 3FVYA 3I4HX 5JJBA 1GTHA 2HNDA 2IJFA 2UUTA 2BUNA 2IVYA 2L9NA 4IQMA 4NWBA 4TQRA 4DUZF 1NK0A 5B7WA 3PW4A 1SB6A 4OLOA 1GH8A 1TTHB 4QIEA 2LQ8A 1E6VA 1NJYA 3L7OA 1DLOB 3HFVA 1SIZA 1TKZB 3POTB 3PYFA 4OX9J 2R7TA 1S99A 3FCHA 1SQEA 3Q89A 5K14B 1FE0A 3VWSA 1X60A 1BQMA 1C4CA 1EX8A 2QLFB 1LWEA 3R7BB 5J2MA 1HPZA 4OI0A 4DL2A 1MW7A 4RUHA 2YTCA 1K47A 1CJKB 2ZDOA 3I5CA 1SH0A 4FKYA 4DBQA 3DLHA 3TEGA 4JYAJ 5HANA 2C3PA 5GAHU 1VBKA 5KT6A 1XNRJ 1NH8A 3TA0A 2NSCA 1L5UA 3UFCX 2WONA 4EWTA 2QRRA 2MSSA 2CNNB 5KFMA 4ZJQA 3BSCA 3RBEA 3AXKA 1VRQC 3AJ1A 4LSLB 5K8PA 3QIPA 4EFAC 2H65B 2WVCA 2VA2A 3QJLA 3HHKA 3ILIA 4UTGA 1FRJA 3VZIA 2LXIA 2MZSA 5AJ3F 3J80Y 1VRUA 1YGYA 2MQ8A 4FKXA 2BOPA 1YBUA 2ZOGA 1FRLA 2JLFA 4ZCKA 2XMWA 4C3LA 2GW8A 2MGZB 3VAJA 1ZA1B 1U02A 2YWKA 3MCOA 2Z30B 1HHTP 4BWJA 2IVMA 1EARA 4OJ3A 1C1CB 3JYTA 4LRBA 3HVTA 1PSDA 1Q16B 1W25A 1WKKA 1A9NB 1YQHA 1R6YA 2VPZB 1UJ6A 4TLQA 3DRPB 2ZH3A 5DETA 2JNJA 4OHXA 2J9DA 1QSSA 2XMMA 3GJRB 3O3LA 1RTIB 1U6FA 1JLGB 3U02A 4KB7A 3LOUA 4ZVSB 5HQLA 2MMYA 4RW8B 5A8KA 4HR2A 1HQEB 2F9DA 3H40A 1S76D 2B5JA 3NBPA 4Y00A 3VV2B 2QA1A 3DU5A 3R3TA 2JLEA 4CLLA 2VPWB 4ZIVA 2FUG9 3NKYA 3VGUA 4AT1B 2VFRA 4DF8A 1HBOB 5D77A 2PMZD 1K8AT 4Y6IA 2O1PA 2CZ4A 1VYAA 2WBRA 3V4IA 2YNIB 4LSNA 4FVCA 5J1PA 4LFAJ 2RUSA 2W24A 3ETMA 3TEHB 4K5RA 3DU6A 1HR0F 1LW0B 1N52B 4M63A 3UN3A 2GVDB 1B4SA 4X2BA 1I3OB 4TYBA 2QC3A 4ETXA 1M5HA 2XMKA 4ECWA 1JJ4A 1VS3A 4LF5J 1K44A 2DXDA 4BDPA 2JFKA 1NJIT 4KFBA 3MEDB 2LFVA 1YJUA 2QN6B 4NPOA 4DS5A 3QGIA 3T1YJ 4LFCF 3HVAA 2YQ1A 5CYJA 1VQNS 1LOUA 3CDWA 4I6WA 2I2YA 2W2QP 3FUYA 5E3PA 4GKKF 4O0IA 4RW7A 2BDPA 3CMQA 3JQJA 1IQZA 4C8OA 1EZZB 3HJFA 2K3IA 3FDSA 4OZ2A 2KFYA 4ZVPB 1RUSA 1ZZFA 4EYIB 2HYIB 2E1MC 4LF9J 5F0WA 5LXRA 4RU9A 2C1EB 1LWXA 1WC1A 3GIMA 3K5LA 5CYMA 2ZBRA 4YB1P 2APOA 3DOLA 5F3TA 3NXZA 1KTQA 1FK9A 2I6WA 2KYZA 2XZWA 1C0UB 4PXDA 3GYXB 5KFTA 2FZCB 4JI8J 4CLYA 3KK2B 1WC0A 4HTIA 2F8MA 1HBNA 2OFHX 2ROPA 4HLBA 4C48A 1TAUA 4DXLA 1TR0A 3PHEA 2V69A 5DLFA 3OQ2A 1REVA 2W4PA 2ASYA 4IG0A 3H7HB 1M5OC 4OHYA 3QIDA 1RWOB 4IFYB 2IFXA 4OZ0A 5F9LA 3NG8A 2WAQD 1UVIA 1SC4B 3O5TB 3MM6A 3VAFA 3PO4A 1IKXB 1MROB 3O2IA 4TN2A 4NLGA 2BOAA 3C6TA 5A8WA 1U45A 4DV0F 2Z8QA 1GFWB 1PIEA 4DV2F 1NKBA 3T41A 3FEXB 2C2OB 5IFMA 1RWVB 4DR3J 3KLFB 4ZVRB 2OMOA 4LUBA 3R27A 4R5PB 2CNKB 1X31C 2YNHB 3MMCA 2FVCA 2Q43A 4OYAA 4ES2A 1RXOB 5KG7A 4CCHA 1UJ5A 1CS4B 2QSFA 3H2LA 3LQVA 3TVZA 4EBDA 4K2XA 4DL6A 3KFWX 2J8AA 4OJHA 3HDSA 4CO2A 5H9EJ 2KM8B 3M32B 3DKDA 1UW4A 4IOBA 3G4SS 1GK8A 4C8LA 2ZE2A 4QIVA 2Z57B 2LP4A 2ZDPA 4HACA 3CD5A 3I9ZA 3LP1B 4F25A 4YFUA 3TARA 5KFEA 1HL6A 2LA4A 4CT9A 1XWLA 5GAEI 3G96A 3EZ5A 1NEEA 1S1UA 2XHCA 3FRZA 3OTOF 1U1OA 3ETOA 2Z4PA 1T9WA 2W9AA 4DV6J 2WVBA 3RRGA 1N5TA 4EYHB 2OGUA 2XLKA 4J9MA 3V6HA 4DFPA 3AD9C 3VZHA 2D1CA 2LQJA 4B3TF 3BH7B 4MIWA 4QIWD 4DSEA 2V4JB 1MNEA 1IR0A 2EI5A 2J7KA 2YX1A 3S8SA 3TJ8A 2J0QD 3R2DJ 3H0PA 4QW8A 1HMVA 5L46A 2DK2A 4RW9B 3BBFA 2FQQB 4HL9A 2D9OA 4ECRA 2NYIA 1FRKA 1X4CA 2P6SA 1UPPA 2D3UA 2FJEB 3CO0P 3PR5B 4DFKA 3NWRA 3OW2R 3HKZD 3I32A 4Y2IA 5KOWA 2C28A 4NZ7A 5T41A 2DEJA 2DO0A 3FSYA 2FHJD 1OPZA 2M8DB 2OD4A 4HHHA 2OJ3A 4F0HA 2J9EA 3JS9A 5M2PA 1NAQA 4JBCA 4RBVA 5DJBA 2FJXA 3FKBA 5HLFB 4LF7F 3I0RB 2DNKA 2RKIA 1FKAF 4A4JA 2L08A 3CJQA 5KFNA 4ED6A 1OPIA 2F40A 2BX6A 1FJCA 2HVDA 1R8PA 1TELA 3PX4A 1R89A 2KZMA 3MCNA 4CQ1A 4ES3A 2MKJA 1T03B 1X5TA 2R2RA 3EZUA 1RWNB 2FB0A 3DLGB 3GIIA 2PEHA 1Q53A 3UVJB 2WK4A 2J0WA 2DO4A 3AH6A 1WEYA 3JTOA 3M7VA 3MEGB 5I3UB 1VRTA 3J80U 3RB6A 2CPHA 4RNMA 4B3OB 3PYEA 4CO1A 4DR7J 2JC1A 3WIVA 4X4SA 3GSDA 2V2VA 1KQKA 2VHGA 1FRIA 4WTOB 3D3BJ 3IBWA 4DQSA 2IAJA 3K58A 7FD1A 3QRRA 2GHPA 3OR2A 5J2PB 2H1YA 5C24A 1WACA 2OKQA 4U96A 3W5XA 2I8EA 2E5GA 2KU7A 4USUA 2YKNA 4ZCMA 2W25A 3QAEA 4MK8A 1FFWB 4C8KA 2YQ3A 3KWMA 4OJ1A 1F9FA 1U48A 4Q2MA 1PYTA 2HBYB 1WF1A 2AJFE 3NCQA 1FHTA 1FD2A 2JEIA 4YB6A 1TKTA 3KK1B 1J5OB 2IA0A 1YLXA 2B9EA 2VG7B 2VV5A 3W2WB 3MM5A 3PACA 4USTA 4HTJA 2B7BB 2H5JB 4RNNA 3V81B 1D3WA 2HVZA 1SV5A 5A2QU 1KN6A 3EE3A 4XDCA 5LJ5Y 3DYAB 4PG5A 1CEZA 3NNHA 2DH7A 1VIXA 3OSNA 3NMRA 4RNFA 1WC6A 1R27B 2KXHA 2H9ZA 3BGOP 4FN5A 1UW9A 2P5VA 4I2QB 2R8KA 3ITHB 1W7WA 4NLQA 1NMEB 4NYPA 2YX4A 2VJUA 2JL9A 5ETOA 4XPCA 3QGPA 1UTAA 4PYAA 1UWBA 5HMXA 5LMUF 1NZAA 3CIMA 5A2QY 1DURA 4QWDA 4QW9A 3MD1A 4FS2A 2E1CA 3CJTA 1NRKA 2MY8A 1NDKA 2HNYB 2DNZA 4DG1A 2BANB 3D54A 1DARA 2ZH5A 3NGUA 4K4TA 3HVWA 4MFBA 4ZVTB 3V5RA 1GTEA 1M90T 3TZYA 4NE9C 4K0KJ 2PT0A 4QPXA 1FJGF 3KKFA 1CC7A 2VFVA 5L8RC 4QBUA 3QT6A 5J1EB 1YX2A 3CJ5A 5ETNA 1DLOA 3IXQA 2ZJQQ 4B3TJ 3GV7B 2J9CA 1KQSR 2XO7A 2MQQA 1FRHA 2CQGA 4JI1F 3TO8A 1AW0A 2AIRB 5F41A 2DHAA 1GXUA 2CDRB 2Q3PA 1RHQB 5CD4A 4X4TA 2GIRA 2AW0A 4TQSA 4F4ZA 4ILLA 1QTNB 4AL6A 1APSA 1I6JA 4DF4A 2CG4A 3M6WA 2HMIB 5BYRA 1MU2B 3FNNA 5K5MA 4DMZA 2IMOA 1RT7A 1T9YA 4R0JA 3M05A 5B0GA 4CZCA 4B3RF 2EBEA 5LT5A 3UPFA 1YIJS 3DLBA 1BQMB 2DNRA 2Y1IA 1F9EB 2G2OA 2DITA 4M95A 3CD6S 3ZZPA 1TKXB 3NCRA 3TR5A 2ATCB 3CGIA 4CLFA 3OFHA 3GYNA 2MGZA 1RZMA 2BZ2A 1RT3A 1U0HA 1GMWD 2CQ2A 2UV8A 2OPPB 4G65A 4DU7A 4F26A 4ID5B 3BQ1A 3ZNJ1 4CM0A 2ZJRQ 2ASDA 3QSYB 1EAYC 2E29A 4BWMA 1K1QA 4R8UB 4ZLJA 3HF5A 4OQJA 3IP0A 4ZPTR 5KT7A 1TK8A 3DM2B 3MR7A 4NLUA 4CLWA 2W9CA 2KVIA 2VQEF 4IRDA 3I5AA 1UEVA 2E66A 1HNIA 1FWLA 2LQ9A 4P75A 3TUPA 1RT6A 3K5MA 1M1KT 2M2BA 1Y5LB 1J27A 1X5OA 3MEKA 1TZ0A 1U0SA 2XMAA 1Z2ZA 1N5VA 2AMCB 4K7QA 5KFVA 3NGRA 1NHUA 2EC2A 2YNHA 1HA1A 1T11A 1EETB 1BXNA 1ZS6A 2DT9A 3EGVA 3G87A 2G9OA 3MAQA 3NNCA 2MKKA 3MM9B 1CULA 3Q8YA 5KFOA 4LBIA 3J81U 3VGVA 1TMMA 2HS0A 5THWA 1BMQB 3A8IA 3CCUS 3M32A 1GQEA 3H2VE 3A8JA 3UR3C 1NHVA 4BC9A 1NSKL 4PZVA 1S9GB 2I1RA 3OXLA 1TVRA 2D69A 1RACB 4HACB 1F5BA 5IC4B 3VGTA 4KSEB 3JAMY 5KG5A 3SZ2A 2BJEA 1OYEA 4NYOA 1JLAB 3QJJA 2UU9J 3THPA 3CMES 4F8RA 2QYCA 2VBYA 3OXFA 3C2PA 1QVFR 3TZZA 2MZQA 2O66A 1WUUA 2FD2A 2WVFA 3JAMU 4FYXB 1PC4A 1ITPA 3T6JA 1IR1A 3JXOA 2ZH7A 3F44A 4DUYF 1YJWS 1XMQF 5IQQA 3MFHA 4C8ZA 3TAMA 4C98A 2JOQA 3VVTA 5CQGA 4DLGA 1N36F 4RW7B 4KKOB 1S7IA 4KAIA 5IM0A 3PIOQ 3MFIA 2LLZA 2QLXA 2YNIA 4LSNB 1YI2S 4QYZJ 2YY3A 2ZNZA 4ZA1A 3SFGA 3UDLA 1FD8A 1LW0A 1S1TA 2DNMA 3SXLA 1M5SA 4ZOSA 3R7SB 3GG1A 4CLUA 3IN5A 4DQIA 3WHIA 4DUZJ 1WOOA 2YWFA 1EJ7L 1D9DA 1H0HB 5HVGA 5LOQA 5HL7Q 2FJVA 2ZZMA 3TAQA 1B70B 3MEDA 3KDNA 4G1IA 4ZCLA 4FYDA 3A3OB 4QR1A 4F3QA 1OY8A 5AXNA 2HPUA 3B4DA 3W9JA 3EICA 3TAPA 2R4FA 1WTBA 1S79A 4B02A 3GU0A 3DRRA 3GB0A 2DKOB 3D0IE 4OIXA 4DV5F 2RD5C 2VQEJ 1J5EJ 1JXLA 2J0SD 1RQ0A 2FHJA 4KPYA 3SSSA 4B08A 1WG4A 1GMWA 3S01A 2GNKA 2FJBB 4YY3F 1N6QB 1XNRF 3P5TL 2B9YA 1NZ8A 3Q8SB 5DDRC 4XTTA 4F0MA 4IO9Q 4EBCA 2EWHA 2H5IB 2FVQA 1G6BA 4P2FA 3J7AN 1FDDA 3EXCX 1SJFA 1KSPA 1PCAA 4UZCA 4PPZA 2AEJA 1LKZA 4I67A 4I2PA 2CQHA 5L39A 3PFOA 5LSLA 2NREA 2CUYA 4URSA 4WP8A 4DLEA 3V6JA 2JDJA 2VF3A 3CEDA 5IT4A 4BS2A 4LF6J 1KLMA 4YR3A 2LQ5A 1K0TA 3MPYA 2LEAA 4CYUA 2JLGA 1YJTA 5F8IA 2YKAA 2V4RA 3T1YF 1LWCB 2HHHF 1IWAA 4CRJA 4M5JA 3KG0A 5E3CA 2MB0B 3BO3A 2Z2YB 2ZM6J 1XR5A 4K4ZA 4MK7A 3HXMA 2GVZB 2D7SA 3MM7A 1DQ8A 4NASA 4R5PA 1S6OA 2KJWA 3KLGB 1PYOB 2UUAF 3K5PA 5GVQA 2CJAA 5IV4A 3UD4P 2W2PP 1BY9A 3LH2S 4IQXA 1FVSA 3D1QA 1Y11A 3DRSA 3EYZA 1HBMA 1RISA 2KXFA 1TL3B 2OO4A 4C2MA 2HHXA 2MZRA 4AXJA 2MKYA 2QX0A 1IM6A 1UWAA 1ZM3A 2YWEA 3JSYA 3V81A 3RB3A 1ZM4A 2V9WA 3L4BC 3IGNA 4J9UE 3M8WA 4YMEA 8RUCA 3HP6A 1PG5B 2HVHA 2LQBA 1LWFB 5AXLA 5L9NA 1FI4A 3LUYA 4DL4A 2ERRA 4LFAF 3I87A 1EQMA 4Y3CA 1IVZA 4WE1B 4CO3A 2HQFA 4K8RA 2RRNA 2G0JA 4ZJLA 8ATCB 2BA9A 1HPZB 2JX2A 4CTAA 5KT4A 1RHUB 3GR0A 4ECYA 3PZPA 1FKPB 5EWEA 4ZVOB 2AU0A 3C46A 3FSXA 4WIQA 3D6TB 5HI7A 2Y0BB 4ER8A 1HI0P 2R2UA 4OLPA 4ILMA 4J9NA 5KFFA 1BQNA 2IPOB 4ANEA 2D3ZA 2HHTA 3R2CJ 3ZTSA 1KC8T 4YR0A 1BD6A 1SIWB 5D8HB 3GJSB 1AA1B 1RT1B 2CRLA 1T9UA 3CJSA 4MMOA 1SKSA 5EUHA 1VRUB 3IWNC 1FDAA 2PSZA 3D67A 1DTTA 1XMQJ 4HH1A 1QE1A 2VH7A 2ZD1B 4J91A 2X1AA 4ECZA 1VQMS 1X4AA 2DGTA 5HROA 5E3QA 1D8ZA 2RJZA 3A4TA 2RKIB 3NGDA 3CC2S 2W8KA 4LF6F 2WOMB 3FCWA 4GVBB 1G2EA 2R7VA 2IRYA 3DNCA 3Q2SC 4ED2A 1VQ9S 1O0PA 2B7CB 2IYIA 1NDLA 4UUXA 1WG1A 2OTLS 2HEKA 3MCMA 3E2EA 2HMIA 2BJ3A 2Y1RI 1HLWA 2HQ3A 3LPYA 2OPQA 1UAWA 3QIPB 4H4KA 5A8RA 1D0EA 2DGQA 2KT2A 1M0SA 3EVOA 2YKNB 4ZP9A 5ETQA 2I5JA 3LANA 4I6YA 4LR8A 1KDNA 4ECSA 2BQRA 3KMQA 4KT0C 1B7FA 1T02A 3PX0A 2E9TA 3IFEA 2CJ9A 2EG2A 2CADA 4NXMF 2WSFC 2M9KA 2Q66A 1NK5A 4CH0S 1UFWA 2CIMA 3BKTA 3KG1A 4J37A 1RLDA 2V50A 3DOMB 4MKAA 4P10A 2NUHA 4JI6F 3W2VB 2KRRA 3WC0A 4BBYA 4UQTA 3DI6B 2XLIA 4DV1J 1HBOA 1VQKS 2JSXA 4OYIA 4KGKA 4DCJB 3KLEB 1YZ7A 1W2IA 4Q2LA 5FD1A 3OR2B 4O44A 2P9CA 4YN3B 1CJTB 2BACA 3UO0A 4FDFA 2I9SA 2PO4A 1JLQB 3DYAA 2OH2A 4U67Q 2R7OA 2GO9A 1DFDA 4HHUA 1YK9A 2Z58B 3DLKB 5AXKA 1T95A 1NJXA 3LGNA 2UXBF 4WKYA 5D0GA 4F0KA 3OV7A 4NLXA 2KH9A 1NK9A 3HD1A 2A10A 4XAKA 2EXUA 5CD4H 1CBKA 3BGLA 3MPVA 2QL7B 2K1RA 3BYPA 3FBBA 2ZWPA 4M5DA 3HHLB 4Y34A 2J6SA 2VL1A 2EPIA 4ECUA 1P27B 2MKSA 1NM2A 3BN4A 1KWMA 1N34F 3PIPQ 2KDOA 2W8LA 1FKOA 1RHJB 4ZVFA 3AT1B 4FNHA 3UD3P 1S57A 2M0GB 4KFBB 4O3NA 1OSCA 2CXEA 2DRBA 3SYZA 4N8OA 2MLZA 2RSQA 5DQIA 4OV6A 3JSRA 3NLCA 4F2RA 2UXCJ 3J7YU 5KG2A 1NJWA 1PAEX 2AYGA 4QQBA 3TX8A 3CDBA 4OZ3A 1NLKL 5HMYA 2IIHA 3D2WA 4F7VA 2HHUA 3MM6B 1S12A 1X4FA 3BR9A 1F5CA 1P6TA 4WFYA 2XGPA 2MZJA 1QJHA 3TQEA 2XS2A 2ZZNA 1HW9A 4JI5F 3RAMA 2ZHOA 2MZTA 1F3FA 4C11A 1FK9B 4AL5A 1RAEB 4RX6A 3AODA 1RU1A 2HZAA 4JP8A 3KUHA 2EW9A 3PEJA 3V4MA 5KFJA 1O8BA 2QA4S 3UN2A 3C19A 2XWYA 4N5SA 5ETKA 1HWKA 3E01B 1FDNA 3HHDA 3LAMA 1TKXA 2BM0A 3CDAA 1FCAA 1HQUA 3QT8A 2B9XA 5H1SV 3KTQA 3NAHA 1RT3B 1A6LA 1UCNA 2WW4A 2LECA 1Y0HA 1XIQA 2X3GA 1DRZA 2KT5A 4ECXA 4IFVB 4X4UA 2ZE2B 4R8UA 4PUOA 4I68A 3GCXP 3BSNA 2AGQA 1F5AA 4I56A 3ELHA 7FDRA 3H25A 2PFFB 2F4VJ 4KGMA 2J7WA 5GAGU 2DR9A 2N4CA 5KT2A 4DV7J 2BBEA 4FBTA 1YKWA 3N9UC 3CCTA 2L9WA 1O51A 5KAKA 1RBOB 4U9RA 3AD8C 2LDYA 3MOZA 4V1Ak 4WPAA 1VQ8S 2IMWP 3GFHA 5EX3A 1NPRA 4UUWA 2MDAA 3IS9A 1JLEA 2YKMA 4YEAA 1UVJA 1KLMB 2K8GA 2IY5B 1MWYA 3LP1A 3JQKA 3OPKA 5E3RA 3R5BA 4ZHRB 5EX0A 3J7A1 4QJVA 4TYAA 2BE9B 2YH0A 3M8YA 4E2FB 2ACYA 1JKHA 4F36A 2PGCA 1U8SA 2RS2A 3M8QB 2G0CA 1H73A 1K9MT 2VOOA 4L74A 4DSFA 1P8GA 4JI0F 4QR2A 2AHOB 4V19J 2VICA 1GXLA 2XLJA 3M9NB 3W60A 1RT4B 1Q82T 2YNGA 4JI7J 4ITSA 1N54B 2DNYA 2V2QA 1TUGB 1VCTA 1YSJA 3D7SB 1GAOA 1TL3A 4P7TA 5HJXA 4O3PA 3MUMP 1ZPVA 2E9RX 5BYSA 4ED3A 3M2UA 4FYWB 4CH1A 1CJVA 3H2UB 3BKFA 3GWCA 4KKOA 4MT1A 2CWXA 4DPUA 4ANDA 2L3MA 2XC9A 2BQ3A 2ZVIA 3FZBA 1LWFA 1NBEB 1VK3A 2BYCA 3KJFB 4UQGA 4WU3A 4J9LA 2C22A 1UZDA 4IO1A 1FEEA 4MYUA 1FJ7A 4W90B 1R8HA 1U26A 4DPWA 3EDRB 2O01C 1BC6A 1MN9A 3FMBA 4NA2A 4PABA 2Q6CA 3TI0A 2F8HA 3DHXA 3KHHA 1SC6A 2PA3A 3WX8A 2KKHA 5HATA 2QLWA 3FMWA 3UQSA 1RA6A 3LP0B 1S9EA 2RB7A 1H7XA 2CPIA 5KFRA 3ZTQA 1T03A 4DX5A 3FBFA 2BR0A 4G3IA 1DTQA 2A3JA 1J2VA 4RL1A 2M3DA 4KHRA 4P52A 4TY9A 3LGHA 2UVVA 5L38A 1U1QA 1UVMA 3MXHP 4WZQA 2Z2LA 3Q83A 3WQPA 5HP1A 1L3VA 1N6QA 4X4OA 3DFEA 1MSWD 5I3UA 5ETSA 3I4PA 1Q95G 3K17A 5DDOC 4LRCA 1SL1A 4OL8A 1IM4A 2HVIA 3BSAA 4B3OA 1RT2B 1C4AA 4CNZA 2Z56B 2XY7A 1NK4A 3TZWA 3NAIA 3TJAA 1FX4A 1ZPWX 3RR8A 4LRDA 4B3RJ 1NDCA 1RBAA 3SFUA 4NLPA 3EWGA 2POKA 2LKZA 4I7FB 1FERA 1X4GA 4Z7YA 4R25A 3T5KA 4CNYA 5J2PA 1O6XA 1HKAA 4IUFA 3I0SA 2CNOB 3MR2A 4USIA 5C42B 1RWXB 1SKWA 2PC6A 4H4OB 4JI0J 2RS8A 3AQPA 1KS2A 1PJ7A 1TV6A 2ZBPA 4NI2A 4DFJA 1YBTA 2D3O1 3IWLA 4IRCA 2Y0SD 1FRMA 9ATCB 1YVFA 4JI7F 1FNMA 4NLVA 3M2VA 2UUCJ 3RTVA 4FBUA 4DJBA 2ZEJA 3NRBA 4QPTA 1UPMB 3N6NA 4CO0A 4F04B 3ZTPA 5F8GA 1WC4A 2WTFA 2C3UA 2WSCC 2MZ1A 2GV1A 2BANA 4TLRA 2DHGA 3RBDA 4M5MA 4DR6J 2WZ1A 4QIFA 5F8MA 2HKEA 3ADAC 3VR1A 3J81j 3TVYA 2XQCA 2CPDA 1L3KA 4WU2A 2JJ4D 1HNWF 4HVZA 2DRAA 2DNLA 2DXFA 4AYBD 1ZTWA 2OSQA 3NS5A 2VIHA 2FVSA 3H4BA 4DV5J 4C0OC 1FFGB 2MQPA 4NRTA 4C0HA 4NLTA 1S1VB 2UU9F 3PY8A 2HG4A 2PN6A 3A1YG 2FLOA 5D15A 3VQTA 2N82B 1VFJA 2HBZB 3CCVS 2KHCA 2RT3A 2YWWA 2V8DA 4RU2A 4OZJA 2X1FA 4DR2F 4MFBB 3ET6B 2CQ0A 1R0BG 3CXCR 1NSPA 2CJQA 3KG4A 1OWXA 2W4DA 1UMJA 1TL1B 4ZVGA 4NCBA 2QIFA 3M1VB 1U09A 2CQ1A 4QOTA 2DH9A 5DO2A 1RAGB 4F4KA 1RTJB 2NS1B 4DL0C 2AEMA 1QSYA 2CDQA 4F4WA 2XY6A 1OQ6A 2K3KA 3BM7A 2KN4A 1M1HA 2IM3A 2M8HA 5L1KA 3HPOA 3CJ3A 5E2QA 4X65J 2EFPA 2LVWA 3IGVA 1SUQB 4OMFG 5HVFA 4N47A 5SZTA 2WOMA 4P72A 1QAYA 1XK8A 5IWAF 1VQ4S 2CQ3A 3IWXA 5GMEA 5DZ7A 1TKDA 2ILYA 2WVEA 2PI5A 5GMDA 1LNQA 5F8LA 2ZBCA 1RKJA 5HN0A 5MLCV 1T05B 1I94J 2OPRB 1WWHA 3E3XA 3NS6A 1S0MA 4K59A 2ILZA 4NA1A 2EEYA 3GV8B 2UUCF 1V9OA 4RWWA 3S1TA 4I0WA 1I51B 3D5MA 3C14A 2GCFA 3HX9A 3T9ZA 2HWHA 4YDXA 2OEJA 2XNRA 4O3QA 1PAUB 1FXDA 1M5VC 1ZA2B 2AJ4A 5KFQA 3K57A 1LWEB 2N4DA 5DRKA 1RP5A 1U24A 3DDIA 1R0AB 1U0HB 2N3OA 2RILA 5GADU 2OPPA 1S49A 2RNEA 2AEFA 2ACMA 5KG3A 2QMUB 3ZZUA 2W4CA 3V6DA 3UCUP 1DQ9A 1D9FA 5KFPA 4I6AA 2B8QA 3CJRA 1RHMB 1KBRA 5ETLA 3TWZA 3WIUA 4ZCIA 5J2NA 2PD1A 2UUBJ 2BXJA 1S9GA 5IS2A 1HBUA 3Q23A 2OPQB 3UDCA 2HGMA 2XZTB 2A0FB 1PKUA 3FFIA 3HJVA 2CFXA 3PRVA 4U95A 2V4QA 2VQFF 4USKA 4OI6A 4K2JA 5I42B 2H48B 2O5DA 3C8YA 4DR5F 4WZMA 3BF4A 3D28A 4MKBA 5C7PA 4EEYA 4P74A 2UUBF 3D66A 4C8YA 3WZ0A 3ULHA 2QE5A 1X5SA 3K2YA 4C0BA 2ZM6F 3MM9A 2XWXA 3FEYB 1JQGA 4B17A 2DB1A 3IS9B 4ZMMA 2H4WB 2H51B 3Q8PB 3NGSA 1N4LA 2XZDB 4BLGA 4DZ6A 3EX7B 1WC5A 5GAGI 1XJWB 4YHHF 2IBOA 3T1HJ 1TK0A 2A2CA 2COLA 4J5OA 2HHWA 1XTZA 4DPOA 3VTIA 3IA0A 4ZVQB 3R8YA 4NLYA 3W9HA 3CDUA 3QAUA 4O23A 2NUUG 4GRSA 5I3QA 4IG3A 4QWBA 1VQSA 1W26A 3LP2B 2F4FA 5AXMA 4X65F 2KRBA 2YPZA 3CCQS 4DV4F 4DQRA 3DLKA 3AA8A 4DPXA 3ISND 2FGCA 1HQEA 2B5JB 2EFNA 4WJBA 4JI3J 5CCMA 5KT5A 4OHVA 4WP9A 4JI1J 3V6KA 4ED0A 1K0VA 5EN1A 3FZ2A 4RPFA 1N32F 1AYEA 1AZSB 2XSJB 1SL0A 3QFWA 1WF2A 4L73A 3ZZZA 2AGOA 3W64A 3JSMA 4Q45A 1LW2B 2KXNB 2J6TA 4WBFA 2Y8YA 4E0DA 1BGXT 3NP5A 1UVLA 3Q22A 4LBHA 2B4OA 1NSAA 2W01A 4PQUA 4GVLA 1BUXA 5I3PA 4YDDB 1EB0A 2DNQA 2MQNA 3ONQA 3MR5A 1HNXF 1XMOJ 4X4NA 5HVHA 2J8SA 4RWXA 2KB2A 3MD3A 2DY9A 1QLNA 1F3VA 4TY8A 1IJEB 4WK1A 1ACMB 2ZBIA 2XBPA 5AJ3J 3OVAA 2DGXA 1AFJA 2CQCA 2XI2A 1HWIA 1UFLA 3W5YA 1CQMA 3GONA 5ETMA 1NSQA 2HW3A 4PUOB 5KFDA 1XC9A 4YR2A 4LR7A 2DY1A 3MR3A 3OD2A 1TQLA 1H2TZ 1XQIA 5A6PA 3G6XA 2IM1A 4Y2AA 2B6AB 3EMTA 2HNZB 3X3UA 2VJVA 4WYLA 1RT2A 3ISZA 2R8IA 4EK2A 4JI4F 3UNYA 4CDIA 4FF3A 1B0TA 4LF1A 3CWJA 4W4MA 4USHA 3PVXA 3VF0B 4J9OA 1UZHA 3ZXWA 3L95X 4DI6A 1PGZA 1DJ0A 3PJWA 4PWWA 2KYXA 5B09A 1ELOA 1F60B 4WFBQ 5JVHQ 4TU9A 4ZPBA 3LF0A 1X9MA 2K7KA 1BHNA 3AD7C 1JLCB 3E51A 3CC7S 2WHOA 1VQ5S 2O67A 3C6TB 4X84A 3VGSA 4X64F 5L1LA 1SC1B 4UY85 2QGFB 4UW2A 3U27A 4CT8A 2DH8A 4KY3A 1M5KC 3K0JA 2V8PA 2V63A 1RT5A 3QPIA 3G8TA 2W9BB 2WBMA 3M2VB 4M5KA 1MMDA 1UFKA 4CTAB 5K8NA 3SSRA 1TL7A 1SL2A 3R6LB 4CWBA 2HHQA 4DQQA 5KG4A 4LF5F 1MG7A 1NNDA 1TAQA 1L3UA 2UXBJ 1KLNA 2CQ4A 3CIZA 2UVWA 4DX7A 4ECVA 4KC5A 2YVSA 4KO0B 2MJNA 1S97A 4NXNJ 2WVDA 5A0YA 2HVEA 2VDHA 1RAAB 2BKOA 3M9MB 4DR5J 3EJMA 4WWSA 4ECTA 1UP1A 5J2QA 5DDQC 4K4VA 3DXBA 1IKVB 5LMNJ 3M8QA 1S7HA 3AA9A 3K5OA 1V3RA 5D4PA 3UN5A 3IG1B 4FYVB 1NB7A 3L7PA 2QJ3A 1N34J 1RT4A 4U7UK 1NCLA 3KHLA 3T1HF 3HZEA 3MGJA 1X9SA 1AB8A 4GVBA 4XO0A 2Q6BA 3Q8UA 2XS7A 3VHQA 1CC8A 1B0VA 2VBXA 3M8PA 5B0DA 1GX6A 4CM2A 2ZH1A 3Q8VA 4PRFA 3M2UB 2QEXS 2VASA 1YJRA 1LQ9A 1URNA 2GZOA 2W2OP 2D74B 4ED8A 5CXTA 1GT8A 2DTJA 4H4MB 3SCLE 4L72B 4FF2A 2G13A 2HFOA 3QRPA 4KGZB 1RT1A 1JLFB 5U47A 3UW1A 5HJYA 2HZCA 4P9SA 5DQGA 1WNEA 4WFZA 1TKZA 2DIUA 2ZHBA 4ED5A 3BBCA 1XN9A 3HFKA 3Q8QB 1V6HA 2F3JA 2GQCA 1HIYA 2RVJA 3D1OA 4AL7A 2I38A 3DLJA 5HK4A 1FVQA 2JC0A 4EI2A 4ZJOA 1E6YA 3PM9A 3CJ4A 1IKYB 4HT5A 4P2XA 3OFGA 2MTLA 2QSWA 3LA0A 2OEMA 3QLHB 3J81Y 3SI8A 1U6ZA 1Y4ZB 2HNDB 5DG8A 3DDKA 3HULA 5F8HA 4X4QA 1CJTA 2ZH4A 2VKRA 1SCJB 3NEKA 4N77A 3F0NA 1H6KX 1HHQA 3QT7A 4LIWA 4LSZB 1S4FA 2HS3A 4IDKB 2DNPA 4M5NA 1WDDA 5T14A 4O4GB 4D3HA 1CJKA 4GMKA 1SH2A 2BEFA 2CNLB 4FZVA 1F2GA 3LGMA 3DI6A 1JJCB 2ALYB 4RR5A 4JYAF 5DG7A 2LMIA 3A12A 1LXNA 2K1RB 3PDNA 3IR6B 4FPIA 4CLZA 4WFAQ 3H4DA 4ZPAA 4ICLA 2AYMA 2GQ2A 5KFSA 3US5A 1HHSA 5C24B 4PWUA 4OYBA 4RKUC 5AE1A 2LA6A 2JEFA 3RR7A 4OI3A 3K7RA 4Q43A 3KUEA 2ZJPQ 2OD6A 3GMGA 5F8JA 4F4YA 1N5YB 2ZZTA 2LCWA 3EGNA 5E41A 1FWKA 3W8GA 3H20A 1VQYA 4Q5VA 5KFAA 5D3GA 1WHVA 5G4DA 4URQU 3ZTRA 2XCPA 1J5OA 1RI7A 1AUDA 2UXDJ 3RG6A 3MM5B 4MH8A 1JJ2R 2ZH9A 1OY6A 1TL1A 3CCRS 4LF7J 4GKKJ 2YNFA 4RUCA 4J90A 5B0EA 1RWMB 1TMJA 2XNQA 3M2RA 2BMBA 2DEIA 3H42A 3J7YI 1HNVB 2DD8S 4CP5A 3QWUA 4IH6A 1LEOA 2CYYA 1RAOA 3ITHA 1H98A 1U1LA 4YP3A 1KOOA 4KHPJ 2ZITA 3ZO7A 3CD7A 3PYGA 4KQZA 2XS5A 3MDFA 4WK3A 1UWBB 2RDJA 4NXNF 1HYSB 1WOSA 2GHVC 5L9XA 3CSKA 3CB4A 3FBEA 2LDIA 5CYQA 4NCGA 2ZH2A 2ZOMA 3EGZA 4IOAQ 4PEOA 1RWPB 5KG6A 2R2TA 5G0RB 4ZLPA 1NPPA 3BEGB 1RTZA 2D9PA 4RUBA 1IBMF 2XY5A 1W2BR 2DYAA 1X8DA 5KG1A 1HD1A 4MIAA 3EM1A 3MPUB 3DOKA 3CNQP 2VFTA 3POTA 4B9NA 4OX7A 2XMTA 1YRUA 1C0UA 2NXEA 4TXSA 4DL7A 4WXWA 5L1IA 2AP6A 4FF1A 1QUVA 1R31A 1S6UA 1WKJA 3M6UA 1HBNB 3SMZA 3W5ZA 5HQ8A 3MURP 2VODA 2GAGC 1HQUB 2HRYA 3FQKA 3BO4A 4DFMA 4URGA 4TU8A 4OV1A 1QDUB 2R7RA 5KFYA 1U47A 3ICLA 2AQ4A 3C15A 2HIQA 2R8HA 1HYSA 5BJRA 2B8PA 4DR1F 4KJIA 2HSEB 3ENVA 5GADI 1U2CA 4HI1A 2RQCA 1JNRB 4DDFA 4ZITA 2W7OA 3PO5A 4KGVB 4EGLA 1RHRB 2HFVA 2AZ1A 1BWVA 1Q79A 2YBVA 3BB5A 3DRPA 2RMLA 2CZVC 2HFSA 2XYGB 3KLFA 3KLIA 4ED7A 2OAUA 2RHQB 3I6PA 1A0OB 1IBCB 1RYRA 3NGTA 1N0UA 4DV1F 2VU5A 1Q7YT 5A8KB 3PG9A 4RO0A 3OUYB 1RWUA 4WCEQ 2UXDF 3MAAB 2B4UA 3KK3A 3RRHA 1RWWB 3D0HE 3GFZA 5CA5A 3P4UB 4HEA9 2CVEA 3RYLA 2NZCA 1SJ4P 2HK2A 1ZETA 2PMHA 3OVBA 3AOBA 1WD6A 3T5JA 2L41A 1KKHA 1JNZB 3A3PB 3HSGA 1UL3A 2HFZA 2G4BA 4AD6A 2DHXA 1IR2A 1H7WA 1RBLA 1EKRA 1WHWA 3GTYX 5IOLA 3IRWP 4DV0J 1X0FA 1VC6A 3GJQB 3MI7X 1S1UB 1G7CB 1HWUA 5AE3A 3MMCB 1VJWA 1RT5B 1NB2A 2FIUA 5C25A 1ZYQA 1RT6B 2VOPA 5FIIA 1WSRA 3TRGA 1P1LA 1FJGJ 1FDBA 1SJRA 4K0KF 4KPCA 3BZQA 1VBXA 1T94A 2OPSA 2DRDA 5DGAA 3PW5A 4NCAA 2XI3A 3TX0A 2ZOFA 2E5LJ 1TP7A 3CCZA 3TVKA 4OZ1A 5MAOA 1GX5A 1WEXA 5LSRA 5H9EK 2EFOA 4UOFA 2HGNA 4X62J 3FSIA 1LK5A 3GIJA 2VC0A 1FEHA 2HAFA 5HBMA 1DAXA 2RRBA 2K06A 1B7YB 5J2QB 3TQ1A 2QLBB 5HP1B 2VPXB 3GIRA 2GVDA 1Y5IB 2XSFA 4XK8C 2OIHA 2CJBA 1B0PA 1VOMA 4UZBA 3OTOJ 4PKDB 2VFSA 2WB4A 2IDEA 4O3SA 2YXLA 3CD0A 4ZPDA 1NKEA 2H4YB 4DV3J 2UXCF 4K50A 2MSTA 2JVRA 1BQXA 2MHEA 2SXLA 3CF5Q 2W2MP 3P3DA 3TA1A 2V4JA 4LF8F 1REVB 3DRXA 1WEZA 2X51A 2HRUA 2F8EX 4H54A 4ID8A 4IG0B 5FLXU 3DGPB 3OFEA 3TAMB 3WDOA 3W7BA 1AZSA 4KR0B 1Q5YA 1SJQA 3CJ8A 1HWLA 3QO9A 3DHWC 3SIPB 2H5EA 1JJHA 2B56A 2YKPA 5ADZA 1ZBTA 2AGPA 3DLGA 2CQIA 4NOHA 3W1YC 3T1AA 1HNZJ 1QD1A 1R6VA 4MKVA 2IM0A 1S1TB 5CYMB 5C5JA 2N7CA 1XNQF 1OSDA 2F65A 2AJQA 1KVIA 1WF0A 3D1HA 1RWKB 1GXTA 1U8WA 2E1PA 2JVOA 4OX8A 5HAOA 3ZZOA 5C2CA 1I94F 1DY3A 3W61A 4DQPA 3I0RA 3F73A 3GZ7A 2DISA 3W65A 1WHYA 2NPIA 2VG6A 2AWZA 3D6MB 3IC1A 3OR1A 4HI2A 4YS2A 4A8QA 1IBMJ 2A2DA 2VFUA 3I55S 4ZLNA 3M6VA 3SDEA 1X0PA 2MQMA 3GQCA 3EPIA 1VLYA 1QAJA 4W92B 4LFBJ 3UE2A 3HFZB 5EDWA 2C3YA 2J6UA 4DV7F 3QGGA 4I4BA 1UVNA 1RA7A 1U7LA 2HGLA 2F1FA 2PFDA 1F6TA 2QA2A 3ISNC 2B51A 1VRTB 2ZFHA 1IKWB 3DLEB 3LALA 4NL5A 4OYMA 3KXDA 4JOUA 3T5LA 1Q1KA 4IDKA 1PILA 1KFSA 1FT8A 1S1XB 2KJVA 2Z0GA 3DXSX 3K89A 1REGX 4HT7A 2GC8A 3T5HA 4P7VA 5FDLA 1FE4A 1ZOTA 2J9DE 3GCWP 4BCAA 3I31A 1BWEA 3SCIE 3N6MA 1RAHB 1S5ZA 2RIJA 2VG5A 3T6BA 5A6WA 2QT7A 4RW9A 2LU2A 4B9MA 3TJ9A 5KT3A 2MLXA 3CCMS 4IYQA 4KBIA 3KMSA 2X1GA 1PYSB 2QL5B 1N88A 4KH0B 4UOGA 4YHHJ 3L3CA 1Q81T 4LQ3A 1TFYA 5GAHI 4NLOA 3BGRB 1S4EA 4ALZA 2VZ9A 3AB2B 4N8NA 4IKAA 4K4UA 2RHSB 3KLGA 1RABB 1L3SA 1Q0NA 4QWCA 3LO3A 2NZ4A 2CPYA 5KOXA 3KK1A 1SUQA 3FK4A 3MPWA 1Y9OA 3V2UC 3K59A 1SPBP 3SEOA 5GAEU 3NCPA 4F67A 3UCGA 3OJUA 4NEYA 3RRKA 3H5SA 1RADB 3PW7A 5EWGA 1G4CA 1HW8A 1S6PB 1SV5B 2B3TB 4W98A 1LFPA 1XNQJ 1PBUA 3CVKA 2M5YA 2CQPA 3VAGA 2K2PA 3ENQA 2JWNA 3MCSA 3MEEA 3AB4B 4PQAA 2WCXA 6FD1A 5LL6d 2HWIA 1TL5A 1V3SA 4C6AA 2DXEA 3C6UA 2GHWA 3BR8A 3GFXA 1VGYA 3BGUA 3DDNA 3BDPA 2PDAA 1QTMA 4NZ0A 3ZZTA 1RAIB 4MK9A 1IKYA 2R3VA 2ZNYA 5CYQB 4GO5X 3BQ2A 4M5GA 2EK6A 4DWIA 4DR6F 5F3ZA 2CQDA 2WONB 3L9ZA 1SC3B 3Q2TC 1WI6A 1IN0A 1FWPA 4Y2KA 2FGOA 4LSLA 1EQ0A 4OHZA 2OPRA 3F41A 2RRAA 3BV8A 1C0TA 4DR4F 2VKZG 1X4BA 3MMBB 4M5HA 2E7WA 1N33F 4Z2XA 4WYWA 3DRYA 2HQDA 3GE9A 3H5XA 3MEGA 4USWA 2P9GA 3MUVP 2DR5A 3TANA 1B64A 5E33A 1YJVA 2RU9A 1U1RA 1N5QA 4CLKA 3O44A 1UA0A 2O3DA 4C8MA 5LMNF 1C1CA 1TK5A 4DR2J 1JIHA 3D4JA 4OHWA 5J2NB 4ID5A 2IRXA 3OXGA 3SQGA 1TUVA 1LXJA 2C2NA 2UUAJ 3KLHA 4QCLA 3QMQA 4Q7AA 3D3CJ 4WXOA 1HBUB 4ZLLA 1MU2A 2NXUA 2WSEC 1S77D 3CE8A 4FF4A 4DN0A 4OYPA 3NY0A 4B9LA 2RH3A 3N28A 1TL4A 3PX6A 2QYGA 3HHNB 2G1HA 3GSIA 5ETRA 1OYDA 3I5BA 3S7RA 4Q8FA 3R1LA 1KR4A 1RAFB 2CWKA 4I2QA 1KHVA 3RU0A 3HI9A 4ENOA 1NHKL 5B0AA 4DL3A 1N5YA 1HQ2A 4JUZA 1QAIA 2QG9B 2RDDA 2J76E 1PBAA 3ENWA 4P2MA 4QR0A 3R5GA 5ETTA 5IT0A 1Z1ZA 4LFBF 3TA2A 2R2SA 3ZNUA 4MAKA 3F56A 1U4BA 1RTHA 3N01A 5KTQA 1ZM9A 4ED1A 3B8HA 4PG6A 1IUJA 2BJ8A 2KFZA 2RE1A 3AFGA 2HWTA 4PXEA 3G6YA 3AHPA 2IC3A 4B9TA 5KFBA 1YWXA 2C3MA 2KI2A 4ZIWA 2XO6A 2ALZA 4KE5A 5E3AA 2AZ3A 4KV8B 5CAAA 5C25B 3GJTB 1MN7A 1HI1A 4BC7A 3CT9A 2EBGA 2CKWA 2VD3A 2DHSA 4QIGA 3S6EA 4U7CA 3VAIA 2FJWA 4O4RA 3PW2A 3I56S 3HKWA 2GAHC 2OHDA 5FLXY 3K5NA 4Y65A 2ZUAA 1XEZA 4A48A 3OT9A 4ZS6A 2M52A 1IBLJ 5HBMB 4N76A 4QYZK 3J7ZT 5F8NA 3ZTOA 1NK6A 2DCUB 2IHR1 3QT5A 2J0XA 2LU1A 2CVIA 2GIQA 4A8OA 2NXCA 4Q0BA 5IC6B 3GP9A 3DOKB 1U25A 2HNZA 1NU4A 2QLJB 3JTNA 1S0VA 2FHMA 2NXJA 3G71S 4NA3A 4QWEA 2X7IA 2E1AA 4DSIA 4ETZA 1U6BA 2HFUA 1ZAXA 1UEUA 2FDNA 2V34A 2VBZA 4CI0B 2HLTA 2BQUA 4Q8EA 3CCLS 5JVGQ 2AJ2A 3ILLA 3B82A 4A47A 2YWHA 1Y00A 1FNOA 1XMBA 5D4NA 3R1HA 1V5IB 3SV3A 2Y9HA 3X1LB 2R7XA 2Y3YA 1H72C 4P2SA 2EC0A 4GKJF 4PG7A 5A8WB 3KOAA 2CPXA 4DCPB 1AROP 4L75A 5ETPA 1CJUA 2XMUA 4WFNQ 3FJ2A 3UNGC 4EBEA 2QMWA 1FO1A 1U49A 4QZVB 2ZHAA 2W7AA 4NLSA 1VBZA 5DM6Q 2AJ1A 4N7TA 2LYVA 3PW0A 1VHIA 3OHBA 2FHKA 1RCXB 1T3OA 2C42A 1G3OA 3I96A 3NWGA 3G9CA 4NLDA 4TKTA 4UT4A 3P6YC 2AYBA 4KHPF 3E01A 3IBFB 2VA3A 3OBIA 2GA7A 2KO1A 1CSJA 1WI8A 4Y2MA 5EGYA 1N33J 2KFNA 5F9NA 4HHJA 2OLWA 2JEGA 5E7OB 3VALA 3OHAA 2OELA 2MYFA 5IXUA 4ZP8A 5K8MA 1KNZA 1IKVA 3Q86A 5M2RA 5KFUA 5I4MA 5SUHA 2RU3A 1FX2A 2BRLA 1R43A 4OI4A 3PJ9A 3KLIB 4KGXB 1WDTA 5GMKa 3LAKA 3AJDA 3KHRA 3CPWR 2A1BA 5HO4A 3AY0A 1MMNA 3U1MA 1UETA 3D68A 3HSDA 4D3GA 1Y7PA 4Z7CA 4ZN1A 1S0NA 4XPEA 3KNGA 5CCLA 3MAAA 1U1PA 1WORA 3MAHA 1CULB 2R9LA 2UVRA 2DR7A 3MR6A 2BM1A 2HURA 7AT1B 2HQCA 1HMVB 5KFZA 5HMWA 3KYLA 2JEJA 3CC4S 3PTWA 1D09B 3RBXA 3TZXA 2MLYA 3T9NA 3LTOA 3PKMA 3OSPA 1UJ4A 2FLNA 1EKSA 3NOGA 3BO2A 2QTWA 2DNHA 1WELA 2CPJA 3SBMA 3G6ES 1G1XA 3N5FA 3MTKA 4ZVUB 3HMJG 4GC7A 1S72S 2MQLA 4JI2J 4B9VA 2MHNA 4KRWA 1EHWA 1NPKA 2F9JA 3G82A 3H98A 3D0GE 5LM7E 5HLFA 4JV5J 1M5PC 1E6YB 1P9YA 2NCKL 3OJSA 1VR6A 1X9WA 2HIYA 3QLHA 3OL6A 3Q0AA 1I1GA 2GJFA 3QZ7A 2ABYA 3DGPA 3THVA 1FJEB 4ZPWR 4C97A 1JLFA 4KHMA 3BQ0A 4IR1A 4JB8B 2XMVA 3PRBA 3TYTA 2PA8D 1KP6A 2GMHA 2QV6A 2ZWOA 2D41A 3HVRA 2DIVA 1ZM2A 4N56A 2P2CB 4JV2A 2GGPB 4WE1A 3M8ZA 3H90A 4DUTA 4AUKA 4O4GA 4OX9F 3N6LA 2CPEA 3OTDA 3MECB 4A8SA 3MWBA 2MEWA 4IOCQ 4XDDA 1C2PA 3PXGa 4B3MF 4A8XA 1YRXA 1WSVA 4EO8A 3IBCB 2VG6B 4E8UA 4ERDA 2W2NP 3OL7A 1R8CA 3AOCA 1BQNB 1OMSA 3D9BA 1U1NA 3TOQA 2KG0A 3DGVA 1T0TV 2QMXA 4ICLB 4FS1A 1NKCA 1SJ1A 1VLOA 3UD5A 2HZVA 5A8RB 3IRXA 4DR1J 4K5SA 2QA4G 1Q78A 4A8KA 4UOCA 4WIIA 2BVZA 2I5JB 1DBDA 2IRUA 1URRA 2IDLA 3MM7B 4O3OA 2V2KA 1S1XA 2YKQA 4HDGA 2N7YA 2R7UA 1Q7LB 1CLFA 3W2VA 3MUTP 4MKYA 2BJ1A 2ZC4A 4FXWA 5D0HA 5FDLB 3SQGB 4RZRA 2C2EA 2IM2A 4CYUB 3HSJA 4B3SF 2IA6A 3SDEB 1FTRA 4RLEA 1ZH5A 1H2VZ 4L6V3 2RF2B 5KFCA 2CJKA 2UP1A 4ECQA 1GNKA 3KNAA 2XEXA 2U1AA 4PG4A 4MTPA 2BE2A 3KJVB 2DPIA 4C9DA 4J9SA 1JX4A 3RJMB 4DX6A 1IKWA 3DLEA 2ZH6A 1VBYA 4K4SA 2DCLA 1HNVA 1RYSA 1EP4A 3D6FB 3N0VA 5B0BA 5LXYA 3GILA 3B4MA 3RW7A 1DHMA 1U1KA 2OUGA 3BDEA 1NK7A 4LF4J 5BYQA 4NXMJ 3DOMA 2NLWA 1FNXH 2KG1A 1HNZF 4PWDA 1IBKF 1ICEB 4C7QA 4JI6J 4MIBA 3DMJA 4A8YA 3KLEA 4M1KA
chains in the Genus database with same CATH topology
3OLBA 3I82A 1FXRA 2FVPA 4O44B 3MMAB 2VG5B 3HHLA 1U2RA 1CVJA 1HD0A 2E1RA 3CCWA 4MJKA 3ZC4A 2B0GA 4AFFA 1S0OA 2MKHA 5KFLA 4PG8A 3H8YA 3HHLC 3M2RB 2E5HA 2DGWA 4UY8T 3O1LA 4A8MP 3BGRA 4KV8A 3MEEB 2GX8A 4M8LA 2FHOB 3M9OB 3TUIC 2P9EA 4OZNA 5K9FA 5DS7A 3WC2A 4OFZA 1FKPA 3JSBA 5DGBA 3IAM9 1QVGR 4NCGB 4PCQA 1VC5A 3AQOA 4MYTA 5G0RA 1WG5A 3OTBA 2EFVA 3THTA 4JI2F 4FVMA 1C0TB 2PI4A 3R5CA 4LF9F 1E6VB 1FKOB 1S1WA 3N79A 1S9FA 1VK8A 2GJ2A 1KFDA 3RZAA 3AJ2A 3CCJS 2J6UA 1SBRA 5K14A 2R7QA 1QE1B 2ZD1A 2RDIA 2B4PA 4ELTA 3C6UB 1CPZA 2XB2D 5HROB 4F2SA 4JI8F 2MY7A 1X4EA 1D1UA 1N5SA 1HYSB 3HT3A 2DJWA 1TFWA 2MKCA 4I64A 1ZAVA 2G1DA 4YQWA 2BV3A 4XIUA 4ZPVR 1P9QC 1HWJA 3G8QA 3MMBA 4C11B 1YBAA 4FPRA 3Q8RB 2C2DA 2DGSA 4EZ6A 5T7LA 3U1NA 1UVKA 4AQYF 1CQNA 1VHFA 3DN9A 4DR3F 1EETA 3CUNA 2V8HA 4F02A 2KT3A 4J9RA 3KK3B 4V19X 2V8GA 1H38A 2BRKA 4BHQA 3V6DB 4Y28C 4KTQA 4IFVA 4PXBA 5LSOA 2Q79A 3KLHB 3CMAS 4X66F 4M5DB 4NZ6A 4ZHRA 1ROFA 3MZIA 5CHCB 2GMLA 1JLQA 1JKHB 2V5HG 4ZP7A 1KQFB 1Q8LA 3TW0A 3PRDA 3WX4A 1SJ3P 3PNIA 3J7Z5 2QFJA 2HHSA 2RUGA 1Q8BA 4F4XA 1KD1T 4QU7A 4L3NA 4OJGA 3BJYA 3UI3A 5K8OA 4DV6F 4C4WA 5M2UA 2V94A 1OIAA 2M4MA 4USJC 4ZK7M 3CCSS 3ZZRA 3G6VA 1Y3JA 2XMJA 2EVZA 2LEPA 5IM0B 1RTHB 2M7SA 3HO1A 1N8RT 5JUMA 3QO9B 4RUAA 1HFEL 2XGQA 1SKRA 2AV5A 1OS5A 4I1TA 5LJ3Y 4Z37A 2FC9A 4LF4F 4WF9Q 4OZ5A 2YKOA 1OO0B 3PEHA 3PIOQ 2B9WA 5B0FA 3LP2A 2GJIA 1JLGA 2KTQA 4OX6A 1X4DA 3SCJE 4Y2CA 1K1SA 3KLVA 3QJPA 1HI8A 2GMJA 2RQMA 3RAXA 4H4KC 3DRRB 5KFWA 1JLBA 3V4IB 1NO8A 4IH7A 2NSBA 4OZLA 2DPJA 4PPDA 3NNAA 2NPFA 5CH7B 5BR8F 4FXVA 4CO5A 2UUBF 1Z4UA 3BGFA 4WFXA 2OSRA 3G86A 2MPUA 3M30B 4I2PB 1R8AA 2IYGA 4JV0A 1Y5NB 3KK2A 3P96A 3M6XA 5CZVA 3GV5B 3FGVA 2ASJA 3OR1B 2E44A 1IXKA 1U1MA 4NLWA 1JLEB 1XR6A 2YKMB 4I7FA 2E9ZA 3SCKE 5KFXA 3I0SB 3EXYA 1LWCA 3P49B 2Z2MA 1ULRA 1IKXA 1MROA 5C42A 1FA0A 3RW6A 4CIOA 4RBUA 4IRKA 4RW4B 1WTFA 4RW6A 5B08A 3QZ8A 1IBLF 2Y1JA 1AFIA 4DV3F 2EFQA 4DN9A 2C2RA 2HHVA 1SH3A 3MOJB 4A8WA 3DRSB 1LV5A 1HBMB 5D4LA 2X1BA 3FRYA 3UCZP 3CDEA 2M88A 2N3LA 5DG9A 2ZC3A 1S6QB 4LIRA 3G8SA 2HFNA 2RF2A 1IJFB 4NRUA 2OTJS 2E7XA 3T3FA 2BE2B 3KJVA 2OFGX 4HYKA 2NQPA 4QYRA 5D78A 1RGVA 2AX0A 2QO3A 3QGHA 3CJKA 1BC6A 1FRXA 1YJNS 2GFFA 3EPGA 2HHPA 4K4XA 2RQKA 2ZUGA 2L9DA 1KEKA 1VMBA 2E5IA 5DDPC 2E5LF 4F3OA 2YNGB 3H5YA 3CO9A 2W7PA 1KHWA 4C3MA 3A8EA 2PIIA 2UUWA 3KHGA 2DNNA 1C1BA 1S6PA 5DQHA 5E5NA 4KO0A 2ZH8A 2DR8A 4C3KA 4X4PA 1DTQB 3I9V9 2MXYA 3NL0A 5AE2A 1ZAWA 1L3TA 2FLPA 4RNOA 5JXSA 3TUZC 2FY1A 4EZ9A 1DTTB 1RTDA 3E8OA 1JK9B 1FXLA 2ZKTA 3AAWB 1BLUA 1ZZNA 1FESA 4TNOA 2Q1LA 2V0NA 3VCDA 3OL8A 4K4YA 2CPFA 3LP0A 4HKQA 3O6QA 1U2FA 1MMLA 4CH7A 4U6PA 2YX7A 2VC1A 3DC2A 1RDRA 3M1VA 3IAS9 2UVUA 3PJXA 3HM9A 1T7PA 2MJUA 2GQQA 1KONA 2B43A 2FTRA 4H4OA 1S1WB 4J9PA 3SV4A 3PFEA 4G1QA 1SXLA 2CQBA 2JZ5A 4NX9A 5KG0A 5J2MB 2BJDA 3GG0A 3MECA 3NGKA 1R0AA 3TNVA 5HMZA 2B4VA 3GIKA 4A8FA 2AJ0A 3TUJC 2XHWA 1T3NA 3LW5C 2DNOA 3LWLA 1RK8A 1OQ3A 1PO6A 4CO4A 1D8YA 1NK8A 1T05A 2JH3A 4P6QA 2U2FA 4EUVA 1HARA 1KTVA 2FJDB 3VAMA 3VAHA 4YOEA 3GR1A 2XULA 5H9FJ 2HQIA 4RW8A 5KFIA 2HLUA 3H59A 3NBPB 2F4VF 1A7GE 2AYEA 2EK1A 3DMJB 3HVTB 3DCAA 4Q44A 3PKYA 2DVIA 3WBZA 1H3DA 3MTJA 3ZZYA 2IAJB 2DBBA 1VQ7S 1R3NA 1O5JA 1KRPA 4DSJA 1VI7A 2IC3B 2ADBA 3BSOA 3QYYA 1F0XA 4IG3B 5I42A 1VQLS 2R8JA 2EKYA 3BREA 1RTIA 5E0OA 3OFFA 1IQTA 2FPHX 3U1LA 4NMLA 1LK7A 3MM8A 2LXFA 5KFHA 2EG1A 3NMAA 2NR0A 2I0XA 4PWDB 1DZ5A 2ROGA 1ZTTA 3UR0A 5D3GB 5CZXA 2HNYA 2J7UA 2VG7A 3W2WA 4DG1B 3N4WA 4QWAA 3O8WA 1XMOF 4ATNA 5DLGA 3H5UA 3MMAA 2YWGA 2DNGA 3PR4A 3RB0A 1Q8IA 2A18A 3IO1A 1NJZA 1VQOS 1RTJA 2VUGA 3M8SA 4ZPCA 2GO8A 4DEZA 2KZZA 4EU0A 4GC6A 5FJ4A 4F3MA 4I69A 4ZDNA 4LJMA 5L1JA 4AE5A 1VQ6S 4M94A 1SI9A 2IVFB 4QU6A 4O3RA 5ITHA 1J5EF 2VB6A 4NLRA 1LW2A 3VQSA 3UWTA 4LQ9A 3DOLB 5J1EA 4DR7F 4PQUB 1KVJA 3HHLD 5T7LB 2B6AA 4DHVA 3T19A 4IH5A 4FNIA 3C3LA 2QZ8A 3IR7B 4GO7X 4EO6A 2BABA 2KHDA 3ZZ0A 3RAQA 1YG0A 2VBWA 4DX8H 2MKIA 3JYTB 2FC8A 4ZKAA 4PXCA 4B9UA 2OP5A 2AF6A 3CJ0A 1JWWA 4NYZA 4JV1A 5D4OA 3FFIB 1RT7B 1QAXA 3N5BA 1T8EA 3W3SA 2LXUA 1HNIB 6FDRA 5D6GA 4RW6B 1XERA 1FTCA 4RW4A 3CULA 3BS9A 4WTYA 1Q86T 4DL5A 1QSLA 1RKIA 1VIOA 4JI3F 2DGUA 3OUYA 2C3OA 2OMLA 1KQGB 2WB1D 4YB7A 3R5AA 5IZHA 3M4XA 2JFDA 1UKUA 1RAJA 4KIAA 1JLCA 2KM8C 2LEBA 4X4RA 2LECA 4J9KA 1X7VA 3DM2A 2W9CB 1VC0A 1TVRB 1JXEA 2BOPA 3RB4A 3OL9A 1QUPA 2V9KA 5J1NA 3CJKB 1N48A 4DOZA 3Q24A 2R7SA 2IJNA 1S48A 1H2UX 4YUDA 5IQ6A 4G1PA 2OPSB 1YHQS 1S9EB 1V3ZA 1X4HA 3EUNA 3FEZA 2V8VA 4LVNP 4TY8B 1S10A 4Y0FA 3LWMA 4LMZA 4ZVHA 2FVRA 1C1BB 5A0YB 2XSJA 2ASLA 3CJ2A 3IRXB 2XCAA 2VONA 2ROEA 4ILRA 3JSMB 2IBKA 1JLAA 1MWZA 2GGPA 1R7IA 1DQAA 4ZP6A 4IR9A 3JB9k 1Q4RA 5F0UA 4R0EA 2XG8A 1Z2LA 1QM9A 2ADCA 4RBTA 3ZFVA 2VPYB 4IFYA 1JLBB 2E5JA 1YITS 4E98A 1YRTA 4TU7A 2P6TA 2FLLA 4ELUA 1TV6B 2RQ4A 2ZVSA 4DS4A 2M70A 3OLAA 3U7JA 3CTRA 1AXQA 1N0VC 1YTYA 2W9BA 3M30A 4G1QB 4YB5A 3PV8A 2ZKUA 4DSKA 3EGWB 4JV5F 2AD9A 1Y3KA 1UA1A 1XR7A 1XBWA 2HS4A 1TKTB 2WW8A 3QWPA 4FP9A 4HDHA 3GFYA 5DM7Q 2JHEA 2PE8A 3MMJA 2D3OR 4WKRA 1S6QA 3K8WA 1PC5A 3M8RA 4B9SA 3VAKA 1JB0C 1VQPS 4C8NA 4K4WA 2L48A 2MQOA 4OI2A 1EP4B 1D9AA 2AX1A 4X62F 1CG2A 1KOHA 1X5PA 3FQLA 1S1VA 3IG1A 2EFGA 5KFGA 3HLUA 3OTEA 1FF2A 3HZGA 3C66A 4AXIA 2DGVA 1K73T 2F7VA 2DGOA 3SSQA 1P1TA 1RJJA 4LVOP 5EHHA 3K8VA 4HH0A 3M8PB 3MHYA 3B78A 4F50A 3TP2A 1N56A 3OVSA 3DLLQ 4A46A 4DSLA 3OTCA 2YNFB 3CCES 4H4MA 2ATLA 3EGZA 1JMTA 1YJ9S 3HHEA 2BW2A 2YH1A 1NH7A 3JTPA 1LFWA 3R5DA 3IR5B 4LT6A 2FJAB 1QY7A 2HAIA 2UV8G 4FXDA 4OI1A 2R7WA 4J9QA 2CPZA 1RTDB 3MM8B 5IT9Y 5B0CA 2J5AA 4RNHA 1WHXA 2UZAA 1R8BA 4ES1A 4G6VB 4ZVEA 5KFKA 2K7JA 2R8GA 2WRMA 3MF5A 3L09A 3BN7A 4ELVA 2JRSA 5EWFA 4PR6A 3FVYA 3I4HX 5JJBA 1GTHA 2HNDA 2IJFA 2UUTA 2BUNA 2IVYA 2L9NA 4IQMA 4NWBA 4TQRA 4DUZF 1NK0A 5B7WA 3PW4A 1SB6A 4OLOA 1GH8A 4QIEA 1E6VA 1NJYA 3L7OA 1DLOB 1SIZA 1TKZB 3POTB 2R7TA 1S99A 3FCHA 1SQEA 5K14B 3VWSA 1FE0A 1BQMA 1C4CA 1LWEA 5J2MA 4OI0A 1HPZA 4DL2A 1MW7A 4RUHA 2YTCA 3I5CA 2ZDOA 4DBQA 3DLHA 1SH0A 2C3PA 5GAHU 5KT6A 1NH8A 3TA0A 2NSCA 1L5UA 3UFCX 2WONA 4EWTA 2QRRA 2MSSA 5KFMA 3BSCA 3RBEA 3AJ1A 4LSLB 5K8PA 3QIPA 4EFAC 2VA2A 3QJLA 3HHKA 1FRJA 3VZIA 2LXIA 2MZSA 5AJ3F 3J80Y 1VRUA 1YGYA 2ZOGA 1FRLA 2JLFA 4ZCKA 2XMWA 4C3LA 2GW8A 2MGZB 3VAJA 2YWKA 1HHTP 4BWJA 2IVMA 4OJ3A 1C1CB 3JYTA 3HVTA 1PSDA 1Q16B 1W25A 1A9NB 1YQHA 1R6YA 2VPZB 1UJ6A 4TLQA 3DRPB 2ZH3A 5DETA 4OHXA 2J9DA 1QSSA 2XMMA 3O3LA 1RTIB 1U6FA 1JLGB 3U02A 4KB7A 3LOUA 4ED3A 3H40A 2MMYA 4RW8B 5A8KA 1HQEB 2F9DA 1S76D 2B5JA 3NBPA 4Y00A 2QA1A 3DU5A 3R3TA 2JLEA 2VPWB 2FUG9 3NKYA 2VFRA 4DF8A 1HBOB 5D77A 2PMZD 1K8AT 4Y6IA 2O1PA 2CZ4A 3V4IA 2WBRA 2YNIB 4LSNA 4FVCA 5J1PA 2W24A 4K5RA 3DU6A 1HR0F 1LW0B 1N52B 4M63A 4X2BA 4ETXA 4TYBA 1M5HA 2XMKA 4ECWA 1JJ4A 1VS3A 4BDPA 2JFKA 1NJIT 4KFBA 3MEDB 1YJUA 4NPOA 4DS5A 3QGIA 4LFCF 3HVAA 5CYJA 1VQNS 1LOUA 3CDWA 4I6WA 2I2YA 5E3PA 4O0IA 4RW7A 2BDPA 1IQZA 4C8OA 3HJFA 2K3IA 3FDSA 2KFYA 4EYIB 2HYIB 1ZZFA 2E1MC 5F0WA 5LXRA 4RU9A 3GIMA 3K5LA 5CYMA 4YB1P 2APOA 3DOLA 5F3TA 1KTQA 1FK9A 2KYZA 2XZWA 1C0UB 4PXDA 3GYXB 5KFTA 3KK2B 4HTIA 2F8MA 1HBNA 2OFHX 2ROPA 4HLBA 1TAUA 1TR0A 3PHEA 5DLFA 3OQ2A 1REVA 2W4PA 2ASYA 4IG0A 1M5OC 4OHYA 3QIDA 4IFYB 2IFXA 4OZ0A 5F9LA 3NG8A 2WAQD 1UVIA 3O5TB 3MM6A 3VAFA 3PO4A 1IKXB 1MROB 3O2IA 4TN2A 4NLGA 5A8WA 3C6TA 1U45A 4DV0F 2Z8QA 4DV2F 1NKBA 3FEXB 5IFMA 3KLFB 2OMOA 4LUBA 3R27A 4R5PB 2YNHB 3MMCA 2FVCA 2Q43A 4CCHA 4ES2A 5KG7A 1UJ5A 2QSFA 3H2LA 3LQVA 4EBDA 3TVZA 4K2XA 4DL6A 3KFWX 2J8AA 4OJHA 3HDSA 4CO2A 5H9EJ 2KM8B 3M32B 1UW4A 4IOBA 3G4SS 4C8LA 2ZE2A 4QIVA 2ZDPA 4F25A 3CD5A 3I9ZA 3LP1B 4YFUA 3TARA 5KFEA 1HL6A 2LA4A 4CT9A 1XWLA 5GAEI 3G96A 3EZ5A 1NEEA 1S1UA 3FRZA 3OTOF 1U1OA 3ETOA 2Z4PA 2W9AA 3RRGA 1N5TA 4EYHB 2XLKA 4J9MA 3V6HA 3VZHA 2D1CA 2LQJA 4B3TF 4QIWD 4MIWA 4DSEA 2V4JB 1MNEA 1IR0A 2EI5A 2J7KA 2YX1A 3S8SA 2J0QD 4QW8A 1HMVA 2DK2A 4RW9B 4HL9A 2D9OA 4ECRA 2NYIA 1FRKA 1X4CA 2P6SA 2D3UA 2FJEB 3PR5B 4DFKA 3OW2R 3HKZD 3I32A 4Y2IA 5KOWA 2C28A 4NZ7A 5T41A 2DO0A 3FSYA 2FHJD 1OPZA 2M8DB 2OD4A 2OJ3A 2J9EA 5M2PA 1NAQA 4JBCA 4RBVA 5DJBA 2FJXA 5HLFB 4LF7F 3I0RB 2DNKA 2RKIA 1FKAF 4A4JA 2L08A 5KFNA 4ED6A 1OPIA 2F40A 1FJCA 1R8PA 3PX4A 2KZMA 1R89A 4CQ1A 4ES3A 1T03B 2MKJA 1X5TA 2R2RA 3EZUA 3GIIA 2FB0A 3DLGB 2PEHA 1Q53A 2WK4A 2J0WA 2DO4A 3AH6A 1WEYA 3JTOA 3MEGB 5I3UB 3RB6A 1VRTA 2CPHA 4RNMA 4B3OB 4CO1A 2JC1A 4X4SA 3GSDA 1KQKA 1FRIA 3IBWA 4DQSA 2IAJA 3K58A 7FD1A 2GHPA 3OR2A 5J2PB 5C24A 1WACA 2OKQA 2I8EA 2E5GA 2KU7A 2YKNA 4ZCMA 2W25A 3QAEA 4MK8A 4C8KA 2YQ3A 3KWMA 4OJ1A 1F9FA 1U48A 4Q2MA 1WF1A 2AJFE 3NCQA 1FHTA 1FD2A 2JEIA 4YB6A 1TKTA <