3D0HE

Crystal structure of spike protein receptor-binding domain from the 2002-2003 sars coronavirus civet strain complexed with human-civet chimeric receptor ace2
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
179
structure length
173
Chain Sequence
b'PFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLKDYGFYTTSGIGYQPYRVVVLSFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Angiotensin-converting enzyme 2
publication title Structural analysis of major species barriers between humans and palm civets for severe acute respiratory syndrome coronavirus infections
pubmed doi rcsb
source organism Paguma larvata
molecule tags Hydrolase
total genus 30
structure length 173
sequence length 179
chains with identical sequence F
ec nomenclature
pdb deposition date 2008-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1840 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3d0hE01
4XAKA 3D0HE 3SCKE 2DD8S 4ZPVR 4ZPWR 4L72B 5DO2A 3BGFA 4QZVB 2GHVC 4KR0B 2GHWA 4KQZA 3SCLE 3SCIE 3D0IE 3D0GE 4L3NA 4ZS6A 2AJFE 4ZPTR 3SCJE
chains in the Genus database with same CATH superfamily
4PQAA 2NUUG 2DGVA 3VAGA 4RNFA 4DUTA 1NJYA 1XWLA 2EWHA 5A8RA 1HLWA 4HKQA 3R5CA 4UT4A 3MMCB 1TK8A 1WEYA 4IH5A 3POTB 5LL6d 1RT7A 3DN9A 1KP6A 3KWMA 3DRSA 2C1EB 1IR2A 2DGWA 3K5PA 4L72B 3BSOA 2ZDPA 3LAKA 5KFGA 2CRLA 3DRRB 2M3DA 5E5NA 4LF5F 4YR0A 7AT1B 3R7SB 4F2RA 4USUA 1WTFA 2ZNZA 4QQBA 2OSQA 3HXMA 3D1OA 1V3RA 2BJDA 1DBDA 1HBMA 4RW4A 1KD1T 3B54A 4DV7J 2YNGA 1SKRA 2V2QA 3UN2A 4G3IA 5HL7Q 2EG1A 3PJ9A 4NLYA 1TL5A 1VRUB 2VPYB 4LF1A 4EBDA 4U8YA 4TYBA 4WYWA 2CJ9A 1S97A 2RS2A 2CNOB 1KLMA 1HBOB 2Y9HA 4DN0A 1F2HA 5FJ4A 1EHWA 5EX3A 2M52A 4MH8A 3HKWA 2RSQA 3L3CA 3H5UA 3W63A 3ILOA 2JRSA 3DLJA 2KYZA 4ZP9A 2Z2YB 1W2BR 3QQCD 1G2EA 1TKTA 1Q79A 4DR6J 4YFUA 1CJUB 4M5DA 1WI8A 4ENOA 3MCOA 3OFEA 2JJ4D 1R0CB 1BUXA 4M5MA 3GFHA 1T9UA 1RWNB 1S10A 1FTCA 5HQMA 1S0VA 2ZOMA 4OZJA 4DR7F 2CJXB 2OUGA 4LMZA 4JI2F 1RHJB 5LM7E 3MEDB 1SKSA 4Y00A 4EO6A 3BPDA 1XC9A 1GMWD 3BYRA 4TU8A 4QW8A 2B8QA 1PBAA 3LPEA 2B4UA 3BGRB 4B3SJ 1VGYA 2VASA 2RUSA 1YGYA 1VQPS 1TTHB 4JI3F 4Q43A 1YJ9S 1FWKA 1GNKA 2B56A 4M5KA 1YK9A 3A13A 2FD2A 2VU5A 2A10A 4QIGA 1FERA 2GMJA 2DY1A 3IWLA 2E7XA 2V67A 3IM9A 3QJJA 1FFWB 1HW8A 4DFJA 3IP0A 1TU0B 3OFGA 1ZBTA 2HW3A 2EC0A 1JLQA 3KLFB 1NHVA 1LW0B 2NR0A 1U1MA 1BQMB 1NK4A 2IA6A 2CJYB 3J7A1 4K4UA 2NZ4A 5ETTA 3NBPB 2FHJD 3TZYA 2E5GA 2ROGA 2XSJB 4GKKF 3RR8A 3MM8B 2OKQA 1KLNA 6FDRA 1IM6A 5A76A 1RE1B 3DCAA 2Y1RI 4IRKA 3GE9A 3MCMA 1XNQF 4PZVA 2UUCF 1NKCA 2R4FA 2K2PA 5LXYA 5FLXU 4LF7F 4QIVA 3GYGA 2IAJA 1Q81T 2XNRA 2HFOA 3OUYB 1TKXB 3HKZD 4GO5X 1RTIA 3TAQA 3PW5A 4I6WA 4H4OB 2ROEA 2ZJPQ 3IC1A 5KFWA 2E5LJ 1IKYB 4O3OA 2KXHA 5I3UB 5CZVA 1Z4UA 2HBZB 2L41A 2ZE2B 4IDKB 3NL0A 3GTYX 2ZUGA 1AA1B 1CG2A 2D3O1 5JJBA 4LF2A 5B7WA 4M95A 3CSKA 4C8LA 1RT2A 5EWGA 2OPPB 4CDIA 3RB0A 3KUGA 4G1QB 2XY6A 3W8PA 2BE2A 1CJKA 4DS5A 1WTBA 3PV8A 3SCKE 3BO3A 4NLVA 4HACB 3K17A 5KFBA 2W2MP 3OR1A 3HSGA 4NEZA 1Y10A 2N3OA 3L95X 3IS9A 1KQFB 3VGUA 3OLBA 3OHBA 8RUCA 2DGUA 1QM9A 4Y2AA 1CJVB 2HHUA 5DLGA 1AUSL 1SJ1A 1WKJA 3TR5A 1MU2B 2BABA 2LFVA 4NYZA 2QLFB 2YWWA 4MKAA 1JNRB 1GFWB 4OI3A 3MUVP 2QEXS 4G65A 4I2PA 4O3QA 1H2TZ 1NPKA 3G8SA 4E2FB 2IYIA 4WU3A 1Z2ZA 2QLBB 3AB4B 4DQIA 2GZOA 3MDFA 1YRUA 4NXMF 2RU9A 2J7UA 1HBUB 3O5TB 2FJDB 4P2SA 2F65A 2D69A 3N28A 3B8HA 2GS8A 4ZVTB 3T5HA 3CD5A 2DR8A 1LXJA 2QSFA 2UUAF 1CBKA 2CPDA 5ETMA 3OHAA 1K73T 3D6TB 2AEFA 4QPXA 1LW2A 5FDLB 3EGNA 4DPTA 1U47A 5EX0A 4HTIA 1FA0A 5CAAA 3VV2B 2KFZA 1TMJA 4CM0A 3ILIA 3D1QA 3KUHA 2UUTA 2VOPA 2WSEC 3BH7B 2VHGA 1DQ9A 4CO2A 2FC8A 5HO4A 4NASA 2EBEA 3FRYA 5IFMA 5J2NA 1KQGB 3MMBA 1F1BB 3QIPA 4FBTA 4MT1A 1R0BG 4B17A 3N0VA 2YBVA 4OYIA 4WF9Q 3OD2A 3PW2A 5KG3A 1JKHB 4M94A 5ETVA 1XTZA 3RZAA 2IRUA 3VWSA 5A2QY 3TVKA 1SC3B 3MPDA 2MHNA 1VK3A 4YMEA 4TY8B 2HHSA 2OFHX 1OJ4A 3DXBA 1ZYQA 4RWWA 2FLLA 4QW9A 1XR5A 1J27A 4KV8A 2CQ2A 2VD3A 3NGSA 1RU2A 5DDOC 1ZA2B 4OIXA 3MCSA 4ELTA 5DM7Q 2E5IA 2W2QP 2J9DE 2P6SA 3ZXWA 3VGSA 3DOLA 3QSIA 2ZOGA 1JLFA 5L9NA 3P45B 3MM5A 2XGQA 2GIFA 3W2WB 4ZVUB 5A8RB 2EPIA 2V8PA 2VQEJ 3GCXP 1UAWA 3B78A 3ULHA 1RT7B 3R1HA 3DRSB 2O5DA 4DDFA 1OMSA 4ZCLA 5I42A 3EVWA 4NA3A 2OLWA 2EFQA 1J5EJ 3SMZA 1AB8A 1SJ3P 4X64J 4Z37A 2V63A 4AL5A 2HWTA 1AUDA 4U7UK 4DSIA 1R8PA 3BGLA 5M2RA 4YUDA 2XEXA 1L3UA 2OFGX 2KG1A 4DL5A 8ATCB 4FNIA 2PE8A 4YB1P 1F5BA 1HBMB 3OW2R 5KFHA 4RW4B 1FDNA 2F4VJ 4CLSA 3QPIA 5DZ7A 3R5BA 4KSEB 2YNGB 4HL9A 3UDEA 3E01A 4UQTA 3HI9A 2MKJA 4IR9A 2FJXA 3QJLA 4MKVA 1KBRA 3UDVA 2Z2LA 1FKOA 4N76A 2CNNB 1ITPA 1OIAA 1YX2A 2PD1A 3ILLA 1REGX 1HKAA 3CJSA 4A8SA 1KLMB 3LOUA 2MJNA 4LF8F 1SV5A 2XI2A 2AJFE 4LR7A 3UCGA 3NOGA 4QR0A 1UZHA 5CH7B 1VK8A 1V6HA 3IA0A 2YKPA 1TKTB 4L6V3 3ZZZA 3HFKA 2Z2ZA 4M5DB 2JLGA 3ISNC 1QAYA 2WW4A 4J9OA 1SBRA 3KG0A 3LTOA 4DPYA 5FIIA 4TYAA 4ZK7M 3QLHA 3M8QA 3HX9A 3VR1A 3IG1A 3AJ2A 4FYWB 2QA1A 4NPOA 4K50A 3CDWA 4AUKA 1Y4ZB 2UXDF 4ZHRA 3H8YA 2HHTA 2XC9A 2PN6A 2XMVA 2MZ1A 4PQUA 1N5TA 1NH7A 1D8YA 1S1VB 2HLTA 4RWXA 4CLKA 1X60A 3KTQA 2RRNA 2FVQA 5KFTA 5IXUA 3M05A 3L7UA 5F0WA 5D78A 5J1NA 3VAHA 4BC7A 3MECA 3ETOA 1HWUA 2DNZA 1UJ4A 2PI5A 3G9CA 4BWJA 2JLEA 3Q89A 4DV1J 2HVIA 3I0RA 4WZQA 5DJBA 3IRWP 1XR6A 2CVEA 4OYWA 3M8YA 2ERRA 5KOWA 2YY3A 2OGUA 3GIIA 3H40A 4EEYA 5H9FK 5F3ZA 3QT7A 3IBCB 4RUHA 4K5RA 1JLQB 1FVQA 2VFTA 3DLHA 3JSYA 4WFBQ 3ELHA 2DR7A 4L74A 3CDBA 1RWMB 2GVZB 3M6UA 1MROA 3DOMA 1RB0A 2QJ3A 3G86A 2DNGA 4DI6A 5GAGU 4NI2A 1X5SA 3M30A 3CB4A 3QRRA 1KRPA 3BR8A 1OY9A 2XTJP 2KRBA 5KFAA 4DQRA 2R2TA 1S4FA 2VPZB 1APSA 2VODA 2IAJB 3U1LA 1T94A 4PKDB 3I6PA 3BDEA 2N4CA 1RTIB 3P6YC 1OO0B 3CXCR 1HNZJ 5LSOA 3D0IE 2FGOA 1Q8IA 5DRKA 2UUBJ 2VG5A 2B5JA 3O2IA 4UY8T 1U45A 2I6WA 4ANDA 3U1NA 5LMNJ 2XSFA 2KVQE 2R9LA 1DQAA 1QLNA 5K9FA 2R42A 1VISA 3GIMA 1RT2B 1YLXA 1S0OA 4K4SA 2GJFA 3TAMA 2XLIA 2OIHA 2A6MA 3QATA 2J9CA 3RBZA 1AFJA 2K7KA 2DITA 3HSJA 4CNZA 1UVNA 1CJKB 1HWLA 4DN9A 2C3UA 1DQ8A 3CJ4A 1QD1A 1X4HA 3JQJA 1NJIT 1IXKA 1MWZA 2J6UA 2HGNA 2NXNA 3IS9B 4AE5A 1UEKA 1F5AA 1SJQA 4P52A 1RT1A 2W2OP 4N5SA 5IQ6A 1VC6A 4RW7A 2UU9J 3L09A 2JOQA 1WSRA 5DQGA 4ZLNA 2XG8A 4I2PB 1OQ6A 5B08A 3CCRS 1RKIA 2Y1LB 3NKYA 3SYZA 4DFPA 3KXDA 4IRCA 4Y65A 2HIQA 5D0HA 2HFVA 2W4PA 4BCAA 4PWDA 1FWLA 5BYSA 3FSIA 5L1KA 4RBVA 1SB6A 4CP5A 5E33A 3BBBA 1XNRF 4NYPA 2EVZA 3DFEA 1IBKF 2OHDA 2EFNA 1VCTA 5KG4A 5H9EJ 4PEOA 4V1Ak 2D3OR 1NBEB 4LFAF 1A0OB 1R0AA 2L9NA 2HQGA 3ETMA 2NXJA 1CSJA 1DAXA 1LW2B 3Q83A 4BC9A 1FDDA 3W61A 2BE7D 2E1MC 3BH6B 3OTCA 1TKZA 2M9KA 3C15B 4OHZA 3JQKA 3HULA 4ECWA 3OJUA 4BDPA 1O0PA 3T1HJ 4FBUA 2X1AA 3UN3A 4Y6IA 3LALA 1DZ5A 5JMNA 4R5PA 5J2NB 3MMBB 1BXNA 1HFEL 3QIPB 4LSZB 3R3TA 2CYYA 4YR2A 2F5GA 5KG7A 4J9UE 1Q4RA 4PG7A 1C0TA 2L08A 2V69A 3RW7A 2EFPA 6FD1A 1AFIA 2FIUA 1AZSA 2A3JA 2V2KA 5D6GA 3SV4A 3VHQA 2VFVA 3GSIA 3ZZPA 1U4BA 1WC5A 2OTJS 2EC2A 1SCJB 2RT3A 4KV8B 3IR6B 2HNYA 3LGHA 3H25A 4NLUA 4BHQA 4ZKAA 4QYZJ 2XCPA 1DLOA 1KN6A 3RU0A 3C19A 3QAUA 2HK3A 4B9TA 1T0TV 2Y0BB 2HHPA 1WOOA 4GKJJ 4LVNP 2KO1A 1VQ9S 5D8HB 3DOLB 4PYAA 1SXLA 4ZMMA 1JLFB 4FNHA 4P74A 3MM5B 2DR5A 1FX2A 4ED4A 4FXVA 3JTNA 3M32A 2KZMA 2VICA 4DF8A 3EMTA 2MSTA 3CUNA 4ECRA 3AA8A 1U24A 1U25A 5I42B 3ZZOA 3G6ES 1QUVA 2MY8A 3EPIA 1ZA1B 1NK5A 3KYLA 4QIWD 1NKEA 1L5UA 2PEBA 2VOOA 4LQ9A 2GAHC 3TX8A 3VZHA 4UUWA 4F3OA 4P71A 2BV3A 2DGXA 3AY0A 2MZJA 4RR5A 4IUFA 2J9EA 1HNZF 1F3FA 2IHR1 1DRZA 1VQ4S 4NOHA 4NLRA 2UUBF 4NWBA 4RJVA 4YY3J 2E9RX 3TARA 3DDIA 3G71S 5JXSA 3E01B 3PRDA 1WSVA 5AJ3J 4U95A 5KFIA 1ZM2A 2DCUB 5KFYA 3H42A 4FP9A 3PXGa 1UL3A 2FB0A 1FKOB 4DS4A 2RAQA 2OO4A 2PDAA 4ID8A 4RPFA 3SSRA 3C6UA 5HBMA 2ACYA 3FVYA 2GJIA 1PCAA 3UI3A 1SV5B 1HI0P 2CWXA 2Z0GA 1LWXA 1KVKA 4A8WA 1WG1A 4FKXA 5KFXA 3BGOP 5HVFA 3B4MA 5T7LA 1XMBA 3EE3A 1ZAWA 3F56A 1YTYA 1X4AA 1X4DA 3M9OB 5E41A 3LW5C 4B02A 3KK1A 4CM2A 2VH7A 1UETA 1VOMA 3BQ2A 1XEZA 4TXSA 4DV0J 3R5JB 3G6VA 4PXBA 2FLPA 4M5NA 1NSAA 1HNIA 4ICLA 2D1CA 4OX9J 4OQJA 3QLHB 3UCUP 3M8QB 3P8BB 4DPUA 3IG1B 4B3RJ 3MPWA 2KT3A 1N36F 1OPZA 4H4KC 2UUWA 1YRTA 3FNNA 3VVTA 2VG6A 1LNQA 2JFDA 4DV2J 3CD6S 4PQUB 3ICLA 1ZZNA 4WPAA 2PT0A 2CJQA 1HQ2A 2WOMA 1KHVA 2VJVA 3EICA 2UVRA 2VBZA 2NPIA 4ED1A 3ENVA 4DL0C 3R97A 2YNFA 3MECB 2CPEA 2YNHA 4OZ2A 1RYRA 3BSAA 5HK4A 2IJRA 4HVZA 1Y11A 2B4OA 3J80Y 4USHA 5K14A 4ZPAA 4ED0A 1NAQA 4DMZA 5LSLA 2X1GA 1VC5A 1HHSA 1FXDA 4JI6J 3I0RB 1S6OA 2KN4A 2C28A 4J9RA 4NLQA 2E9TA 3IBFB 1PYOB 2GMLA 3PKMA 2B7BB 1WF1A 4J37A 2ZH5A 5E0OA 1U1OA 5KFQA 2V8DA 4A8KA 1NSQA 1MROB 1UZDA 5HMYA 3QNWB 2A0FB 3DOMB 4JI8F 2SXLA 4A48A 2GIRA 1EKRA 1FD8A 3CDUA 2ABYA 1ZM9A 3QO9A 1LWCA 3KHHA 4X62J 2V9WA 5IT4A 2AX1A 4NI2B 3M30B 2KG0A 3TW0A 3EZUA 5KFDA 3EX7B 2O66A 4QJVA 3T6BA 2BQ3A 1ZH5A 3DU6A 3MM9A 4KHMA 2MQPA 3MZIA 5C24A 4DSKA 2MKHA 5AE3A 4MK9A 1T9TA 4DCPB 2XHWA 1N52B 2LXFA 5AT1B 4OI0A 2M8DB 4DHVA 3TUIC 3AD8C 4FS2A 3G8TA 2OEMA 4GKJF 5D0RA 3J81Y 2KHCA 4NLSA 2A6OA 1KQSR 4USMA 2BDPA 2VG5B 2B5JB 4EMDA 1U1QA 5E3PA 4U96A 5FD1A 3S8SA 4GC7A 3H5SA 2XYPB 3CULA 3EDRB 3H2VE 3KDOA 2VPXB 4CI0B 1T9VA 5B0GA 1RISA 1VYAA 2FJEB 1JXVA 1R43A 3TAMB 2WVBA 4KGXB 4UOFA 4E98A 3I9V9 4ZPTR 1VIXA 4EBCA 1F6TA 1M5SA 1MMDA 5HQLA 1JIHA 4EZ6A 1LQ9A 2QGFB 4OX7A 3FK4A 4HHJA 1SH2A 3DYAA 4UTGA 2DNPA 2WRMA 1S57A 4J9LA 2DNQA 2YWKA 4CWBA 1IM4A 3KJQB 4B9LA 2NQPA 4IH7A 2IMWP 4RX6A 2ZZTA 3KFWX 2XLJA 2EFGA 4NYOA 4K7QA 1NDCA 1OSDA 1S9EA 4K59A 5IZHA 1M0SA 5AXMA 4Y2KA 1HQUA 1RT1B 3GPAA 4YY3F 1PO6A 3Q86A 4RW7B 4EU0A 2ZUAA 2I38A 2NREA 3SEOA 3D2WA 5LSRA 2BACA 1R6YA 1U1RA 3TWZA 2ZC4A 4LUBA 2R7XA 4IQXA 1H7XA 2PGCA 2BBEA 1YJTA 1U6ZA 2J9DA 3GV7B 4FF1A 2EKNA 3F41A 2BYCA 2QA4G 5A8KA 2JEJA 4PWDB 1VQYA 4YHHJ 4OX8A 5IOLA 4ZCMA 1U1NA 1S6UA 1RABB 3RJMB 1RAEB 3OL8A 5CD4H 3VALA 5F8NA 3GR0A 1QAIA 2VF3A 2HVEA 1PC4A 1N5QA 2F40A 3EVMA 2AT1B 4DQPA 1R0AB 4I6YA 4ZVFA 1O6XA 3M6WA 3J7YI 1LFWA 3J7ZT 2HKEA 2OMLA 4ETXA 4AD6A 1CS4A 1TKZB 1NDLA 4RBUA 1XMOF 2KH9A 2P6TA 3R7BB 3OTOJ 5BR8F 2G2ZA 4RBTA 4R5PB 1MSWD 9RUBA 1RU1A 3BGFA 4EK2A 3I56S 1IBMJ 1NRKA 2D74B 2IM2A 3O44A 4IG0A 4LF4F 3HT0A 2RQCA 4JYAF 5JVHQ 2AP6A 2PA8D 1Q8KA 2V50A 2WCXA 3V4IA 2YH1A 2ZHAA 4J7CA 1AZSB 2FVPA 3NNCA 3DLLQ 2J8AA 3U7JA 3BB5A 4OJGA 2VONA 1GMVA 4P7VA 4Q2MA 5K5MA 2HNYB 1NNDA 3IWXA 2O67A 2E5HA 4KKOA 3KNGA 4JI6F 1DLOB 4MKYA 5F8HA 1GAOA 1HI8A 1WHYA 3PX6A 4YB5A 2MZQA 1IWAA 2HZCA 3ZZ0A 4OZ1A 2W8LA 3UPFA 3N4WA 4BS2A 3GJRB 3J80U 1S0NA 2XNQA 2XY5A 4KQZA 3CCUS 3PIOQ 3M32B 5GAHU 4XPEA 5GAEI 4JI4J 3MEGA 1N33F 2GIQA 2UXBJ 2DNKA 4L3KA 4C0BA 1C2PA 1YJWS 1TL7A 5CXTA 4IOBA 2CJBA 1TELA 3CJQA 1RJJA 3VAFA 5LJ5Y 1NK9A 4F0HA 3UD4P 1S4EA 1MG7A 5HSPA 2RB7A 1H73A 5IT9U 3CNQP 5LJ3Y 3D68A 3MM7A 1QE1A 3JTOA 1B7FA 2HQFA 1IKWA 1T8EA 3NRBA 3TZWA 3EPGA 4DQQA 3K7RA 3C66A 2OI2A 2YWGA 4I4BA 3RAXA 2HBYB 2HNZA 3BDPA 1R8AA 2QTWA 5AXKA 1YDLA 4NRTA 2ZFHA 1R8HA 5HJXA 2C2KB 2BRKA 5CABA 4JI1J 4F8RA 2GHWA 5ETQA 1U7LA 3C6UB 5HBMB 3TRGA 1U0HA 4PG8A 1NPPA 1YZ7A 3K8WA 2BJ1A 2BQRA 1MLAA 4QR2A 1S77D 1WC6A 3MTKA 1SVDA 2BVZA 5T7LB 2I1RA 1VLOA 2RDIA 5L46A 1VBKA 2P8IA 4EYIB 4TU7A 3OL9A 1B0VA 3KK1B 1Q5VA 3P3DA 3CDAA 4ECTA 2K3IA 1MWYA 1OY8A 1BC6A 3I9ZA 1HNIB 1MWQA 4DJBA 3WC2A 4ZLJA 4ICLB 4ZVPB 2YWEA 1A6LA 3KJNB 1TAQA 4C3MA 3SQGA 2UXCF 1K0VA 3DHXA 4WJBA 3MR3A 2ZHBA 3LP0A 1S1TA 5ETPA 3IN5A 3HHNB 4OLPA 4ZVQB 2VG6B 2C2OB 5D4NA 3CJTA 2VBWA 2D41A 3AQPA 4DZ6A 3BN4A 2KDOA 4WBFA 1VRUA 4N41A 2WOMB 2HZVA 1PAEX 3BV8A 4IFVA 4KPCA 3NCRA 4XPCA 4DBQA 1VBZA 1AXQA 1GQEA 1UA1A 4UUXA 4DFMA 5C2GA 1FFGB 1U1LA 2YNFB 2YNHB 5K8OA 4I1TA 4LF6J 4NLWA 4C48A 2KJWA 3NGUA 2WSFC 3I5CA 5CQGA 3H4BA 2KM8C 7FD1A 5K14B 3FEZA 1X4BA 4Q8FA 2DHSA 1IBLF 1FJEB 4Q8EA 5BYQA 2ZITA 3W66A 2CG8A 1HD0A 2ZJQQ 1ROFA 4FF4A 3JSMA 1NJZA 3PEHA 1QVFR 4MMOA 2Z2MA 2LDIA 1UVIA 3G87A 3QO9B 1LWCB 4JV5F 4ECVA 4JI0J 5GADU 3PEJA 2KM8B 2CJKA 1SIZA 1FDAA 2ZVSA 2H5JB 4P72A 4EYHB 2GHPA 1S5ZA 1Y9OA 5G0RA 2ALZA 1RTJA 2QMUB 1S76D 3MM9B 1C1CB 3E2EA 3CJKA 5KFMA 5C24B 3AD9C 3V6JA 1IKXA 3IR5B 8AT1B 4OV1A 3AFGA 3EGVA 4OZ0A 4ZN3A 5KTQA 3FKBA 1RP5A 2GQ2A 1S7HA 1BD6A 2DJWA 3QZ7A 1WKKA 2WK4A 2HQIA 1FKPA 4I6AA 1S0MA 1FT8A 4ED8A 2O01C 2CQ3A 4NLTA 3K5LA 2ZH2A 2IDLA 2LMIA 4F36A 1KVIA 2LEPA 2RIJA 2QL5B 1TMMA 2C3OA 1TL3A 2CUYA 3T3FA 4FF2A 2Y8WA 4FVCA 1NSKL 2ZDOA 2Z56B 3S6EA 2XWYA 2JC1A 3NCPA 2PFDA 1BQNA 3K59A 3DYAB 4F3MA 3QT8A 2XM3A 3HT3A 2DEIA 2KT2A 3D66A 3DLGA 3MUMP 3QFHA 3FDSA 2P9EA 1S9EB 3RTVA 1HQUB 3W2VA 1RQ0A 3FGVA 4I67A 4DV3J 2W4DA 1NSPA 3MTJA 1FXLA 2I0XA 1PJ7A 5KFNA 3SI8A 4OI1A 1X0PA 2V2VA 3G6XA 1FEHA 3NNAA 4DR2F 5CHCB 4DWIA 1IKYA 1OY6A 1HPZA 1VHIA 3VAIA 3CGIA 2QG9B 2Q43A 5A8KB 1WC3A 1YKWA 1E6YB 3FEYB 4QWBA 4F3QA 2LXUA 4P7TA 3BZQA 5E3AA 4ZP6A 2HIYA 3MFIA 5AE2A 4KB7A 1UFLA 4FYYB 1KSPA 4IRDA 1SJFA 3MFHA 4DQSA 2QLJB 3IWNC 3GCWP 3L4BC 3R5GA 3PHEA 4HH0A 2IA0A 1IQZA 1OYDA 2OELA 2QO3A 5HQ8A 1LV5A 3CC2S 3S1TA 4A8YA 3D6MB 1SKWA 2VKRA 3JSBA 1V9OA 4X4VA 2CFXA 3W3SA 1CS4B 1CQNA 4WKRA 3PR5B 2IM3A 2RRBA 4KO0A 1VQ5S 1FEEA 3OVBA 3NCQA 4G6VB 3IGVA 1OYEA 4IG0B 2WB4A 3CW2C 2JHEA 2KT5A 2LQBA 4RNNA 1P1LA 2J8SA 3HVTA 1HARA 3NMRA 2KTQA 3V4IB 2F8HA 2AX0A 4ZIVA 3CCJS 5AXNA 3A3PB 3IGNA 4QWCA 5AE1A 2W01A 4DR7J 1W2IA 2J6TA 4DCJB 1VMBA 1HNWF 4JI2J 1UVMA 2EK1A 4K5SA 1TK0A 1D09B 4K2JA 4AL7A 1D1UA 3VQTA 1EP4A 2NXCA 3THPA 3DMJA 3N6NA 5CYMB 3DLBA 4KKOB 1U6FA 3JXOA 3GU0A 4JI3J 1I5OB 4URSA 4WK1A 1T02A 3LF0A 5MLCV 4JP8A 5DDQC 3DRXA 1PJ5A 2FVCA 4F25A 1MMNA 1RZMA 4Y3CA 5L39A 4P10A 2XWXA 3IFEA 3CE8A 4KIAA 3G6YA 4X4QA 2ASLA 4DUZF 3ENWA 4FPIA 1LWFA 2FHOB 2UZAA 1V5IB 5DZ6A 2UP1A 3SZ2A 2RMLA 3MEGB 1GK8A 2XYGB 4DLGA 3ZZRA 1JX4A 4JV1A 1TL7B 3EYZA 3M8PA 4LBPA 3MMAA 3RAQA 1FVSA 1X0FA 2HAFA 3G2XA 4AXIA 4DOZA 4I56A 4OX6A 1YJNS 1EAYC 2Y8YA 4PG4A 2AJ0A 2OD6A 3CMQA 5IM0B 4TY9A 4GKKJ 2F9DA 2NUHA 1Q7YT 1H98A 4XAKA 3JAMY 2IRXA 1VIOA 1H3DA 3ZTRA 1SJRA 3M1VA 4OV6A 3MM7B 1QE1B 1XNQJ 2UUCJ 1IKWB 3KKFA 2AD9A 4LF7J 2W4CA 3QSYB 1P6TA 3LO3A 4B9VA 3QYYA 2YNIA 3EVOA 3TJ8A 3AJDA 4IG3A 3DNCA 2CG4A 2HNZB 2G0JA 3C6TA 4JI5F 4DU8A 3DI6A 4RLEA 1GMWA 2V8VA 4RW9A 2F63A 3Q2TC 2D3ZA 4NX9A 4DL4A 1M5OC 3CO9A 1TKDA 1NDKA 1U0HB 4MIWA 1FRXA 3V6HA 3D5MA 3W2WA 2HEKA 4W90B 2WBMA 2CDQA 4J9NA 3MOZA 1HQEA 1VC0A 1N34F 4ZOSA 1WHVA 4LSNA 4USTA 3LGNA 4LBHA 4ZLLA 5D3GA 1W25A 2CPZA 5EWFA 3P4UB 1T11A 1R89A 1FFSB 5EGYA 1EARA 4PPDA 3T1YJ 4DV3F 4CLZA 2K3KA 4OHWA 4X65F 3MI7X 1MNEA 1Y00A 2DK2A 3DC2A 2B9YA 3SQGB 5H9FJ 1UTAA 1KHWA 5J2MA 4XK8C 3R2DJ 2GFFA 2R8IA 4ELVA 4F50A 2W7PA 4KHPF 2QFIA 2FHJA 3LP0B 1S1TB 4PXDA 2QL7B 3JTPA 4LIRA 4USKA 2ZD1A 2FY8A 1TL4A 4F2SA 2JX2A 3ZTOA 3CPWR 2F1FA 4M5HA 4IFVB 1HW9A 2PO4A 2V2ZA 4LRBA 1LFPA 3D7SB 1Q8BA 3C14A 3MEKA 3RB4A 5D4LA 4V19J 3OTEA 2XY7A 4OJ3A 3TA0A 3PJWA 4NXMJ 5C25A 1H74A 3V5RA 2J76E 4TN2A 4KGZB 1HNXF 3EXCX 2FHMA 4ZP7A 5LT5A 3RBXA 4DCOB 4NCAA 5F8GA 2WB1D 2DR6A 2UUAJ 3M2UA 4RUBA 1X8DA 2AJ1A 5CCLA 3GG0A 2JVRA 3ITHA 4PRFA 2M70A 2EG2A 2CWKA 3HVRA 2KL8A 3D3BJ 3JSMB 3KNAA 4DZDA 2ZKTA 2BR0A 3PR4A 2OD4A 3TVYA 4URGA 2BX6A 2VKZG 3D54A 1U1KA 1H38A 4O0IA 5M2UA 1RTZA 1FJGJ 2AV5A 2FZKB 4FXWA 3M9NB 1X4EA 1NK0A 3Q8YA 4YB6A 2LP4A 4XIUA 4FZVA 5G0RB 1RTJB 1S1VA 2FJBB 1D9FA 5KFOA 3A12A 3CJKB 2YKOA 2VJUA 3RG6A 5KG6A 2E7WA 5KFSA 3TVZA 2GC8A 1IKXB 2M5YA 2EFVA 2R8JA 3C8YA 1RTHA 1N0UA 2DR9A 2L9WA 3FBEA 1DJ0A 2BM1A 4B9SA 4RW6A 1WD6A 2RJZA 4KH1B 3DXSX 1RGVA 5E3RA 5CA5A 2POKA 2KU7A 4JV0A 1FKPB 4J9SA 3I96A 1TZ0A 2O3DA 2RILA 1YVFA 1QDUB 1FRLA 4DG1A 1W7WA 4LQ3A 2CNKB 3VAJA 4K4ZA 2PSZA 1X5TA 1RT5A 2ZBCA 1TL3B 1YJUA 3CCTA 3PX4A 2HHHF 3QBCA 1NJXA 2V9KA 2AQ4A 1B7YB 2F7VA 1S9GA 1BQNB 2HYIB 2GVZA 1REVA 1NKBA 2BKOA 4L73A 4KGKA 2AU0A 3DLGB 1WF0A 4DF4A 3SXLA 5KOXA 2JSXA 4ILMA 3V4MA 2RHQB 3FZ2A 2GO8A 3W2VB 3TQ1A 2H5IB 4B9UA 3HHLD 4GC6A 2W9CA 2V4QA 4Z7YA 3CEDA 3HCXA 4DV4F 1X4GA 2JFKA 3MPYA 3D67A 1V3SA 1QAXA 3BR9A 4LRDA 4TU9A 3FFIA 3PYFA 2BE9B 4FDFA 2VQFF 2HVDA 1RHRB 4N8OA 3LUYA 4OI6A 3AOCA 2DNYA 1HPZB 3PW0A 1Q1KA 3MPVA 3JAMU 2CVIA 3SFUA 3WX4A 2IPOB 4OZ3A 5KG2A 2XB2D 2ZH6A 3UNGC 4NXNJ 2XZTB 1RHKB 1WOSA 1KS2A 2W25A 6AT1B 3H0PA 4C8OA 2FZGB 2G2YA 2D7SA 2RQ4A 2LEBA 3AH6A 4DEZA 4UOHA 5KG1A 4OHXA 2QV6A 1R6VA 2RE1A 3M2VA 1C0UA 3PYDA 3O8WA 4ED2A 3ZNUA 4LF8J 4TKTA 4LSLA 2KVIA 4A8MP 1OS5A 3FMBA 3T1YF 1WF2A 3P5BP 1Q95G 1ICEB 3AA9A 3JSRA 5KFJA 4KO0B 3BO4A 1U49A 3QGIA 1NH8A 2CPIA 4N47A 2HHVA 1ZS6A 1JLBA 3ZO7A 3MUTP 3M8WA 4OHYA 4J9VA 4GMKA 2X3GA 3SIPB 3NY0A 3HVTB 4WXOA 3CT9A 2AYBA 1N88A 5KT6A 1VR6A 1BE4A 1LK5A 2CDRB 1VQSA 4ZS6A 1OWXA 2UXDJ 1H7WA 4PYDA 1H72C 1NK8A 4QU6A 3OPKA 4QYZK 5C7PA 2OPQA 4OZ5A 1SC1B 2YVSA 1EP4B 3MGJA 2JNJA 2MQ8A 4F4XA 2ZH7A 1WC0A 2VC1A 2ZZNA 2ZNYA 1FE4A 3DMJB 4XDCA 4CZCA 1YBUA 3F44A 1VQOS 2AJQA 1GH8A 1WNEA 1Q8LA 4CYUA 2W1BA 4EFAC 3LP1A 1S48A 2YPYA 4LJMA 3V81A 2M0GB 4U67Q 3MHYA 4LIWA 5H1SV 4WP8A 3UVJA 4O3PA 3WX8A 3C15A 2PI4A 2Q1LA 3I4PA 3SCIE 5L1LA 2WW8A 3FJ2A 1LWFB 1FJGF 1RKJA 2C3YA 4ES1A 5SUHA 2ATLA 1QJHA 4XDDA 4ZP8A 1D3WA 2I5JA 3M8PB 1S49A 3MMAB 3PFOA 3GIKA 1B0TA 4C3KA 3KK3A 2DRDA 4HT5A 2B43A 1UVLA 3EGZA 1SQEA 4YN3B 3EXYA 3OXLA 3OVAA 4K2XA 3M1VB 1G3OA 4Y34A 4HT7A 3W9HA 5DGBA 4CIOA 2YNIB 1RCXB 4IG3B 3JB9k 3R6GB 5F8JA 5CD4A 3AXMA 3C6TB 3H59A 3DI6B 2AW0A 5E7OB 2X1FA 2NS1B 5AXLA 3BKFA 2VFRA 3UR0A 4CLWA 4RW9B 4OYPA 1VFJA 2B0GA 3GSDA 2M4MA 1IR0A 2JLFA 3J81j 2C3PA 4ZDNA 2HHXA 1M5KC 3UCZP 5GVQA 2BJ9A 2JDJA 2RH3A 5HANA 4BBYA 1HQEB 3WHIA 4ZVEA 1J5OA 3KMSA 4LSNB 3MF5A 2OPSA 2BEFA 2GJ2A 4KGMA 3K57A 4F26A 4X84A 3QFWA 3TEGA 3IAM9 4HI2A 2HQ3A 4PWUA 4ATNA 1T9YA 5D3GB 2Z4PA 2Q3PA 3RB3A 1ULRA 5B0BA 3TUZC 2CQHA 2FLNA 2DB1A 2WONA 3NNHA 3N9UC 5B0FA 1KQKA 2LQ8A 4CTAA 5J2MB 3ZZTA 1N0VC 4A4JA 1SPBP 1XMQF 1JB0C 2H9ZA 3CDEA 4RKUC 2QSWA 1MN9A 4F4WA 2J0QD 1FDBA 2FUG9 3PG9A 4QU7A 2ZD1B 1AROP 3US5A 3MR7A 3T9NA 3PTWA 4NXNF 5IC4B 2QA2A 1RSCA 3HHLB 3T5JA 3HD2A 4FYVB 1R3NA 4M1KA 3C14B 4DPOA 5L1JA 4YS2A 1UFKA 3OTBA 2KXFA 2IC3A 2DY9A 1GX6A 4FKYA 5C25B 2Z57B 4FPRA 2B9XA 4DSEA 1WJ9A 4MYUA 1XNRJ 1Q0NA 2R8GA 2WVEA 1UP1A 1PAUB 1RA7A 1IBKJ 2MYFA 1RACB 3GFXA 4F67A 1UPPA 3FUYA 3M2UB 3NS6A 3Q8SB 1BQXA 4LFAJ 3PKYA 1ZAVA 3EGWB 2AGPA 4U7UD 5IT0A 5BXIA 3ITHB 1NMEB 1KVJA 4DR5J 1L3KA 4W4MA 5F9LA 2XLKA 2FPHX 1X31C 3AT1B 3CWJA 1RWPB 3TO8A 2HHWA 3UD5A 4ZIWA 2R7UA 4DUYF 3PO4A 4ED5A 2V4RA 4OYOA 3K2YA 2LQJA 4N77A 1UKUA 2PEHA 2YX1A 2MGZA 4C3LA 5KT2A 2FC9A 3MWBA 4TVAB 1B64A 4HHUA 1U2CA 2HFSA 3HZEA 1ZETA 3DGVA 2HAIA 4LREA 5LXRA 4K8RA 5CYJA 2IM1A 3BO2A 2NZCA 3TX0A 2LVWA 3ADAC 3JS9A 3D9BA 3TZXA 3QT5A 5ETOA 1RTHB 2MQMA 2G0CA 2YTCA 1O5JA 3CIZA 3GIRA 1HIYA 2MMYA 3V6KA 2XMTA 4Z7CA 4RW6B 4L3NA 3RRKA 5DS7A 1VHFA 3LQVA 4KHRA 2N7YA 4O3RA 1K8AT 2MTLA 4WK3A 2MXYA 1L3TA 3THVA 3AOBA 2Q79A 1XK8A 4NLXA 1UWBA 4C8MA 4FS1A 2OSRA 4KBIA 2ZM6F 2NYIA 1TUVA 1WORA 2GX8A 2W7AA 3D6FB 4DG1B 1SC6A 1UW9A 1CQMA 1J2VA 2LKZA 1RT5B 2BW7A 5LMUF 2XS2A 4L75A 4ZCKA 2JVOA 4ES2A 5IS2A 5HROA 4PAAA 1BWEA 2H54B 3RYLA 3EZOA 1RDRA 1I51B 2HFUA 1BMQB 3SCJE 3O3LA 5IQQA 4X66F 1S9GB 2P9CA 2AEJA 3IO1A 2L9DA 4TLRA 1REVB 2BANA 3QIDA 2P5VA 1F9HA 1IR1A 1K44A 5HVHA 1VJWA 2OJ3A 4NZ7A 2R7VA 3CO0P 2RUGA 2W9CB 3EZ5A 2OMOA 4Q5VA 2IMOA 2DBBA 3A8JA 1B3TA 3D0HE 4C6AA 3CJ8A 2MPUA 1DHMA 4PXEA 3FFIB 1Y7PA 2VDIA 1I94F 3RGIA 3AQOA 4IR1A 4U8VA 3FEXB 1OQ3A 2H48B 4A8QA 1KFDA 2MQLA 1JMTA 2WSCC 3PYEA 2DT9A 1TV6A 1JLEA 4GRSA 4ZVSB 2UVUA 4KTQA 3OSNA 3EWGA 1B99A 2C2ZB 3ZTPA 4OYXA 1WG5A 3C16A 3VVUA 3R2CJ 2ATCB 3V2UC 2F4FA 2CPJA 1N32J 3QAEA 2GGPA 1FWPA 3M2VB 2XS7A 2MHEA 3MD1A 2L3MA 1C0UB 2CNLB 4LSLB 1RWKB 2LYVA 3NLCA 3FZBA 1K1QA 2HQDA 2ZBPA 2N3LA 3N5FA 2DYAA 3M8RA 1T3NA 3EUNA 4JBCA 2ZH3A 5F8LA 2R7WA 4KAIA 3NGRA 4ZCIA 4DR4J 3A3OB 2J0XA 4NMLA 2R2RA 3KHGA 2DRAA 4IKAA 4L76A 1F0XA 4CO0A 4B3TF 4LT6A 2B6AA 4NCBA 5HI7A 1JLBB 5J1PA 2ZZMA 5DM6Q 4DR3F 1PG5B 1SIWB 2IVYA 4CLUA 4CLTA 4M5IA 4YQWA 1CC7A 3P49B 2LXIA 3I55S 3OFFA 2W9BA 4C8ZA 3CD0A 1N36J 1G4CA 4C8YA 2Y3YA 3FQLA 1S6PA 2CQDA 2BKNA 4K4YA 3MR5A 4P75A 1PGZA 1R7IA 5E3QA 3H5YA 2OPQB 4CH7A 4J90A 4MJKA 4LFBJ 1FRMA 5HN0A 4LF9F 2VPWB 2OP5A 1NK6A 4CYUB 4DR1J 1XBWA 1RWOB 1PJ6A 5B0CA 3CVKA 3T5LA 3LP1B 2E44A 5KT3A 3V81B 4DR5F 4X2BA 2MZSA 3AD7C 3KG4A 3UVJB 2W2PP 3MM6A 1KOHA 3QGHA 4ZPDA 3RRGA 2RDJA 1HR0F 2QMXA 2KYXA 5J2PA 3W9IA 1FK9A 1YQHA 2HVHA 4N8NA 1Y5NB 3H4DA 2ILYA 3IAS9 2EEYA 4Y2IA 4ZITA 1QY7A 4B9MA 3L7PA 3LWMA 2CQ4A 1WOPA 4WP9A 4C98A 5C42A 2I5JB 1Q78A 3H2LA 4OFZA 4JV2A 1XJWB 4KRWA 1VQ7S 3PM9A 4JI8J 3KK3B 3FCHA 2MZTA 4PWWA 4DL7A 2IBOA 4KJIA 2YQ0A 1Q86T 5HJYA 1S59A 2MSSA 1M1HA 1RT3A 3KLHB 2CA9A 2QMWA 2MQQA 1WDDA 3SSSA 2PIIA 4ANEA 2DHXA 4WFYA 2YKQA 1LEOA 2K06A 3M4XA 3W9JA 1ACMB 3HJVA 1HMVA 3AB2B 3KLEB 2CZVC 2R7QA 2E1PA 2HBQB 3TEHB 3I87A 3IBWA 1QUPA 2BW2A 2H1YA 3RW6A 1D8ZA 4WIQA 3R5DA 1SI9A 1Y5LB 4USJC 2B4PA 3LWLA 2DXDA 3OFHA 3Q8PB 1M5HA 2FHKA 3E8OA 3BN7A 2DNMA 3GONA 4OL8A 1VI7A 1U02A 2Q6CA 1WDTA 1XQIA 3UDLA 5D4OA 2JWNA 1J5OB 1VRTA 2CQBA 3CJ5A 1EIYB 2KZZA 4Y2MA 2OH2A 3X3UA 2OPSB 1PSDA 4ZJLA 3J7AN 1C4CA 1AYEA 4ECQA 1BGXT 2GQQA 3NXZA 5DQIA 4ID5A 5J1EA 2RKIA 3VGVA 1VQ6S 4ZPVR 2B9EA 2FY1A 4ECSA 4CLFA 2WONB 4QZVB 3CCMS 4FF3A 4CTAB 1FHTA 1IUJA 4HYKA 1LWEA 1PIEA 2QYGA 4A46A 1U8SA 2QA4S 2HWIA 4MFBA 2V4JA 1RLDA 1WG4A 1RHMB 2O1PA 2WZ1A 3GV8B 4C7QA 2YKAA 4J5OA 3AXKA 5EDWA 5I3PA 4ZPBA 1NB7A 1QTNB 1RWUA 1RYSA 2C2RA 1N32F 1H6KX 4MYTA 2IC3B 3D6HB 4HDGA 2BZ2A 4WE1A 1RBOB 3R6LB 2R7RA 4N7TA 3DU5A 1AW0A 2B9WA 3GILA 3RRHA 4O4GA 3QWUA 5RUBA 2DH8A 1CULA 3BYPA 3WIUA 4EO8A 3LP2A 3K0JA 2C2DA 1UWAA 4DR4F 2DO4A 1RBAA 2DPJA 1CC8A 3NEKA 3UQSA 3CMAS 3HF5A 3GV5B 3FC9A 4P9SA 3CCSS 3QWPA 3LGMA 4QIFA 2IDEA 4D3HA 2HMIA 2LEAA 1XMOJ 2VFSA 1JJHA 3B4DA 4NLGA 5DLFA 1IJEB 1F60B 2MGZB 5ETLA 5BR8J 2ZC3A 5GMKa 4C11A 2QRRA 1HWJA 2MKCA 4DV6J 2RF2A 5D0GA 4ANCA 5KFUA 2E1AA 4A8XA 2BRLA 4LF4J 2UVVA 2QL9B 4JYAJ 2HGLA 5B09A 3DHWC 1RAAB 4LFBF 3ISND 3VGTA 4DV7F 1FJ7A 1RHQB 3H7HB 3NGTA 1N48A 4CLYA 3ZZYA 2J0SD 4DR1F 4P6QA 1R8CA 4AL6A 3DLKA 4LRCA 1ZM3A 2W8KA 2EFOA 2Q6BA 1GX5A 4WKYA 3A1YG 2MQNA 4K4VA 1UWBB 2G1HA 5IV4A 2DNLA 3ZC4A 1DURA 3DRPA 4UZBA 2R2SA 2CXEA 1S1UB 1S79A 5A8WA 3RR7A 4IFYA 1ZPWX 1Y5IB 5HROB 1H2UX 4CNYA 2BOAA 1U2RA 1HYSA 4DR6F 2A18A 2CZ4A 4QIEA 4DSJA 3VAMA 1FO1A 3SBMA 5IT9Y 1BLUA 2WBRA 5KFLA 2BANB 1VS3A 4WFNQ 1RLCL 3BSNA 1DARA 2YKNA 2MDAA 4KC5A 3T19A 1N33J 4OI4A 1CPZA 1TAUA 3FCVA 2IFXA 2FQQB 1RAHB 2GMHA 4OMFG 3TA2A 1RT6A 4UY85 4UW2A 1C1CA 2EKYA 1KKHA 4C9DA 4ECZA 1VRQC 2BJ3A 3LA0A 4C97A 1TUWA 2VBYA 3HP6A 5D0EA 3JYTB 3MR6A 1X5OA 2NSCA 5BYRA 2R2UA 1DFDA 5L9XA 1GTHA 4XO0A 4B3SF 4CO4A 3CCWA 1U0SA 3BBFA 2CKWA 1FI4A 2FVRA 3Q8QB 3GZ7A 2JEFA 2MEWA 3P5TL 1TV6B 1JLEB 2W24A 1JLCA 2MY7A 3NG8A 5LOQA 3KK2A 2AZ1A 2HLUA 3MD3A 3G96A 1S1WA 3C16B 1FJCA 1JXLA 2GGPB 2IIHA 3QGGA 3WDOA 5KFFA 1M5VC 3UD3P 2XBPA 5HVGA 4Q45A 3BQ0A 4U6PA 5B0EA 3HSDA 1SUQA 4F02A 4C4WA 3R9LA 2GVDA 2FJAB 5DG8A 2M88A 3VCDA 2FZCB 5EWEA 4DL3A 4USIA 2B6AB 4B08A 2XGPA 1OSCA 2RDDA 3TP2A 2PA3A 3H98A 4IO1A 4DFKA 1H2VZ 5MAOA 2AYEA 4LBIA 4ZVGA 1FTRA 4CT8A 4DL6A 5DO2A 2V34A 2UXCJ 4USWA 4WYLA 1WELA 1R31A 4J91A 1KR4A 2G2OA 3PCOB 2W9BB 3DOKA 3KJVA 1S6PB 4ED6A 1RI7A 4W98A 3RAMA 5ETRA 2MLZA 4K4WA 4X4TA 4OI2A 2AIRB 1ELOA 4RW8A 5L38A 1E6YA 2E5LF 3NS7B 2NPFA 4IQMA 2B8PA 2QX0A 1XN9A 3M8ZA 2RQMA 3M2RA 5DETA 2BQUA 4KH0B 3OXFA 3OVSA 2NLWA 4RO0A 2EW9A 4HH1A 3WQPA 2XMJA 2RQKA 1URNA 1S7IA 3FBBA 2CQ1A 3A8KA 4PR6A 2DHAA 4GVLA 4DPXA 3W62A 1FRJA 3SSQA 3MM6B 1IBLJ 1N5YA 2Z8QA 4P2MA 1JK9B 3F0NA 5J2PB 4ZVOB 2WVFA 1VBYA 2XULA 2XCAA 1FK9B 5DDPC 1IJFB 4DV6F 1P9QC 1YSJA 4DX8H 2ZJRQ 4R8UA 5C42B 3CJRA 1MMLA 1I1GA 2IRYA 2V68A 3X1LB 2DISA 1WEZA 2XI3A 4JV5J 2HURA 2HNDA 3BPSP 2VIHA 2GA7A 4JOUA 1PYTA 2X7IA 1RT3B 1ZTTA 2COLA 4F04B 2R8HA 4X4SA 1DY3A 3IMQJ 1HMVB 3M6XA 5GAGI 4GVBA 2QE5A 5CYMA 2ZBQA 1VJQA 3JQMA 1X9MA 3VTIA 4AQYJ 4Q7AA 5U47A 2D3UA 2ZWOA 2XMMA 3PZPA 3THTA 3J7YU 2ACMA 2B3TB 3ET6A 5KFKA 3GJTB 2CPXA 2BJ7A 5K20B 2QC3A 2KJVA 3KLIA 3PJXA 3Q8VA 3T1AA 3U27A 1N56A 2LU2A 2ZOFA 2V8HA 2GAGC 1HBNA 1VRTB 5G4DA 1FKAF 1SJ4P 1FRKA 3BSCA 4H4KA 3ZNJ1 2YKMA 3RB6A 1UEUA 3W5ZA 1YBAA 2KFNA 3K5MA 4OZNA 1GXTA 2JC0A 2LU1A 3GWCA 3GFYA 2RVJA 4ID5B 4DX6A 5J1EB 2BM0A 2RKIB 1S72S 4NLPA 4W92B 1RXOB 3IR7B 3W8GA 1IVZA 4PG5A 4HI1A 1QSSA 2MJUA 5IM0A 2RD5C 2QFJA 1N4LA 4KY3A 3PY8A 1LWEB 2V0NA 2N7CA 3IXQA 1Q53A 1MW7A 4MFBB 2V4JB 2R7TA 5JUMA 4Q0BA 3HFZB 4Y28C 2ZKUA 4P2XA 1IWGA 5DG7A 2ZBIA 2C2EA 2DTJA 4WXWA 5EN1A 3GR1A 2AKWB 4DR2J 1S6QA 2BJ8A 1I3OB 1IQTA 1ZZFA 2WAQD 3MAQA 2IBKA 1H0HB 4PABA 3BGUA 3PRBA 3MAAA 4NE9C 5A2QU 1RAFB 2A1BA 3R27A 4WE1B 2R3VA 4WIIA 2MKIA 3OT9A 2FJVA 2CZ9A 3BEGB 3MPUB 1SL2A 1F9EB 2JL9A 1UCNA 5GAEU 4O4GB 3HFVA 2H4YB 1X4FA 1TL1A 3HZGA 3H20A 2ASJA 1WUUA 1CULB 1YBTA 3D3CJ 3LP2B 2BJEA 2IJNA 3OL6A 2XYHB 2VQEF 1EJ7L 3PHTA 1EB0A 1X9WA 1BWVA 3I0SA 3AAWB 2BE2B 4USVA 1SH3A 4YB7A 1VQ8S 2ADCA 1J5EF 3PW4A 2HMIB 3CJ3A 4X64F 2YH0A 1VQNS 2HFZA 3OR1B 1KTQA 4C11B 4X4OA 1VBXA 2KFYA 3CCLS 2RF2B 4ZLPA 2RS8A 2DIUA 4ILRA 4RU2A 4YEAA 4BWMA 2E1CA 1M5PC 2LDYA 2ILZA 2E9ZA 2F4VF 3TOQA 3N01A 1M90T 1FX4A 4DX7A 3GLJA 3V6DA 2DIVA 4LR9A 4NL5A 1HNWJ 4J9QA 3TUPA 2H4WB 4F7VA 2KI2A 3DLKB 1WKLA 2AZ3A 4QWEA 3VAKA 1RTDA 3A8EA 3AOAA 3T6JA 3W5XA 1IBCB 4ZVRB 3CD7A 1UW4A 2HK2A 1URRA 3DRPB 1T05A 1X4CA 3GJQB 1JLGA 2PFFB 5A8WB 4F4YA 2UV8A 2PMZD 4IFYB 3TQEA 2DHHA 5KAKA 1LXNA 1NCLA 2BOPA 4QYRA 1HYSB 3DM2A 4NEYA 4RZRA 1G1XA 4J9PA 4DUZJ 2ZBRA 2KKHA 3A3NB 2XS5A 3U02A 2YKNB 4LRFA 5BJRA 4HLBA 1K1SA 2AHOB 3OR2A 3OSPA 1RT6B 4J9MA 2LA6A 3BREA 5HLFA 1Q5YA 2BXJA 5A6WA 4C2MA 3DDNA 2DH9A 2M2BA 1KC8T 4Y0FA 2DNHA 2PMHA 5KFPA 4AQYF 3UNYA 2YWFA 3CC4S 3Q22A 1N5VA 5CCMA 2VC0A 3D1HA 1OPIA 1IKVA 2CAJA 3MURP 4DSFA 4WFAQ 3FRZA 1JLCB 1O8BA 3GFZA 1KOOA 4JI5J 5K8PA 4UOCA 3KK2B 2C2NA 1TVRA 1S1WB 3TZZA 3H2UB 4CH1A 4MK8A 4DV1F 3QGPA 2ZHOA 3H5XA 4LFCJ 4Y2CA 3CF5Q 4KFBA 2MLYA 3NAIA 4I7FA 2R7SA 1UJ6A 1SUQB 3G8QA 2MKKA 3HHEA 5KG0A 4UOGA 1E6VA 1N6QA 1N34J 2U1AA 1R8BA 2GVDB 2QYCA 4EI2A 2J6SA 2W7OA 1JLAA 3FSYA 3A8IA 4DL2A 2G0IA 4K0KJ 4IYQA 1NEEA 3HPOA 1GMUA 3R7NB 4X65J 3CJ2A 3DKDA 4O0NA 4O23A 2DH7A 3WIVA 3FSXA 1FE0A 1UFWA 3R5AA 4AYBD 5KT5A 3DOKB 4KHPJ 3KJVB 3I4HX 1FNXH 2GW8A 1EETA 2G1DA 9ATCB 4DLEA 1KTVA 4WTOB 4RW8B 5HAOA 1NB2A 2C42A 2LQ5A 3HMJG 5ETNA 3J7Z5 2YXLA 4CRJA 4CLPA 3K5NA 3VZIA 5KT7A 3MMJA 1WHXA 5LMNF 4ECXA 3M2RB 2XMUA 3B6BA 3N79A 5KG5A 5F9NA 4AXJA 2BUNA 3H90A 4C0HA 1X9SA 4M5JA 2W2NP 1SL0A 1UJ5A 2N82B 2VBXA 4ELUA 3CCZA 1HNXJ 5HATA 3MOJB 1EQMA 3NAHA 1RAJA 3ZTSA 1L3SA 2DGSA 3PFEA 5C5JA 3S01A 1N5YB 4ZPWR 5A0YA 1ZOTA 1EKSA 4I64A 1F3VA 4PUOA 1Z2LA 2E29A 2GV1A 2FLOA 2LA4A 4U7CA 1PYSB 3PX0A 2P2CB 3B82A 5HP1A 3Q24A 4H4MA 2FGCA 4R8UB 3G4SS 2DHGA 2DCLA 5EUHA 3OL7A 4C8KA 2UU9F 2HS3A 1RAOA 3E51A 3SDEA 2HNDB 2F9JA 4URQU 3QRPA 3FCWA 3OBIA 5L1IA 3DRYA 1RUSA 3CC7S 4M5LA 1BHNA 4WP3A 1WC4A 1CEZA 1U2FA 2KB2A 1EQ0A 4ZHRB 2HWHA 3OV7A 4GVBB 1W26A 3UO0A 4UF4A 4EBEA 2E5JA 4CO1A 2MQOA 2XMWA 2I8EA 3QJPA 1XR7A 3ET6B 4ITSA 4CCHA 4K4TA 2Y1JA 4NRUA 1RCOB 4UZCA 3TANA 3KLIB 2RRAA 2YPZA 2K1RA 5I4MA 2VG7A 5KFZA 5C2CA 4ECYA 3TI0A 3ZZUA 1T3OA 3NWGA 1NZ8A 4I2QA 1HBNB 4YDDB 1WEXA 1HNVA 2RNEA 3D28A 4MKBA 2YKMB 2HHHJ 4RU9A 1JJ2R 2IJFA 1P27B 3O1LA 4WFXA 3T1HF 2FJWA 3UR3C 2NXUA 2H3EB 2JEIA 2YX4A 2CJAA 4B3OA 4I68A 4NLDA 3W60A 3SV3A 5B0DA 3E3XA 4NZ6A 1GTEA 1LOUA 3MEEA 4MK7A 2DPIA 3PACA 2RU3A 1D9AA 3KDNA 4DV4J 3AHPA 2EXUA 3BF4A 5J2QA 4Q0BB 5M2PA 1HHQA 2R8KA 2VUGA 3AODA 4Q2LA 2UV8G 4NCGA 2VQFJ 3MR2A 2GHVC 5F41A 2DO0A 2XO6A 4BLGA 1S6QB 1PILA 4CLLA 4LFCF 1DTTA 3N5BA 4LRAA 1RAIB 2ZVIA 2X1BA 3MAAB 1NK7A 3LANA 1ZPVA 3CMES 1HHTP 2B4VA 2HRUA 2DGTA 3U1MA 1CJTA 2AGOA 4YDXA 3ZFVA 4OYAA 1DTQA 1ZM4A 1TL1B 5CYQA 3M9MB 4JUZA 2QLXA 1FESA 1G6BA 5HMWA 3BJYA 3IRXA 3TJAA 1Z1ZA 3Q2SC 1HWIA 3I82A 4K0KF 1CVJA 3I0SB 2DEJA 3O6QA 4J9KA 2W9AA 3M7VA 4DV5J 2WVDA 2DXFA 3BBCA 2I2YA 3FBFA 5D4PA 4HTJA 2CQPA 3PIPQ 4FXDA 2UVWA 1GT8A 3MAHA 2MKSA 2ZWPA 1C1BA 3ENAA 3PW7A 3KOAA 1NPRA 2F3JA 1U6BA 4FYDA 2C2MB 1TP7A 4F4KA 4EZ9A 4NA2A 4ER8A 3HHLA 4WWSA 5DDRC 2D9PA 5AJ3F 1S1XA 1V3ZA 4KGVB 1FCAA 2V8GA 3V6DB 1B0PA 1M1GA 1F5CA 4WU2A 5DG9A 3EM1A 4CH0S 2YQ1A 5L8RC 1RTDB 1X5PA 3IM8A 4X4NA 3MCNA 3Q8UA 3W1YC 1U1PA 2I9SA 4MAKA 5F0UA 4EWTA 3ILJA 1NZAA 1T05B 4QPTA 1JLGB 1QVGR 3HSZA 1UVKA 4DX5A 4OYMA 3M6VA 1ZAXA 2HRTA 2DNOA 2NXEA 4WCEQ 7FDRA 2F8EX 1VDHA 3SCLE 3GG1A 2VA2A 3DM2B 2E7VA 4DU7A 1O51A 4MIAA 3T41A 4DV0F 2RHSB 4KE5A 4QWAA 3TAPA 4OX9F 3HK2A 4NZ0A 1Q16B 4FVMA 1RHUB 4B3RF 2HS0A 1T03A 4G1PA 1NO8A 3OR2B 3GYNA 1K9MT 5HMZA 2QIFA 5IV3A 2KRRA 1F2GA 4C0OC 4O3SA 4OJ1A 5GAHI 5HLFB 2M8HA 1G7CB 5KFEA 4DV2F 1Y0HA 3ZTQA 4Q44A 1EZZB 1C0TB 1SQGA 1JWWA 1RT4A 2HZAA 4DXLA 3PDNA 1KONA 3KHLA 4WTYA 3CCQS 2KXNB 3DGPA 1SC4B 4O44A 2XZDB 3OTDA 3SQOP 1IKVB 3HDSA 4ZN1A 4B3MJ 4DPWA 1UVJA 4NA1A 3D4JA 1WC1A 3I31A 4KR0B 1NM2A 1TVRB 1P8GA 4OHVA 4O3NA 3NMAA 3UWTA 4XTTA 4C8NA 3KLGA 2QZ8A 4JI7J 4I0WA 2OAUA 4KFBB 3TYTA 2NCKL 1D0EA 1RADB 4UQGA 5A6PA 2OPRA 1KEKA 4I7FB 1TFYA 3GB0A 4B9NA 2Y0SD 3GIJA 1E6VB 1N6QB 2Q66A 1JJCB 1YITS 2MKYA 3PRVA 3TUJC 4PPZA 3C46A 3W5YA 1KFSA 1JLAB 3GJSB 2H51B 1VQLS 4X62F 4TQRA 3UE2A 3NOCA 5GMEA 2HSEB 2XO7A 3QZ8A 4ES3A 3TNVA 1Y3KA 1K0TA 4ECUA 3I5AA 3OLAA 2A2CA 3Q0AA 4ED7A 1NUEA 2G4BA 2MB0B 5IWAJ 3I32A 4EUVA 1X7VA 1XMQJ 3OJSA 3DLEA 1N8RT 1K47A 5ITHA 2FVSA 1YI2S 5IC6B 3GYXB 1F9FA 1EETB 3G82A 2BA9A 2MLXA 2DXEA 3UW1A 2FDNA 2J7WA 3L9ZA 2YWHA 5H9EK 2J7KA 4MIBA 4KYZA 2XHCA 2XMAA 1FF2A 3UN5A 2LQ9A 1FNMA 4OLOA 2XZWA 4QBUA 2IYGA 2CQCA 3BKTA 1FD2A 2JZ5A 3N6LA 3RUBL 4ED3A 3QMQA 5F8MA 3KLVA 2ROPA 3SFGA 1VQMS 3ONQA 3LPYA 3VF0B 1AT1B 1BY9A 3WZ0A 2GQCA 1T95A 1WACA 2GO9A 3KMQA 2CQGA 2CQ0A 4DV5F 3J81U 2ADBA 3GMGA 4RL1A 4IH6A 5A0YB 2F8MA 1A9NB 2J0WA 3EJMA 4F0MA 4PUOB 3MMCA 4P73A 2OEJA 3RBEA 3POTA 3KHRA 2AMCB 4ERDA 4R0EA 2B7CB 3FBCA 5HP1B 4ZA1A 4YR3A 5E3CA 4U9RA 2OEKA 1A7GE 4H4MB 2LECA 1SKUB 1B4SA 4KPYA 4ILLA 1YG0A 3OXGA 1TR0A 3HHDA 2PC6A 3DRRA 3BKUA 4RUAA 2B51A 4DUYJ 1P9YA 2HBRB 3SDEB 3EDQB 2HPUA 4A47A 2KHDA 1C4AA 2IVFB 4R0JA 2LCWA 5F8IA 1YWXA 3UFCX 2IM0A 4RNHA 1JQGA 1YIJS 3HD1A 5GADI 2DRBA 4N56A 4YHHF 2VFUA 1ZTWA 1NLKL 1JJ4A 1PC5A 4Z2XA 2IVMA 5K8MA 5HMXA 1I6JA 2H65B 3RBDA 3N6MA 1RWXB 5I3QA 3MXHP 4I69A 2M7SA 1V5VA 2GNKA 1QSLA 3D0GE 4FN5A 1GXLA 1HWKA 1Y3JA 1KNZA 1B70B 1HBOA 2ZM6J 4RNOA 2K1RB 4HHHA 3C2PA 3R1LA 2AWZA 2VG7B 2HRYA 1HI1A 1JNZB 4WFZA 4I2QB 2CQIA 1HNVB 4GO7X 5LMUJ 2G9OA 3TA1A 4S0MA 2H5EA 5B0AA 2VA3A 1S12A 1U26A 1CJUA 3OTOF 1U09A 3K5OA 4X66J 2HFNA 1UPMB 3S7RA 1WI6A 1NHKL 1UMJA 3QT6A 4V19X 1IBMF 4B3OB 1T7PA 3T9ZA 1RWVB 5EHHA 1JXEA 3KLHA 4H54A 2ASYA 2NYHA 1D9DA 2OTLS 2HGMA 3MEEB 2HHQA 1VLYA 2VL1A 1SL1A 4NMXA 2D9OA 2XQCA 5ADZA 2EI5A 3MEDA 5J2QB 4HEA9 2L48A 3KLEA 4B3MF 1GEHA 1S9FA 2BMBA 2A2DA 2NSBA 4QCLA 2CPFA 4NCGB 1Q82T 2FTRA 1I94J 1UA0A 4JB8B 3P96A 1WWHA 4X4UA 3BGRA 2MZRA 1KWMA 3F73A 2AYGA 1R27B 4MTPA 4JI7F 1DTTB 4AFFA 4OZLA 4CQ1A 2APOA 3OQ2A 1P1TA 5ETKA 4PXCA 4TNOA 1HD1A 1CJTB 4QWDA 1DTQB 3GP9A 5CYQB 1NJWA 2DVIA 2QT7A 3IRXB 5KFRA 1TK5A 4DSLA 3HHLC 4AT1B 2K8GA 2HG4A 3HVAA 4JI4F 3HLUA 4E8UA 2QLWA 3FQKA 3KLFA 2YQ3A 3T5KA 1LW0A 2UXBF 2CADA 4M8LA 1BQMA 5K8NA 2DGQA 2VV5A 2ZEJA 5IWAF 3CJ0A 3NBPA 4TQSA 3DDKA 3CTRA 4ZJQA 4OJHA 4B3TJ 1SH0A 2XSJA 2DKOB 1C1BB 3MM8A 4ZVHA 3HJFA 1L3VA 5KFCA 3QRQA 1YRXA 4DR3J 1HA1A 4PG6A 4ALZA 4OYZA 3Q23A 4OYBA 4LF5J 3OUYA 3NGKA 1TKXA 2DGOA 1LKZA 4KT0C 2AGQA 1S1XB 1YHQS 3W65A 2HQCA 3W64A 3WC0A 3KUEA 4H4OA 1KDNA 4NLOA 2EBGA 3L7OA 2G13A 2ALYB 5DGAA 4IOCQ 3A4TA 3TJ9A 5I3UA 3WBZA 5SZTA 2Z58B 4JI1F 2ZE2A 4X4RA 4IDKA 3CCVS 4LF9J 2VZ9A 3ENQA 2OPPA 1XIQA 1YJVA 4O4RA 4G1QA 1RBLA 3I5BA 3AJ1A 1N54B 4D3GA 2R7OA 3M8SA 4RNMA 1CLFA 1MN7A 4LR8A 3PVXA 1NHUA 4HACA 1HR0J 5KFVA 1LK7A 2IY5B 1NU4A 3BM7A 3HVWA 1WHWA 1TQLA 2X51A 1QAJA 3LH2S 3ISZA 2ZH4A 5T14A 2XMKA 1YZ6A 2N4DA 2VB6A 2C3MA 3FMWA 2QN6B 2V6AA 5CZXA 4PCQA 3HM9A 1CJVA 3NS5A 4WZMA 2C22A 5D77A 1T03B 4G1IA 2CIMA 1EX8A 2EK6A 1MU2A 1PKUA 4IO9Q 1RWWB 3BQ1A 2Y1IA 2AF6A 1QTMA 5D15A 3PYGA 1FNOA 1YJ7A 1Q7LB 4P2FA 1FRHA 5THWA 5GMDA 1YJRA 4YP3A 5F3TA 1RT4B 5DQHA 2K7JA 2FYXA 2HS4A 4K4XA 1RK8A 3W7BA 3DGPB 4O44B 4LVOP 3C3LA 4M5GA 4IOAQ 2J5AA 2AJ2A 4ZJOA 4LF6F 4QR1A 2DNNA 3NGDA 2PMWA 1FRIA 1HBUA 3K58A 4R25A 2ZH9A 1TUGB 4ETZA 4F4ZA 3HO1A 4F4AA 2VDHA 3PNIA 4CO5A 1S1UA 3KLGB 4EGLA 1GXUA 3KJFB 2BKPA 5KT4A 5E2QA 2AYMA 2LLZA 3R8YA 2WTFA 2JEGA 2U2FA 4CO3A 4E0DA 2YX7A 1HL6A 2OPRB 4CT9A 5FDLA 1M1KT 2HVZA 1SQFA 1IN0A 3K8VA 3HHKA 2WHOA 1U8WA 3VQSA 2ZH8A 2ASDA 3Q8RB 2AEMA 5JVGQ 3KG1A 5T41A 2P9GA 4JI0F 4TLQA 2V94A 3GQCA 5FLXY 1T9WA 1UEVA 1RA6A 2ZH1A 3CCES 1XERA 4HR2A 1FXRA 2DD8S 4YOEA 3JYTA 2V5HG 2E1RA 3K89A 1JKHA 4X4PA 3BS9A 4FYXB 2CPYA 1QSYA 3PO5A 1PBUA 1TFWA 1N5SA 2DNRA 2E66A 4A8FA 1VQKS 3DLEB 2AJ4A 2X3DA 4TY8A 3CIMA 3NWRA 3G82B 3NP5A 4QOTA 2JH3A 1S99A 4RUCA 2CPHA 1RAGB 2WVCA 3LAMA 3UDCA 1NXIA 5ETSA 2Z30B 2GCFA 4A8OA 1U48A 4HDHA 4M63A 4ZPCA 1NDPA 4F0KA 1T9XA
chains in the Genus database with same CATH topology
2LDYA 4PQAA 2O66A 4QJVA 3T6BA 2BQ3A 2NUUG 2DGVA 1ZH5A 3VAGA 3DU6A 4LIWA 2ILZA 2E9ZA 3MM9A 4KHMA 2F4VF 4RNFA 5H1SV 2MQPA 3MZIA 5C24A 4DSKA 2MKHA 5AE3A 4O3PA 3TOQA 3N01A 4MK9A 1M90T 2XHWA 1NJYA 1XWLA 2PI4A 2Q1LA 2EWHA 1N52B 3I4PA 5A8RA 2LXFA 3SCIE 5L1LA 2WW8A 4HKQA 3FJ2A 1LWFB 4OI0A 2M8DB 3R5CA 4DHVA 3MMCB 3V6DA 2DIVA 3TUIC 1FJGF 4NL5A 1TK8A 1WEYA 4IH5A 4FS2A 3POTB 4J9QA 1RKJA 5LL6d 2C3YA 1RT7A 4ES1A 3DN9A 3G8TA 3KWMA 5SUHA 2ATLA 3DRSA 1QJHA 4GKJF 2KI2A 3DLKB 4XDDA 2KHCA 4ZP8A 3J81Y 4NLSA 2DGWA 3K5PA 4L72B 4QWEA 3BSOA 3VAKA 1KQSR 1D3WA 2ZDPA 1RTDA 2BDPA 2VG5B 2B5JB 3A8EA 3LAKA 2I5JA 3M8PB 1U1QA 1S49A 2CRLA 5E3PA 5FD1A 5KFGA 3S8SA 3T6JA 3MMAB 3DRRB 4GC7A 3PFOA 3H5SA 2M3DA 5E5NA 3CD7A 1UW4A 1B0TA 3GIKA 4C3KA 3KK3A 4LF5F 3CULA 4YR0A 3H2VE 4HT5A 4F2RA 2B43A 1URRA 2VPXB 4CI0B 3DRPB 5B0GA 1UVLA 1T05A 3EGZA 1X4CA 1RISA 1JLGA 1SQEA 1WTFA 2FJEB 3EXYA 1R43A 2ZNZA 3TAMB 3OXLA 2PFFB 4QQBA 5A8WB 2OSQA 3HXMA 4F4YA 3D1OA 1V3RA 2UV8A 2PMZD 4E98A 4IFYB 4K2XA 3OVAA 2BJDA 3I9V9 1DBDA 1G3OA 3M1VB 4Y34A 4ZPTR 4HT7A 1HBMA 1VIXA 5KAKA 1LXNA 4EBCA 4RW4A 1KD1T 2BOPA 4QYRA 1HYSB 3DM2A 1M5SA 5DGBA 1MMDA 4RZRA 1JIHA 4EZ6A 1LQ9A 1G1XA 4J9PA 2YNGA 4CIOA 2YNIB 4OX7A 1SKRA 4HHJA 1SH2A 3DYAA 4G3IA 2DNPA 2WRMA 2KKHA 4J9LA 5HL7Q 4IG3B 2XS5A 3U02A 2DNQA 2YWKA 2EG1A 3JB9k 1IM4A 4B9LA 5F8JA 4NLYA 1TL5A 2NQPA 2YKNB 4IH7A 2IMWP 3C6TB 4RX6A 1VRUB 3H59A 3DI6B 3KFWX 2AW0A 2XLJA 5E7OB 2EFGA 2X1FA 2VPYB 2NS1B 4NYOA 4EBDA 5BJRA 5AXLA 2VFRA 3UR0A 1OSDA 1S9EA 4TYBA 4K59A 5IZHA 4RW9B 1M0SA 5AXMA 4WYWA 2CJ9A 1S97A 4Y2KA 1HQUA 1RT1B 2RS2A 4X4TA 1VFJA 4HLBA 1K1SA 3OR2A 2B0GA 3OSPA 3GSDA 1RT6B 2M4MA 1KLMA 1HBOB 1IR0A 2JLFA 4J9MA 2LA6A 4YY3F 1PO6A 4RW7B 3BREA 2C3PA 4ZDNA 4EU0A 5HLFA 2HHXA 1M5KC 4DN0A 3UCZP 5FJ4A 2BXJA 5GVQA 5A6WA 2I38A 2NREA 4C2MA 3SEOA 2JDJA 2RH3A 5EX3A 3D2WA 3DDNA 4BBYA 5LSRA 2M52A 2DH9A 4MH8A 3HKWA 2BACA 2M2BA 1R6YA 1HQEB 2RSQA 4Y0FA 1KC8T 4ZVEA 3H5UA 3L3CA 1U1RA 2DNHA 1J5OA 2ZC4A 2PMHA 5KFPA 4AQYF 4LUBA 2R7XA 4IQXA 1H7XA 2YWFA 2PGCA 3KMSA 2JRSA 4LSNB 3DLJA 2BBEA 2KYZA 4ZP9A 3CC4S 3MF5A 2OPSA 2GJ2A 1YJTA 1U6ZA 2J9DA 4KGMA 1W2BR 3Q22A 3GV7B 3K57A 4F26A 4X84A 4FF1A 3F41A 2BYCA 1G2EA 1TKTA 3IAM9 4HI2A 2HQ3A 1N5VA 1Q79A 4PWUA 4ATNA 4YFUA 2QA4G 5D3GB 4M5DA 1WI8A 2VC0A 3D1HA 5CCMA 5A8KA 2JEJA 4PWDB 1VQYA 2Z4PA 4OX8A 3OFEA 2Q3PA 1OPIA 1IKVA 3MURP 4DSFA 3RB3A 1ULRA 5B0BA 2JJ4D 3TUZC 4WFAQ 4ZCMA 4JI4F 3FRZA 1JLCB 2CQHA 1U1NA 2FLNA 1S6UA 1O8BA 2DB1A 2WONA 3GFZA 1KOOA 3NNHA 5K8PA 4UOCA 3KK2B 3N9UC 3OL8A 5B0FA 3GFHA 1KQKA 1TVRA 5CD4H 1S1WB 3VALA 5F8NA 3H2UB 4CTAA 5J2MB 3GR0A 4CH1A 4MK8A 1QAIA 3ZZTA 4DV1F 1S10A 1FTCA 3QGPA 2ZHOA 1N0VC 1PC4A 1S0VA 3H5XA 4A4JA 1N5QA 1XMQF 1JB0C 2F40A 2H9ZA 2ZOMA 4Y2CA 3CF5Q 4KFBA 4OZJA 4DQPA 4DR7F 3CDEA 1R0AB 4RKUC 2QSWA 4LMZA 4I6YA 4F4WA 2J0QD 1FDBA 2FUG9 4JI2F 4ZVFA 3NAIA 4I7FA 4QU7A 1SKSA 2ZD1B 3M6WA 3MEDB 1AROP 3US5A 3J7YI 1LFWA 4Y00A 3T9NA 3J7ZT 4EO6A 2R7SA 1UJ6A 1SUQB 4NXNF 3G8QA 2MKKA 3HHEA 5KG0A 1E6VA 1N6QA 1XC9A 4TU8A 2OMLA 2QA2A 4ETXA 4QW8A 3HHLB 3T5JA 2U1AA 1R8BA 1TKZB 2B4UA 1R3NA 4M1KA 2QYCA 2J6SA 3BGRB 4RBUA 1XMOF 2KH9A 1VGYA 2P6TA 2W7OA 1JLAA 4DPOA 5L1JA 3FSYA 2VASA 4DL2A 1YGYA 1VQPS 5BR8F 4RBTA 4JI3F 4R5PB 3OTBA 4Q43A 1MSWD 2KXFA 1YJ9S 2IC3A 1GNKA 1GX6A 3BGFA 2B56A 4IYQA 5C25B 3I56S 1NEEA 3HPOA 1NRKA 2D74B 2IM2A 3O44A 4FPRA 2B9XA 4IG0A 4DSEA 2FD2A 3CJ2A 4LF4F 4MYUA 2RQCA 4O23A 4JYAF 2DH7A 5JVHQ 2A10A 2R8GA 4QIGA 2AP6A 2PA8D 1FERA 2GMJA 3FSXA 1FE0A 1UP1A 1RA7A 2MYFA 3IWLA 2WCXA 1UFWA 3V4IA 3GFXA 2YH1A 3R5AA 2E7XA 2ZHAA 4AYBD 3QJJA 5KT5A 1HW8A 4F67A 4DFJA 3M2UB 2FVPA 3NNCA 3DOKB 3NS6A 3DLLQ 3Q8SB 3KJVB 2J8AA 1BQXA 3U7JA 3BB5A 3I4HX 4OJGA 3PKYA 1FNXH 1ZAVA 3EGWB 2AGPA 2VONA 2GW8A 3OFGA 1ZBTA 5IT0A 1EETA 2HW3A 2G1DA 3ITHB 2EC0A 4DLEA 1KTVA 4RW8B 1KVJA 2C42A 4P7VA 1JLQA 2LQ5A 3KLFB 1L3KA 1NHVA 1LW0B 3HMJG 2NR0A 5F9LA 3J7Z5 1U1MA 4Q2MA 2XLKA 2FPHX 5K5MA 3CWJA 3K5NA 3TO8A 1BQMB 1NK4A 2HHWA 2IA6A 3VZIA 5KT7A 2HNYB 3MMJA 1WHXA 5LMNF 4ECXA 1NNDA 3M2RB 2XMUA 3IWXA 2O67A 3J7A1 2E5HA 2R7UA 3N79A 4KKOA 3KNGA 4DUYF 3PO4A 4K4UA 4ED5A 5KG5A 2V4RA 5F9NA 4AXJA 2NZ4A 2BUNA 3K2YA 3NBPB 2LQJA 2FHJD 1UKUA 4N77A 4JI6F 2PEHA 4C0HA 2YX1A 1X9SA 2MGZA 1DLOB 4C3LA 4MKYA 5F8HA 5KT2A 1GAOA 2FC9A 2E5GA 3MWBA 1SL0A 1UJ5A 2ROGA 2XSJB 1HI8A 4GKKF 2N82B 3RR8A 2VBXA 3MM8B 2OKQA 1WHYA 1KLNA 4ELUA 6FDRA 1B64A 3PX6A 4YB5A 3CCZA 2MZQA 2HZCA 3MOJB 3HZEA 3ZZ0A 4OZ1A 1ZETA 3NAHA 1RAJA 3DCAA 2Y1RI 2HAIA 3GE9A 4IRKA 2W8LA 1XNQF 2UUCF 1NKCA 2R4FA 5LXRA 2K2PA 5LXYA 3UPFA 1L3SA 3BO2A 5CYJA 2IM1A 4LF7F 3N4WA 4QIVA 4BS2A 2DGSA 3PFEA 5C5JA 2IAJA 2LVWA 1Q81T 2XNRA 3S01A 2HFOA 3OUYB 4ZPWR 1S0NA 1N5YB 5A0YA 1TKXB 2XNQA 2XY5A 3HKZD 1ZOTA 1RTHB 4GO5X 1RTIA 4KQZA 4I64A 2MQMA 3CCUS 3PIOQ 2G0CA 2YTCA 4PUOA 1O5JA 3CIZA 3TAQA 2MMYA 3M32B 1Z2LA 2E29A 3V6KA 2GV1A 3PW5A 2XMTA 4I6WA 4RW6B 4L3NA 2FLOA 5GAHU 2LA4A 4H4OB 3RRKA 2ROEA 5DS7A 4U7CA 4XPEA 5GAEI 3PX0A 1VHFA 2ZJPQ 3B82A 3LQVA 3MEGA 5HP1A 4KHRA 1N33F 3IC1A 2N7YA 5KFWA 4O3RA 1K8AT 1IKYB 4WK3A 2MXYA 4H4MA 2FGCA 3Q24A 2GIQA 4R8UB 3G4SS 1L3TA 3THVA 4O3OA 2KXHA 5I3UB 2DNKA 2Q79A 4C0BA 2DHGA 5CZVA 1C2PA 1YJWS 5CXTA 1XK8A 1Z4UA 4IOBA 2CJBA 2DCLA 5EUHA 2L41A 2ZE2B 4NLXA 3OL7A 1UWBA 4IDKB 4C8MA 4FS1A 4C8KA 3NL0A 2OSRA 4KBIA 2ZM6F 2UU9F 2ZUGA 1RJJA 2HS3A 2NYIA 1TUVA 3VAFA 5LJ5Y 1CG2A 5JJBA 1NK9A 3E51A 3SDEA 2GX8A 2W7AA 2HNDB 5B7WA 3UD4P 4DG1B 2F9JA 4URQU 1SC6A 4M95A 3CSKA 4C8LA 1CQMA 1J2VA 2LKZA 2RB7A 3OBIA 1RT2A 5EWGA 2OPPB 5L1IA 3DRYA 1RT5B 5LMUF 3RB0A 3CC7S 2XS2A 4ZCKA 5LJ3Y 4G1QB 2XY6A 2JVOA 3MM7A 4ES2A 5IS2A 2BE2A 5HROA 1QE1A 3JTOA 1CEZA 1U2FA 1B7FA 2KB2A 1BWEA 3RYLA 1IKWA 1RDRA 1T8EA 3SCJE 3O3LA 3NRBA 4ZHRB 5IQQA 4DS5A 1WTBA 2HWHA 3SCKE 4X66F 3OV7A 3EPGA 1S9GB 2P9CA 3BO3A 4DQQA 3PV8A 4NLVA 3IO1A 2L9DA 3K7RA 3C66A 4TLRA 4EBEA 2YWGA 2E5JA 5KFBA 4I4BA 1REVB 3RAXA 4CO1A 2BANA 3QIDA 2P5VA 2HNZA 3OR1A 3BDPA 2MQOA 2XMWA 2I8EA 1R8AA 1VJWA 2N3OA 3L95X 3IS9A 1KQFB 2OJ3A 3OLBA 3OHBA 3QJPA 1XR7A 4ITSA 2DGUA 4CCHA 5AXKA 1QM9A 4Y2AA 4NZ7A 4K4TA 2HHUA 2Y1JA 4NRTA 2ZFHA 2R7VA 4NRUA 5DLGA 1R8HA 3TANA 2RUGA 2BRKA 2W9CB 3EZ5A 2OMOA 1SJ1A 3TR5A 3KLIB 4F8RA 2RRAA 2GHWA 1MU2B 1U7LA 3C6UB 5HBMB 3TRGA 2BABA 2K1RA 4NYZA 4PG8A 5I4MA 2IMOA 2VG7A 4Q5VA 5KFZA 4MKAA 1JNRB 4ECYA 2DBBA 3K8WA 3TI0A 3ZZUA 4OI3A 3MUVP 2BQRA 1T3OA 2QEXS 3D0HE 3NWGA 4I2QA 1HBNB 4YDDB 4QR2A 1S77D 4I2PA 2MPUA 3MTKA 1DHMA 1WEXA 1HNVA 4O3QA 4PXEA 1H2TZ 3FFIB 2BVZA 5T7LB 1Y7PA 2I1RA 2RNEA 3D28A 3G8SA 4MKBA 1I94F 2YKMB 2RDIA 3AQOA 4RU9A 1JJ2R 2IJFA 2IYIA 4IR1A 4EYIB 3FEXB 1OQ3A 4TU7A 3OL9A 4WU3A 1P27B 3O1LA 4WFXA 1B0VA 1Z2ZA 3KK1B 3T1HF 4A8QA 1KFDA 3AB4B 2MQLA 4DQIA 3P3DA 2FJWA 3CDAA 3MDFA 4ECTA 1JMTA 1YRUA 2K3IA 2WSCC 3UR3C 1MWYA 4NXMF 2DT9A 1BC6A 2RU9A 1TV6A 1JLEA 2NXUA 2JEIA 2J7UA 3I9ZA 1HBUB 2YX4A 2UVUA 1HNIB 4DJBA 3OSNA 3WC2A 4KTQA 2CJAA 4ICLB 3O5TB 4B3OA 4I68A 2YWEA 1A6LA 2FJDB 4NLDA 3SV3A 4P2SA 1TAQA 5B0DA 4C3MA 3SQGA 3N28A 2UXCF 3E3XA 3B8HA 1K0VA 4NZ6A 1WG5A 1GTEA 3DHXA 4WJBA 3T5HA 3CD5A 3MR3A 1LOUA 3V2UC 2DR8A 2CPJA 1LXJA 2QSFA 2UUAF 3MEEA 4MK7A 2DPIA 3QAEA 2GGPA 3PACA 2RU3A 1D9AA 2CPDA 3M2VB 2ZHBA 3LP0A 1S1TA 3IN5A 3HHNB 2XS7A 3OHAA 2MHEA 3MD1A 2L3MA 1C0UB 3AHPA 1K73T 3BF4A 4OLPA 2VG6B 5J2QA 5D4NA 4QPXA 2VBWA 1LW2A 4LSLB 5FDLB 2D41A 2LYVA 5M2PA 3NLCA 4Q0BB 3EGNA 3AQPA 1U47A 2R8KA 2VUGA 5EX0A 4HTIA 1FA0A 3FZBA 3BN4A 2KFZA 2KDOA 1K1QA 1VRUA 2WOMB 4N41A 4Q2LA 3D1QA 2UV8G 2UUTA 4NCGA 2VOPA 2WSEC 3MR2A 4IFVA 2GHVC 5F41A 2DO0A 3NCRA 4XPCA 2N3LA 3N5FA 3M8RA 1DQ9A 1T3NA 4DBQA 3EUNA 4JBCA 1S6QB 4CO2A 2ZH3A 1PILA 1VBZA 1AXQA 1GQEA 5F8LA 2R7WA 4KAIA 2FC8A 1UA1A 5HO4A 4UUXA 4DFMA 4ZCIA 2EBEA 4NMLA 2J0XA 3FRYA 2R2RA 3KHGA 2DRAA 1DTTA 3N5BA 4IKAA 4LFCF 5IFMA 1U1LA 1F0XA 4CO0A 2YNFB 5J2NA 4B3TF 1KQGB 3MMBA 2YNHB 4LT6A 2B6AA 2X1BA 5K8OA 4NCBA 4I1TA 5HI7A 1JLBB 3QIPA 4NLWA 4FBTA 1NK7A 5J1PA 2ZZMA 2KJWA 3LANA 1ZPVA 5DM6Q 3CMES 2WSFC 3I5CA 5CQGA 4B17A 3H4BA 4DR3F 2KM8C 1SIWB 2B4VA 2HRUA 3N0VA 7FD1A 1HHTP 2DGTA 4WF9Q 3U1MA 2IVYA 3PW2A 2AGOA 4YDXA 3ZFVA 5K14B 3FEZA 1X4BA 1DTQA 1ZM4A 1TL1B 5CYQA 3M9MB 4YQWA 5KG3A 1CC7A 4Q8FA 1JKHB 2DHSA 4M94A 3P49B 1IBLF 1XTZA 1FJEB 3RZAA 4JUZA 2IRUA 3VWSA 2LXIA 2QLXA 1FESA 1G6BA 3OFFA 3I55S 2W9BA 4Q8EA 4C8ZA 5HMWA 5A2QY 3CD0A 3BJYA 3IRXA 3TVKA 4C8YA 3FQLA 1S6PA 2MHNA 2CQDA 1VK3A 5BYQA 4YMEA 4TY8B 4K4YA 3MR5A 2HHSA 2OFHX 2ZITA 3DXBA 1Z1ZA 3Q2SC 1R7IA 1PGZA 1HD0A 5E3QA 2ZJQQ 1HWIA 3I82A 1ZYQA 4K0KF 3H5YA 1CVJA 3I0SB 4RWWA 2FLLA 3O6QA 1ROFA 4QW9A 4J9KA 4FF4A 2OPQB 2W9AA 1XR5A 3JSMA 4CH7A 1NJZA 4MJKA 3PEHA 1FRMA 4KV8A 1QVFR