3D0IE

Crystal structure of spike protein receptor-binding domain from the 2005-2006 sars coronavirus civet strain complexed with human-civet chimeric receptor ace2
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
179
structure length
173
Chain Sequence
PFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLRGYGFYTTSGIGYQPYRVVVLSFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of major species barriers between humans and palm civets for severe acute respiratory syndrome coronavirus infections
pubmed doi rcsb
source organism Paguma larvata
molecule tags Hydrolase
molecule keywords Angiotensin-converting enzyme 2
total genus 31
structure length 173
sequence length 179
chains with identical sequence F
ec nomenclature
pdb deposition date 2008-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1840 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3d0iE01
3BGFA 4XAKA 2GHWA 5DO2A 4KR0B 2GHVC 4L72B 3D0GE 4QZVB 4KQZA 4L3NA 4ZS6A 3SCJE 3D0IE 3SCIE 2DD8S 3SCLE 3D0HE 4ZPVR 4ZPTR 2AJFE 4ZPWR 3SCKE
chains in the Genus database with same CATH superfamily
3PCOB 3KNGA 4KGXB 2Y0SD 3N6NA 4G1QA 3LQVA 4MFBA 1IKXB 1ICEB 4USKA 4WK3A 3ZXWA 4DX8H 5L38A 4G3IA 5K14A 4DCJB 2HNYB 1LV5A 2KH9A 3GILA 3QSYB 5IC4B 5FLXY 1R0CB 4M5LA 1S1WA 2BYCA 2Y1LB 5KG6A 5T14A 4WFAQ 1T0TV 5J1PA 2UUAJ 2CPDA 2H51B 5L39A 4CNYA 3M4XA 3BYRA 3V6DB 2BQUA 1RABB 5DG9A 4QU6A 3QSIA 3E01B 4NLTA 4QIEA 2JFDA 1TKXA 4USHA 3K5OA 3M1VA 1DY3A 2CQ2A 8AT1B 3KK2B 4OJ3A 4RNMA 1AUSL 3BSCA 3QMQA 2HIQA 3VVTA 1H98A 3CCMS 2AT1B 2DR8A 2P9GA 2ADCA 2JJ4D 4JI2F 5H9FK 3DMJB 1KFSA 3CEDA 3CNQP 1QAYA 2JC1A 5KFVA 4C0BA 3VR1A 4BWMA 2QSFA 4K4SA 4NLDA 5IT9U 1BGXT 1S9EB 4NA3A 2GVZA 3J80U 1S7IA 4PG5A 3UNGC 4W4MA 4B9LA 1FFSB 2WBMA 4NPOA 3ZZPA 4WBFA 2QG9B 1U1MA 2ZM6F 1YBAA 1QSSA 3POTB 3DLHA 4J9VA 3O1LA 4ZPCA 4USJC 1Z2LA 3DRSA 1S6PA 4CLZA 5ADZA 3CCJS 2WHOA 3ONQA 1DLOB 5EWEA 4OX9F 4DCOB 2ZFHA 3HM9A 2I5JA 3VTIA 5AXNA 3BGFA 1TKDA 5BR8F 3BJYA 1Y00A 4TVAB 1SV5B 1VBKA 4NLOA 2KL8A 4PXCA 1KONA 4TY8B 1PILA 3TUJC 1JLBB 3LH2S 3M2UB 3CJKB 1BHNA 4C2MA 3D0GE 3T1YJ 3TOQA 1Q78A 2EKYA 4FS2A 4DLEA 1RAHB 2DHHA 4DL5A 1I6JA 5GAGI 1TK5A 2H5IB 3I56S 3JSRA 3BQ1A 5A2QY 4IUFA 4HYKA 2MKCA 2ZH5A 1UVLA 3I0RB 5LJ3Y 1GMWA 2MKHA 3THTA 2POKA 5T41A 3FEXB 2KJWA 3RYLA 2MXYA 1U6BA 1JLEA 2O67A 2RU3A 3MM8A 3MWBA 4PUOB 4BDPA 1WSVA 2VV5A 3VHQA 5JMNA 1KVIA 2E44A 5F41A 2XZDB 3QT7A 2KB2A 2FY8A 2KT3A 2ZITA 3MXHP 4DPWA 4M5DA 1ZAVA 2V8GA 2GJFA 4L3KA 2UP1A 1KHVA 3PO5A 1FJGJ 3KK3A 3E01A 2JHEA 1SKRA 4ECRA 3QNWB 4LF9F 2VQEF 2ACMA 3O8WA 2VBWA 4JV5J 1JLQA 2V4QA 2G2ZA 1S76D 3KK2A 3KHRA 2ZHOA 1W26A 4LFCJ 3EE3A 3R27A 2C3YA 3CD5A 2UU9J 3KOAA 4X4RA 2JLFA 2CA9A 1GFWB 2J76E 4CM0A 1GX5A 1SQFA 2VPWB 1M1KT 4WF9Q 3AOAA 1R0AA 2LDIA 1FKAF 2CQCA 2IJRA 1WF2A 1Y3KA 3W1YC 3WDOA 1FFWB 1UETA 1VFJA 2DRDA 3DLEA 4AT1B 1NK7A 1LWFB 1E6YB 3CDWA 5ETVA 2FVCA 3KLHB 4I2PA 2HQ3A 4NEZA 4QR0A 5CXTA 4QU7A 3M8WA 3R3TA 3PX6A 4X4SA 2ZUAA 4HHJA 3QIPA 2YNIB 5MLCV 3F73A 3KG4A 1T05A 1NNDA 2GHPA 2M0GB 3VAIA 4JI5F 1TL7A 4FKXA 4OV1A 2P6SA 4DR7J 3H59A 4BBYA 1A0OB 2D3OR 2DGWA 2YWFA 4ECQA 1TL1B 4TU7A 4NCBA 4ZCKA 1SH0A 3H2LA 3MHYA 4ERDA 4JI1F 4Y00A 1ZTTA 2M8DB 3GCXP 2M3DA 5KFQA 2RMLA 2SXLA 2DR7A 3MPUB 1Q7YT 3TUZC 3OUYB 1UEVA 1TUVA 4NMLA 3TZZA 3D54A 1X4FA 4YDDB 3CMES 2W4DA 4ATNA 2Z2MA 1RBAA 5EHHA 3G2XA 4C4WA 4DS5A 1UVNA 3A3NB 2JC0A 1H2VZ 2GHWA 3HHLB 2OPQA 2NXUA 3NGUA 3MM9B 5DO2A 4FKYA 4U7UK 1VQSA 1PO6A 2VA3A 2CQ3A 2OSRA 3PJWA 1VQYA 4A8QA 4GKJF 5HROA 4XPCA 4EO6A 4DPTA 1N8RT 3U1NA 2BBEA 3O6QA 4DUTA 5B0BA 1S7HA 3GYXB 3RTVA 1WD6A 2MTLA 4M1KA 1BQNA 2GFFA 2HFNA 1ZOTA 4QWAA 4RLEA 3G6ES 1NLKL 2XS7A 1MG7A 1RTJA 5B0GA 1RTHB 7FDRA 4UW2A 3TAQA 5K8MA 2IVYA 5HANA 4AQYJ 3T5KA 1M1HA 2CDRB 2YWHA 4UF4A 1YJRA 4BCAA 2NXEA 2DNLA 2N7CA 1KLMA 2ASDA 1D9FA 3W63A 4JI8J 2FYXA 2V67A 3NNHA 4EGLA 1BWEA 1U1RA 4DUYF 3EGZA 1NAQA 3KYLA 4NI2A 4CRJA 4LFAJ 2OAUA 4DX5A 3JSMA 3KHHA 3RAQA 1X0FA 2K3KA 1R6YA 2RQ4A 2W2NP 1RT1B 2DK2A 1FDNA 1K0TA 3KUGA 2OLWA 2YPYA 3DOKA 4MJKA 5K8NA 1RAEB 2JFKA 4RUAA 3HVAA 4KC5A 2DJWA 2ZBIA 3A3OB 4JI8F 4UUXA 1OIAA 3M2RA 2MKSA 3MEDB 4TY9A 3C16A 4KGVB 2VKZG 2HHUA 1TFYA 1NH7A 5DGBA 4A8SA 2VG6B 3DLKB 1R8CA 1RAFB 4IG3B 4URQU 5HO4A 3BSNA 1D8YA 1HNIB 4KO0B 2OSQA 1Z4UA 2E66A 4LFBF 1KNZA 1NZAA 2ZM6J 1T03A 1ZPWX 2VBZA 4C6AA 3C3LA 3TJ8A 5LMUJ 1VK8A 4P10A 5D3GA 2HS4A 3NWGA 1NDLA 4YB6A 3BGRB 2XMAA 4HACA 3AJDA 1UMJA 1VQ9S 2WRMA 3MM9A 4NLVA 2F4VJ 2JRSA 1JLGA 2PA8D 1TELA 2WSCC 2DITA 1HI1A 5J1EB 1IR2A 4O3OA 2IBKA 2M5YA 1F2HA 4NASA 3MECB 2FJEB 4ECWA 4JI2J 1LW0B 2DH8A 5C42B 1YJWS 4ZOSA 3CGIA 6FD1A 4LF5J 4NLPA 3HD2A 1K44A 2EBGA 4DBQA 4ZLNA 2V2QA 5D8HB 2PMZD 3B6BA 5A8WA 4KPYA 1P6TA 5KFYA 1TL3A 3D5MA 3OR2B 4JB8B 4KIAA 2N3LA 2RDIA 4ZPWR 4CLYA 4DZDA 2VJVA 1ZZFA 2BEFA 2CUYA 2G0CA 5E41A 4XPEA 4EYHB 2VFRA 4QBUA 4R5PA 2MHEA 5B0DA 1U26A 3SXLA 3KK3B 1YJVA 4MIBA 5E33A 1QAXA 5T7LA 2FZKB 1RHUB 4TU9A 3CULA 1C2PA 2P2CB 2EI5A 3CO9A 1I51B 1RT2B 4J9NA 1RGVA 1HNXF 3NS7B 4B9MA 4ANEA 3P45B 2IM2A 5J2QB 2ZH9A 4NMXA 5M2RA 2W9BB 2HBZB 4HT7A 4ILLA 1S1TA 3G82A 5FJ4A 3HKWA 1Q81T 4NI2B 2L48A 3CW2C 4P2MA 2JEFA 5GAHI 1EP4B 4CYUB 5BXIA 1FWPA 4O4GA 2W9BA 3L7OA 2JVRA 2RRNA 2P8IA 2CNKB 4IR9A 3C46A 5B0CA 1JLFB 1HBMA 2MQLA 3HZGA 3PKYA 3V6JA 2JEGA 2ROGA 5BYSA 2MLYA 3K5LA 3DOMA 5A6WA 3V6HA 1YJTA 2Z58B 3TEHB 4J9PA 4NLQA 5LJ5Y 3MURP 4PQUA 2L3MA 2I38A 3BKUA 2V2KA 2Y1JA 1K8AT 1RCXB 4LF8J 2LKZA 4B3MJ 2HVHA 4DUZF 2Y1RI 5IWAF 2I8EA 4DX7A 2XLJA 3T9NA 1J5EJ 2GS8A 1HKAA 3IGNA 2C22A 3C2PA 3NL0A 5DZ6A 2MLZA 3EICA 3RG6A 1VQ8S 4OJGA 2FHJD 2R2UA 3FSYA 3MCSA 1CJKA 1FRMA 4J9UE 4ZK7M 4B02A 5KT3A 1NSPA 2KRBA 2NXNA 3OR1B 8RUCA 2VF3A 3ITHB 2ZH6A 3Q8VA 3WBZA 1HNWF 2XLKA 1EKRA 3M2VB 5KG0A 4C97A 2BANA 2XY7A 4LF2A 1FT8A 2QO3A 3MCOA 3N0VA 2CIMA 1R6VA 1XR5A 3O5TB 2XO7A 1U1OA 5IWAJ 1RWUA 1FNOA 2K7KA 2Y0BB 2JEIA 4DV0F 3H8YA 3TX0A 4UT4A 3KG1A 1IM4A 3EPIA 1TQLA 3HVTB 2OPPA 3A8JA 1FF2A 4KBIA 3OXGA 2X1GA 2HQGA 4EU0A 1L3UA 2OTJS 1WI8A 4N47A 4AXJA 3PX4A 3KDOA 3CJSA 4B3OB 4MMOA 4IFVA 4CLPA 2K3IA 3DLBA 1HNWJ 1MWQA 1NB7A 1EB0A 1A6LA 1FEEA 1VHIA 3AD7C 3CTRA 3I96A 5KT4A 1VQ5S 2X1FA 3GR1A 5H9EJ 3BQ2A 1ZZNA 4J9KA 1N36F 1RWOB 1RBOB 3JAMU 3FMBA 3BEGB 2V34A 3EGNA 1NPPA 1T02A 2B51A 4HVZA 2Y9HA 3WZ0A 3R5GA 1RTIA 4MH8A 4JV1A 4UOCA 3CUNA 4L72B 3IR6B 1VIXA 2CG4A 2HRYA 3T19A 3HCXA 1UVIA 3FKBA 4GC6A 2HVEA 3EZUA 4C48A 5DG8A 4ZPAA 3GB0A 4HR2A 1NH8A 1V5VA 3BGOP 4RW4B 4ALZA 3OVSA 1H7XA 2IPOB 3HHKA 3SCJE 5GADI 1N4LA 3DM2A 4IOAQ 1VJWA 2AF6A 2CQ1A 5F8LA 1S6QA 3M9OB 3PTWA 3TVKA 4XO0A 4DV2J 1EAYC 1UFWA 1U0SA 2M52A 3DOLA 2VHGA 4C9DA 3M8YA 4EZ6A 2C2MB 4YOEA 1GMWD 2I1RA 3IRXA 2XSJB 3A8EA 3PR5B 4ECXA 4WXWA 1VBZA 2DHAA 2F63A 2OD4A 1RP5A 3K7RA 3QAEA 1S6OA 2IC3A 4B3SJ 1IKYB 1S1UB 3LP1B 2QMWA 2K7JA 2O66A 2VBXA 4J90A 2J5AA 3DKDA 2VODA 4NYZA 3W2WA 5KT2A 2GVDA 4KGZB 3EDRB 3HHLA 2YWGA 4DV2F 2RIJA 1B64A 2AMCB 5DS7A 4DR5J 2MGZB 1PJ6A 2CJBA 1VCTA 3MAAB 3CCTA 4N5SA 1VISA 2MQMA 3HT3A 2QYGA 3KFWX 3M9MB 2OPPB 1U47A 4M94A 3SBMA 2JL9A 5DGAA 3W2VB 4ID5B 1IQTA 3MI7X 3AQPA 3HJVA 2I2YA 2FUG9 1DFDA 3KLVA 1U1LA 1IBKF 4DR1F 1AXQA 2KI2A 4YUDA 2DO0A 1VRUB 3KLIA 4Y28C 4F4KA 1NO8A 3W2VA 1F9FA 5THWA 4DL7A 3FCWA 2C3UA 3LOUA 4U9RA 4MIAA 4ED0A 2FJVA 1NK0A 4ZJLA 3MM7A 2AJ4A 2XYPB 5ETPA 5AT1B 3FZ2A 1LNQA 1JIHA 3CE8A 4U8YA 5B0AA 2KFNA 1I94F 3CJTA 1GXLA 3ZO7A 2MKYA 3ICLA 1IBKJ 3IS9B 1WKJA 1S49A 1UL3A 3OJUA 2QFIA 1JJ2R 1KVJA 2A6MA 2KYZA 2CYYA 4ZJQA 2CAJA 4ICLB 3NNCA 2DGSA 2H4YB 1RTJB 3R5AA 2J8SA 1WORA 4CI0B 1B0PA 3GTYX 1TUGB 2Z0GA 1YWXA 2RDDA 4J9RA 1N34J 1PG5B 2E9TA 4BWJA 1F6TA 5H9EK 2LQJA 4ZP6A 1S1XA 3EVWA 3OT9A 1RKJA 3IA0A 3NAIA 2XM3A 3SIPB 1BMQB 4PPZA 2FVRA 1XNQF 3NMAA 4UZBA 3DLEB 1HBMB 1JLFA 2HFUA 4FVMA 1EQMA 2H4WB 4Q45A 1WEZA 4OX7A 5DM6Q 3KK1A 1WKLA 1Y7PA 5CCMA 5BJRA 2NSBA 4LQ9A 1VI7A 4I67A 2W2OP 1NBEB 1Z1ZA 4ZKAA 4LF7J 2E1RA 3M30B 3UDEA 1DAXA 2NREA 3CIMA 1HPZA 4OZNA 1ZBTA 3J80Y 1DZ5A 3PFOA 2QC3A 2RKIA 1T9YA 1KTQA 4RNHA 4ZP9A 2QRRA 4DSJA 2VOPA 1F5CA 4OQJA 1JLAA 3M9NB 2RF2B 2VONA 3ZTSA 1GMUA 3N01A 1C1CA 1X4EA 3GG1A 3N6MA 4X62F 3D0HE 2UVWA 4OL8A 1WTBA 2BE7D 2PA3A 2YQ0A 3M2UA 2ZBPA 4LBIA 2CJXB 4FYVB 4CT9A 4J9SA 1J5OA 4LF8F 2CADA 2C1EB 3RUBL 4ED3A 3HHLC 1OQ6A 3A3PB 3ZZYA 3TUPA 3BO4A 5ETQA 1GH8A 4B08A 3AFGA 3B8HA 1X4GA 4R0EA 1I1GA 1RWXB 2XMJA 3CCWA 4RBUA 2RHSB 3GONA 2PO4A 3C14A 3WC0A 3UNYA 4K0KJ 4KKOB 2DNHA 3QAUA 4WIIA 3VF0B 4F50A 1HARA 2AGQA 3GU0A 4IDKA 5EWFA 4OZ2A 5DRKA 5HQLA 2AX0A 3BQ0A 4B3OA 4OI2A 1FD2A 4RW6A 2UXCF 4MK9A 1SC4B 2M9KA 1WACA 3RAMA 5LSRA 3QBCA 2ZJRQ 3CCUS 2PFFB 1Q86T 3D9BA 1LFWA 3AHPA 2B3TB 4DV6F 2WVCA 3NMRA 2CG8A 1HNVA 2LMIA 4IH6A 4DWIA 4PG4A 4PZVA 3MCMA 1MMDA 2YNGB 3BR9A 2HVDA 4N8NA 4DCPB 1H38A 4KH1B 1WG4A 5KFEA 3PIPQ 1U24A 4OYIA 1TKZB 4R25A 3EZ5A 2WONB 1RB0A 2QLJB 3DOKB 3ET6B 3HSJA 2K1RB 4DR3F 2BACA 1QVFR 4JV5F 1Q53A 4I6YA 4IO1A 1NUEA 5A0YB 4B3MF 2HBYB 2YH0A 2VG7B 4MKBA 4B9UA 2GO8A 2Y8WA 1ZA2B 3MEDA 2QYCA 1WC3A 5CAAA 2V50A 1J5EF 4A8YA 3Q8YA 2I6WA 2NZ4A 3GP9A 2AWZA 4ZCIA 4YR0A 3QJPA 3KHLA 3FRYA 2HBQB 1VQNS 2C2EA 2UV8A 2I9SA 2D3UA 2XWXA 3AJ1A 2LQ8A 3CDUA 1GXTA 4ZN1A 3GFYA 1S9GB 5H9FJ 5HJXA 3CC7S 4UOGA 3MEEB 1FESA 2BRKA 2LA6A 1LFPA 1CJVB 2V2ZA 2KXNB 4ZPTR 2HRTA 3AB2B 1XEZA 4AE5A 1S59A 1IBLF 3KTQA 4JI0J 2XGQA 1YZ7A 5HP1A 2YWKA 1HBOB 3Q8UA 2AYBA 2MY8A 3QGGA 2IMOA 2APOA 1U2RA 3DXBA 4ES3A 2FJAB 2HNDA 3KDNA 1H0HB 2R7WA 4I6WA 1XMQJ 4IR1A 4TN2A 5EX3A 4X66F 4PWUA 3T5JA 4W90B 1K9MT 2CPHA 4KR0B 5GMDA 1FKPA 1RA7A 2LQ9A 5L9XA 5J2NB 4IH7A 4YHHF 3KJVB 3FSIA 2PMWA 4K50A 2BANB 2KYXA 3I0RA 1SC6A 2UXDJ 4Z37A 5F8GA 3CDAA 2DISA 4FNHA 2AEMA 4J5OA 5CYMA 5E3PA 4ZS6A 4Q43A 1RBLA 2K06A 2RQCA 2RU9A 4X65J 3M6VA 5CH7B 2ZH1A 3A1YG 1CJKB 2DD8S 1HHQA 1WOSA 2LXFA 3CWJA 3TAMB 3L4BC 2EFOA 1D1UA 1TU0B 2FPHX 2RQKA 3IM9A 4KB7A 4NYPA 2OGUA 1Q8LA 2WW8A 2PN6A 3B4DA 3C14B 1Y4ZB 3R5DA 4OYAA 4LIRA 2CRLA 3IR5B 4HHHA 4YHHJ 4F8RA 4ECTA 3DCAA 2A18A 3MOJB 1NK8A 3ENWA 2WONA 1E6VA 1SH3A 2XBPA 1HFEL 4V1Ak 5AXMA 5IV3A 4OZ1A 4DV4J 3QJJA 3US5A 2OJ3A 2FJBB 3GJTB 1I3OB 3MUVP 2DEIA 2E9ZA 3IWXA 2AJ1A 5MAOA 1Y5NB 2DGQA 2LLZA 3EVOA 4CH0S 1UP1A 2CZ4A 3G96A 3SSSA 3UDCA 1M90T 4JYAF 3Q0AA 4V19J 2WK4A 2CNLB 3MM5B 2RDJA 4K4XA 4AQYF 3PW7A 3HI9A 3NGKA 2CJYB 2DCLA 2B43A 3CJ4A 3H2VE 1TVRA 4P2XA 4ED1A 3I4PA 4K59A 1NDPA 3NCQA 3WHIA 4NCGA 3G82B 1HA1A 1OO0B 1S6QB 2XMUA 3EDQB 3NLCA 2D7SA 1LWFA 2AJFE 1P1TA 2Q79A 1VS3A 2GQ2A 3WX8A 2LFVA 1FJEB 1N5VA 3AODA 3H7HB 4DLGA 4DSKA 1N5YA 3UW1A 3DNCA 1CJUB 3HMJG 3NKYA 3UI3A 1N54B 1WC6A 4ZN3A 5KFWA 2V9KA 3GIJA 3BDPA 1RWMB 4EEYA 2XYGB 2KJVA 2B9EA 3MMBA 2O1PA 1S97A 1SJRA 1R27B 3UN5A 2IHR1 1C4CA 3RBXA 1XJWB 1TV6A 5HBMA 2KXFA 1WF1A 4ZLPA 3L3CA 4J91A 3MM6B 2B4OA 2A1BA 4N56A 4X4UA 1UEKA 3V4MA 4OI4A 3HP6A 3U02A 3DU5A 1RWKB 4E98A 2R2TA 4RW7A 1FX4A 2DKOB 4Q8FA 3MPDA 2H48B 3SDEB 2BXJA 4QWEA 2FLLA 4G1QB 4LRAA 2HQCA 2JWNA 4F26A 1ITPA 2Q1LA 3HFKA 2X3GA 2RT3A 3CCVS 1REVA 2W25A 4X84A 4YY3F 4CO0A 2E1CA 4K4VA 1TK0A 2UUBF 1JB0C 4U95A 2BUNA 2E29A 1A7GE 2CJKA 2OUGA 2HWTA 2XNQA 3THPA 2IMWP 4LRDA 4CLFA 2KN4A 4NRTA 1RT3A 4F67A 2EBEA 2QLBB 4HT5A 2VPYB 2QZ8A 1U4BA 4P75A 1NRKA 4ZLJA 3Q23A 2YKPA 5KFJA 3VAKA 5A8RA 4KFBB 4K8RA 5HMXA 3BREA 5KG7A 1FRLA 4ID8A 2E5GA 3D6FB 2ZVSA 2W2MP 3SCIE 1KFDA 1LK5A 2ZBCA 3GCWP 5KFFA 4NE9C 3ULHA 1JQGA 4FXDA 2BZ2A 2GC8A 1YGYA 1WEYA 4TQRA 3OV7A 3BO2A 1VR6A 3FFIA 2MZQA 2YXLA 1VBYA 2IBOA 5HQ8A 5B08A 1PIEA 1Q8IA 2HHHF 1S77D 1TKTB 2FVPA 2LCWA 2ZUGA 1VBXA 2KHCA 4ES1A 3W9IA 3R5CA 4BC9A 1TP7A 3VWSA 2B7CB 1NSKL 3BN7A 2ZH8A 5AXKA 3UN2A 2ATLA 3BB5A 4Z7YA 3RRGA 3HD1A 3N5FA 2RSQA 1S10A 1NMEB 5KFHA 3MM6A 3RW6A 1O8BA 4IG3A 3OFHA 4LRBA 5ITHA 1QSLA 4FNIA 3W66A 4PQUB 4O23A 3CCZA 3JQMA 3MMBB 4OHWA 5M2UA 3UR0A 3T1YF 1QAJA 3R97A 3OW2R 2B4UA 3ZZTA 7AT1B 4JI1J 4ZCLA 2GJIA 2GIQA 5D4NA 5KFSA 3I31A 3KMSA 1JLCB 3W64A 2AGOA 3VGTA 2R8IA 3G8TA 2XWYA 3HSZA 1T9TA 5HBMB 2XSJA 4ECYA 2L9NA 5F8IA 4PUOA 2DXEA 4ED5A 2WVFA 3MEGA 4DV5F 5C2GA 1FXLA 3M8SA 5IT4A 1XWLA 2OPQB 4DV6J 1HBUA 4ILRA 1DTTA 1VMBA 3H20A 3JSBA 2KZZA 2BABA 3RRKA 2W1BA 2GAGC 5KOWA 4DSEA 3EM1A 4B3TJ 3HT0A 2IVFB 1NJXA 1S72S 4RUCA 4X66J 4YR3A 1N56A 1ZTWA 4IH5A 2EFVA 3MM8B 4ZP7A 2VJUA 2HNYA 2RHQB 1R89A 1X5PA 2L9DA 4IKAA 4HI1A 4ELVA 3AXMA 2VQEJ 4DL3A 3NGSA 4KYZA 2Q6CA 1BQNB 1IUJA 1CBKA 2DIVA 2XYHB 5E3CA 4CM2A 4TU8A 3H4DA 4NOHA 1Q95G 3UPFA 4ICLA 2QTWA 2OKQA 4FXVA 4WE1B 3UQSA 2YX4A 5HROB 3TZWA 4WWSA 5IQQA 1NK4A 2E5LJ 1CLFA 5E3RA 4TYAA 4EFAC 4M95A 1RWVB 4Y2KA 1IWAA 5L8RC 4C3MA 1RJJA 3QLHA 4ZVFA 3IMQJ 4K4UA 2V68A 3Q8QB 5D4PA 5CQGA 1NKCA 3S1TA 1WF0A 2Z2ZA 5CA5A 4MT1A 1MROA 2F9DA 1D8ZA 3LP2B 3IBFB 3M32A 1T03B 4CTAA 1MU2B 3ENVA 5I3PA 2JEJA 3T6BA 1LK7A 4RO0A 3M2RB 2IM3A 4K5SA 4DOZA 2NR0A 3L09A 4C98A 3R1HA 1TFWA 4E0DA 3QRRA 3DOMB 1YRUA 1BD6A 2HAFA 2K8GA 2XHCA 3NBPA 4GKKJ 5KFRA 3J81j 2YKNA 3TA2A 1T9WA 3T3FA 2BX6A 4KY3A 4DPYA 3JYTA 5DLFA 3OVAA 2OTLS 1T05B 3QT6A 4ITSA 3F0NA 3C19A 2XNRA 5A8KA 1OJ4A 4OHVA 4O3QA 3FBFA 2YY3A 3ILOA 3R9LA 5GADU 1A9NB 3ZZUA 2HNDB 3PYFA 3UDLA 4P7VA 2FLOA 5KFPA 3M6UA 1KS2A 2IDEA 4QOTA 5DQHA 4MKAA 3CC4S 2MKJA 1X7VA 2MMYA 5ETTA 4USWA 5SZTA 4HLBA 2OFHX 2FJWA 4RJVA 2BJEA 4DSLA 1F5BA 4CIOA 2ZH2A 5HLFA 1O51A 4DU7A 4DN9A 4TKTA 4DS4A 2XSFA 4YFUA 4JI7F 3DRRA 2L08A 1F9EB 1TL3B 2CVIA 2CWKA 2GZOA 3OR2A 2ZZNA 4GMKA 2LXUA 2VZ9A 2E5JA 5E5NA 1FO1A 1FD8A 2KRRA 4NA2A 3DRYA 1Z2ZA 5B0FA 5K5MA 1ZM4A 5HQMA 3N79A 3V6DA 1SL2A 1NHUA 1WDTA 2ZOGA 3LAKA 1OSCA 4GVBA 3K58A 4FBTA 2R7TA 1VQKS 4KGMA 5EGYA 2HLUA 4H4KC 4DEZA 2CPEA 2UUBJ 1WHXA 2HHPA 1Q4RA 4DG1A 4DFMA 1RT2A 1LW2A 1BY9A 3LP0A 3TJ9A 2XCAA 4N41A 1S12A 3FFIB 3ISNC 1YBTA 4OJHA 4A8MP 3ILLA 2U1AA 2HGMA 2G1DA 4YR2A 1R43A 1LW2B 1VQ4S 8ATCB 3QO9A 1VQPS 4DR2F 1VJQA 2B9YA 1HWKA 2DHXA 3V5RA 4M5JA 3OL6A 1IR0A 2CXEA 2K1RA 2ATCB 2KDOA 2ZVIA 3E3XA 4C8OA 2VFUA 1S0MA 3DDKA 2E1PA 3D3BJ 4HH1A 4NLSA 3VAMA 2QA1A 3LF0A 2VDHA 1RT7A 3M6WA 2GV1A 1RSCA 4M8LA 5D0GA 1VRQC 4A8XA 2R8JA 3HK2A 3IG1A 1PCAA 2MQ8A 3NCPA 2BR0A 3BBCA 4I6AA 2N3OA 4DXLA 3K89A 5L1LA 2AQ4A 4ZVOB 2NPIA 3K0JA 1RT5B 3W5YA 3PY8A 1DLOA 4DFKA 2CDQA 2C42A 2PC6A 3IWLA 3D0IE 2VOOA 4G1IA 2F4VF 3M8RA 4RUHA 2L41A 4L73A 3C16B 1N5SA 3AA8A 3K8WA 3QZ8A 3A4TA 2CJ9A 3WIVA 3J81U 1ELOA 2ZWPA 4RW7B 3PKMA 1UJ6A 4OFZA 1SPBP 1X5SA 2RE1A 3CT9A 1T11A 5IM0B 5LL6d 4CDIA 1KBRA 3HFVA 2MZSA 3OL7A 3K59A 1TL5A 3FC9A 3NNAA 5ETKA 2DBBA 5F9LA 4AL6A 2GAHC 4FBUA 3CD0A 3OD2A 1HBUB 5K14B 4WPAA 4DL2A 1KSPA 1RYRA 4O3PA 2ZE2A 1IQZA 3FGVA 3FEYB 4WU3A 2XO6A 2RNEA 3D6TB 4USVA 2IFXA 1RHKB 3NOCA 4PABA 3THVA 5DQGA 2PGCA 4I4BA 2VIHA 2J6SA 1SBRA 3WC2A 3RGIA 4WFXA 4WKRA 2LA4A 2LVWA 3GYNA 5D15A 3BGLA 3H4BA 5HMZA 4R8UB 1FRIA 5KFDA 4NLRA 3W61A 2GCFA 2OMOA 3MF5A 3TVZA 3HXMA 2N4DA 4V19X 1M5KC 1VLYA 1FE4A 3BSAA 3KLGA 3G71S 1KKHA 4PXBA 5HMYA 2MZ1A 3VQSA 2BM1A 1S1WB 1DQAA 1AZSB 4I2QA 2DCUB 5HVFA 2W9CA 4EBDA 4L75A 2DNYA 1ZYQA 3TYTA 2RVJA 1FERA 4WZQA 1HIYA 2P5VA 3A12A 1S5ZA 4RBTA 3Q8SB 1ZM2A 2PEBA 2AJ2A 2YNGA 3QGPA 3UE2A 4R0JA 2DYAA 4BS2A 2CNNB 3PJXA 2J8AA 2AZ3A 5IC6B 2GJ2A 1VHFA 3OFGA 1FRKA 1HI0P 5I4MA 2XGPA 1TL4A 4PXDA 2R2SA 1SXLA 2XY5A 4ANDA 2BRLA 5HVHA 3VGVA 3FQKA 3BGUA 2WOMA 3P4UB 4FN5A 2CQHA 2OPSA 2B5JB 3MR7A 1RT7B 2BE2B 2GNKA 3G87A 2IRUA 5HK4A 3D7SB 3HVRA 1X5OA 3FNNA 1S0VA 1KDNA 1EIYB 2QL7B 4LR9A 1RHMB 4WTYA 4B9VA 2DR6A 1DTQA 3JQJA 4K4WA 4X64J 1NU4A 4EWTA 3JTOA 4YN3B 1YTYA 1KRPA 3DLGB 5D4LA 5AXLA 3OXLA 1VQOS 3PYGA 3BGRA 4A8KA 2E5HA 1ZAWA 3GFXA 4DV7J 1AROP 1U25A 2LU2A 3PFEA 2D69A 1S0NA 2BW7A 3ZNJ1 3TA0A 2D3ZA 2NSCA 4ZVTB 5CZVA 1K47A 4ED6A 1G7CB 3C15A 2BJ1A 3KLFA 4HDHA 1ULRA 4X64F 4X4VA 5KFXA 5LOQA 5LT5A 4UOFA 1XMQF 4O3SA 1YX2A 1IN0A 3AXKA 3D67A 3N28A 3R6LB 4A46A 4YB7A 1VQ6S 2DPIA 3C15B 2J7UA 4FF3A 4KTQA 3PV8A 1AYEA 3FJ2A 3MMJA 3Q8PB 1G4CA 2F9JA 2CQ0A 2KXHA 3CJQA 3OFFA 3R5BA 1FDAA 1WSRA 1R0BG 4OYWA 1SQEA 4I69A 4K2JA 1EHWA 3I5CA 4USIA 4X65F 4AFFA 5EN1A 4I68A 5B7WA 1Y5IB 3KLGB 2KVQE 4RW9B 3TZYA 4DR4F 5KTQA 1XR7A 1UWAA 1KVKA 1YZ6A 2V4JA 3HF5A 5JXSA 1U0HA 3Q8RB 4L3NA 2UVVA 1G2EA 2Y3YA 4Q8EA 3NAHA 1PC5A 3EJMA 4JI3F 2WB4A 4IRKA 4RX6A 1OYDA 3EUNA 2D41A 4GO5X 4F4ZA 2KVIA 1RK8A 4KHRA 1WOPA 2V9WA 1Y0HA 4UY85 3C6TB 2HFSA 1X4HA 3CJ0A 3LP2A 5E7OB 2HHSA 2IDLA 1HHTP 5KFGA 3NGTA 5EWGA 2JX2A 3P96A 3M8QB 1SCJB 1DTQB 3GJRB 4YEAA 2QN6B 3D4JA 2AYEA 2CQIA 4DFPA 4KJIA 4FP9A 3PYEA 4OJ1A 3K8VA 4I0WA 1F1BB 3BDEA 3D1HA 3AD9C 2IJFA 3FUYA 3KJNB 1IKVB 1UTAA 3M8ZA 4NCGB 4NCAA 1HD1A 1SQGA 4MAKA 4I7FA 1C1BB 2WSFC 1H74A 1PAUB 2A3JA 2QE5A 2OIHA 3SFUA 1GAOA 1GQEA 4OYPA 4OYXA 3CPWR 3CCLS 2BQRA 2UVUA 3MGJA 2EFGA 1VOMA 1UZHA 3JAMY 3QZ7A 5DLGA 1G1XA 4B17A 1S0OA 4P52A 4I7FB 4LVNP 1XTZA 1YBUA 4LFAF 2V69A 2YNIA 3J81Y 2DVIA 2OH2A 4BC7A 4DL6A 4ED2A 1VIOA 4HACB 1K1SA 3BO3A 1SV5A 4TY8A 2IC3B 3QWUA 4ECZA 3PO4A 1CC8A 5J1NA 1FDDA 1P27B 1U48A 4C8ZA 4GKJJ 5M2PA 2AU0A 2EFNA 4DQRA 1IBMJ 1T94A 4MK7A 1YI2S 5HLFB 1CVJA 3N4WA 2JVOA 2MB0B 3SDEA 4CWBA 4FF2A 1P8GA 1RADB 2EG2A 2G1HA 3TR5A 5F8JA 2P9CA 2UUWA 1HBNB 5F0WA 1WG5A 5AJ3F 2LQBA 2EFQA 2ASLA 4RU2A 3G6YA 2YPZA 2LEPA 3OJSA 4O44A 4CO3A 4C8MA 1S1VB 2DNGA 1R8HA 3U7JA 1MMNA 1RTDA 3NS5A 5DZ7A 1UVJA 2UV8G 4USUA 4NLUA 4YY3J 4DSFA 3W65A 3F41A 4DPXA 5A76A 1RT4B 4CT8A 2AYGA 3JQKA 4L6V3 2OMLA 1JNRB 1QSYA 1QVGR 1WTFA 2BE9B 4FPIA 3A13A 4M5DB 4ZVUB 3DI6A 3OLBA 4L76A 1RTDB 4Q2LA 1YIJS 4O4RA 2J9DE 5A2QU 1PSDA 3ET6A 2DNQA 1IXKA 4NLYA 1FFGB 4NXNJ 3RR8A 1QTNB 1NSQA 1HQUB 2UUAF 4M63A 4PEOA 4Q44A 1JJHA 1Y5LB 4H4MB 4KSEB 4N77A 2QA4G 3JSYA 1X9SA 2B6AB 2Z30B 2B0GA 3IN5A 3RB6A 1KLNA 3NBPB 4TXSA 3CVKA 4IOBA 1HW9A 2Q3PA 2MDAA 4I64A 2CQDA 3ADAC 5FIIA 1YK9A 1B3TA 2HMIA 3IG1B 4P9SA 2ZC4A 5CYJA 1GMVA 3LWLA 5A8KB 3SV4A 4F2SA 4LSLB 3PJ9A 4ANCA 2XMTA 4DPOA 1W7WA 4YP3A 1VK3A 1BE4A 3W8PA 3QT5A 1JXVA 3TI0A 1T3OA 3LPYA 2YKNB 4FF4A 1Q79A 4S0MA 1F60B 1KWMA 1SJ3P 3R7BB 3UD3P 4FXWA 1JMTA 3D6MB 1S4EA 1DHMA 1Y10A 3MMAB 2HNZA 1DRZA 1JLBA 2DRBA 4HTJA 3EPGA 1YLXA 4LREA 3DDIA 3V4IA 3CSKA 3TX8A 1C1CB 2DNNA 1FK9A 2AZ1A 4NEYA 4ECUA 3CJ5A 4UQGA 3AH6A 1XC9A 4LT6A 1ACMB 1UAWA 3MAAA 4M5GA 3GIKA 2C3MA 2ADBA 1UWBA 4OX9J 1PGZA 1GX6A 2VFSA 1MW7A 1JLGB 5BYRA 1SJFA 4NZ0A 3VGUA 1NDCA 3VV2B 3PW5A 1HR0F 1FNMA 1ZH5A 1F3VA 3CCQS 5LSOA 4K4ZA 3X3UA 2ZD1B 2ROPA 2B4PA 5SUHA 4CH7A 3HSDA 3OSNA 1PJ7A 4QWCA 4F4YA 4ED8A 3SQOP 3DRPA 3N5BA 4J9MA 4NYOA 2C2KB 2HYIB 2W9CB 2Z2LA 2BKOA 3D66A 3Q24A 1RZMA 2V4JB 3GPAA 2W4PA 3M1VB 3LO3A 3KLEA 2JOQA 3T1AA 1QTMA 4IRCA 1Q0NA 1RT4A 2P6TA 1TMMA 2ZBQA 4GRSA 3QRQA 3N9UC 1WKKA 4R8UA 4OHZA 3X1LB 2DNMA 3PEJA 1YITS 2YKQA 5E3QA 1HHSA 3KXDA 1LEOA 3P8BB 4QIWD 2FC9A 2H5JB 3DI6B 2MSTA 4QIVA 2DGXA 4WU2A 5RUBA 4FYDA 2GO9A 4CYUA 2ZJPQ 1RKIA 1TTHB 3BKFA 1N32F 4J37A 4HDGA 1QY7A 2IRXA 1HD0A 4WYWA 4JI5J 4DU8A 4WP3A 2LECA 2COLA 3J7A1 1Q5VA 4Y2IA 3M32B 3DFEA 3QFHA 2J0SD 2R9LA 1FRJA 2YTCA 2QA4S 4OZ0A 2MKIA 1NEEA 2CNOB 6AT1B 2H54B 2NCKL 2YX7A 4JI4F 1WC0A 4UUWA 1UW4A 5LM7E 1JKHA 1FRHA 4LBHA 4JI3J 4DQSA 2JSXA 4JI0F 4LFCF 2DH9A 2OEKA 2AHOB 3AOBA 3QT8A 1U6ZA 3JS9A 5HI7A 2ALYB 3S7RA 3VCDA 1D09B 1UJ5A 2W4CA 1V5IB 2Q43A 3IM8A 3JYTB 3MD3A 4OX6A 1IM6A 4ZVRB 1HQEA 1M5VC 4JI6J 3ZZ0A 4URGA 4KAIA 5ETLA 2R7VA 1YDLA 4MK8A 2VICA 2XY6A 1XMOJ 2J0WA 2YKAA 3ILJA 3E8OA 3K57A 4PQAA 1U1KA 3CJKA 2ILYA 3W2WB 4OYBA 5IT0A 5DDOC 3DGPB 4P71A 3M7VA 5H1SV 1UW9A 3CJ3A 3D1QA 3GJSB 1ZPVA 2CQ4A 4G6VB 3TA1A 4EYIB 2AW0A 2HZCA 4DQPA 4ZHRA 1KEKA 1JNZB 2YQ1A 1RHQB 3MEKA 4M5NA 3UDVA 5KFNA 4RPFA 2MGZA 3G6XA 4N76A 2J7KA 4DDFA 1DTTB 1J5OB 2O01C 1GXUA 3ZZOA 3KJVA 1KQSR 2NUUG 2FC8A 3NGDA 1VQLS 5GMKa 3V81A 2C2NA 2HFVA 2GGPB 2JNJA 1DQ8A 2PFDA 2HBRB 1SB6A 2QFJA 1OYEA 2CFXA 4TLRA 4DL4A 5F9NA 2HWHA 3IAS9 4DHVA 4IO9Q 1GTHA 1WHYA 4OI3A 3VAHA 3LAMA 2KM8B 2XMWA 1U0HB 2G13A 4LMZA 2R7QA 2LEAA 1C4AA 2VH7A 1H2UX 4KHPJ 3R2CJ 2HQIA 4CLUA 3BV8A 1NDKA 1S1TB 2RB7A 4ZVHA 4RNOA 2BJ8A 3SFGA 5KFOA 3KLEB 5KFMA 1YSJA 1O0PA 4DF4A 1UPPA 1WC4A 1AB8A 3OFEA 3NXZA 1RHRB 2UXBF 3T5HA 3TANA 4UTGA 2M70A 2MPUA 2IM0A 4U96A 1QJHA 2EVZA 2O3DA 4FPRA 4XDDA 1KOHA 3T6JA 2RRAA 4JP8A 3UO0A 4A8FA 1CQMA 3D2WA 4KHPF 2VG7A 3IBCB 4CLTA 2C2DA 1OY9A 4P72A 3T1HJ 4ZCMA 4NXNF 3MM5A 3LPEA 1U02A 2YH1A 3DHXA 3IP0A 4B3RF 1N33F 2DTJA 2DT9A 2UXBJ 3J7Z5 1F3FA 4NZ6A 3W9HA 2BE2A 1N0UA 2WAQD 2YNFA 5HMWA 2IAJA 2OPSB 4DUYJ 3BPSP 4Q2MA 3L9ZA 3M8PA 1SKUB 1N5TA 4DQQA 4OZJA 4PPDA 3M05A 2DRAA 1RT5A 1RACB 1SL0A 1M5PC 3K17A 4ZITA 4DN0A 4WK1A 1WDDA 1BQMB 1EZZB 1HWIA 3TO8A 3Q83A 2RS2A 2XMMA 3QIPB 2ZDOA 1ZETA 3CJ2A 1RAAB 1NPKA 2DY9A 4P2FA 3I32A 4DR1J 4BHQA 2VFTA 5EUHA 3H5XA 1REVB 4ID5A 1F2GA 2F65A 3Q22A 5KT6A 3D1OA 1QUVA 2F7VA 2RJZA 2YX1A 4XDCA 3GFHA 4QWBA 4ZJOA 3MUTP 1FI4A 3CB4A 2F4FA 3LA0A 5KT7A 1YG0A 3TAPA 5D77A 4LFBJ 2XG8A 1XIQA 4Z2XA 5J2PA 3V6KA 2EC2A 2RD5C 5KFIA 4C11A 1VQMS 5KFLA 2V8VA 2QEXS 1EARA 1HW8A 1CULA 4CLKA 2HWIA 1SC1B 2HK2A 1RYSA 4KV8B 3OLAA 1XNRJ 2VB6A 1CEZA 4N8OA 4CZCA 1C0UA 1JLQB 2CVEA 4NLXA 1X4DA 6FDRA 2X1BA 2HFOA 4KRWA 1HR0J 1MMLA 4GVBB 1PBUA 2QL9B 1KTVA 2V94A 2H1YA 1TKXB 4PXEA 1UCNA 2NZCA 4RL1A 1S4FA 4Y2AA 4TQSA 1VLOA 3UCZP 1RTIB 2FVSA 1FKOA 5LMNJ 2GMLA 3HLUA 2QA2A 5CD4H 3MR3A 2EG1A 1NXIA 3PRVA 1N32J 4RNNA 2B6AA 3WX4A 1RT1A 2XEXA 4H4MA 1XBWA 4IFYA 5IOLA 4DV3J 1UA0A 2FHKA 2YKOA 5KG4A 3BR8A 2LEBA 1EJ7L 5DG7A 4OI0A 9RUBA 3PIOQ 4C7QA 3KJFB 2D1CA 3PRBA 3FZBA 5CABA 1WI6A 1HQ2A 1X8DA 3HULA 4F4AA 3K2YA 4GC7A 3QWPA 2DNOA 3NEKA 3A8KA 2VASA 2XTJP 4Y2MA 1U8SA 2Z57B 3QRPA 2LYVA 2V8HA 1N48A 2YKMA 2ZNZA 4M5IA 5C25B 5K8OA 2UUCJ 3IAM9 2CJAA 3P5BP 4PCQA 4JI4J 2AJQA 1UA1A 1S79A 4WP8A 4Y3CA 2A2DA 2OD6A 1GK8A 4DMZA 4ES2A 1VYAA 2X1AA 5LXRA 3W5ZA 2N4CA 1LWCA 4WFZA 2BV3A 3V4IB 3NRBA 1HWUA 3OTOJ 4DV0J 4NLGA 4Q7AA 4RUBA 1D9DA 5G0RB 2ZC3A 1RLDA 3PVXA 3SV3A 2PMHA 4O0NA 4ZDNA 2FQQB 4K0KF 3EWGA 1URRA 2H5EA 2YQ3A 4UZCA 5F0UA 4A4JA 3FK4A 4ZMMA 3BBFA 2AJ0A 5CYMB 3M2VA 4LF9J 1HYSB 4U8VA 5HVGA 1PYSB 4RWWA 3ITHA 3HX9A 2J0XA 3FRZA 4WJBA 4QJVA 3KKFA 1KR4A 1N36J 5D78A 3IBWA 2BVZA 2WBRA 4RNFA 2WB1D 4HL9A 3M6XA 3TWZA 4KHMA 1MLAA 1CJTB 4RZRA 4CH1A 1Q1KA 4FF1A 1YJUA 1N5QA 1X5TA 3AB4B 4KFBA 4QQBA 1FXDA 4H4OA 2WW4A 5KG2A 2BQ3A 4DR3J 4EUVA 3I0SB 4O3NA 5KOXA 4X4TA 3OTDA 2HEKA 3TNVA 4CO2A 1NKEA 2FGOA 2HGLA 4IFYB 4PYAA 3CCRS 3PHEA 2CJQA 2VBYA 2C2ZB 2AGPA 4ILMA 4MIWA 1HLWA 1ROFA 4XIUA 3FEZA 4Y6IA 2VU5A 3EX7B 2KTQA 1T9XA 3I4HX 4CLSA 1JXLA 2V8DA 5A6PA 1AA1B 4C3LA 2XI3A 5KFAA 4O4GB 1ZA1B 5T7LB 5HJYA 3D68A 4HKQA 1R0AB 4OYZA 4K2XA 3P6YC 2D9PA 2QSWA 4DF8A 4AXIA 1NB2A 1VRTA 3P49B 1PAEX 1ZAXA 2OEMA 1L3SA 1RA6A 4GKKF 5D0RA 2IVMA 1SKWA 1AFIA 3BH7B 1RE1B 2QX0A 1SL1A 1ZM3A 2PSZA 3FVYA 1S1XB 5DETA 2N82B 2ACYA 1B99A 4JUZA 3R2DJ 4QYZJ 2R7XA 3CDEA 3D3CJ 4OLOA 3NG8A 3SQGB 1QM9A 1RT6B 4DR5F 2U2FA 1O5JA 4EZ9A 3HPOA 3OXFA 1V9OA 3DLGA 2FJDB 1X31C 1C0TB 2AX1A 2HQFA 2VQFF 3H2UB 2FD2A 3PRDA 3TVYA 5AE1A 4U7CA 2HRUA 3HHEA 2PI5A 1JLCA 2C28A 1FNXH 3RRHA 2FJXA 1KQKA 2LP4A 2XHWA 4C8KA 2QLXA 2BA9A 2HPUA 3R6GB 3MPVA 3H5UA 1WC1A 2B9WA 2BJDA 2CZVC 2HNZB 3SSQA 5C7PA 1OPZA 4WP9A 2R7RA 3L7UA 4WIQA 2H3EB 4C8YA 2ZKUA 3PDNA 4G1PA 4QCLA 4A8WA 1ZM9A 5LMUF 2J7WA 3DGVA 1WJ9A 2VQFJ 1RAJA 1K73T 2V5HG 3SCLE 5J1EA 5C24A 3MDFA 1CULB 2HAIA 3GJQB 5ETNA 2L9WA 2A6OA 2RRBA 1IJFB 2DB1A 2HVZA 4DV4F 1YRTA 3GG0A 4KKOA 3UN3A 5FDLA 3UWTA 4KH0B 1HMVA 5LSLA 5FD1A 2Y1IA 2J6UA 3OVBA 1T95A 3FMWA 4X4PA 5E0OA 2IIHA 2LQ5A 3ZNUA 1RI7A 3GWCA 5AJ3J 3J7YU 3T1HF 4O0IA 2DNKA 4ETXA 3OL8A 3UVJB 1VC5A 1OY8A 3BKTA 3UCGA 3QFWA 4B3RJ 4QW8A 3ZFVA 2F3JA 4Q0BA 4DR2J 3B4MA 4HI2A 4OYOA 4EK2A 2J9EA 2V4RA 3AY0A 1KLMB 4ELUA 4HTIA 4DG1B 2MJUA 3NWRA 1CPZA 1AZSA 4I2QB 4UOHA 3EZOA 4QIFA 1LXNA 5KFTA 4LF7F 2H65B 2KFZA 1PYTA 4MKYA 4K5RA 5J2MA 1RWNB 5GVQA 3TZXA 3JSMB 1DBDA 2QLFB 2WVDA 2HZAA 1SJ1A 2OELA 3P5TL 1S9GA 3MPYA 1DARA 3TUIC 3U1MA 3OTBA 3DM2B 5HSPA 1HNXJ 4CNZA 1CJUA 2KU7A 4DPUA 4ER8A 4RW4A 3CF5Q 3KK1B 2EW9A 2ZWOA 1YJNS 3EGVA 4X62J 1WWHA 3LALA 4FZVA 1HBOA 4H4KA 4QR1A 4P73A 2RUSA 4XAKA 5GAEI 2JDJA 3GV5B 4J9OA 3MAQA 3M30A 4RWXA 3DOLB 3FQLA 3IFEA 4QW9A 4ED7A 4DR6F 3G4SS 2G9OA 1PKUA 2EKNA 3SSRA 2Q66A 2J9CA 4J9LA 2BKPA 3HZEA 1PBAA 1N34F 2HHXA 3N6LA 2BOPA 1O6XA 3DDNA 2OPRB 2W2PP 2HHVA 3RBDA 2HHQA 1XNRF 1U1QA 1QE1A 3ENAA 5B0EA 3ISND 3T41A 3IRWP 2Z8QA 1NJIT 2PT0A 1S57A 1NSAA 5BR8J 3LGMA 2YVSA 7FD1A 2CPYA 1B7FA 4KPCA 5CZXA 1D0EA 1Q82T 3K5NA 4Y2CA 5CCLA 4DR6J 4PWDA 1VC6A 2F8HA 3MECA 1YQHA 4YMEA 1NKBA 1RXOB 2EPIA 1H72C 4OV6A 2ASYA 5F8MA 4J9QA 2ROEA 2AEFA 3OR1A 3ISZA 4WXOA 2B56A 3W5XA 2J9DA 3GIMA 1V3SA 3CC2S 2X7IA 1S99A 2CQGA 4PR6A 2MQPA 2PDAA 4W92B 3JTNA 5KFCA 3H40A 1RTZA 3TAMA 5IFMA 1LOUA 2EFPA 2XZWA 4M5MA 4H4OB 2R2RA 3TRGA 2DEJA 2DNRA 2N7YA 4ZVEA 3W60A 2XC9A 2QT7A 1Y11A 2AIRB 2FHMA 1TR0A 4OYMA 4O3RA 5EX0A 3MMCA 2R3VA 3BH6B 3K5PA 1VRUA 3C66A 3KLIB 4F25A 4G65A 5EDWA 1FJ7A 4ETZA 3TARA 2OHDA 2WZ1A 5DDQC 1FCAA 2PEHA 3LP0B 4B3TF 1YJ9S 1UJ4A 5DDPC 3LTOA 3SI8A 3W7BA 3M8QA 2HVIA 1FEHA 3MUMP 1GTEA 4PAAA 4RR5A 2DIUA 1UEUA 2RH3A 1VRTB 3ENQA 2HZVA 1EP4A 2UUTA 2IM1A 3EGWB 2AYMA 3I9V9 3KG0A 3OTOF 3IGVA 4BLGA 1E6YA 2QLWA 3KLHA 4A47A 2HMIB 1EQ0A 1J27A 3ZTRA 2R8GA 1UVKA 2CPIA 4FS1A 4F3QA 2O5DA 4IQXA 2GVZB 1LKZA 2ZH4A 3IC1A 3HHNB 1N0VC 3B78A 1HPZB 3PM9A 5KAKA 5KFKA 5E3AA 1RQ0A 3SQGA 2AD9A 2ZZMA 1BUXA 1N6QB 3CDBA 1CG2A 1YVFA 2ABYA 3UCUP 4ZA1A 4C0OC 4NA1A 2BW2A 3W3SA 2VPZB 3KWMA 3SCKE 2K2PA 4HEA9 1FK9B 5DJBA 1QD1A 2V6AA 5IM0A 4X4NA 5E2QA 5IV4A 3LW5C 4UY8T 1KHWA 4ZLLA 1YJ7A 2CZ9A 1B4SA 3EVMA 2W01A 4C11B 1B0TA 4OIXA 2FVQA 2AKWB 1XR6A 2YWEA 4RKUC 3W8GA 1RHJB 1T7PA 3H5SA 3IR7B 4YDXA 1UWBB 2R8HA 3MCNA 1R8PA 4K4TA 2A10A 4KE5A 1SJ4P 2DNPA 1DQ9A 3FBCA 3JTPA 4OZLA 2IA6A 1CJTA 3MTKA 2OP5A 2E1AA 1IR1A 1L3KA 2ZD1A 3A8IA 1TMJA 5FDLB 3UD5A 5AE3A 4QPTA 2ZH7A 2CKWA 5JVHQ 1D3WA 2PE8A 3S01A 3U27A 3NGRA 5C5JA 3FBEA 2MLXA 4R5PB 1U1NA 1X4CA 4LR7A 4TYBA 2VC0A 3GSDA 1C0UB 2WVBA 3OHAA 3F44A 5A8RB 2DY1A 1HNZJ 2GA7A 3CCES 1WHVA 1H7WA 3KJQB 4AL5A 4IDKB 2HG4A 5K8PA 2W8LA 1M0SA 1HQUA 3VZIA 3VAJA 1PC4A 4RW8A 2DXFA 3HO1A 4WZMA 3DMJA 3JB9k 3OL9A 2EEYA 1MU2A 1P9QC 1YRXA 2VDIA 3GZ7A 3I6PA 4WE1A 2E5IA 3F56A 4AD6A 2YNHA 4X4OA 1BC6A 4QYZK 2XB2D 4OMFG 2W7OA 1I94J 4CLWA 2FTRA 3B82A 4XK8C 1M5HA 2XULA 2MKKA 3GQCA 1HWJA 3VZHA 1HNZF 1WNEA 5KG1A 2RUGA 2F8EX 1U1PA 1HL6A 2CQPA 2IYIA 2OFGX 4B3SF 3HJFA 5DQIA 1FHTA 3CIZA 4Y0FA 4FYWB 1T8EA 5L1KA 3IXQA 2PI4A 1T9UA 2LU1A 4USTA 1R3NA 1JWWA 1OY6A 2RKIB 1HNIA 4KO0A 1M5OC 1C0TA 5B09A 1BQXA 2IYGA 2VG6A 4MYTA 4U6PA 1T3NA 4JYAJ 2W8KA 1V3RA 5C25A 1CJVA 2KKHA 2IAJB 3DYAB 3OBIA 3Q86A 1KD1T 2VA2A 2HW3A 2JLEA 3VQTA 5D6GA 4D3HA 2A2CA 1YKWA 1EX8A 1KOOA 2MJNA 4Y34A 3UD4P 1KP6A 2HFZA 1X4AA 2OI2A 2QIFA 2W2QP 3AT1B 4WFNQ 2FY1A 3FCHA 1AUDA 2QMXA 1RAIB 4KGKA 3VGSA 3RJMB 9ATCB 1U6FA 3HHDA 2NS1B 5CD4A 3MFIA 2R4FA 3PHTA 3DLLQ 1JK9B 4ZPBA 4TNOA 2QGFB 1I5OB 2Z4PA 1BXNA 3MEGB 3SMZA 5FLXU 3KLFB 1ZS6A 3LUYA 1CSJA 2CPJA 2F8MA 1SC3B 3DU6A 5F8HA 4NRUA 4RW6B 3GYGA 1HWLA 2YBVA 3Q89A 5I3QA 2KM8C 2Z2YB 2G2OA 1U7LA 3GFZA 1Q8BA 1HMVB 1MWYA 1JLEB 1NM2A 1RAGB 1S6UA 4URSA 5KFBA 1SVDA 2DGUA 4ECSA 1HNVB 2W7AA 4GO7X 1J2VA 2RILA 4YS2A 1CC7A 1XMBA 2NLWA 4IFVB 3W9JA 5C24B 5L46A 3E51A 4P74A 2AV5A 4YB1P 4E2FB 2DR5A 2YNHB 1TKZA 4NWBA 4DV1J 1NCLA 3ELHA 1G6BA 5A8WB 3J7AN 4L74A 4U67Q 4IOCQ 3I87A 3UR3C 2ILZA 4OHXA 4ZVPB 2BOAA 3O3LA 1VC0A 1XERA 2MZJA 1RDRA 2EK1A 4EO8A 5L9NA 3H25A 4Q5VA 3K5MA 1X60A 1KC8T 4JBCA 2ZDPA 2LDYA 4LSNA 1NPRA 3RB4A 5LMNF 2Y8YA 1RISA 4ZIWA 2DHSA 4CCHA 4FYYB 4F0KA 3MAHA 4P2SA 3NOGA 1F5AA 4I1TA 5HAOA 4F3MA 2ZNYA 1NK9A 3AQOA 1K1QA 3PNIA 3GIIA 1RT6A 1SKSA 5D0EA 3U1LA 4DV3F 2KFYA 1T9VA 3PG9A 2C3OA 2KO1A 1HQEB 2M8HA 4M5KA 2ZJQQ 3RR7A 2MQOA 4JV0A 2JH3A 3AJ2A 1TL7B 3M8PB 2GX8A 4LF1A 4QWDA 1VDHA 2B4VA 5LXYA 5ETMA 1N6QA 1Q5YA 3SEOA 4F36A 2HHHJ 2E7WA 1MWZA 2NYHA 3HSGA 5F3ZA 2KHDA 2NXCA 3ETOA 1OQ3A 5DM7Q 1U49A 1IKYA 1S1UA 3FSXA 4IQMA 3FCVA 4ZVGA 2UUCF 4PRFA 1N5YB 3BZQA 5L1IA 1IVZA 4C8LA 2D74B 2B8PA 3PXGa 2VG5A 1PYOB 2F5GA 3WQPA 1IBCB 1SUQB 4DJBA 3OTEA 5HP1B 2G0JA 2GQQA 1LWXA 4F0MA 2DPJA 3AAWB 1EETA 3L95X 3PYDA 3DN9A 1SI9A 3V81B 2VUGA 4LVOP 4MFBB 3DLJA 4MKVA 3T5LA 2NUHA 2ZZTA 2ZKTA 3EXCX 4CO1A 3QIDA 3G9CA 5CYQB 2CPZA 4FDFA 2VL1A 2ALZA 5KG5A 4ZHRB 3HVTA 4KV8A 1JX4A 2D9OA 3BYPA 3I82A 1SH2A 3VAFA 1TK8A 1N88A 1TUWA 2HQDA 2CPXA 1LW0A 5C42A 4Q0BB 2IJNA 2FGCA 2BM0A 3MD1A 4DV5J 3MZIA 4DL0C 3AD8C 2XMVA 1AW0A 5JJBA 1L3VA 3OHBA 4LRFA 2UU9F 4X2BA 4NX9A 1X0PA 1NZ8A 4RU9A 3DRXA 4ECVA 3MTJA 4GVLA 3BPDA 3QJLA 3OPKA 2OO4A 2WSEC 2YWWA 2X3DA 2MSSA 1RT3B 4ENOA 5ETOA 2ZOMA 5KT5A 4LF4F 1B0VA 4DI6A 1UZDA 1WUUA 1R8BA 4KT0C 1TZ0A 3MMCB 3J7ZT 2GQCA 1R7IA 4KQZA 2ERRA 1UKUA 3MOZA 1MN9A 5F3TA 4OI6A 5I42B 3MR6A 1S9EA 2PD1A 4K7QA 4HHUA 4PG8A 1QAIA 4CLLA 2XLIA 2GIFA 2VFVA 2YNFB 4B9SA 3BM7A 3O44A 3ZTPA 2I0XA 3NCRA 4NXMJ 4DR7F 3I5AA 2ZHAA 3AOCA 4I2PB 2XCPA 1Q8KA 4JI6F 4F02A 1DURA 2GMJA 2OPRA 3RW7A 3GLJA 5U47A 2DR9A 2HHWA 1U8WA 3H42A 3CD7A 4YB5A 2BKNA 2XI2A 1GEHA 3R5JB 3MPWA 2M4MA 4H54A 5GAGU 3DYAA 1V6HA 4LJMA 4A48A 3MEEA 4YQWA 3BF4A 1GNKA 4PG6A 5L1JA 4U7UD 4NXMF 1XQIA 5GAEU 4WYLA 1LWCB 1CS4B 1LWEB 4JI7J 3CMQA 3KUEA 5KG3A 3B54A 4EI2A 3IRXB 1H2TZ 3PEHA 1TV6B 1UFLA 3FBBA 2CQBA 1R8AA 3ETMA 3NP5A 5J2NA 3CD6S 3KMQA 2XZTB 3RAXA 3H98A 1XK8A 4QIGA 3TJAA 4QPXA 4IG0B 1EETB 2IRYA 3QGHA 1IJEB 1FXRA 2FIUA 4F04B 3LWMA 4NLWA 2FHOB 2H9ZA 1XN9A 1TAQA 2MZRA 3BN4A 4O44B 3DRRB 1OWXA 3RU0A 1LXJA 1H73A 1RU2A 2RAQA 1U2FA 3NY0A 3ZC4A 4C3KA 3S6EA 3BBBA 5ETSA 1NJYA 2GGPA 2M2BA 3NS6A 3GR0A 4FYXB 2C2OB 4ZVSB 5J2PB 2X51A 3BSOA 2ASJA 3UVJA 2V63A 1W2IA 2BJ9A 1E6VB 2A0FB 2ZOFA 1FRXA 2DGVA 4CP5A 3RB3A 3Q2SC 4MTPA 3PX0A 1FWLA 1RAOA 3R7SB 1L5UA 2AP6A 3HKZD 2MHNA 5CHCB 1G3OA 4EBEA 4LR8A 4OZ5A 3FDSA 3SYZA 4X4QA 4OI1A 4IRDA 1H6KX 4MYUA 4CTAB 5A0YA 2MYFA 4F4WA 3P3DA 1GT8A 1YHQS 4DV1F 1W2BR 1MROB 2DHGA 4WFBQ 2D3O1 3R1LA 2HSEB 3S8SA 1S9FA 4B9TA 1B7YB 2E7VA 1PJ5A 3HFZB 3QLHB 4JOUA 2GIRA 3GV8B 2YKMB 2CPFA 3W62A 2NPFA 1KN6A 4CO4A 3PR4A 1JKHB 2F40A 1NK5A 2FLPA 1BWVA 2VD3A 1TL1A 2HLTA 1L3TA 1MNEA 2KZMA 3IO1A 1U09A 3DC2A 4Z7CA 3CXCR 3TQ1A 3GV7B 1XNQJ 4WTOB 3KNAA 4NZ7A 3ZZRA 5IZHA 3DRSB 5F8NA 4N7TA 5K20B 2GVDB 5G0RA 4F7VA 3EXYA 1IBMF 4DZ6A 4F0HA 3OQ2A 1QE1B 3PACA 4DFJA 3D28A 1SUQA 1R31A 1TAUA 1JJCB 2QV6A 2VG5B 4LIWA 5HL7Q 4F3OA 1CS4A 1F9HA 1LWEA 1N52B 3DXSX 4ED4A 2Q6BA 4NL5A 5D0HA 5D4OA 1HBNA 4LRCA 3RBEA 3I55S 1CQNA 4LF5F 1FKPB 3LGHA 4D3GA 3RB0A 4PWDB 3GMGA 5JVGQ 2UZAA 3PW0A 3ILIA 4EMDA 1RLCL 3QPIA 4AL7A 1JXEA 4LUBA 5G4DA 2G0IA 2MQQA 3LANA 5HN0A 1RU1A 1QLNA 2FDNA 1NHKL 1FKOB 2HS0A 4UQTA 1NK6A 5ETRA 2M88A 1RCOB 2QMUB 3I0SA 1VQ7S 1FTCA 1S48A 4ZVQB 4AYBD 2DNZA 3G8QA 5IS2A 4HH0A 1S1VA 1FWKA 4PWWA 2ZHBA 1X9WA 4OLPA 3I5BA 3ZTQA 2UXCJ 5GAHU 4WCEQ 4M5HA 4LSNB 2R7SA 1Y9OA 1WOOA 4W98A 4E8UA 3IWNC 2FLNA 5BYQA 1P1LA 2V8PA 2DGTA 5GMEA 5KFZA 3H90A 4ZIVA 1M5SA 2MQNA 5J2MB 2KG1A 3GE9A 4QZVB 3HDSA 4Y65A 4DX6A 4USMA 4F2RA 2QL5B 1IKWA 2VC1A 2E5LF 3GIRA 2E7XA 1HYSA 2QJ3A 5IXUA 2KT5A 2E1MC 5I42A 2R8KA 1FA0A 2WVEA 1FVQA 5I3UB 2BDPA 3C6TA 2XS5A 2C3PA 3ZZZA 5IQ6A 4I56A 3QQCD 1Q7LB 3OTCA 3KUHA 3POTA 1UFKA 4DV7F 2B5JA 2HKEA 2VKRA 3EMTA 1OPIA 4TLQA 2W24A 2WTFA 2W7PA 2EC0A 1FJCA 3UFCX 2R7UA 2M7SA 5I3UA 2DGOA 2RQMA 4CQ1A 1K0VA 4DUZJ 1JLAB 2XMKA 3G8SA 3PW2A 4DSIA 3CCSS 1U45A 1X4BA 4DQIA 3HHLD 2C2RA 1C1BA 3E2EA 3OUYA 2AEJA 1BLUA 2ZEJA 4LSLA 1EKSA 3DGPA 5HATA 1LQ9A 3MR5A 2GHVC 1KQFB 1WHWA 3LGNA 4XTTA 5DDRC 2ZH3A 1AT1B 1BQMA 1NJZA 4FVCA 1DJ0A 1IBLJ 3HVWA 2P9EA 2FZGB 2R42A 3CJ8A 3RBZA 2ZBRA 5CYQA 3TEGA 3G6VA 4DR4J 4IG0A 5AE2A 3Q2TC 1RWPB 1WC5A 3D6HB 4J7CA 3WIUA 2ZE2B 5C2CA 2NQPA 3VALA 2WCXA 3H5YA 3RZAA 1URNA 2DH7A 1FJGF 2HGNA 4LF4J 2E9RX 4PG7A 4PYDA 3V2UC 4C0HA 1W25A 3C8YA 1MSWD 2EXUA 2BMBA 4LF6F 1U2CA 2DO4A 2PIIA 2BJ7A 2R7OA 2GW8A 3DHWC 4LSZB 2XQCA 3PW4A 4LBPA 1XMOF 4ELTA 3C6UB 2IA0A 2UXDF 1RTHA 4PKDB 3G86A 2KT2A 2MZTA 3QYYA 4QYRA 1JJ4A 3VVUA 2LXIA 4P7TA 1IKXA 4QR2A 1RUSA 3BS9A 4RW9A 2HK3A 3T9ZA 4LQ3A 4WFYA 3AA9A 3QATA 1M1GA 2V0NA 1VGYA 1QUPA 3OSPA 1QDUB 3C6UA 2UVRA 3MM7B 3CO0P 3DRPB 3PZPA 5J2QA 4JV2A 3MFHA 4K4YA 4CO5A 1X9MA 1D9AA 1P9YA 3TW0A 3GSIA 5JUMA 1FX2A 1NHVA 1Q16B 1HI8A 1SIZA 4ZP8A 4EBCA 4LF6J 2FB0A 1OMSA 2RS8A 3IS9A 4WKYA 1OSDA 4RW8B 3I9ZA 4P6QA 2J6TA 1TVRB 1NJWA 2MEWA 3KHGA 1B70B 2HS3A 1MN7A 1TKTA 2WOMB 2F1FA 1SIWB 1UPMB 3O2IA 4OX8A 1FVSA 3L7PA 4OZ3A 1SJQA 2B8QA 2MY7A 5KFUA 2IY5B 3TQEA 1FE0A 1APSA 1F0XA 1IKWB 4AUKA 3H0PA 3QO9B 2HURA 2FZCB 2VPXB 1S6PB 1IKVA 4RBVA 1V3ZA 4F4XA 2GMHA 2JZ5A 2JLGA 3VAGA 3QGIA 3MMAA 4ZPDA 1IWGA 4OHYA 2NXJA 4A8OA 3R7NB 5D3GB 2EWHA 4B9NA 2OEJA 1UVMA 2HHTA 1OS5A 1WELA 2B7BB 3JXOA 2G2YA 2Z56B 2CWXA 3SZ2A 1KQGB 3DLKA 2W9AA 2FHJA 4C8NA 2G4BA 1Y3JA 2NYIA 3CMAS 3CJRA 5K9FA 1FDBA 1H3DA 3ZTOA 1REGX 2EK6A 3MR2A 3J7YI 1FTRA 3R8YA 1RWWB 1AFJA 2J0QD 2HIYA 4ZPVR 3EYZA 3TP2A 3LP1A 1WEXA 2B9XA 2DXDA 2XS2A 5IT9Y 2RF2A 1WG1A 2BJ3A 1N33J 2I5JB 2V2VA 4IYQA 2KG0A
chains in the Genus database with same CATH topology
3KNGA 2Y0SD 3N6NA 4G1QA 3LQVA 4MFBA 1IKXB 4WK3A 4DX8H 5L38A 4G3IA 5K14A 2HNYB 1LV5A 2KH9A 3GILA 5FLXY 1S1WA 2BYCA 5KG6A 5T14A 4WFAQ 5J1PA 2CPDA 5L39A 4CNYA 3M4XA 3V6DB 2BQUA 5DG9A 4QU6A 3E01B 4NLTA 4QIEA 2JFDA 1TKXA 4USHA 3K5OA 3M1VA 2CQ2A 3KK2B 4OJ3A 4RNMA 3BSCA 3QMQA 2HIQA 1H98A 3CCMS 2DR8A 2P9GA 2ADCA 2JJ4D 4JI2F 3DMJB 1KFSA 3CEDA 1QAYA 2JC1A 5KFVA 4C0BA 3VR1A 4BWMA 2QSFA 4K4SA 4NLDA 1BGXT 1S9EB 4NA3A 4PG5A 3UNGC 4B9LA 2WBMA 4NPOA 3ZZPA 1U1MA 2ZM6F 1YBAA 1QSSA 3POTB 3DLHA 3O1LA 4ZPCA 4USJC 1Z2LA 3DRSA 1S6PA 5ADZA 3CCJS 2WHOA 3ONQA 1DLOB 5EWEA 4OX9F 3HM9A 2ZFHA 2I5JA 3VTIA 5AXNA 3BGFA 1TKDA 5BR8F 3BJYA 1Y00A 1SV5B 4NLOA 4TY8B 4PXCA 1KONA 1PILA 3TUJC 1JLBB 3LH2S 3M2UB 3CJKB 4C2MA 3D0GE 3TOQA 1Q78A 2EKYA 4FS2A 4DL5A 1I6JA 5GAGI 1TK5A 3I56S 3JSRA 3BQ1A 5A2QY 4IUFA 4HYKA 2MKCA 2ZH5A 1UVLA 3I0RB 5LJ3Y 2MKHA 3THTA 2POKA 5T41A 3FEXB 2KJWA 3RYLA 2MXYA 1U6BA 1JLEA 2O67A 2RU3A 3MM8A 3MWBA 4PUOB 4BDPA 2VV5A 1KVIA 2E44A 5F41A 2KB2A 2KT3A 2ZITA 3MXHP 4M5DA 1ZAVA 2V8GA 2UP1A 1KHVA 3PO5A 3KK3A 3E01A 2JHEA 1SKRA 4ECRA 4LF9F 2VQEF 3O8WA 2VBWA 1JLQA 2V4QA 1S76D 3KK2A 3KHRA 2ZHOA 3KOAA 3R27A 2C3YA 3CD5A 4X4RA 2JLFA 2J76E 1GX5A 2VPWB 1M1KT 4WF9Q 1R0AA 2LDIA 1FKAF 2CQCA 1WF2A 1Y3KA 3WDOA 1UETA 1VFJA 3DLEA 1NK7A 1LWFB 1E6YB 3CDWA 3KLHB 2FVCA 4I2PA 2HQ3A 4QR0A 5CXTA 4QU7A 3R3TA 3PX6A 4X4SA 4HHJA 3QIPA 2YNIB 5MLCV 3F73A 3KG4A 1T05A 1NNDA 2GHPA 2M0GB 3VAIA 4JI5F 4OV1A 2P6SA 3H59A 4BBYA 2D3OR 2DGWA 2YWFA 4ECQA 1TL1B 4TU7A 4NCBA 4ZCKA 1SH0A 3H2LA 3MHYA 4ERDA 4JI1F 4Y00A 1ZTTA 2M8DB 2M3DA 5KFQA 2RMLA 2SXLA 2DR7A 1Q7YT 3TUZC 3OUYB 1UEVA 1TUVA 4NMLA 3D54A 1X4FA 4YDDB 3CMES 2W4DA 4ATNA 2Z2MA 5EHHA 4C4WA 4DS5A 1UVNA 2JC0A 1H2VZ 2GHWA 3HHLB 2OPQA 2NXUA 3MM9B 5DO2A 4U7UK 2VA3A 1VQSA 1PO6A 2CQ3A 2OSRA 3PJWA 1VQYA 4A8QA 4GKJF 5HROA 4XPCA 4EO6A 1N8RT 3U1NA 2BBEA 3O6QA 5B0BA 1S7HA 3GYXB 3RTVA 1WD6A 4M1KA 1BQNA 2GFFA 2HFNA 1ZOTA 4QWAA 4RLEA 3G6ES 2XS7A 1RTJA 5B0GA 1RTHB 7FDRA 4UW2A 3TAQA 5K8MA 2IVYA 3T5KA 2YWHA 4BCAA 2ASDA 1YJRA 2N7CA 2DNLA 1D9FA 1KLMA 3NNHA 4EGLA 1BWEA 1U1RA 4DUYF 3EGZA 1NAQA 3KYLA 3KHHA 2OAUA 3RAQA 3JSMA 1X0FA 2K3KA 1R6YA 2RQ4A 1RT1B 2DK2A 1FDNA 1K0TA 2OLWA 3DOKA 4MJKA 5K8NA 2JFKA 4RUAA 3HVAA 4KC5A 2DJWA 2ZBIA 4JI8F 4UUXA 1OIAA 3M2RA 2MKSA 3MEDB 4TY9A 2HHUA 2VKZG 1TFYA 1NH7A 5DGBA 4A8SA 2VG6B 3DLKB 1R8CA 4IG3B 4URQU 5HO4A 3BSNA 1D8YA 1HNIB 4KO0B 2OSQA 1Z4UA 2E66A 4LFBF 1KNZA 1NZAA 1T03A 1ZPWX 2VBZA 3C3LA 5D3GA 1VK8A 2HS4A 3NWGA 4YB6A 3BGRB 1VQ9S 1UMJA 2WRMA 3MM9A 4NLVA 2JRSA 1JLGA 2PA8D 2WSCC 2DITA 1HI1A 5J1EB 2IBKA 4O3OA 2M5YA 3MECB 2FJEB 4ECWA 1LW0B 2DH8A 5C42B 1YJWS 4ZOSA 3CGIA 6FD1A 4NLPA 4DBQA 2EBGA 5D8HB 2PMZD 5A8WA 4KPYA 1P6TA 5KFYA 1TL3A 3D5MA 3OR2B 4KIAA 2N3LA 2RDIA 4ZPWR 1ZZFA 2G0CA 5E41A 4XPEA 4EYHB 2VFRA 4QBUA 4R5PA 2MHEA 5B0DA 1U26A 3SXLA 3KK3B 1YJVA 4MIBA 5E33A 1QAXA 5T7LA 4TU9A 3CULA 1C2PA 2EI5A 3CO9A 4J9NA 1RT2B 1RGVA 1HNXF 4B9MA 2IM2A 5J2QB 5M2RA 2W9BB 4ILLA 4HT7A 1S1TA 5FJ4A 3HKWA 1Q81T 2L48A 2JEFA 5GAHI 1EP4B 4O4GA 2W9BA 3L7OA 2JVRA 2RRNA 4IR9A 3C46A 5B0CA 1JLFB 1HBMA 2MQLA 3HZGA 3PKYA 3V6JA 2JEGA 2ROGA 5BYSA 3K5LA 3DOMA 5A6WA 3V6HA 1YJTA 4J9PA 4NLQA 5LJ5Y 3MURP 4PQUA 2L3MA 2I38A 2V2KA 2Y1JA 1K8AT 2HVHA 2LKZA 4DUZF 2Y1RI 5IWAF 2I8EA 2XLJA 3T9NA 3C2PA 3IGNA 2C22A 3NL0A 1VQ8S 4OJGA 2FHJD 2R2UA 3FSYA 3MCSA 1FRMA 4ZK7M 4B02A 5KT3A 2KRBA 3OR1B 2ZH6A 3ITHB 3WBZA 1HNWF 2XLKA 4C97A 3M2VB 5KG0A 1HYSA 2BANA 2XY7A 1FT8A 2QO3A 3N0VA 2CIMA 1XR5A 3O5TB 2XO7A 1RWUA 1FNOA 2K7KA 2JEIA 4DV0F 3H8YA 3KG1A 1IM4A 3EPIA 1TQLA 3HVTB 2OPPA 4KBIA 1FF2A 4EU0A 3OXGA 2X1GA 2YH1A 1L3UA 2OTJS 1WI8A 4N47A 4AXJA 3PX4A 4B3OB 4MMOA 4IFVA 2K3IA 3DLBA 1NB7A 1FEEA 1A6LA 3CTRA 5KT4A 1VQ5S 3I96A 2X1FA 3GR1A 3BQ2A 1ZZNA 4J9KA 1N36F 3FMBA 3BEGB 3EGNA 1T02A 2B51A 4HVZA 3WZ0A 1RTIA 4MH8A 4JV1A 4UOCA 3CUNA 4L72B 3IR6B 1VIXA 2CG4A 2HRYA 3T19A 1UVIA 4GC6A 3EZUA 5DG8A 4ZPAA 3GB0A 1NH8A 4RW4B 4ALZA 3OVSA 1H7XA 1N4LA 3HHKA 3SCJE 5GADI 4IOAQ 3DM2A 1VJWA 2AF6A 2CQ1A 5F8LA 1S6QA 3M9OB 3TVKA 4XO0A 1UFWA 2M52A 3DOLA 4C9DA 4EZ6A 4YOEA 2I1RA 3IRXA 2XSJB 3A8EA 3PR5B 4ECXA 4WXWA 1VBZA 2DHAA 2OD4A 1RP5A 3K7RA 3QAEA 1S6OA 2IC3A 1IKYB 1S1UB 3LP1B 2QMWA 2K7JA 2O66A 2VBXA 2VODA 2J5AA 4NYZA 3W2WA 5KT2A 3HHLA 2YWGA 4DV2F 2RIJA 1B64A 5DS7A 2MGZB 2CJBA 4N5SA 3HT3A 2VOPA 3CCTA 1U47A 2MQMA 3M9MB 3KFWX 2OPPB 4M94A 2JL9A 5DGAA 3W2VB 4ID5B 1IQTA 3MI7X 3AQPA 1DFDA 2I2YA 2FUG9 3KLVA 1U1LA 1IBKF 4DR1F 1AXQA 2KI2A 4YUDA 2DO0A 1VRUB 3KLIA 4Y28C 4F4KA 1NO8A 3W2VA 1F9FA 5THWA 4DL7A 3LOUA 2C3UA 4U9RA 4MIAA 4ED0A 2FJVA 1NK0A 3MM7A 2AJ4A 3FZ2A 1JIHA 3CE8A 2KFNA 5B0AA 1I94F 1GXLA 3ICLA 3IS9B 3OJUA 1S49A 1UL3A 1JJ2R 1KVJA 2KYZA 2CYYA 4ICLB 3NNCA 2DGSA 1RTJB 3R5AA 4CI0B 1B0PA 2Z0GA 1YWXA 4J9RA 2E9TA 4BWJA 2LQJA 4ZP6A 1S1XA 1RKJA 1N32F 2FVRA 3IA0A 3NAIA 1XNQF 3NMAA 4PPZA 3DLEB 1HBMB 1JLFA 4FVMA 4Q45A 3KK1A 1WEZA 4OX7A 5DM6Q 1Y7PA 5CCMA 5BJRA 2NSBA 4LQ9A 1VI7A 4I67A 1Z1ZA 4ZKAA 2E1RA 3M30B 1DAXA 2NREA 3CIMA 1HPZA 4OZNA 1ZBTA 3J80Y 1DZ5A 3PFOA 2RKIA 4RNHA 1KTQA 4ZP9A 2QRRA 4DSJA 1F5CA 4OQJA 1JLAA 3M9NB 2RF2B 2VONA 3N01A 1C1CA 1X4EA 3GG1A 3N6MA 4X62F 3D0HE 2UVWA 4OL8A 1WTBA 2PA3A 3M2UA 4CT9A 4J9SA 1J5OA 4LF8F 4ED3A 3HHLC 1OQ6A 3ZZYA 3BO4A 1GH8A 4B08A 3B8HA 1X4GA 4R0EA 1I1GA 2XMJA 3CCWA 4RBUA 3WC0A 2PO4A 4KKOB 2DNHA 3QAUA 4WIIA 3VF0B 4F50A 1HARA 2AGQA 4IDKA 5EWFA 5DRKA 2AX0A 3BQ0A 4B3OA 4OI2A 1FD2A 4RW6A 2UXCF 4MK9A 2M9KA 3CCUS 1WACA 3RAMA 5LSRA 2ZJRQ 2PFFB 1Q86T 1LFWA 3AHPA 2B3TB 4DV6F 3NMRA 1HNVA 2LMIA 4IH6A 4DWIA 4PG4A 1MMDA 2YNGB 3BR9A 4N8NA 1H38A 1WG4A 5KFEA 1U24A 1TKZB 4R25A 3EZ5A 2WONB 3DOKB 4DR3F 1QVFR 4JV5F 2K1RB 2BACA 1Q53A 4I6YA 4IO1A 5A0YB 4B3MF 4B9UA 2YH0A 2VG7B 4MKBA 2GO8A 3MEDA 2QYCA 1J5EF 4A8YA 2NZ4A 2AWZA 4ZCIA 4YR0A 3QJPA 3KHLA 3FRYA 1VQNS 2C2EA 2UV8A 2I9SA 2D3UA 2XWXA 3AJ1A 3CDUA 1GXTA 3GFYA 1S9GB 5H9FJ 3CC7S 3MEEB 1FESA 2BRKA 2LA6A 1LFPA 2KXNB 1IBLF 4ZPTR 3AB2B 4AE5A 1XEZA 3KTQA 2XGQA 5HP1A 2YWKA 1HBOB 2AYBA 2MY8A 3QGGA 2IMOA 2APOA 1U2RA 3DXBA 4ES3A 2FJAB 2HNDA 1H0HB 2R7WA 4I6WA 4IR1A 4TN2A 5EX3A 4X66F 4PWUA 3T5JA 4W90B 1K9MT 2CPHA 4KR0B 4YHHF 1FKPA 1RA7A 2LQ9A 5L9XA 5J2NB 4IH7A 3KJVB 3FSIA 4K50A 2BANB 2KYXA 3I0RA 1SC6A 4Z37A 5F8GA 3CDAA 2DISA 4FNHA 4J5OA 4Q43A 5CYMA 5E3PA 4ZS6A 2RQCA 2RU9A 3M6VA 5CH7B 2ZH1A 3A1YG 2DD8S 1L3TA 3CWJA 2LXFA 3TAMB 1D1UA 4Q8EA 2EFOA 2FPHX 2RQKA 4KB7A 4NYPA 1Q8LA 2WW8A 2PN6A 3B4DA 1Y4ZB 3R5DA 4LIRA 2CRLA 3IR5B 4F8RA 4ECTA 3DCAA 2A18A 3MOJB 1NK8A 3ENWA 2WONA 1E6VA 1SH3A 2XBPA 1HFEL 5AXMA 4OZ1A 3QJJA 3US5A 2OJ3A 2FJBB 3MUVP 2E9ZA 3IWXA 2AJ1A 5MAOA 1Y5NB 2DGQA 2LLZA 4CH0S 1UP1A 2CZ4A 3G96A 3SSSA 3UDCA 1M90T 4JYAF 3Q0AA 4V19J 2WK4A 3MM5B 2RDJA 4K4XA 4AQYF 3PW7A 3HI9A 3NGKA 3H2VE 2DCLA 2B43A 3CJ4A 1TVRA 3I4PA 4K59A 3NCQA 4NCGA 1HA1A 1OO0B 1S6QB 2XMUA 3NLCA 2D7SA 1LWFA 2AJFE 1P1TA 2Q79A 1VS3A 2GQ2A 4DSKA 1FJEB 1N5VA 4DLGA 1N5YA 3UW1A 3DNCA 3HMJG 5KFWA 3NKYA 3UI3A 1N54B 3BDPA 2V9KA 3GIJA 4EEYA 2KJVA 3MMBA 2O1PA 1S97A 1SJRA 1R27B 2IHR1 1C4CA 1TV6A 5HBMA 2KXFA 1WF1A 4ZLPA 3L3CA 3MM6B 2B4OA 2A1BA 4N56A 4X4UA 3V4MA 4OI4A 3HP6A 3U02A 3DU5A 4E98A 2R2TA 4RW7A 4Q8FA 3SDEB 2BXJA 4QWEA 2FLLA 4G1QB 2JWNA 4F26A 2Q1LA 3HFKA 2X3GA 2RT3A 3CCVS 1REVA 2W25A 4X84A 4YY3F 4CO0A 2E1CA 4K4VA 1TK0A 2UUBF 1JB0C 2BUNA 2E29A 1A7GE 2CJKA 2HWTA 2XNQA 3THPA 2IMWP 2KN4A 4NRTA 1RT3A 4F67A 2EBEA 1U4BA 4HT5A 2VPYB 2QZ8A 1NRKA 3Q23A 2YKPA 5KFJA 3VAKA 5A8RA 4KFBB 5HMXA 3BREA 5KG7A 1FRLA 4ID8A 2E5GA 2ZVSA 3SCIE 1KFDA 1LK5A 2ZBCA 5KFFA 4FXDA 3ULHA 2BZ2A 2GC8A 1YGYA 1WEYA 4TQRA 3OV7A 3BO2A 3FFIA 2MZQA 1VBYA 2IBOA 5HQ8A 5B08A 1Q8IA 2HHHF 1S77D 1TKTB 2FVPA 2LCWA 2ZUGA 1VBXA 2KHCA 4ES1A 3R5CA 4BC9A 1TP7A 3VWSA 2B7CB 3BN7A 2ZH8A 2ATLA 5AXKA 3BB5A 3RRGA 3N5FA 2RSQA 1S10A 5KFHA 3MM6A 3RW6A 1O8BA 4IG3A 3OFHA 5ITHA 1QSLA 4FNIA 4PQUB 4O23A 3CCZA 4OHWA 3MMBB 5M2UA 3UR0A 3T1YF 1QAJA 3OW2R 2B4UA 3ZZTA 4ZCLA 2GJIA 2GIQA 5KFSA 3I31A 3KMSA 1JLCB 2AGOA 2R8IA 3G8TA 2XWYA 5HBMB 2XSJA 4ECYA 2L9NA 5F8IA 4PUOA 4ED5A 3MEGA 4DV5F 1FXLA 3M8SA 5IT4A 1XWLA 2OPQB 2KZZA 1HBUA 4ILRA 1DTTA 1VMBA 3H20A 3JSBA 2BABA 3RRKA 5KOWA 4DSEA 2IVFB 1NJXA 1S72S 4RUCA 4YR3A 1N56A 1ZTWA 4IH5A 2EFVA 3MM8B 4ZP7A 2HNYA 1R89A 1X5PA 2L9DA 4IKAA 4HI1A 4ELVA 4DL3A 2Q6CA 1BQNB 1IUJA 2DIVA 5E3CA 4TU8A 3H4DA 4NOHA 3UPFA 4ICLA 2OKQA 4FXVA 4WE1B 3UQSA 2YX4A 5HROB 1NK4A 5IQQA 1CLFA 5E3RA 4TYAA 4EFAC 4M95A 4Y2KA 4C3MA 5L8RC 1RJJA 3QLHA 4ZVFA 4K4UA 3Q8QB 5D4PA 5CQGA 1NKCA 3S1TA 1WF0A 5CA5A 1MROA 2F9DA 1D8ZA 3LP2B 3M32A 4CTAA 1MU2B 3ENVA 5I3PA 2JEJA 3T6BA 1LK7A 3M2RB 2IM3A 4K5SA 4DOZA 2NR0A 3L09A 4C98A 3R1HA 1TFWA <