3D0SA

Camp receptor protein from m.tuberculosis, camp-free form
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
224
structure length
224
Chain Sequence
MDEILARAGIFQGVEPSAIAALTKQLQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISDSERLARRAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of cAMP receptor protein from M. tuberculosis in the unliganded form
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
molecule keywords TRANSCRIPTIONAL REGULATORY PROTEIN
total genus 69
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3d0sA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3d0sA01
2D5FA 3QACA 2P5VA 4LEJA 1B59A 3LAPA 1R36A 4LA3A 2QQBA 2EA4A 1GQGA 1S29A 4ZU5A 2QWWA 3H8UA 1FSEA 2DW4A 2GA2A 1ZG5A 1XE8A 4AVBA 4AIHA 1JE8A 2L4AA 1BJAA 4I3PA 3KLOA 2EWNA 4IRGA 3RYRA 2QENA 3E97A 2IC1A 1VJ2A 2HKOA 4U0VA 4OIQF 2UYAA 3FJSA 1CAXA 1UFMA 1YW7A 4YYOA 4WBBA 2MLKA 5E8GA 3IDCB 4HN0A 4MTDA 1ZHFA 2AXLA 4ESFA 5CVIA 1R00A 4FBFA 2ZCWA 1DDNA 5L3DA 4H0EA 1PMIA 2C0ZA 2H0VA 2OU2A 3NVCA 3M1EA 1QBJA 2HQNA 1YS6A 1FOKA 5KHGA 2F5CA 1XE7A 2PAMA 4XF1A 3CUQA 3GX4X 1YUDA 2XRNA 1YHFA 3T1BA 3SCGA 2EVXA 4YG2F 5TRDA 3J81K 4HBNA 2HEOA 2Q8KA 1OMIA 4ESBA 3KE2A 1ZLKA 4DINB 1U8RA 1OPCA 3WW1A 5JR3A 1IPKA 2OAZA 1TLHB 3QRFF 1IW7F 4U0WA 2NYXA 1X82A 1XSVA 4E2QA 4LULA 1FYMA 1L0OC 4MGKE 3D0SA 4OINF 2JPCA 2EV0A 3TOBA 2NAZA 5BMZA 1RL3A 2DCTA 1XD7A 2CAVA 4D0PA 4XLPF 3UKTA 3F8CA 4LG0A 4EM1A 4KU7A 3WTTC 4MEXF 3J81Z 3BU7A 2CYYA 2WC2A 3S2WA 4M9ZA 3HTSB 4ZU4A 4QM9A 2XAGA 2LKPA 4TV7A 2STWA 4MHGA 2VT2A 1ON2A 2E7WA 5ED4A 3FXUA 1UW8A 4XF0A 2AS5F 1ZRDA 2LNBA 2R7DA 5E1ZB 2HOEA 4M71A 5DYMA 1GVJA 1FT9A 3DF8A 3KP6A 4IEPA 3F8NA 1Q43A 3I7DA 1IN8A 1ZRRA 3ZMTA 3Q9SA 3WGHA 1Y0UA 3GLXA 2CAUA 1KU9A 3GFIA 1D3YA 3CLOA 1QO0D 4KU8A 1AOYA 4BYYA 3WW2A 3E3VA 4IEQA 1XDUA 1R1UA 2D1VA 2FE3A 3DPTA 1QPMA 5ERIA 5D8KB 4JBAA 3P9CA 3PVBB 3TO9A 4B8XA 2CSOA 2VBYA 4KWKA 4BXUA 2P6SA 1I27A 2LF7A 5I91A 3IRQA 1DP7P 3CL1A 4HAMA 3SXYA 1FSHA 5AIQA 1K78A 2ACJA 3KEOA 3OV8A 5D5WB 1LDDA 2IJLA 4Q0UA 3ZN1A 5HI0A 2V09A 3IKTA 3JTGA 5BS6A 2DT5A 1F1ZA 5HDNA 4L9TA 5LGTA 2VOPA 4KL1A 1IPJA 3HSFA 1R7JA 3KSCA 2O6GE 3T8TA 2V1XA 5LEJA 2MA3A 4P96A 2IRFG 4HMZA 1AWCA 3QAHA 3IHUA 1R5GA 3I0TA 4ZYHA 3I59A 1FZPB 2FQ3A 4HF2A 3MAJA 2XKPA 3V8JA 1R1VA 3SFZA 2MBFA 4AVCA 5K5OA 3R61A 2DQRA 4YFNF 1LQ1A 5FPXA 1IXCA 2RVCA 1HSJA 3H3ZA 5KVRA 4AQ6A 3AAFA 2ISYA 5F1RA 5KHKA 4RGSA 2RQPA 2QUFA 1U5TA 3JZVA 2QDRA 4HF1A 4HLYA 2B5HA 3MEXA 3NKTA 1NHAA 1SFUA 2XV4S 1RC6A 4Q4ZF 2KIFA 4PDKA 2VC1A 5C6CA 4QLCU 1ZZ9A 4Z2YA 3JSPA 2P7VB 3I64A 5ILUA 2Y48A 2V79A 3MPBA 3ULQB 2H27A 3MZHA 3IKVA 3I4PA 3ISPA 2XVCA 1B9NA 4EQQA 2ZO4A 1ONVA 2Q30A 5DCMB 2FBIA 1OI6A 4R1HA 3LA7A 2CQKA 4DQ2A 1MDMB 1XGNA 3L2HA 4YIFA 4HV6A 1K78B 1V70A 3T0YA 1KQ8A 3DL3A 3IWFA 4LJZF 1KQ0A 2XGXA 4UV8A 4UHTA 5FPZA 4MEYF 5LBQA 3FM3A 3HIFA 1RGSA 4XF3A 3FF5A 3DV8A 4Q5SF 5ICGA 3ES4A 2IXJA 1IN4A 1XGOA 3ZDSA 4A5MA 4KN4X 1OD5A 2QBYA 3S7EA 3E5QA 2ZJ2A 4B29A 4HLTA 3E6CC 5CVUA 2HYFA 5FD5A 3EYYA 5FCCA 3C18A 3F8MA 1U3EM 4P9UA 4DNCA 4R79A 3G7DA 2O8QA 3SCHA 2COMA 3LWCA 4NVPA 2ETHA 5D5VB 3QU6A 5LRSA 3LQRA 2OZUA 5D5UB 2IT0A 4ZYGA 3CJNA 3EBRA 3U2RA 2QLZA 1V4RA 2CFXA 4KN7X 1ZVFA 1HBXG 1S3JA 3BCWA 2PN6A 2K0GA 1SAXA 4O9GA 1KYWA 1PDNC 2YPRA 3KP2A 2K4BA 5CVJA 5FLIA 1JHFA 1GXPA 2ET1A 3UKVA 4Y13A 3ELKA 3ST7A 5L3FA 4WVZA 2Z3YA 4A6DA 2F2EA 3ECHA 2B0LA 1WWXA 3LZZA 1K6OA 3JAMZ 2A07F 1O4TA 2E9QA 3PNAA 1J58A 2QVSB 3FXRA 3SHFA 4L18B 3EHKA 3SMHA 3BJOA 5JAXA 2CW0F 5J3UA 3F6VA 4ON0A 1JUHA 2HTSA 3GYHX 2M5WA 4KDPA 2IXLA 1QGPA 1R5HA 3COAC 3WE3A 1UIJA 2UXXA 3HSRA 2EA2A 3LAGA 3SXWA 1I6XA 2VECA 2EV6A 3EETA 3QU3A 4JK1X 4LLGF 4HV5A 5DUKA 2CO5A 4I09A 2EB7A 4UNOA 3S0MA 1FXZA 1FI2A 2E1NA 2GC0A 4MZUA 1DGRA 3QOPA 4G6DA 3ZQ7A 4JTOA 4NHJA 3L09A 1P4AA 3BOQA 3M8FA 3V4GA 4XETA 1E17A 3O6BB 4M9XA 4BHCA 5HS9A 4ZYDA 2P5LC 2PJPA 3ROUA 3DP7A 3F8FA 4EGYA 2D45A 1FYLA 1FPQA 1G3SA 2PHDA 2PG4A 2PA7A 5CVVA 2WFPA 4XFBA 5A2QZ 5I0UA 1DUXC 2IXKA 4RB1A 2V6CA 4YNIA 2QJVA 3ZN0A 1H9TA 3BPVA 4QX5A 3I5UA 4KNYA 5FGMA 5A2QK 2MNGA 1J1LA 1ZZ6A 1SD6A 3RKXA 4HZFA 4YIIA 1UIKA 3H1MA 1YTYA 2LSOA 3CUOA 1DZRA 1CX4A 4E2SA 3QP5A 4M74A 5I93A 1ZRFA 5ILVA 5I0SA 5D5XB 4BAYA 2K02A 4L5JA 4LD5A 2ZFWA 1LDKB 4WXHA 4RGXA 3H7JA 2R3SA 3TDUC 2VODA 2EK5A 1DPRA 2M1BA 5EZWA 2LF8A 3D5LA 4A5NA 1W7PD 1T98A 2EV5A 1O5LA 2FU4A 2K9ZA 4E70A 5LHHA 2D93A 1Z05A 4IEVA 4U0YA 2Z99A 4JV4A 2OD5A 5E1XA 4LTAA 1FBUA 5HLIA 3HTUA 2KKOA 2XLAA 4KFCA 5AONA 1MKMA 3L2CA 5LHGA 2E7XA 3ML6A 2P17A 2IA1A 4XFHA 3FZVA 3I59B 2EJRA 4ESJA 1QNTA 3F8BA 3LA3A 3FMSA 2EAAA 2Q0OA 1O57A 2VXZA 1LVAA 2HKXA 5ICCA 5LRRA 2NNNA 4PGGA 4CYDA 1L3JA 4EM0B 4HA8A 4MGRA 1Z6TA 1VR3A 2ZNYA 3IL2A 1ODDA 3MFKA 2I45A 3L9FA 1SFXA 1J5YA 3BWGA 3R4KA 4P9GA 4IHSA 1EYBA 1O3TA 1W5TA 3OGJA 2JSCA 2DFIA 3DKWA 4CGZA 2NNYA 5I8SA 2RV8A 4LB6B 2PI0A 3CLPA 2FMYA 4KWJA 1SFEA 5F6FA 2Z5UA 3GF2A 1XMKA 3H3UA 2XLFA 2KXLA 3C1DA 3FMQA 4EGZA 2XLGA 2A3SA 4ORFA 3TKYA 2Y0MA 2EFOA 5HLGA 2VOOA 1REPC 1YW9A 4EWEA 1FBSA 2CG4A 4B09A 1EPZA 1MJ9A 4M9SA 1X3UA 2HR3A 4CDGA 4MUVA 4EM2A 5H20A 3SCFA 3T8RA 1FBQA 4CO8A 4X6RB 1YG2A 3HRSA 2V9VA 5F64A 2FBKA 1O5UA 2VT3A 3H1WA 4RD7A 3J80K 2YX4A 4XBFA 1FP1D 4I01A 5BOXA 4HVOA 2ZXJA 1XMAA 3RTRA 1MJBA 4EV0A 1ZZ7A 4KWLA 1TW2A 1O7LA 5HS7A 1ZZBA 5I8YA 5FQ0A 2PFWA 4LLOA 1XCVA 2M8EA 2JTVA 1P6RA 1OFNA 3V7SA 3H1YA 1IF1A 4D7TA 3VFZA 5E16A 2PQ8A 1XDSA 2OBPA 5ICFA 1FLIA 2A61A 3WTUC 1ZGJA 4Q29A 5BPIA 1L3LA 1F9NA 3J7AO 2PAKA 1IN7A 4RB0A 2P5KA 1U2WA 3FMRA 1K7AA 4OIRF 2XL9A 4OU0A 5HDKA 1RUNA 2BEOA 2D1HA 4MGIE 3L00A 2PFBA 3OOPA 4BHPA 3GFMA 3TQNA 1TQ5A 1CAUB 1Q5OA 2HQRA 5CVRA 4I98B 1D8KA 3I71A 1NXMA 4WK8F 1SMYF 5FB2A 1XSDA 5JSOA 1XGMA 4HBLA 3GFLA 1BI1A 3K0LA 2FXAA 1CAXB 2O61A 4ZU7A 4IVNA 3BY6A 4ZZLA 2XL7A 2XAQA 1JXSA 2BNOA 1QXRA 3EDPA 4KIBA 1UHMA 4G94A 1HQCA 3KLNA 3KZZA 2RN7A 1VP6A 5FD6A 3LWFA 4O3MA 2N7GA 2FBHA 3HYIA 3NSTA 1WLTA 2MH2A 2P7CB 3M70A 2Q1ZB 3GFJA 3F21A 1A04A 4JQFA 2L01A 2LDUA 1FYKA 4UVCA 4KICA 1J3PA 4F7ZA 2B9UA 4AWXB 2FF4A 2W25A 1IN6A 1RZ4A 4P5OA 2EFWA 1RUOA 3H92A 3SQNA 4HVRA 2D5HA 2UZKA 4O6JA 4LMYA 2PQQA 1G6NA 2L3DA 1CF7A 2XUBA 1UHWA 1HKTA 4ZZDA 2KJCA 4TLFA 5KHJA 1Z9CA 1B1BA 2HDCA 2IP2A 2FA5A 1ZYRF 3C3WA 3VB2A 2KIMA 4EJVA 5LHIA 1WA4A 2OQRA 5J8CA 2DQLA 3K1MA 5HLHA 4A2UA 3H9AA 4WWCA 2IPQX 5KBFA 4IEWA 3RYKA 4HW0A 5JR7B 1PUEE 3OF1A 1EV7A 1T6SA 2Z69A 1R22A 3BROA 4O9EA 1I1GA 1SMTA 3GZ6A 3VODA 4A6EA 4FX4A 5AVPA 3USSA 1Z6RA 3DEUA 1G3YA 1YWKA 1H1MA 1T0FA 3O14A 1JHHA 1P4WA 1S7AA 3WTYC 5BXXA 1UCRA 3RIRA 3ETQA 1HKSA 2CGPA 2PMUA 1FWZA 2ELHA 3KZYA 5HVQC 4Q0PA 2BGCA 1NE6A 3NJZA 3RDIA 3ACLA 2DO7A 1ZRCA 4E2GA 3FWEA 2JRTA 1G4DA 1LNWA 2Y75A 5JFRA 4ENKA 4BNCA 1ZX5A 1T2KA 4EJUA 1YLFA 3BPXA 5CJ9A 5I8TA 2ZMEA 5BPDA 2P8TA 3E5XA 2R7FA 4PZJA 1Q3EA 2KIUA 4F8AA 4JVAA 1QXJA 3H7YA 2HWVA 2HJIA 1HXDA 4BH9A 1FC3A 2VONA 4XRFA 4RB2C 4I0BA 2IW5A 1R23A 1LRHA 2W24A 1R1TA 3WTWC 4XFIA 2YSRA 3HHHA 3R0AA 2W57A 3TNPB 4U88A 2GC2A 3WTSC 3WG9A 1H0MA 3FM5A 3MCZA 1YLLA 3LA2A 3PLQA 2BV6A 4MQVA 3NRVA 4IEXA 2QZ8A 2DPUA 2H6CA 2QQ9A 3FXQA 4Q0QA 4HYEA 1U5TB 3FX3A 2STTA 1BIAA 1BBYA 3MQ0A 4HSJA 4HLXA 2BYVE 2FEZA 3JSOA 1NZCA 3WW4A 3F23A 4KYWA 2XKOA 1PP8F 1QY4A 2M30A 4UBHA 4FX0A 4GGGA 5H6QA 5E18F 4FHTA 2UY8A 4Q0VA 5K1YA 1WSUA 4P55A 5JSPA 1EH6A 3WTXC 5DD4A 1S7OA 1TW3A 4HF0A 4IEOA 1NYWA 2VPVA 1OYYA 3O2PE 3WW3A 1XCBA 1PM7A 5BQTA 3TNQA 3I58A 4G8XA 4J1XA 4UBGA 5CU1A 2G7HA 2PBIA 5LLQA 4YFXF 1FX7A 5L3CA 4OIPF 4K8FA 2O03A 3RJPA 3SHRA 4OLLA 5TJJA 2GC3A 4A0YA 2QCSB 5JHUA 2A5YB 1CAWA 2B8MA 3HT1A 3PQJA 3FFQA 4AXOA 2DI3A 4ONUA 5E8IA 1IZ1A 4S04A 4MNUA 1KU3A 4RGRA 2JT1A 3WODF 4UV9A 4G7ZF 2FRHA 3F6OA 4QXKA 3KCCA 3QPTA 2GAUA 1LDJA 4X6QB 1XGSA 3R0JA 2ESHA 4L0YB 2L4MA 4WXCA 1XRUA 3CUQC 3TGNA 3CDHA 5KK1A 4AVPA 1O3SA 1LB2A 5H6RA 3CUQB 3VOEA 4L9NA 1FP2A 3KP4A 4WZCA 4CICA 3WU0A 3EUHA 1Y9QA 2HS5A 2GA1A 2GXGA 3WGIA 5I0TA 3TO7A 2PLYA 4MV2A 3IDBB 2XIGA 1U78A 3E6BA 3GZ5A 5FO5A 1UD1A 4CZZA 1HW5A 2OPKA 3D82A 3IC7A 3LOIA 4I2OA 4HOBA 4HDVA 4PIXA 3SZPA 3ZMVA 3M3IA 2D2WA 4N9IA 3EO6A 4WXDA 2GC1A 5CADA 3KGLA 2RC4A 4KUMA 3KEQA 1WRJA 4EWDA 4M73A 3HOSA 1P2FA 1HW2A 3F72A 4OOIA 3U10A 4GULA 3ZMUA 5LEKA 2D40A 2L02A 5BY5A 4KIGA 4UVBA 4XSXF 3HRTA 4I02A 3ABTA 3M8EA 4Z07A 3Q9VA 4MTEA 4HN1A 3FHZA 2DAOA 5DUIA 3L7WA 3MWMA 2K7LA 4IHTA 2PTMA 4CHUA 2ESNA 4XFFA 4YARA 3GW2A 3E6MA 3VEPA 4IERA 5J8FA 4KT5C 4AD9A 3DPLC 3R60A 4L5IA 4PJYA 2GZWA 4Y15A 3BJAA 3G3ZA 3WTZA 4YFKF 1JGSA 3E5UA 2A6HF 3EJKA 4LGWA 3V7CA 4K2EA 1DZTA 4EJWA 4OMYA 4I7HA 2OA2A 5J48A 1W7PB 2VE8A 1F4KA 5HOOA 2PMHA 5ILSA 2UY9A 5K5QA 4S05A 1NE4A 4PIZA 1H9GA 4MX3A 4G9YA 5K8SA 4LUKA 3U0ZA 3WTVC 1ZH5A 3KP3A 4IPAA 1J75A 3HRMA 3ELNA 4RB3C 2EFNA 1GQHA 1W5SA 3RPQA 1BM9A 1J7KA 1TBXA 4BIFA 2Z9OA 5IT9K 2DTRA 1D5VA 1MDMA 3MDPA 4EWAA 4HX4A 1I5ZA 5E20A 1J59A 1KU2A 4ENMA 3FE5A 5LGUA 5LGNA 5E1RA 3WU1B 2QBYB 1LEBA 4RAYA 4L9JA 2F5FA 3GO5A 1S8NA 2H6BA 3HRUA 3ZPLA 1YIOA 2GH2A 3Q5FA 4KIFA 2YR2A 1EH8A 1USSA 1QZYA 2X4HA 5K5RA 5JI6A 5FFZA 2VQAA 2EFQA 5JSRA 2BBYA 2IXHA 5DCMA 5KHIA 4WCGA 2OZ6A 4FT8A 1BI0A 1SFNA 1ZARA 4LLLA 4Q47A 4MGZE 3HUGA 1U6GA 3WE2A 4QM8A 1TNSA 1GHCA 4UUVA 1RNLA 3I53A 4EVIA 1OKRA 4XF9A 3HSEA 1ZGAA 1F5TA 1C0WA 3ZMZA 2CWEA 2ET7A 4LK0F 3KGZA 2DBBA 3DFGA 3QP6A 4LLNA 2EA7A 1SEFA 3M7GA 2VC0A 1KU7A 1PP7U 4IEZA 3RPUA 3K1PA 3RKYA 2HGCA 3ZP5A 4OMZA 4BHBA 2ISZA 3IIAA 4AQ2A 4L11A 1J0RA 5DV5A 1ZREA 1B9MA 3HOTA 3R6SA 5DEQA 1J3QA 2QVOA 2GU9A 3CJXA 2MH9A 4YRDA 5JVTA 5FDBA 1ZLJA 1IAWA 5FLXK 2BNNA 1UB9A 3MZYA 4NB5A 4O5VA 3F22A 3RNSA 3CTAA 2NRAC 2O8XA 1BC8C 4A0ZA 1YFXA 4I0AA 4IEYA 5CYVA 1U5TC 1BC7C 4IETA 1XB4A 1SD4A 5DCFA 3NQOA 5D4RA 3JAMK 1EP0A 3P7NA 3OD0A 1YFWA 3CO7C 3BJ6A 4GYIA 2WWYA 4G6QA 3IBMA 3V8KA 2G7UA 3K9TA 4A0XA 2HZTA 4BQAA 1B4AA 3BPZA 1IXRC 3HQXA 2VBZA 3BB6A 1YO5C 3CEWA 4LB5A 4G7OF 2KJBA 3DQVC 1P4XA 3K69A 3ECOA 1CF7B 3TOAA 4IF4A 4ZYEA 1RTVA 2PAEA 1BN5A 1MJAA 1KGSA 4WX9A 2XROA 3K2ZA 3ZMDA 1YFUA 2IXCA 3TDZC 5BUVA 1LEAA 5C8WA 5IT9Z 3W6KB 2QNKA 1Z91A 2GIVA 1OR7A 2IA0A 5L3GA 4H7LA 2X0LA 1V3FA 2K86A 4WF2A 6PAXA 1MZBA 2F5DA 2NS0A 4EJOA 3KP7A 3T5XA 2YU3A 3GBFA 1J9IA 3H50A 2ZBKA 2HYGD 2OQGA 2H09A 1UCXA 2DK5A 3CF6E 4LG0B 4HX7A 1WQ2A 2E1CA 4META 2JZYA 4QGLA 1SD7A 3N97A 1OYIA 2A69F 1YFYA 2QYOA 4AIJA 4N0BA 1UPIA 5L3EA 2FQPA 2IA2A 3ERED 4L0ZB 2UWMA 2A68F 4GCVA 4Y17A 1J3RA 2PYTA 4HQMA 3EQEA 1TQIA 1BI3A 1T38A 2DK8A 2P4WA 3GEZA 4P9FA 1CAVB 1IRFA 3ES1A 2ZNZA 1YS7A 2V1DA 2ETEA 2VE9A 2GWRA 3RYPA 1CAUA 5L3BA 4XFAA 4Q48A 3LFKA 2MC3A 1XSXA 5I0RA 4R52A 3WGGA 2CV6A 3UKNA 3E6DA 3VHRA 5CLSA 3BP8A 3KMHA 1YFHA 1I1SA 2ADUA 2RKHA 4IRIA 4U7DA 4ETSA 2UYBA 1IRGA 5KHHA 5D1IA 5BV6A 4IEUA 3NL1A 3V7RA 4MQ9F 3OTFA 4EJTA 2Q0AA 1H1IA 1LR5A 2ATFA 2M45A 1E2XA 5FLXZ 1S6LA 1EH7A 5JCTA 2O0YA 2UXNA 2W84A 4U7BA 5ICEA 2ZKZA 4J1WA 2H94A 3I54A 1LJ9A 3G73A 2Q2EA 4HSLA 1XN7A 2FSWA 2O3FA 2RNJA 2WTEA 1CAVA 4GYGA 4KMUX 3KP5A 1G3TA 1Y3TA 4Z82A 1IUYA 4OIOF 5HS8A 4RS8A 1WI9A 5DD8A 3K1NA 3FHIB 2VBXA 2Q4SA 3JW4A 1U12A 1X8MA 1YYVA 2DLLA 4ENJA 2FNAA 1ZZCA 4Q0SA 3P9KA 3U1DA 5BPXA 2FMLA 1W4MA 4KA4A 4UVAA 1KQ9A 2J5OA 4QGNA 4IXAA 3QPHA 4XEZA 2IVMA 2V1UA 2XAFA 3GVAA 1HSTA 2J5PA 3S7IA 4GO1A 2W85A 1TQMA 2ZKLA 3RZZA 1ULYA 3PQKA 1B6AA 3P9IA 3EYIA 2WV0A 1O3QA 1Z1DA 1KA8A 3HT2A 1CAWB 4AIKA 1MGTA 5FFXA 1D8JA 4HQEA 2GXBA 3ABUA 2G9WA 4CXFA 1QQIA 3CO6C 3RI4A 3B73A 5AIPA 2XASA 2HTJA 5EFUA 1Q1HA 1YQAA 1HKQA 2JPBA 1ZNPA 1ON1A 5E1WA 3KFWX 1QZZA 1SQ4A 5FQ0B 1WKMA 3LQQA 2XHKA 4NQWA 2Y0OA 1P92A 2PEXA 1BOAA 2XAJA 3SZTA 3GWZA 2IXIA 4QGMA 2P6TA 2Z2SB 1HW1A 3NEUA 1ZG3A 4FAGA 1ZN2A 1O7FA 3LSTA 3V8LA 5HDGA 3BZ6A 1Z7UA 4LK1F 2OZJA 4XFCA 4RAZA 3F3XA 1J2XA 1R58A 3EQLF 4N9HA 2OYZA 2MPFA 1FY7A 2VN2A 1K79A 4M6XA 1MD0A 3HHGA 2M87A 4A12A 2FOKA 1EY2A 1WGPA 3LAJA 2BE5F 2O1QA 4QMAA 4FAHA 3W6JB 2K27A 5J6XA 3OCPA 5EEGA 4KMFA 2C6YA 4L2NA 4QWQA 5J7MA 2F5EA 3NW4A 1LKNA 4LUMA 1FNNA 4ENNA 2F4PA 5D6EA 4LFUA 1X7NA 2HFHA 3KETA 3REOA 1ZZ8A 3GUDA 1ZAOA 1TTYA 1RI7A 4ZH4F 4EMSA 2TDXA 1DGWA 3GXOA 3BDDA 2K4JA 2OA4A 3MYXA 4ASNA 4UXNA 2BNMA 3ZMSA 5D4SA 5E17F 4M6YA 1OYWA 1T39A 5DDGA 3M9AA 4IRHA 4PGHA 4G7HF 4R8HA 1TQPA 4YSFA 3IWZA 3O3KA 4XSZF 2QM3A 1TNTA 4RGUA 3D0JA 5EEHA 2PHLA 4UXAA 3U9GA 4PCQA 5T3NA 4XLNF 3DXJF 1YW8A 3C7JA 4HVQA 3U11A 2MHFA 1QWRA 1O3RA 1STZA 2DPDA 3J80Z 3BALA 1VTNC 2RGVA 5D6FA 2A6EF 3B02A 2YX7A 1BI2A 2Z33A 4OFGA 2EFPA 1SD5A 1X8EA 4MH0E 1G3WA 1CGPA 5IT3A 2QQAA 2RDPA 3N4MA 4EROA 2XAHA 2GQQA 2DU9A 5FLJA 1RIOH 4D7SA 1GXQA 4IESA 3IRRA 4AVAA 2ZMEB 3C3VA 2L54A 3GYDA 1IXSB 4PIYA 1KYZA 3RKWA 4GXOA 4LA2A 3PFIA 1IN5A 4M72A 5FLHA 1DPUA 2FNPA 2MD5A 2VBWA 4XF4A 4L9VA 1W7PA 1ZG1A 2MLGA 4HDUA 3DN7A 1USTA 4MGYE 3CO2A 4HX8A 2KRFA 3JTHA 3FZ3A 3TO6A 1BIBA 4IJAA 4JTNA 4XFGA 5D8LB
chains in the Genus database with same CATH superfamily
3QACA 1AJOA 5KAFC 4JHZA 1XB9A 1MVEA 3WV6A 3ZYPA 1HLVA 3NWSA 4OI2A 1HF0A 1GQGA 2QWWA 4XKBA 3W5MA 1RINA 3OIQA 2JK3A 1XE8A 2L4AA 5JR2A 4A7ZA 5EGOA 1H4HA 2P3JA 4EE2A 4CCJA 2NVXJ 1HB4A 1K5MA 3RYRA 1BR1A 3IPVB 1X33A 5LBFA 3VBRA 2FDFA 1E5SA 2WNUB 3FJSA 1CAXA 2VJJA 1NH3A 3RSJA 5L9VA 2MLKA 1H88C 4HN0A 3AKZA 3AZXA 1RRJA 4LBNA 1ZHFA 4ESFA 4FBFA 1W0UA 1V9U1 1DDNA 2CUEA 1FTTA 5DUUA 2PQSA 1W2OA 1PO21 3NVCA 1W36C 1SBDA 4XAEA 2XSDC 2P6HA 2NS7A 2WO1A 2UWBA 1G9FA 4W6XA 3OYMA 1TP4A 3CDIA 5FP3A 2BY0A 3GX4X 2VMGA 1DQ1A 2X6WA 5H9SA 1VF9A 2JUGA 3AG1H 4XIKA 5JZGC 3DPUA 3SCGA 3CCMI 2DYCA 4XUPA 4YG2F 1SAUA 5FZOA 5D8AC 5TRDA 3J81K 4QAWA 3H0GJ 5FZAA 4Z6YA 3LFUA 1U8RA 3WUCA 5JR3A 3QRFF 5DQ0A 5ABJC 1IW7F 2NYXA 2M4GA 1X82A 4AHWA 4E2QA 1Z7S2 1L0OC 3DU6A 3D0SA 1PGW1 3BIEA 3WNXA 2ME6A 5HNFA 3CQOA 4XLPF 3TEYA 3UKTA 3F8CA 1K12A 5CA6A 2QQVA 2MABA 2E33A 3BU7A 4KBBA 3HTSB 4CEYC 4QM9A 3WF0A 2LKPA 2R7XA 4RFT0 5IYCJ 4W97A 4MHGA 5J1RA 1ON2A 2E7WA 4FP3A 1XC6A 1UW8A 4XF0A 4Y1UA 3ZFEB 2R7DA 2ZAAA 2J1SA 1RHI1 1W36D 5LD2C 1CVNA 1FT9A 4IEPA 3F8NA 2WB1A 2XJUA 5F37A 3TBIA 5FO9B 3Q9SA 3WGHA 4FSJA 4BL0B 3GFIA 1H9WA 1QO0D 1WJ5A 4FTHA 1NUKA 3VPRA 1VRH3 1HX6A 2FE3A 2J22A 5BYNA 3O0XA 2AH2A 3RPUD 3RVHA 1HQNA 2XJVA 2JDAA 5KWRA 3TO9A 2AQFA 4Q1RA 5LK5A 1SPPB 3SITA 4SLIA 1F36A 1VBD3 4B8XA 5LBBA 2X85A 2W47A 3UJOA 2E2JJ 1I27A 2E7QA 3IRQA 1DP7P 3CL1A 4CDUC 2HWC1 1EKEA 1W6PB 2D97A 1YI2I 4AFDA 5D5WB 1QU0A 4A45A 2IJLA 4XIDA 5C8CC 3FUQA 3S1MJ 3ZN1A 3UYJA 1HRI3 1MMAA 4ASKA 4ZDLA 3JTGA 4M3FA 1PIV2 3KS7A 3NNJA 2DT5A 2LBFB 1QJX1 3TB0A 1T08B 5E79C 1GOFA 3HSFA 3KD4A 3KSCA 2O6GE 3T8TA 3FLTA 2V1XA 1TC3C 4HMZA 2OV7A 3QAHA 2XUMA 2JECA 5L7OA 2Y26A 2X6XA 2C1FA 2FQ3A 1Q8VA 3QYEA 3G1MA 1QKQA 3FXJA 1UY0A 5H9PA 2EIGA 4XIOA 3TN92 4LBQD 2DQRA 1LQ1A 5KVRA 4XJUA 2M7BA 1RMU3 1D0XA 2A6TA 4AVSA 1U5TA 5L19A 1PZ9A 4IV1B 5JZGB 2Z42A 2QKMB 4UYBA 2VCAA 3MEXA 2EXJA 3ZXGA 2XV4S 2D7FA 4Y52J 3B94A 2I5UA 4QLCU 5EYYA 3ZQFA 3HQUA 4Z2YA 4BXFA 2P7VB 3AMQA 4H3WA 2DA2A 3THPA 2O8OA 3AM2A 5BNPA 3CCEI 2H27A 2R7TA 2PMWB 5FAXA 1X4PA 1B9NA 3DCQA 4EQQA 4ZTJA 1ONVA 1SBFA 4LORA 4OYUA 3BVCA 3ZSJA 1OA2A 1OI6A 4NHMA 3BKZA 4E7LA 3UNGC 2CQKA 2UWCA 1RVF1 4YIFA 2DA5A 4HV6A 4IL6C 3AMNA 1KQ8A 3DL3A 5FP8A 5FMOS 2M7AA 3IWFA 4LJZF 4PSWA 3CHXA 5FPZA 1AF9A 2RAEA 4Q5SF 3WDVA 2VL8A 1LODA 1XGOA 1GU3A 5LA2A 1QJY1 2YC0A 4RA0A 3VL8A 2QBYA 3S7EA 4CDWB 4IE6A 2R063 3B9IA 1A34A 2HYFA 5T54A 4OHZA 3EYYA 3I2DA 3WDUA 3C18A 3OYIA 3TEZA 4R79A 2CQQA 5JPNB 2ETHA 2ME0A 5C8CA 5LRSA 1UHSA 3V42A 4XLCA 5CKQA 1VPHA 5D5UB 2Q1FA 4DJAA 2CFXA 4KN7X 5FROA 1ZVFA 1HBXG 5CFCB 3BCWA 4YLZA 2JRMA 3ZFEA 4XRSA 1I3AA 3AYDA 4F83A 2PN5A 2QQJA 1JHFA 3VB9A 3ZIXA 5JI9A 2B7EA 3DTKA 4A6DA 3OSGA 3ECHA 1WWXA 4AWDA 5B1AH 4E7ZA 3WP4A 5T5JA 5G04L 3SH5A 2TBVA 1ACCA 1O4TA 4CRQA 4OMDA 3OYKA 3OY8B 4UT5A 2AYHA 1UZVA 2HXIA 3EHKA 1W2UA 3HG9A 4MXWA 2MC4A 5JOYA 3WCSA 4QQ2A 5J3UA 5D8AA 2GALA 1HA8A 2HTSA 1PO23 2M5WA 1GP5A 3DYOA 5GZCA 1GZWB 1W8TA 4LOTA 1AR61 3HSRA 4OHYA 3BR6A 2ARBA 4YPJA 4A3BJ 3WNPA 5EGOB 3EETA 3HOWJ 4LO5B 5CEHA 2EB7A 4Y1ZA 2Y9YA 5T5PA 2GC0A 4MZUA 3QOPA 4G6DA 3ZQ7A 1CPNA 3L09A 3BOQA 3M8FA 1UU6A 3CCJI 3MI8A 4XETA 3JRIA 5FBZA 1B8IB 1OURA 1OQYA 4F3JA 4OQ9A 3F8FA 3BR2A 4EGYA 1VAKA 2PA7A 1MMSA 3PNYA 1X50A 4XFBA 3CP2A 4R4ZA 4RB1A 2V6CA 4YNIA 3ZN0A 3OSFA 4KNYA 5F9TA 5SV8A 4XKVA 4XQWA 4KJZA 5A2QK 3OIPA 2W91A 4HZFA 1UIKA 1YTYA 3FHNA 2RS52 3N9PA 3QP5A 5L9BA 3OYWB 4EN0A 3S3OA 1WCKA 2XBO2 4C0HA 3A02A 2NVUB 4RGXA 4L5JA 4LD5A 3JD73 4LBLA 3IMMA 1R1A1 1LOFC 3FHAA 1BJZA 4E9KA 1RUJ1 3TDUC 2EK5A 2M1BA 4FPCA 3HOUJ 4X8NA 5EZWA 4A5NA 1W0OA 1W7PD 1UOFA 4V1PA 1O5LA 2FU4A 4E70A 5LHHA 2KISA 2W0XA 1LKXA 3D5SC 2Y60A 2R1DA 4IEVA 1I50J 4U0YA 2VZQA 2OD5A 2E63A 4YW3A 4FOVA 2XLAA 3P5BA 1V5EA 3L2CA 2Q8CA 4XFHA 4MIMA 3V64A 1UZZA 5CKMA 5FYVA 3F8BA 3P5JA 2Q0OA 1O57A 1NCQA 2ERFA 4M3CB 1OPOA 5LRRA 4FQ4A 2NNNA 5HCBA 4CYDA 4BQXA 3VWBA 2YFZA 1LHWA 2QQLA 3IL2A 1Z3YA 1T56A 1K3IA 5B4NA 2G0EA 2WDBA 4BQQA 3BWGA 4XUQA 3OYHA 1PVC2 2HWF1 2NNYA 1W1WE 4DEVA 2F5VA 4GB32 3KVAA 2C9KA 5A70A 1G9DA 1OVSA 3FMQA 1XPXA 1S2BA 4EGZA 3AMPA 2A3SA 4ORFA 5EF6A 4R4XA 1YW9A 2E1OA 2NVQJ 3J7ZI 1FBSA 3WF2A 5JOXA 5HV0A 1FV2A 4CDXC 1X3UA 1DP0A 1PIV1 4LE4A 4AI9A 1R091 1JYXA 1YI7A 2ZGMA 3SCFA 2GOMA 1HDKA 4CO8A 1QOTA 1UYZA 2JENA 3JRFA 3VHPA 4E4HA 2YX4A 1PGL2 4Q5OA 4XK4A 4RR3B 5BOXA 1VQMI 4LXLA 1XMAA 3MIBA 1RUI1 3LSIA 3RTRA 4AYUA 4RM3A 2VR4A 1ZZ7A 2I74A 1O7LA 5FQ0A 4LLOA 3V65A 1C1FA 1P6RA 3DKXA 3V7SA 4K40A 2DOFA 1BMV1 3VFZA 1ULOA 1WCUA 1AKHB 2WAOA 1GLHA 5IATA 1SANA 2A61A 1H30A 3PNTA 2RS32 2J1RA 1B72A 1FMWA 1CZTA 1U2WA 1IPSA 4PLNA 3K4CA 4MGIE 4WVMA 4RQPC 2PFBA 2HOAA 1FPN2 4BHPA 5FY8A 2WNOA 4D94A 4KH9A 5IUQA 4Q4Y2 3DXTA 3PMEA 1WMFA 3U37A 4MGSA 1SMYF 1XSDA 4HPKA 1WCQA 4LKDA 4HBLA 3PM1A 2BUKA 1RVF2 1CAXB 5CG9A 4WM7A 4CDXA 1QQP1 5JPMB 1QXPA 3ZN4A 4IVNA 3USUA 2LUWA 2L5QA 1TWGJ 4Y4YA 1JXSA 2JUCA 4BQNA 3ZXFA 2XONA 4KIBA 2WR9A 3KLNA 4FQGA 1WJCA 2N7GA 1MS3A 2FBHA 3HYIA 3E1F1 1MPXA 1F35A 5EPAA 2MH2A 1HDPA 2BVLA 2P7CB 4B4CA 1VQ4I 3CC4I 1DQ6A 4JQFA 1NKGA 1W8WA 5DDJ2 5M5WJ 4CUBA 1RUJ2 4X0GA 1UU4A 1J3PA 4NJ4A 2VM9A 3A01A 4F7ZA 4Y22B 2IFRA 4AWXB 2BW3A 3MVPA 5EJ3A 5C33A 3FISA 4FPGA 4W6YA 5JLXA 3ZSEA 1WFXA 2D5HA 3KQRA 5A1FA 1R64A 4IL7A 5A3UA 1G6NA 2L3DA 4QQLA 4AEMA 1CF7A 1HKTA 4XDQA 1U8BA 1YOVB 1IQAA 2RS12 3GJBA 1Z9CA 1GP4A 4DUXA 5LY2A 4FPFA 1ETKA 1ZYRF 1WW5A 1REEA 3ZXSA 3BCAA 1Z78A 2WFF2 3ZXAC 2ZX3A 4A2UA 4WWCA 1GT0C 5KBFA 2VVFA 4P5YA 4XQ4A 2RQQA 1RUE3 3OF1A 1T6SA 5FXZA 3BROA 2VVEA 1SMTA 1XNDA 3PSFA 2TRTA 2OF7A 2W92A 3SISA 1S2KA 1G3YA 1NY72 3H9GA 1T0FA 3O14A 1W3VA 3RIRA 1P9QC 3ETQA 5E6HA 1OLTA 3RQIA 2WN3A 3SC7X 2OUJA 3KZYA 4Q0PA 4JP0A 3NJZA 3RDIA 3ACLA 4Q27A 3VBUA 5A3TA 2ELJA 2Y75A 5JFRA 2HLEA 4OI1A 5F7UA 2CW7A 1T2KA 1RJ7A 3VYSB 5I8TA 1FV3A 2XF6A 2YC4A 3GZTB 5LATA 1VBA2 2KIUA 3HBZA 5DUWA 1G9CA 1QXJA 3KT1A 1OQEA 3H7YA 1W05A 2HWVA 1HXDA 1RUG2 3N9LA 2WQZC 3MFAA 5CFDA 1HJFA 5JOWA 2YSRA 4B8EA 1ULFA 4RSUA 2Y0IA 5HLTA 1IOAA 3VDAA 4DB5A 3EB7A 3WTSC 2DTWA 4XVHA 3WT3A 3WG9A 2GNMA 2Y33A 1R1A2 3ETPA 1YLLA 4FP2A 5BNNA 1E0EA 4NAMA 2QQ9A 3W58A 1NX9A 4HYEA 3FX3A 3T0BA 2ZXQA 3BN6A 3GBGA 5F3EA 5FUNA 5JHFA 3HL2A 2W68A 5F6LB 5JUVA 2BYVE 3IIIA 1FNZA 3RMYA 3F23A 5FYIA 2WZ8A 1QY4A 3I4MJ 2VW1A 2M30A 4IQ4A 3OYJA 4A44A 3DECA 4GGGA 2E35A 2IS2A 3QH7A 2UY8A 4XHBA 4P55A 5JSPA 3IDAA 5DD4A 2EICA 1S7OA 1BZWA 2PXJA 3AFKA 1X1CA 4KG8A 4AI8A 4IEOA 1WVRA 2R7UA 5C4JJ 1PM7A 2HWC3 5FP9A 4V2FA 4UBGA 2G7HA 4YFXF 2W3JA 3RJPA 1RR8C 4OLLA 5TJJA 1SCRA 4D6RA 2XDVA 2B8MA 1UMQA 3PQJA 4L8QA 2DI3A 2HEWF 4XICA 3MKWB 2QKLB 1IZ1A 1KU3A 4UV9A 3BTAA 1OHFA 1W6QA 1X9TA 4O65A 5FKMA 3B69A 4X6QB 1XGSA 1C8M2 4YVSA 3BOWA 2Q1MA 2R0FA 2WYFA 4D7MA 5KHDA 5HCHA 3CUQB 4QPOA 1OUSA 1FMVA 3KP4A 4OAYA 2A6WA 2WT2A 5APAA 3WU0A 1GDTA 1Y9QA 2GA1A 3J7MA 2YZ4A 1PK6A 2MFZA 2VBBA 4LPLA 4MV2A 4YZ4A 2XIGA 1TME2 1U78A 4YW2A 3BG5A 4J19A 3I2IA 1BEV1 4DS0A 1JZ8A 4BKXA 1WMXA 1WUVA 4NWVA 5FY5A 1HW5A 3D82A 4JGYA 4Y33A 1DYPA 3M3IA 4WXDA 2MG4A 2GC1A 3KGLA 4EWDA 3HOSA 4KI5M 3WVJA 1R093 1NK2P 3FHQA 1H8TC 4AGGA 1D1BA 4CUCA 5BY5A 4I02A 3NJYA 2OIIA 4A3ZA 4B1MA 2VUCA 2DAOA 3L7WA 4IHTA 1IGOA 2CY6A 3ECQA 4DBRA 2PTMA 1MW7A 3LOBA 4CHUA 1UOJA 2ESNA 5F32A 4IERA 5FZ3A 5T50A 1IG0A 3R60A 4AQTA 2GZWA 4Y15A 5FJ8J 4MG2A 3E5UA 4LGWA 1I3QJ 1DZTA 3PU3A 1N47A 4KG0A 1S7EA 1W7PB 3JQXA 3OD4A 2PMHA 2X9DA 2XWBB 4PIZA 5K5QA 3Q0VA 4C2TA 1PO13 1VAMA 4PCRA 2WY8Q 4G9YA 3K46A 4Q1PA 1PHMA 1IDYA 2W1UA 4GWMA 4FFFA 1ZH5A 4RAGA 4S2DA 3KP3A 3ZKUA 2JMWA 3HRMA 1GQHA 3NNLA 5JDBA 4A7KA 2W39A 2N8GA 4ZZ8A 4WM7C 2AR6A 1IC8A 3D5OA 2QE3A 5LGUA 4BJ5C 3QODA 3TWIA 4AGVA 2F5FA 3HRUA 4Z1VA 3L9JT 1A8DA 2C26A 4UW6A 3H5NA 5C3QA 1OQ1A 3NWKA 3H3VK 3Q5FA 2GH2A 1WD4A 1EH8A 1USSA 1K5MC 1XJAA 3U4SA 2VI6A 4XYXA 4HSTA 5JSRA 2BBYA 3H42B 2IXHA 4Q4V2 2EBIA 5DCMA 1QOOA 4Q8KA 5LW9A 1YEWA 1ZRIA 4JC1A 1CJDA 4YZ3A 1ZARA 4LLLA 3I2GA 4MGZE 3HUGA 2JICA 5FZEA 4ZDPA 3BQZA 4BQWA 3FLPA 4UUVA 1RNLA 4XF9A 1C0WA 4JAAA 1IS4A 3A0KA 4N53A 1BR2A 1YXWA 3ZO0B 5K7ZA 1HQWA 2EA7A 4NBQA 1W99A 1SEFA 1JYIA 4YVWC 3M7GA 1O8SA 1KU7A 4FOYA 2LH9A 4AVTA 3Q8AA 1B9MA 3HOTA 2QZ2A 1AU7A 4XLHA 1VQ6I 2VBPA 4UW4A 2MH9A 4A6SA 4YRDA 2RMU2 4O5VA 4NC8A 4IV1A 4NPLA 3PTYA 1F4HA 1D1AA 3I8TA 2NRAC 1YFXA 4FTEA 2V5DA 4DRVA 3VBFB 1HB1A 1BC7C 4IETA 1XB4A 3HOZJ 1SD4A 5JMCA 2R061 3S30A 3NQOA 1ALYA 5D4RA 1AYM1 5GLUA 2CRGA 3MW4A 1EAH2 3P7NA 1R082 3SDBA 1YFWA 4K3UA 3JBG3 2WWYA 4G6QA 5E3MA 2D6NA 2RDRA 4A0XA 2HZTA 4BQAA 3DXUA 3T1LA 2VBZA 2ZZQA 2CDPA 5FRNA 3BB6A 4ATFA 4XL9A 1AVBA 2CV0A 3ECOA 2UWAA 4IF4A 1RTVA 1MSFC 2P1BA 2FOWA 3W21A 3WNOA 4R9AA 4WX9A 1HRV2 1ORKA 3K2ZA 1YFUA 4N53B 5IK4A 3P3PA 1LEAA 1CJPA 3W6KB 1WBLA 1V6KA 2IXSA 2VUJA 1YJ9I 2K86A 4XM3A 2VQ0A 3LEGA 2E53A 4IQPA 2PLV2 3T5XA 1OQDA 1BVP1 1J9IA 3H50A 2GXAA 1OFCX 1H8VA 3H3LA 5HXVA 4XMYA 2ZBKA 1K83J 5ANNA 1F9KA 3B3QE 2DK5A 4HX7A 1WQ2A 1IRZA 5D8AB 1SPPA 1SD7A 2DMQA 3N97A 2LM3A 2OTLI 3WHBA 4AIJA 1GYKA 1UPIA 4HKWA 4RM2A 2WAQA 1LGCA 3AKQA 5L3EA 1AR63 3GZNB 4L0ZB 3RQ0A 4YRVA 3BODA 4XPVA 4FXKB 3GEZA 4P9FA 2EAKA 1NOVA 3R0RA 3BQYA 5A3MA 4FFHA 2YHJA 4AI3A 2ZNZA 2VE9A 3VLBB 1MACA 4XFAA 3LFKA 1XSXA 4M00A 1TNFA 3QOEA 1LCLA 2CV6A 3OMYA 3E6DA 3IP4B 2VOVA 4UUSA 4LBJA 4LKEA 2A3WA 1RUH1 3LSMA 4IRIA 3ZPYA 4QPGC 2UYBA 3O1OA 1IRGA 2ZGPA 3T4HB 3ZSLA 3OTFA 2Q8DA 1LR5A 2ATFA 1F5FA 1EH7A 3WQ0A 5LZ6A 2K9LA 2H94A 1LJ9A 3G73A 4AFCA 1WBFA 5CBLA 3BG7A 4K7JA 4GA9A 2RNJA 4QKFA 2HWD2 1BEV3 1GR3A 2WTEA 3H35A 3LEIA 1IUYA 4J00A 1Y7BA 1UU5A 1WI9A 1IQDC 1BQPA 3K1NA 2C4XA 2DUQA 3AL5A 2VBXA 1OUXA 1UPSA 3F95A 3TEXA 4AFAA 2DJNA 2Q4SA 1X8MA 3CJRB 2PHXA 4Q0SA 3P9KA 1COV1 2JDYA 2JKXA 1PO11 2HWD3 3OUIA 4EEFG 4LOCA 3O1VA 2J5OA 1AX0A 1HXS3 3ZSKA 3CKHA 1WH5A 2FDKA 1G9AA 5GALA 3CP8A 2J5PA 3U4XA 4CU6A 4GO1A 2W85A 1TQMA 1RUF3 1WMDA 2WV0A 1MH4A 5J40A 1AR91 2OQ7A 1Z1DA 3HT2A 1MGTA 1YX5A 2PLV3 4W1UA 2OT7A 3POFA 1D8JA 4HQEA 3LCPA 4C9YA 1O4ZA 3ABUA 3CO6C 5IP7J 1GNYA 1TEIA 3B73A 2M0CA 2X48A 3LDBA 3TYJA 2YBPA 1Q1HA 1YQAA 2BGPA 5TGTA 2JPBA 4CP9A 1MBJA 4DPNA 1RC9A 4D1QA 3T2OA 1QZZA 5DAVA 1WKMA 3LDRA 3LQQA 2XHKA 3RRDA 4YEJA 3GF6A 3NKGA 1SLCA 2PEXA 1BOAA 3RJRA 3AZVA 3K4JA 4NRPA 4K21A 3ZFFC 2GMPA 4FAGA 3KCYA 1ZN2A 2VUDA 2OZJA 3V8LA 5HDGA 4LK1F 1Z7UA 1R083 1UO9A 4XZUG 1OISA 5HBAA 1J2XA 3ATGA 2CFOA 2MPFA 4M6XA 5DM7F 4B44A 3HHGA 3BR5A 4N43C 3ZLIA 1Z7LA 1NCRC 4FAHA 3TL4X 4S2GA 1E57A 1SC7A 2OX0A 1UZWA 4QWQA 2F5EA 1WW7A 1LKNA 2BW8A 1JYTA 4A3GJ 4CDWA 1TWHJ 3VDCA 2F4PA 1AX2A 4XC9A 5D6EA 3JREA 4LFUA 1X7NA 5EQUA 5F04A 3KETA 1ZZ8A 4AE2A 5CKTA 1FPN1 4EMSA 1HRV3 3GXOA 2R16A 1JJ8C 3BDDA 5KAIC 3MYXA 5IOZA 4RLFA 2VH9A 4ARXA 4DOUA 1W6PA 3ITQA 3LIGA 3T2TA 3WX5A 4AIDA 4COZA 3A1YA 3ZYFA 4G7HF 1JKRC 4R8HA 2NPIA 2B42B 3D0JA 2HWB1 1VBB3 3C7EA 2MGQA 4XLNF 3DXJF 4JX0A 5JLVA 4YGCA 1EAH3 4IE0A 3J80Z 5CAZA 4JKLA 4Q4V3 3I3MA 2DCEA 4RBOA 2ARAA 5D6FA 1JYWA 3CMMA 2J1AA 1BI2A 2Z33A 1HQLA 1RKWA 4OFGA 4BMBA 2EFPA 1A3KA 1SD5A 1X8EA 3LFIA 2IS1A 4UFMA 5FY1A 3RI9A 4LBOA 5LA9A 5TSWA 4QX0A 1ETWA 2GQQA 3N7MA 5C70A 1E3HA 1GXQA 3ZFEC 5FLMJ 3C3VA 2ZABA 2L54A 1Q8SA 1TMF2 4LBKA 5C44J 5FKLA 1UG2A 5JXIA 4AEJA 1KYZA 4IZZA 2V72A 4GXOA 3PFIA 2Y34A 2ZHNA 4CA0A 2EXKA 2WSVA 1PZ7A 4QQOA 2WFF1 2FNPA 4JGYB 3BU0A 4XF4A 5FZ0A 5F5CA 2EALA 2YYOA 2ZGRA 1KDMA 4O7XA 4OUMA 1YC61 3CO2A 3JTHA 3FZ3A 1PO12 5C4WC 1BIBA 1DGWX 4IJAA 3FXLA 1W6OA 5GLZA 5FYMA 4XXPA 4B3AA 2RR12 2P5VA 4LEJA 1B59A 3WQ1A 4DGWB 2YS9A 3C8XA 2QQBA 4DW6A 4F52A 1DU3D 1PGL1 4MOAA 3DEMA 3U1KA 4XORA 2ZX2A 3CMEI 2Z79A 3H8UA 5CNAA 2ZC2A 1FSEA 1W9SA 3RZLA 5M5XJ 3IZOA 1ZG5A 3CCVI 4AVBA 2CW8A 5KXCA 1MZEA 2RJLA 1OCPA 5KC6A 4NPMA 2EWNA 4IRGA 5GTIC 2QENA 3RJ2X 2IC1A 1VJ2A 2HKOA 5GAEJ 4CCEA 3BTXA 4D6SA 2P81A 4XAAA 4YYOA 5CG8A 2K9MA 2XR4A 5E8GA 4BXXJ 5JIAA 3I3BA 2B46X 1PGSA 3I55I 4OI4A 4BGDA 5L3DA 2W08A 3SZGA 1EV12 2CTVA 5FUIA 2WINB 1PMIA 2C0ZA 2H0VA 2OU2A 3GCXA 3M1EA 3HUGB 3LSHA 5KHGA 2ZX0A 3RGBA 1XSRA 2FMDA 3CUQA 1UX6A 4K6BA 4LO6B 5TISC 5J3LA 3O5SA 5IWFA 2DT7B 2VQCA 4JX6A 2EZKA 3S57A 4HBNA 2HEOA 2W2IA 4ESBA 3WW1A 4WVMB 2OAZA 1TLHB 4AG4A 2HU9A 3D5RC 5DAXA 3LF7A 4MFDA 1FYMA 1OCOH 1AL0G 4OINF 4V19K 1PVXA 2EV0A 4GWIA 5BMZA 2DCTA 2LYCA 2ZZJA 3KEYA 2ZEZA 2CAVA 4RYDA 1LFPA 1JBCA 1OOPC 3TMOA 3ASIA 1H0BA 1R092 1AKHA 5FZ7A 2CYYA 4QWNA 4M9ZA 3WZ1A 3DPRB 3AG2H 2DVAA 2ZX4A 3AMMA 2STWA 2VQTA 3OG2A 2ZSIB 2L2OA 1W9TA 5C9AB 1TG7A 1L7RA 3W20A 5EYXA 2LNBA 3FK7A 4A3XA 2D6KA 1N1VA 1TME3 3DF8A 3KP6A 2G4IA 1V6IA 3I7DA 2L0KA 3ZMTA 1J1TA 3GLXA 4BMEA 4M3DA 1KU9A 2VJ5A 2ECCA 4KU8A 3WNNA 3BLYA 2RV9A 3E3VA 3WW2A 4IEQA 5ERIA 1MS8A 4JQTA 3WG2A 2NQYA 4Z8BA 3PVBB 3I56I 1K4TA 5GADJ 4UUTA 3IT8A 2VZUA 1CZSA 3GALA 1JKPC 1E3OC 1NCRB 1JT0A 2P6SA 3ABKH 4ZYAA 2LF7A 4B1RA 4EYUA 4RGGA 1B35A 2Y6HA 4HAMA 3OBAA 4B48A 1OLQA 4PLOA 1R5ID 3WG4A 4Q0UA 4ZONA 4I99C 2HWC2 1RUG3 2M8GX 1DGLA 1RESA 1ZBE1 2JD4A 3PFYA 2V09A 3IKTA 4QPIA 4WM8A 3Q0UA 2QQOA 2KD7A 4GWJA 3PUIA 4AYBA 3VBFA 2OVUA 2FCUA 2XQXA 2MA3A 4Q2FA 1W3XA 5FPLA 3IHUA 1SFYA 3I0TA 4ZYHA 2NMNA 2DDUA 4ZKTB 1FZPB 4HF2A 4PI0A 1RUE1 2VZ3A 3SFZA 3ZQQA 4AVCA 1TT0A 2E51A 4Y22A 3H3ZA 3VD4A 1IV8A 4D5FA 5K7PA 3NWTA 1Y0NA 5KHKA 2RQPA 2VZTA 2ZGQA 3MUY1 1G8XA 3TAYA 4IOCF 3JZVA 1R1A3 2R072 1W6MA 2QDRA 3WG7H 1NHAA 1SFUA 4AHZA 4Q4ZF 1XOYA 3VBRC 3INAA 3V0AB 1ZZ9A 4PK4A 3A4UA 2JG8A 1XE0A 3I64A 4XLAA 3PMSA 2WZR1 1Z67A 3QLQA 3MPBA 1W2NA 2ADDA 3VKOA 1VBE2 5AC92 4QX2A 1GV2A 1M1EB 2BHZA 5KXDA 3JCIA 1EV11 3VSLA 1LHUA 5IOYA 2LS6A 1XGNA 1AYN1 5HCAA 1LGNA 3L2HA 4OVEA 3T0YA 1WLCA 2O8KA 2XGXA 3GTQJ 4UHTA 4MEYF 2D44A 3FM3A 4FFIA 3FF5A 1V5GA 3IV5A 3ES4A 5J1YA 3MKYB 1GSLA 3J7AY 1OD5A 1RUJ3 2HZDA 5LASA 4HLTA 2AO9A 2VL4A 3E6CC 5CVUA 1H2LA 1LUJB 4COYA 1N78A 4IHYA 3ACIA 3C2UA 3SCHA 2COMA 2JG9B 2E34A 5D5VB 3QU6A 5IPAA 1C8NA 4FOWA 2K3PA 2XBO1 3KX2A 3GTOJ 4ZYGA 2YU1A 3I4NJ 1QZEA 1V4RA 2HOSA 3ZXKA 5A3NA 2PN6A 1Y8RB 3S3MA 4NDLA 3CBNA 1ETXA 5J1XA 2P0WA 1GXPA 3UKVA 1OA3A 5L3FA 3BT9A 2Z3YA 2F2EA 2RJKA 1K42A 4U36A 2XVLA 3LZZA 1BW6A 2J42A 5GPAA 2A07F 1VBB1 2QFEA 2K9QA 1J58A 3VKNA 1W9WA 2GM4A 4LBMA 3ZPOA 3VUOA 1YQ8A 1S0FA 2HBUA 5JAXA 3O0WA 1JW6A 4UF0B 1JUHA 4QXBA 2L9NA 2RS33 2A75A 3GYHX 3A7QA 2YBKA 4KDPA 4K1ZA 2K46A 3ZR6A 4AHXA 5A1AA 4JDOA 3Q8FA 5L9RA 5KXEA 1I6XA 1SMVA 1UYXA 1OT5A 2R7QA 1GNZA 2EV6A 1FIAA 4JK1X 2DCKA 4HV5A 2CO5A 1E5IA 1FXZA 1DGRA 4JTOA 4NHJA 1BBT1 1P4AA 1LHOA 1E17A 5A7QA 2R7EB 1OCCH 4M9XA 4QPIC 4WM8C 5HS9A 4BQ4A 2P5LC 1CD3G 3ROUA 1PK6B 3DP7A 2DWRA 2ES3A 2ZHKA 2JG9A 1GP6A 2BY2A 1FPQA 3LIHA 1RITA 4Q4Y3 4CYCB 3A0BC 1ERDA 3BPVA 4JGYC 3I5UA 3MV01 1SDWA 3MIDA 3RI8A 5FGMA 3WDWA 1ND2A 3RKXA 4YIIA 4PQQA 4JGZC 3H1MA 4P02B 2HBTA 3MUZ1 1DZRA 1CX4A 4M74A 2P3KA 2WBKA 4GD4A 4X6AJ 1JN2P 5D5XB 4URAA 4BAYA 2K02A 1XMXA 1DGWY 2DOEA 4M4RA 1XC5A 1JUSA 2VODA 2DU1A 1NG6A 1DPRA 2TCTA 3POIA 1MNMC 1N77A 2LF8A 2GSYA 1SZBA 1DHKB 2VMHA 3K70C 3KWVA 1LOFA 2Z99A 4BDYA 4MHUA 2CMPA 1TZOA 1FBUA 1WA6X 3HTUA 1MKMA 2X10A 3FBYA 2E7XA 3ML6A 2XJSA 4Y20B 3U21A 4G9SB 1Y9GA 2VNVA 1FEXA 4ESJA 1QNTA 5FMCA 3LA3A 1W6MB 2VXZA 5CFDC 3QD6A 1WHUA 1ZK8A 2QQWA 3UGFA 4PGGA 3LPGA 5EDNA 4EM0B 4HA8A 4MGRA 1Z6TA 2KQRA 5FKKA 1MNDA 2IS4A 2QKDA 2WO2A 3MFKA 5BNOB 2EZHA 4LITA 4HOOA 4H7MA 2FHRA 4P9GA 3QBQA 4IHSA 2XJQA 5EG0A 4NUBA 4CGZA 3VHOA 2Y8KA 2PI0A 3ZSMA 4ZPIA 4Y1VA 2KXLA 5J96B 3ESWB 3KLSA 4EN7B 3TKYA 2EFOA 2FBEA 2VOOA 4QHZA 3BGAA 2LR8A 4XUNA 4O61A 1GZCA 4M9SA 1B35B 2LRPA 1DP3A 3TEWA 4QHBA 4G6TB 2AUYA 2YGLA 4X6RB 1NCRA 2YROA 5F64A 2VT3A 2HI3A 3J80K 5FZMA 2ZXJA 2NZ9A 4KT6A 2DMNA 2BWCA 4ASMB 1MMGA 3CJTB 1TW2A 1KRIA 1ZZBA 4JYKA 4PUSA 2PFWA 4DEQA 2VOXA 4P00B 3KV5A 4A7YA 1OR7C 1G9BA 4XRMA 3H1YA 2AACA 3NJVA 4BE3A 5L7OC 3TEDA 1ZGJA 4UAPA 3CQZJ 2WADA 2YXSA 2W9XA 1F9NA 4BDZA 4E7KA 2PAKA 1O59A 5HXMA 4XCBA 1K7AA 4OIRF 5HDKA 2HWE2 2WKKA 3WU2C 1RUF1 1S1AA 3HB9A 2D1HA 1XQNA 3GBWA 3L00A 4AC0A 5FZ9A 1I39A 3OOPA 1WPKA 1FJLA 2VCCA 3GFMA 5IVJA 2HQRA 4Q8LA 2BY3A 3WG1A 5CVRA 1D1CA 5FZCA 4I98B 1D8KA 4KBZA 4CEYA 4WK8F 4C2UA 5JSOA 2A1XA 4D5CA 4LK7A 5LBCA 2FXAA 5BNQA 2O61A 3AG3H 2JXAA 1EPWA 1RXGA 1Y6IA 2ORZA 4MVTA 2DDBA 4ZZLA 1LESA 1A8MA 2ZACA 3KV4A 5EJ1B 3CDLA 3H0OA 4A3KJ 3K2OA 1UHMA 1AHDP 2RN7A 3LWFA 3AYCA 4IV3B 3LOCA 2R32A 1W9FA 3S2HJ 3HKZA 5FTTC 3PTRB 2GIZA 2WLPA 5F5QA 1YITI 5HPOA 3POEA 1NA1A 2DTYA 3F21A 1SEUA 4QT6A 2R062 4QB2A 3C7OA 2C24A 3W59A 4KICA 1QHDA 2ZMNA 2WT0A 2B9UA 1IZ3A 4B43A 4CDXB 1LFBA 1IN6A 1RZ4A 2EFWA 2FCVA 1LFUP 3SQNA 4HVRA 2WWSA 2UZKA 2PQQA 4ZZDA 2DFCA 1SLTA 3AFGA 1MMDA 2HDCA 4UUSB 2YFUA 3VB2A 3S1QJ 4D6QA 5LHIA 3CJIB 2LMDA 4BQ3A 3HQRA 3H9AA 2IPQX 3C7HA 4HW0A 1ZELA 1PUEE 5E3OA 4CH7A 1EV7A 5A7WB 5FKOA 1R22A 2LW8A 4UOJA 5IK5A 1I1GA 1Q8QA 1V9U3 5EYRA 1FNYA 1BCXA 3AP6A 4PFOA 1MBHA 5A33B 1MS5A 2KZGA 1DQ0A 1D4M1 4ISRA 1AUYA 2Y30A 1D2SA 5AVPA 1COV2 3USSA 3B9CA 1OOPB 2X8KA 1VBC1 2VMDA 1P4WA 1UCRA 1XTAA 2CGPA 3TN93 5JVVA 1FWZA 1HIXA 4EN9B 2BGCA 5IYDJ 2CQNA 1ZRCA 4E2GA 3AL0B 3JRDA 2JRTA 1G4DA 1DQ4A 2QF7A 2GNDA 4EJUA 1YLFA 2LALA 4HK9A 3A03A 2P8TA 3E5XA 5FMOL 4FFGA 5A7SA 4E4ZA 4YVWB 2A05A 3OL3A 3POYA 2JG8C 2R1BA 1SVLA 3OYLA 2IW5A 4M3CF 4LQRA 1R1TA 1EF4A 1ODNA 3LPFA 4FQZA 3TNPB 2GC2A 5A3PA 3OUJA 1PZ8A 3O1SA 1H0MA 4AOCA 1ST8A 3FM5A 3NAPC 3MCZA 1JHJA 3AJYA 3LA2A 3PLQA 4A4AA 1AYM3 4MQVA 3MF6A 5SV5A 1LOBA 4LHNA 2H6CA 1KONA 3WUDA 1RMU2 3T0DA 1W8OA 3OGSA 1U5TB 2VQHA 1BIAA 4OMCA 1X2MA 4CXWA 3AP5A 4HSJA 4DO0A 3L2WA 4KYWA 2XKOA 3H0DA 1LOCA 5M3MJ 3JXSA 2L9SA 4FX0A 4BU2A 3AZWA 3J8F2 3O0VA 4Q0VA 5K1YA 2WT1A 4N4OB 2YUEA 1TW3A 1PIV3 1NYWA 3THDA 3O2PE 1UZCA 1HRI2 3TNQA 3CESA 2EIEA 4V2WA 1MS0A 4J1XA 2KA3A 2EIDA 2O03A 3LL7A 2BZTA 2HWF3 3K4AA 4A0YA 1QDOA 2QCSB 2A5WA 5JHUA 3K51A 4XLFA 5LBEA 1I9RA 2A5YB 2GBYA 4AXOA 2HVQA 1OH4A 2JT1A 2F6CA 2NVYJ 3WODF 1C8M1 4J01A 4G7ZF 4QB6A 3KCCA 3QPTA 2GAUA 1Z7S3 1VBD2 2ORXA 2XPUA 1QJEA 2MEV2 1XRUA 3L2YA 3TGNA 4RGKA 2YC2A 5H6RA 1P7JA 3ZYIB 1RUD1 4CICA 4FETA 2GXGA 1X19A 1V6NA 3WDTA 5I0TA 2YDEA 3PUFA 4BE1A 5LWBA 2LBFA 3HR9A 2AC1A 4I76A 5A1LA 4N8MA 2VJ4A 2MEV3 4A3IJ 2KHMA 2GN3A 2HEVF 4MFEA 3LOIA 2A6VA 3SZPA 3ZMVA 2ZJPF 4N9IA 3EO6A 1ZGWA 1MR5A 2XPVA 2QQPA 5CADA 3N7LA 2RC4A 3CF2A 3F72A 3KV9A 2ZXIA 2C5DA 3ZMUA 4Y5TA 4YW6A 5LEKA 1QGLA 1WMEA 1IG3A 3VHNA 3ABTA 4EN8B 4CCMA 1XNKA 4IV3A 4HN1A 3DYPA 3FHZA 1DDLA 3MWMA 2K7LA 2E26A 2A3XA 2Q2EB 3BOPA 2XH6A 5IJRA 3GW2A 1VBC2 2X53S 3VEPA 4AD9A 5GLVA 1VMFA 4CU8A 3W3CA 3WQ7A 4GB31 3G3ZA 4YFKF 1LE8B 2A6HF 1MNEA 3V7CA 1QJZA 2OA2A 2DVFA 5JWPA 2VE8A 1QJFA 5FFOC 5HOOA 2UY9A 4IX7A 1H9GA 1X3WB 1Y56A 3OYCA 3BIWE 3U0ZA 1C3HA 2OQ6A 1ND3A 3WTVC 4CCKA 4TSVA 3VDDA 4M4PA 3PHMA 2CJJA 2HDWA 2D6LX 4IQJA 3ELNA 4RB3C 1AYM2 5K7HA 3N36A 4P9YA 2Z9OA 4CU9A 4EWAA 5C9AC 2Z1DA 1V5FA 3FE5A 3EUAA 4Y4RA 4FPYA 4RHV2 3OY9A 2LD5A 5LGNA 5E1RA 2JA2A 4XMAA 1ULPA 4L9JA 3VYUB 5FMBA 3ORJA 2G9FA 1SVOA 2WJSA 5FK8A 3MBWA 1DLLA 5J09A 3LB9A 5E89A 3C2GA 3BTLA 3WOGA 5FFZA 2O0OA 5F2WA 4CCOA 4GIQA 5FWEA 5B2GB 3L2QA 4FT8A 4BK4A 3VZJA 2XGDA 4IGPA 4QM8A 3I53A 4EVIA 5F3GA 1OKRA 2C9AA 1F5TA 2CWEA 2ET7A 3OGGA 3KGZA 1GWKA 3ZQLA 1Y43B 2JDPA 3QP6A 5K0UB 2XGEA 1U9NA 4QX8A 4AW7A 1AYN2 2ZGSA 1K4SA 5DTDA 1OC1A 3RPUA 2OCEA 2V5YA 3ILRA 2PMZA 4BHBA 2ISZA 4IGQA 3IIAA 3PIOF 4L11A 1KS5A 1OFSA 3OPZA 3IH4A 4UB8C 2K3FA 2H1LA 4XUOA 5DEQA 3RQ4A 1J3QA 5FYSA 2GU9A 2V4AA 5JVTA 5FDBA 1IAWA 5FLXK 1JU3A 1VB4A 3MZYA 4L97A 3PO3J 2L7ZA 3KIOA 3CTAA 1DGRN 2RMU1 1RUH2 3FFZA 4N43B 4IEYA 2VJIA 5CYVA 5A6QA 2DTZA 1POV3 4C2MJ 4OHXA 3MW3A 3VDDC 3JAMK 1BA5A 3HJRA 1TNRA 3CO7C 2X29A 4AQSA 4ZXKA 5FYHA 3F9KA 1LHVA 1H6YA 5D2AA 3BPZA 1DU0A 1IXRC 3HQXA 3ZR5A 4IGOA 3N3HA 5FZBA 3CEWA 4BB3A 4UFJA 3EXUA 2LY1A 2HWD1 4NPRA 2KJBA 3DQVC 1CF7B 3HOYJ 4ATEA 4XN0A 2XROA 1YJNI 2IXCA 4HETA 3CIHA 5BUVA 1YQ6A 2VKVA 4NRMA 2COBA 1LU1A 2GIVA 1OR7A 5L3GA 2ZJQF 2D3RA 5K9YA 6PAXA 1RIRA 4EJOA 3H8RA 4DXTA 3H9JA 1BLZA 5FREA 2VOWA 3ALQA 4LG0B 2NVTJ 5EG0B 3LGRA 2ZGLA 1YFYA 1NY71 4B3XA 2D43A 4XCAA 1BKZA 2VOKA 5BNOC 2WLQA 2XVGA 2HWE3 3K4NA 2A5ZA 5T52A 2UWMA 2A68F 2AGSA 4GCVA 1PJRA 1J3RA 2V7FA 2PYTA 4MHRA 3F0CA 3VD5A 4HQMA 1WCMJ 2M3AA 2DK8A 2P4WA 4DQAA 1VE0A 3IAPA 1YS7A 2V1DA 2ETEA 1W03A 2DU0A 1ENQA 3RYPA 4LG3A 1CAUA 5L3BA 5EP9A 3IAM2 4BBRJ 3R05A 2BXYA 1UMIA 4YG0A 5A7PA 4DRRA 1VBE1 2VU9A 3V0BB 4E8CA 3VHRA 1YFHA 1I1SA 2BQPA 1DFQA 3O8GA 2P3IA 2RKHA 1QOSA 1J09A 3LSPA 4U7DA 2X09A 3LSJA 1R71A 1PNGA 3M3CA 5D1IA 5KR7A 3V7RA 3WHCA 1RB8G 1VQKI 3HOVJ 1TWAJ 2VZVA 4YG6A 1R9TJ 4CCCA 2M45A 2ZHMA 1E2XA 1A6QA 5FLXZ 4RL7A 3DBLB 3HNMA 2UXNA 1YX3A 2CNAA 4SBVA 3SDGA 3I54A 3SNMA 2FSWA 2O3FA 3EYPA 3E7LA 3DYMA 1G3TA 3PU8A 4OIOF 1NK3P 1GQPA 3WCRA 1ULDA 1X1AA 1WCDJ 3R4SA 1KZHA 3JW4A 1U12A 2A7AA 3IM0A 2FD5A 3I2JA 1SLAA 4M0NA 3G71I 4AEDB 1ZZCA 2FNAA 5DZFA 5FR3A 1VNDA 3MIEA 5BPXA 3H5AA 2FMLA 5EIYB 1ZTRA 4IE4A 1W4MA 1VQ8I 4IO9F 3CMGA 4CP2A 2YV8A 4UVAA 1KQ9A 4NIDA 4QGNA 3VKMA 2VPRA 3TRSB 3MFCA 4N4NB 2P34A 1K61A 5BNNC 4DYQA 4YELA 3AZZA 1Z77A 3M8JA 3SEQA 2VASA 2ZKLA 1ULYA 3PQKA 1NQJA 3W2WA 2UU8A 1QH6A 3RZMA 2Z16A 4IV3C 3B93A 4MXVA 3KM5A 4AIKA 5GP9A 1KJLA 3ACGA 3QWLA 2GXBA 2WO3A 3RI4A 5H2FC 2XASA 3MIHA 2G9ZA 4JX5A 2HTJA 4BEHB 1TZLA 4AEDA 5LFAA 4L0PA 2QTWB 1KFUL 1J84A 1LOAA 2W52A 5E1WA 3KFWX 1QU3A 5HNHA 1NCQB 1VIWB 4M3CA 5FQ0B 4NQWA 2Y0OA 3JQWA 3WF4A 1P92A 5IT6A 5ACA1 4ZXEA 4MSVA 3SZTA 4BY1J 1BBT2 2FDIA 4GH4A 1AX1A 3VD7A 2FX0A 4QGMA 4BM8A 2VQUA 3ACFA 3NEUA 2NOGA 1QJX2 1ZG3A 5I0DA 2X1DA 4YW1A 4ES9A 2VUMJ 2PHFA 1R58A 2BY1A 2V9KA 2VN2A 4HKLA 1MD0A 1W5CC 2M87A 1WGPA 1EY2A 3LAJA 2O1QA 3A22A 4QMAA 1MBEA 3T2PA 5CQEA 5F0HA 4H2AA 2VNOA 1FNNA 3VBOB 2HVSA 2LY2A 4W65A 3OGVA 4Z2WA 3K4BA 3ZN6B 2DCYA 1TTYA 1DZQA 1JU4A 4ZH4F 2L9LA 5ISLA 3M8LA 3S8PA 4NE9A 3R4DB 3N9QA 1P7IA 5C4WB 4UXNA 3LQCA 3OBTA 5C3OA 2D3PA 2HYXA 3PIJA 5DDGA 3WF1A 3ZXDA 5EXOA 1FAYA 3M9AA 3B01A 3DBRB 3DUIA 3UGGA 3O3KA 1APNA 1TNTA 4RGUA 1YRNB 5KXBA 5EEHA 4M6VA 1YQCA 4DZJA 2PHLA 2JG8B 3U9GA 1AR92 2O14A 1ETVA 3V56A 2E19A 3C7JA 3U11A 2MHFA 1QWRA 1O3RA 3BALA 1VTNC 4BQ5A 1CWPA 4ABZA 1AL23 3RCOA 3B02A 4CPBA 2FCTA 5JXJA 1H2MA 1ZM1A 2KM2A 3SJMA 1BK0A 2WNEA 4CDUA 5JXHA 1CX1A 5IT3A 3KZ4C 3NAPB 2QSHX 3TP3A 2RDPA 2XAHA 2EXIA 4BXSV 3A0HC 5FLJA 4XONA 4D7SA 3PIPF 3A23A 3IRRA 3I2FA 2ZMEB 4AVAA 4PJLA 3IUOA 4RA2A 1HLCA 2B45X 2W82A 4NQWB 1W8NA 3GYDA 3RKQA 3RKWA 4LA2A 3DCFA 4OI0A 4N53C 1UKGA 1DPUA 4Q4X3 3LE0A 1XNAA 5G05L 3RWKX 3DEWA 4YFWA 1SFPA 1YJKA 3RMXA 3AKPA 1USTA 3S2DJ 2WS93 4HX8A 4XOPA 2KFDA 1ETQA 2D5FA 2XPJA 1FMD2 3SKJE 3I3DA 3LAPA 3OYBA 1CIWA 2FQ4A 4PJ0C 3ACHA 4E4SA 1GLNA 2IVIB 1MMNA 3N7JA 3OIOA 4YZ5A 2GA2A 5F0FA 1VAVA 5AC93 1VBE3 1JE8A 4I3PA 4GMP3 3KLOA 4A3EJ 4QDRA 3RFRA 4U0VA 2PMZN 2LKXA 4OIQF 1W6OB 4KGQA 3SEZA 2RM21 2UYAA 4BS9A 1UFMA 1YW7A 4WBBA 1F5JA 1POQA 3OGRA 3IDCB 4MTDA 2AXLA 4B7EA 1R00A 2ZCWA 4QQPA 4ZHNA 2LKSA 2BW3B 4GH4C 4H0EA 4RGAA 3MMYB 2O7OA 5A32B 2HPIA 4AM3A 3VBUC 4HK8A 2OW4A 1QBJA 5GAGJ 2HQNA 1YS6A 5KCMA 1FOKA 1Z0XA 3T0AA 2F5CA 1CESA 3GTKJ 1AXZA 1ND3B 1XE7A 2PAMA 5DM6F 1ZBE2 2XUEA 2OXBA 5A3WA 3SFIA 3T1BA 3GTLJ 2F4OB 2D6PA 2Q8OA 2Q8KA 1OMIA 1HB2A 5T5OA 3KE2A 3KYDB 1ZLKA 1MSEC 1OPCA 3IDEA 1IPKA 3HXLA 1XSVA 1F2NA 4MGKE 2FZ1A 3TOBA 3TW6A 1CONA 3JRBA 2Y38A 2NOJB 3ZQCA 4D0PA 4WVVA 1SDDB 3THTA 4KU7A 3DEEA 4MEXF 5FV3A 2R043 4GJZA 3ZDVA 2WC2A 3S2WA 1ASJ3 5EJZB 4LBQA 4KISA 1PX3A 4TTGA 3U75A 3THCA 1PX4A 4TV7A 5FLVA 1Y8QB 4RS5A 1RETA 5ED4A 3OYEA 2AS5F 3PUQA 4TLGA 3G6JB 4MO7A 2HOEA 1GVJA 3PO2J 3NV2A 4OHVA 5J47A 1IN8A 1W04A 1ZRRA 1W8UA 1D3YA 1V55H 3CLOA 4GAZA 1AOYA 4BYYA 4GRIA 1XDUA 2D1VA 3DPTA 1CZVA 1QPMA 2YPJA 3OSDA 3HBLA 1XNCA 5LCWL 1AR72 2WABA 1UJ8A 1AZDA 3S5AA 1ND2C 1GICA 1EAH1 2IWGB 1X4OA 3OBZA 5FZFA 4KWKA 4BXUA 3ZXJA 2VY0A 3ZFGA 3ZN5A 2ID3A 2W1SA 5F1JA 4UI9L 2QQKA 4IOAF 5FZ1A 3SXYA 2JE8A 2ZA9A 5A7NA 1FSHA 1K78A 3KEOA 3OV8A 3KQ4B 4A3LJ 3O7OA 3ONQA 1Q56A 5A7WA 2XPWA 1NXD1 5FY4A 5GZEA 4EQVA 5HI0A 2KLOA 3ZYJB 5BS6A 3M4OJ 4XKWA 5HDNA 1WZ2A 5LGTA 2ZJRF 4KL1A 1IPJA 4CP9B 2C6SA 3AZYA 4P96A 5DPNA 1W8HA 1L7QA 1JZ2A 4HNUA 5GM0A 4U2AA 3MAJA 3V8JA 1R1VA 2MBFA 4RQPB 4HFSA 5K5OA 4DUVA 3VD9A 1GMMA 1HSJA 1O8PA 3WSOA 1LPQA 1BMV2 3AAFA 5F1RA 2CDOA 2B9SA 4RGSA 2B9VA 5M0TA 2CGNA 2X1EA 2E32A 4HF1A 2QCOA 1N75A 2JKBA 4CUGA 1T8IA 4KWUA 2VC1A 1VZ0A 4LE3A 5C5UA 5GZFA 3VV1A 4B1LA 1VRH1 4AF9A 3CZUA 3N9NA 2Y48A 3URFA 2V79A 2IEKA 3ULQB 1T2XA 3ZR8X 3QH6A 3MZHA 2RG4A 3RZHA 4XJ8A 2LP0A 2XVCA 4Q4Y1 2ZO4A 2Q30A 2WZPP 1IRXA 2FBIA 4R1HA 3J8F1 1AL22 4DQ2A 3E1SA 4NC6A 4BJ0A 2JIGA 2PJRA 2ID4A 1D4M2 1K78B 5FXXA 5FPVA 2XB6C 1KQ0A 4S2FA 3RZKA 1RGSA 4XF3A 3DV8A 3OYNA 1AR93 4X8PA 5ICGA 4CCDA 2IXJA 3AKSA 1UN1A 1IN4A 4LIVA 1W8FA 1KQRA 5FPAA 3N9OA 3E5QA 2ZJ2A 3MKLA 4OUEA 5A80A 3FDYA 5FD5A 3PUHA 4M3GA 4AVZA 2RJ2A 5FCCA 3F8MA 3LSEA 1BR4A 1U3EM 4NHXA 4P9UA 1WI3A 4DNCA 2O8QA 2DA6A 3LWCA 4LKSA 1ONAA 1S5LC 3U14A 1PUFB 3LQRA 3M4FA 2IT0A 5E3NA 3EBRA 3U2RA 2QLZA 4UF0A 1S3JA 3X2QH 4PBOA 3BI3A 4AAPA 2K0GA 1SAXA 4GXLA 1KYWA 1PDNC 4DYCA 5GLTA 1GKBA 3BTYA 2QSFX 2YPRA 3HPHA 1ULEA 4ISQA 3ELKA 3PJYA 3W9AA 2ZMEC 3FLRA 5FXVA 3J7NA 4LBQB 5B5EC 2XHNA 2Y69H 3PNAA 1MZ5A 3GTPJ 2QVSB 3FXRA 2E7AA 3L2VA 3SHFA 4CPBD 3SYTA 1HC8A 4L18B 1JI8A 3SEEA 4C30A 2DA3A 4CZSA 3SMHA 3K2AA 4XJAA 3BJOA 2IGMA 1MQTB 1VBB2 2LG4A 3F6VA 2BP6A 1BBT3 5A3OA 3VN4A 2FZ2A 1QGPA 1R5HA 1RXFA 3WE3A 2UXXA 2V6EA 1KDKA 5DAPA 1D0HA 2EA2A 1KFXL 3K4ZA 1C5HA 4XNFA 2VMCA 4Z2AA 5BNPC 2JA7J 4NO4A 5DUKA 1YJWI 3S1RJ 2PJRB 3S0MA 1F4AA 4ZC3A 4WZFA 1FI2A 5L36A 2R5ZB 1UAAA 3IAQA 2VKHA 1XU2A 3V4GA 4DYRA 4BHCA 5GZDA 2PJPA 3D1NI 3N05A 5BNPB 1JT6A 2ZFUA 3SH4A 2FDGA 3ZM8A 1E5RA 1FYLA 5CVVA 2WFPA 4HT1T 3WDYA 1VLNA 2RREA 5I0UA 1DUXC 2EXHA 2JB4A 2QJVA 2BPA2 1Q1VA 3WNMA 1HN1A 2WZR3 5E3LA 2LSOA 4RFRB 5LY1A 1I5PA 1O4XA 1ITYA 1ZRFA 2R7RA 5I0SA 3L1PA 1NAEA 4WXHA 2ZFWA 1LDKB 3OR2C 2VCBA 2R3SA 1JGGA 3NV1A 1SFKA 1D5YA 1Q8OA 2HQAA 3D5LA 5JOZA 2JA6J 2WBMA 4IE7A 3M07A 1T98A 2EV5A 4NAOA 4EZ4A 2J7MA 1JTZX 4GMP0 4DBQA 4NHYA 4XJ9A 1HDDC 4JKMA 3RZGA 4LTAA 4W4ZA 5HLIA 4OHWA 2KKOA 1B35C 5GTHC 5K7FA 1UOBA 2P17A 2IA1A 3I59B 3TW7A 4MADA 1K6YA 1X1DA 2EJRA 3K4DA 1SFOJ 5CIRA 2I8DA 3B6CA 2R93J 1RUF2 3KHBA 2VNGA 3ERMA 4CCLA 1ENRA 4CUAA 4YZ1A 4QU1A 2XF7A 1L3JA 1RUC1 4CTEA 1O6UA 1VR3A 2JQ7A 1X9PA 1NG7A 1IG7A 2Q8EA 4U87A 3L9FA 2KRHA 2F4MB 1VQ7I 2TEPA 2XAUA 3SH3A 3OGJA 1FOD2 5I8SA 2RV8A 5FMDA 2WWJA 3S6PA 4M3CE 4PT6A 2ZMKA 4KWJA 1VMHA 1HN0A 3GF2A 1XMKA 3C7GA 4GFBA 1L7LA 1ND2B 2VUAA 2L7KA 1PK6C 4GWNA 1ULGA 4IUGA 4FPEA 2Y0MA 3HWJA 1REPC 1REFA 3CNAA 2VZRA 4EWEA 3K4MA 2ZAHA 4D0QA 2VZOA 1EPZA 3EPZA 4RS5B 4JGZB 2FDHA 5H20A 3D6EA 3HEIA 1WD3A 1JH5A 3JB4C 2E1MC 3T8RA 4LHKA 1JUIA 3HRSA 4C0BA 3AL6A 2FBKA 5CISA 4RD7A 1FP1D 4JQRA 5F2SA 1MBKA 4I01A 3LDKA 1OLRA 3DGTA 1MJBA 4EV0A 1N1SA 1I6HJ 5C9AA 4KWLA 5IP9J 3ZN6A 3M1HA 2IFWA 2FJ1A 4INDA 4IHVA 1XCVA 2M8EA 2JTVA 1OFNA 2M0MA 1ZBA1 1T6BX 5E16A 4AU7A 2OBPA 1FLIA 1UL9A 5FP4A 1R49A 3FBNB 5BPIA 1G8WA 4DY3A 1IN7A 2ZS6B 4RB0A 2VKDA 4D8MA 1AR62 2WS91 4LJHA 3LD8A 3NARA 5FK7A 2QGUA 4OU0A 2GMMA 4JDMA 1T0FC 4M01A 2Y6FA 3TQNA 2NP0A 1CAUB 1Q5OA 2CV2A 4JOMA 4XBNA 1NXMA 4TN7A 1ETOA 2JG9C 5JXGA 4XBLA 2VTXJ 3GFLA 2JDKA 1HJGA 1Y1WJ 5J4VA 4F92B 3BY6A 1MBGA 1S55A 3WD5A 2I07B 4LLFA 1A31A 2LOOA 2BBAA 2DA1A 1QHGA 2BNOA 4P14A 1QXRA 2DMUA 3EDPA 5HV4A 4YW4A 4G94A 1HQCA 3MN2A 3NNFA 4FXGB 1VP6A 5FD6A 4O3MA 1WLTA 2WRAA 3MO4A 3POGA 3M70A 3T08A 2Q1ZB 3GFJA 3DBHB 2ZX1A 1GANA 2KL4A 1A04A 2QEXI 2DT6A 5FUPA 2L01A 1RUC3 2DCZA 3BG3A 4BBSJ 2LDUA 3HN1A 1QH7A 5C3EJ 2OPWA 4UVCA 1CIYA 5FRAA 5GKAC 1OLMA 4NN0A 3JBG2 4RMNA 2W25A 4B4PA 5IY5H 2GNTA 3H92A 4PF5A 5LK7B 4O6JA 4LMYA 1MVQA 2XUBA 4II2A 1OF3A 1TME1 1BW5A 1B1BA 2K9NA 2F48A 3BG9A 2HWB3 3C3WA 1ODMA 2QQMA 2K9SA 1QF3A 4ARYA 2KIMA 4EJVA 5CPRB 1DQ2A 2OQRA 2RMU3 3QPSA 5J8CA 3K1MA 5HLHA 4HPKB 3F2ZA 2R7SA 1G2HA 4KITB 3JRHA 4IEWA 3MGUA 4GJYA 4O9EA 2V9PA 4YGEA 5F6KA 5K4LA 3GZ6A 4N43A 3I97A 4A6EA 4FX4A 3EUKL 2EZLA 3E0JB 3ZYRA 1Z6RA 3DEUA 5EEAA 1YWKA 1H1MA 2F17A 1JHHA 1S7AA 1B72B 3W2AA 3WTYC 4KNCA 5BXXA 2F4LA 3O1TA 1BHGA 2L7MP 3OS0A 3HN3A 2ELHA 4C1WA 1NE6A 1HB3A 2AENA 4FTBA 2NN8A 2DO7A 1LNWA 4ENKA 2HXOA 2MEV1 2ZMEA 5BPDA 2JDNA 4M3BA 4PZJA 1Q3EA 1VBC3 2CL2A 2CGOA 2AEYA 2HJIA 1W06A 4QKNA 1FC3A 3T2QA 3JRGA 2BVVA 3WEZA 4I0BA 2D6OX 2W24A 4N7IA 3MEPA 1VB2A 4XFIA 2K2SA 3R0AA 3UL2A 2DVDA 2CQ7A 4U88A 3O12A 3UNPA 3TP0A 2WWUA 2BV6A 5DG1A 2WV1A