3D0SA

Camp receptor protein from m.tuberculosis, camp-free form
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
224
structure length
224
Chain Sequence
MDEILARAGIFQGVEPSAIAALTKQLQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISDSERLARRAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of cAMP receptor protein from M. tuberculosis in the unliganded form
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
molecule keywords TRANSCRIPTIONAL REGULATORY PROTEIN
total genus 69
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3d0sA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3d0sA01
5H20A 2ZKLA 5AONA 2ZJ2A 2PMHA 5BPDA 1PP7U 5ILSA 3BP8A 2DFIA 5HLHA 2A68F 4LA3A 1U3EM 5D6EA 1HKTA 3BJ6A 2XHKA 1XD7A 1ON1A 3KSCA 1R22A 1R36A 1S29A 1TTYA 4WXCA 3DN7A 1G6NA 1W7PD 4NHJA 2JSCA 3P7NA 3ZQ7A 3V8KA 3FWEA 3RYRA 3IDBB 2D40A 4OFGA 4IRHA 4ESFA 4I0BA 2KIFA 3C3VA 3EYYA 4PIZA 4HOBA 3COAC 3H7YA 1OYYA 3Q9SA 1W7PB 1EP0A 3S2WA 4KIBA 4P9GA 1ZN2A 3HSFA 3BU7A 2L4MA 4F8AA 2K27A 1JUHA 2QM3A 4TLFA 4WF2A 1LDDA 5BUVA 3CJXA 1QO0D 1UFMA 1J0RA 2FMYA 5BV6A 2FXAA 2BBYA 2K4JA 3DFGA 1HXDA 3UKNA 2P17A 2IXJA 5D1IA 4HAMA 3HT2A 4KL1A 3R6SA 4MHGA 2H09A 5L3EA 2D1VA 3TOAA 4EMSA 4PJYA 2EVXA 1ZZ9A 1ZHFA 2BNNA 1CAVA 3R4KA 1WGPA 1CX4A 4HN0A 4A0YA 1V4RA 4G7ZF 3IWZA 2F4PA 2K4BA 5BMZA 3MQ0A 3GFMA 4AQ6A 1B9MA 2OU2A 1YQAA 3R61A 4B29A 2VOOA 3HSEA 3NVCA 1XGSA 1J75A 2VQAA 3BCWA 4M72A 4QM9A 3WTVC 3M8FA 2ELHA 5CLSA 1XGMA 2F5EA 4HX8A 2STTA 1KGSA 5CU1A 2WV0A 4L11A 5JHUA 5DEQA 1U6GA 3C3WA 5FO5A 3GLXA 2HS5A 4AVPA 3GX4X 5C8WA 5I8TA 3V7SA 3U9GA 4L9VA 1YWKA 1U78A 3P9IA 4ETSA 1C0WA 3HQXA 3I58A 2GAUA 2JRTA 4CHUA 1EH8A 5F6FA 2HFHA 4ORFA 1FNNA 4UVCA 1IRGA 2CAUA 3GFIA 4GYIA 2K86A 2CV6A 1YFUA 2EFNA 3HTSB 3QPTA 1KQ8A 3KZYA 2R7DA 5K5OA 1J3RA 2EFQA 2F5DA 3CTAA 5FLHA 1IN4A 3I5UA 4ON0A 4EM2A 1ZLKA 2PYTA 4Y17A 3RI4A 4QGMA 2KJBA 3KMHA 2QLZA 2OA2A 5JSRA 3QU3A 3FM5A 3IHUA 3FHZA 3U10A 4GYGA 2EWNA 3WG9A 3EETA 4A6EA 3CLOA 3MDPA 1V70A 1DDNA 3FMSA 1ZZBA 1XSDA 5CVRA 3OV8A 2GXBA 3W6JB 3VOEA 3OD0A 2FA5A 1Q3EA 3ABUA 5LBQA 5JSPA 1VJ2A 1TW3A 4QWQA 2QBYB 1CF7A 3NRVA 1W4MA 1O57A 4ONUA 2AXLA 4Q0SA 2DK8A 2GA2A 2PJPA 4ZZDA 5E18F 3E5XA 5FGMA 2PFWA 3ZMDA 3KP4A 4HV5A 1XMKA 1J7KA 2IT0A 1HW1A 4HF2A 4EM0B 1WQ2A 2Q2EA 4E2SA 3U0ZA 5I0UA 2DTRA 3RPQA 4MUVA 1YFHA 2IJLA 3UKVA 3WU1B 4LA2A 4HN1A 4KWLA 2VODA 2CGPA 1BIAA 4O9EA 4QX5A 3ZMTA 2VN2A 3KEQA 2EA2A 3WGGA 4MEXF 1U5TC 4OMZA 3SXYA 3FXUA 4QXKA 2VOPA 3LAGA 4Z82A 5E1XA 4H0EA 2K02A 4L9NA 2EAAA 1LKNA 5IT9Z 1KU9A 3RDIA 1FC3A 4KN4X 1PMIA 4M9XA 1P4AA 2GQQA 2GC3A 2A5YB 3R0JA 3ZPLA 1R5GA 2QVSB 2V9VA 4ZYEA 2M8EA 3PFIA 4BIFA 4PDKA 3F72A 2GU9A 2VT2A 4HX4A 2WFPA 2QQBA 1KQ0A 2VBWA 4DQ2A 2A07F 3QU6A 1O3RA 3NL1A 4HZFA 4I02A 3GF2A 5KHKA 4M71A 3PQKA 4RB2C 1UIJA 2H94A 1XGOA 1DPUA 5ICFA 2M45A 4DNCA 3LWFA 1B4AA 1D3YA 2CYYA 3F8CA 2XAGA 5DCMA 4HDVA 4ZU7A 4M73A 4L5IA 3T5XA 3HYIA 3L7WA 2K7LA 3F8FA 2ZMEA 3DEUA 3C18A 5ICEA 3ULQB 3OCPA 4LEJA 2OPKA 4LFUA 5HLIA 2GA1A 2IP2A 3EDPA 3I7DA 2MNGA 5E1WA 4EVIA 4YFKF 2KXLA 2ZNZA 4XFBA 5HI0A 2B8MA 1ZARA 3LOIA 5K5RA 3H3ZA 5L3BA 4MZUA 3Q9VA 1J59A 3TGNA 3KEOA 2XLFA 1HQCA 4M6XA 3I53A 1OYIA 2IXIA 4NQWA 1FZPB 1CF7B 2L01A 4D7TA 3E6BA 1ZZCA 1USSA 1I5ZA 1FBUA 4ZU4A 4YARA 3CUOA 4EJTA 1H9GA 3KP3A 2OZUA 5DD8A 2PHLA 3N4MA 1RUNA 3ELKA 2PMUA 2BGCA 1XCBA 3HSRA 5J48A 2HKOA 2IA2A 3S7EA 4IEWA 2QBYA 1O4TA 5E8GA 4PGGA 3LQQA 1OMIA 2W24A 3CUQA 3I64A 4AVCA 1ZGJA 1IXCA 1HW2A 2DI3A 3BROA 5EEGA 1FP2A 1A04A 3BJOA 2Z99A 3PVBB 2M1BA 2O6GE 3GW2A 1DZRA 3CEWA 4HVRA 3CL1A 3K9TA 1R58A 3U2RA 4IVNA 1HBXG 5D8KB 3E97A 3EQEA 1SD4A 4OIRF 1VTNC 2HTJA 1G4DA 3LAJA 3FMRA 1RI7A 5JAXA 3VB2A 2VONA 4R79A 3GZ5A 4A2UA 1LEAA 2EB7A 1QWRA 3FE5A 4HLTA 3CLPA 1J3QA 3MZYA 3V4GA 2I45A 3TNQA 1FT9A 1EH6A 1GVJA 2HKXA 5JI6A 4KWJA 1J9IA 2O03A 4UBGA 1MJ9A 3H8UA 2QUFA 4FHTA 3IKTA 3JSOA 1F5TA 2Y0OA 2Z5UA 3ST7A 4RB0A 4OIPF 2DPDA 4L9JA 2Z2SB 4IETA 3H7JA 1T39A 3SCGA 3H50A 2FNPA 1WWXA 5BPIA 1U8RA 2M87A 4I2OA 3FXRA 1Z1DA 2W25A 3BY6A 4GGGA 2XKPA 3SMHA 1KA8A 4NVPA 1G3WA 2XLAA 3USSA 1TW2A 4X6QB 2CFXA 4XFCA 1IPKA 2YPRA 2B9UA 4ENJA 2DK5A 1TLHB 4UBHA 5BY5A 5FLXZ 5D5UB 5D6FA 2NNYA 3N97A 3RPUA 1OKRA 2QNKA 5CVIA 3RJPA 2QWWA 2ZKZA 2OAZA 5FFZA 1CAUB 2MHFA 2MLGA 5J8FA 2XLGA 3CO7C 3KFWX 3ES1A 3L2HA 3V7CA 1S8NA 1FBQA 1PDNC 2V1UA 4MNUA 1G3SA 5AIQA 3F8BA 2UY9A 5I0RA 1R1TA 4ASNA 3M9AA 3K1PA 1FSHA 1ZG5A 1DGRA 2PN6A 1BBYA 5KBFA 2VBXA 4EQQA 4P9FA 1R5HA 3ES4A 3IRRA 1REPC 4MX3A 5HDNA 5LHIA 3ZN0A 4JVAA 4G7OF 4QMAA 2O3FA 3RNSA 3V7RA 1MGTA 5D5XB 4I7HA 4IEVA 3TDZC 5KK1A 4AD9A 5CADA 1I1GA 1YFXA 2JPBA 1DP7P 2RGVA 1P4XA 5DD4A 2P4WA 3WW4A 2X0LA 2C6YA 2P8TA 1FP1D 3FM3A 4XF3A 1J2XA 2JTVA 2EFPA 4WXDA 2W85A 4PZJA 3RYPA 4DINB 3IL2A 4XFGA 4Y13A 4R8HA 5LEKA 2EV6A 3H3UA 4M9SA 4XSZF 3GYDA 2FE3A 4EWDA 3MEXA 1IXRC 2UXNA 3DL3A 4R52A 2K9ZA 3F3XA 5IT3A 4O3MA 4IEUA 1NHAA 1UIKA 1S6LA 2FNAA 5LEJA 1K7AA 5TRDA 3S7IA 1XRUA 5DCFA 4KMUX 5A2QK 5AVPA 5DDGA 4FX4A 2E7XA 3KP2A 2ETHA 1ZNPA 1TQMA 4XF9A 3VODA 2JZYA 4LUMA 2BE5F 3H1MA 4EWEA 3TNPB 1L0OC 1Y9QA 3O3KA 3FJSA 1TNTA 2FQPA 3FX3A 3DKWA 3O2PE 1CAWA 5D5VB 5LGUA 4MTDA 4RGUA 3TO7A 3ETQA 4LLLA 4UV9A 4MEYF 2OZ6A 1HSJA 4MGZE 4Q4ZF 1MDMA 4OOIA 5D4SA 3DXJF 4RB3C 1H1MA 2E1NA 2ZMEB 1VR3A 2V79A 3E5QA 1USTA 3EQLF 4GCVA 1ZGAA 3RKYA 1LDKB 1YHFA 2O61A 2PLYA 5I0TA 3NJZA 1MJAA 3NW4A 1LEBA 1CAWB 3LA7A 2WTEA 4A6DA 1ULYA 1JGSA 3F8MA 2FF4A 2OD5A 1T98A 4AIKA 3KZZA 2Q0AA 2ETEA 1ZYRF 5FB2A 2VC0A 2IXKA 1CAXB 2N7GA 2P5LC 4ZYGA 1UCXA 4AIJA 2QQAA 1OR7A 2NNNA 2LSOA 5DCMB 2VECA 2ET1A 5JVTA 1AWCA 4YRDA 2YU3A 2GC1A 2XAJA 3J81Z 3M8EA 4RGSA 3IC7A 5LGNA 3GWZA 2Q8KA 1O7FA 3G3ZA 3KGZA 4MV2A 1YYVA 3REOA 5CVJA 2Q4SA 2COMA 3WE3A 2L54A 4QGLA 3WTYC 5FQ0B 5BOXA 3BJAA 4LJZF 3ABTA 2FSWA 3GBFA 3IDCB 2UZKA 3FZVA 1EPZA 4KUMA 2O1QA 5K8SA 1FYKA 5I8YA 1OD5A 2PAMA 4KIGA 3DPLC 2AS5F 2GH2A 5FLJA 4D0PA 3FMQA 3LFKA 5I8SA 1P92A 4IHTA 1J5YA 3HHGA 5DV5A 4IESA 2PQ8A 4LMYA 1ONVA 1BI0A 2RVCA 4Q0PA 4Q48A 5K1YA 4UUVA 4UXAA 1XDUA 1Y3TA 3EJKA 1X7NA 1LQ1A 2DAOA 4K8FA 3DV8A 3WW1A 1RZ4A 4IF4A 1XCVA 1IF1A 4M9ZA 4M6YA 4O5VA 3CO6C 4XF1A 3QOPA 5DUKA 3FFQA 4XETA 5D5WB 3E3VA 2E9QA 2G7HA 3OGJA 4EJWA 4PIYA 2MA3A 1RGSA 1TBXA 4U0YA 4HW0A 3RZZA 2XAHA 1ON2A 3B73A 2M5WA 2Q0OA 2RNJA 1PM7A 4N9IA 5EFUA 3WE2A 3F8NA 1O3TA 2L3DA 1WRJA 1Z91A 4RGRA 1NE6A 2MBFA 4IJAA 1DGWA 3TOBA 5FPXA 2HR3A 4RD7A 5L3DA 4XLPF 4OLLA 2XROA 2DQRA 4HLYA 1L3LA 2HQRA 3LSTA 1GQHA 4YIFA 1SMYF 2P7VB 3WTZA 1SD6A 1NZCA 5E1RA 3WGIA 1YLLA 4HVOA 3GYHX 2RQPA 1W5SA 2FBIA 1KYWA 1I6XA 1YW7A 4HMZA 3F6OA 2XKOA 3ERED 1BI3A 4JBAA 3L00A 3HIFA 2L4AA 2PAEA 2GXGA 3DPTA 5A2QZ 4GO1A 2XAQA 3GEZA 3PQJA 1WA4A 4ENNA 1QXJA 2IXCA 5E17F 4ZH4F 2Q1ZB 2Y0MA 1D8JA 1SFNA 1DUXC 5E8IA 3D82A 2XAFA 3KP5A 2XL9A 3GUDA 4NB5A 4EGYA 2WC2A 4HF1A 4PGHA 2HDCA 1Z9CA 2STWA 1XGNA 4J1XA 1H9TA 4L18B 3E6MA 4KYWA 3J7AO 1TQIA 1BC8C 3DQVC 3W6KB 5ILUA 2ESNA 1IRFA 1RIOH 4CYDA 3G7DA 2XVCA 2EV0A 1XE8A 1BM9A 1Z7UA 1XB4A 1WSUA 2FQ3A 3D0JA 5ERIA 4KN7X 1UW8A 2E7WA 3WGHA 4UV8A 1YO5C 2HYGD 3ZMUA 2EA7A 4L0YB 1SFEA 2GWRA 3BALA 3SHFA 2E1CA 3EO6A 2Z33A 4IPAA 4OU0A 5L3CA 4A5MA 3LQRA 4ESBA 2MLKA 2B5HA 3S0MA 3HRSA 4OMYA 2EFOA 4Q47A 4LGWA 3I71A 2PQQA 2HJIA 4U88A 4IEZA 3H9AA 5HS7A 2W84A 1J3PA 3E6CC 5J8CA 4LD5A 3OTFA 4LLGF 2LNBA 2IPQX 3QACA 4Q5SF 4P96A 1O3SA 4IRGA 2H0VA 4ZU5A 1WI9A 5E20A 3TO6A 2RKHA 2TDXA 3Q5FA 2Y48A 4YIIA 4TV7A 3M7GA 3ZMZA 5HLGA 2V09A 2CSOA 4FAHA 5LRSA 2P6TA 1UB9A 3QPHA 1YFYA 1EH7A 3PNAA 3JW4A 4U0VA 1XN7A 4WBBA 3LA2A 4Z07A 2A6HF 2LF7A 3I54A 1GXPA 3EHKA 4JQFA 2D2WA 3LA3A 1K78A 2CW0F 1O3QA 4OIOF 2FBHA 4BHBA 4L2NA 4KT5C 3WW2A 2JT1A 3MCZA 4LK1F 2HGCA 1RTVA 1RNLA 1SMTA 2P5VA 2DO7A 3LAPA 2KRFA 1EY2A 3HOTA 2RDPA 2ZBKA 1ZVFA 4LB6B 2YX4A 2IVMA 3KETA 1BJAA 2OQRA 2V1XA 1Q43A 4XFHA 3K69A 2NYXA 1NXMA 1UHWA 1R00A 1R7JA 5ICCA 4KIFA 1JE8A 1HW5A 5D4RA 3ZMVA 1E17A 5JCTA 2UWMA 4I98B 1QBJA 3JAMK 3OF1A 5LLQA 3KLNA 4BH9A 5LRRA 1ZRRA 4EJVA 3ACLA 2HTSA 3HT1A 2EFWA 4XF0A 2XASA 2CQKA 4XRFA 1GHCA 2B0LA 2D5HA 4WZCA 3IBMA 2YSRA 5FLXK 4RAYA 4XBFA 4B09A 4ZYDA 1BI1A 4M74A 4O6JA 3ELNA 4KNYA 2ZXJA 1D8KA 4XFIA 2X4HA 2F5CA 1LJ9A 1MZBA 1LRHA 4LULA 3V8LA 2M30A 1GQGA 5F1RA 2DBBA 5HDKA 5LHHA 4S04A 3E5UA 3K2ZA 3CF6E 4I3PA 5FCCA 1T2KA 1IXSB 3ZDSA 1FI2A 5JFRA 4KICA 2FU4A 4CXFA 3WTXC 4E70A 1O5LA 1F1ZA 1ZG1A 5H6QA 3IRQA 1YTYA 1BC7C 1LNWA 1YUDA 4WXHA 2IXHA 4I09A 3GVAA 2BEOA 3T0YA 1HSTA 3L2CA 2XV4S 1CAVB 5FPZA 1S7AA 4CGZA 2IA0A 2OZJA 4LK0F 2J5PA 3TKYA 3R0AA 1UPIA 1FYMA 5CVUA 4KFCA 1LR5A 1FX7A 5ICGA 1STZA 3IKVA 1TNSA 3UKTA 2HYFA 2BV6A 2QDRA 4CDGA 5JR7B 4CZZA 3MZHA 1FXZA 1AOYA 1LDJA 3I0TA 1IN5A 4HLXA 1XDSA 1LVAA 2Z9OA 4EWAA 3J81K 5KHHA 3M1EA 3JSPA 3BPVA 2D93A 4AWXB 3HHHA 5BPXA 2PA7A 3O14A 3KCCA 3L9FA 4G94A 4BHCA 2G7UA 4HSLA 2OA4A 1JXSA 2WWYA 1ZH5A 2HOEA 1ZRFA 3EUHA 3J80Z 5DYMA 3SZPA 1I27A 4A12A 3FF5A 2XRNA 3RTRA 1IN8A 1ZREA 2DQLA 2QQ9A 3ECHA 1G3YA 2XL7A 3MPBA 2PTMA 2VXZA 5L3GA 2VT3A 1YW8A 2BNMA 2PHDA 5LGTA 5EZWA 1IUYA 2P5KA 1KQ9A 1R1VA 4AVAA 3F6VA 5ILVA 4G9YA 3K0LA 3BDDA 5I91A 1YFWA 1TQPA 4UXNA 1H1IA 3KP6A 4WVZA 3CDHA 4PCQA 1FYLA 5EEHA 2HQNA 2PBIA 4L9TA 4KU8A 3KGLA 4MQVA 1J58A 3T8RA 3MWMA 4HVQA 3P9CA 1YG2A 4WCGA 4B8XA 1Q1HA 3CJNA 4MGKE 3ML6A 5HOOA 4XF4A 1B6AA 1CAUA 2PEXA 3K1NA 2RN7A 1X82A 2DCTA 3KE2A 1ZLJA 4FT8A 1ZG3A 2ZFWA 3ZN1A 5FFXA 3NKTA 5J3UA 1DPRA 4BHPA 3SQNA 1SFUA 2VE9A 3RKWA 4I01A 2P7CB 2LKPA 4META 4EJUA 1YIOA 3KLOA 3JAMZ 5FD5A 1YW9A 1T6SA 4P9UA 2NAZA 3MYXA 2R7FA 4OIQF 2Z69A 3BB6A 1RC6A 3H1WA 2LDUA 4O9GA 4MH0E 3QRFF 4UVAA 4F7ZA 4BQAA 3HRUA 1YLFA 4RB1A 1W7PA 4RGXA 2HWVA 1F9NA 4MGYE 4L5JA 1XSVA 3H1YA 2OYZA 3I59B 2A3SA 4P5OA 4ESJA 4AVBA 4HX7A 1QXRA 1E2XA 1S3JA 2FBKA 3G73A 3J80K 4YNIA 3EBRA 1QZYA 2ATFA 4Q0QA 2Y75A 3RKXA 2A6EF 4HQEA 4Q29A 1FOKA 4KMFA 1SD5A 4WK8F 1IAWA 3H92A 3WU0A 1QY4A 3QP6A 4QM8A 1BN5A 2F5FA 3I59A 1J1LA 1KU2A 1U2WA 2RV8A 2CAVA 4ENKA 5TJJA 2MC3A 1ZRDA 4JTOA 3RYKA 1PP8F 4LG0B 3C7JA 4G6QA 4H7LA 1L3JA 4YG2F 3I4PA 2NRAC 2J5OA 1LB2A 2JPCA 4IXAA 1ZRCA 3CO2A 3SXWA 5CYVA 5HS9A 1I1SA 2QENA 5KHJA 2D45A 4X6RB 3V8JA 1BIBA 1MJBA 1FSEA 4AQ2A 2ET7A 5BQTA 1K79A 1ZZ6A 3VFZA 2W57A 4IEOA 1K78B 1PUEE 3E6DA 1JHHA 1CAXA 1U5TA 1X8EA 4YYOA 2XIGA 4HDUA 2O8QA 1FPQA 1Z05A 2ZCWA 4CO8A 1D5VA 2FOKA 3HOSA 2IRFG 3TQNA 4GULA 4IERA 4QLCU 1Q5OA 2DLLA 1O7LA 2DW4A 4HBLA 3TO9A 4HF0A 3HRTA 3BWGA 5BXXA 4JV4A 1ZZ7A 4N0BA 2QZ8A 4EROA 1F4KA 4LUKA 3SCFA 3ZP5A 2NS0A 4HA8A 4LLNA 4I0AA 2CO5A 1GXQA 1KU7A 4U7BA 1QGPA 2O0YA 2V6CA 4D7SA 2PAKA 4XEZA 2EA4A 3LZZA 1RL3A 3BOQA 1EV7A 4XSXF 4ENMA 3CUQC 4HQMA 1S7OA 2FRHA 4EGZA 5H6RA 3KP7A 1OYWA 1Z6RA 1SEFA 2OBPA 2PI0A 2MH9A 3WTWC 2VC1A 1SAXA 4UHTA 2YR2A 1FWZA 3GXOA 1JHFA 3T1BA 4IRIA 3GFLA 4Q0UA 4HBNA 5FDBA 3LWCA 5KHGA 5E1ZB 1T0FA 3MFKA 3PLQA 3HTUA 2FEZA 5C6CA 4S05A 1UHMA 1X8MA 1P2FA 1QZZA 3P9KA 2Q30A 3TDUC 3GFJA 1FLIA 3O6BB 2QCSB 1X3UA 1FY7A 3QAHA 1FBSA 4YFXF 4BAYA 1MDMB 3ZMSA 4MGRA 4RAZA 1R23A 2ISZA 1V3FA 2D5FA 4XLNF 4IHSA 2CWEA 3HRMA 3SZTA 2PFBA 4UVBA 4MTEA 1UD1A 5CJ9A 4EJOA 4QGNA 2A69F 1BI2A 2LF8A 3F22A 1WKMA 1H0MA 4FX0A 3FZ3A 1YS7A 4JTNA 5BS6A 2H6CA 4EM1A 3M3IA 4E2GA 5HDGA 5DUIA 3OOPA 3IIAA 1SD7A 2VE8A 2ADUA 2GIVA 1IPJA 1SQ4A 1TQ5A 2MH2A 2VBZA 3U1DA 1K6OA 4ZZLA 2RC4A 4IEPA 3M70A 4R1HA 3L09A 4IEYA 1W5TA 4IEXA 2EK5A 3FHIB 2IXLA 2D1HA 3K1MA 2MPFA 3WTTC 4A5NA 3RIRA 4LB5A 2K0GA 2O8XA 4YSFA 4IEQA 4P55A 1BOAA 4AXOA 1DZTA 1XMAA 4LLOA 2HEOA 2BYVE 2DU9A 4HSJA 2DT5A 4FBFA 3R60A 5JR3A 1G3TA 4UNOA 5J6XA 1B9NA 2ESHA 1SFXA 3D5LA 5D8LB 3WTUC 3DP7A 3SCHA 1CGPA 2MD5A 3AAFA 2ZO4A 4BYYA 4EV0A 4N9HA 1B1BA 2Z3YA 1QQIA 1P4WA 2IW5A 4Q0VA 4Z2YA 1B59A 2XUBA 5K5QA 3WODF 2VBYA 3ROUA 5E16A 4WWCA 3BPXA 1KU3A 3JTHA 5F64A 3QP5A 4G7HF 3T8TA 4K2EA 2KJCA 4MQ9F 2GC2A 5FLIA 1YS6A 5IT9K 3HUGA 1OFNA 1ZZ8A 5HVQC 1O5UA 6PAXA 2OQGA 2L02A 1XE7A 1VP6A 2G9WA 1ZAOA 2ISYA 4KU7A 3DF8A 5ED4A 3JZVA 4LTAA 1T38A 3NSTA 1UCRA 3D0SA 4YFNF 1IN6A 4U0WA 1OPCA 2P6SA 5CVVA 3SHRA 1HKQA 2H6BA 4J1WA 5J7MA 2EV5A 3JTGA 5HS8A 4BNCA 1NE4A 4JK1X 3NEUA 4GXOA 1KYZA 3ECOA 4CICA 3F21A 2GC0A 5JSOA 2BNOA 1HKSA 4Y15A 5AIPA 4RS8A 2QYOA 5T3NA 2CG4A 4ZYHA 4KDPA 4A0XA 1WLTA 2XGXA 4PIXA 3GZ6A 1U12A 3EYIA 3C1DA 2R3SA 4LG0A 1XSXA 3VHRA 3BZ6A 1MKMA 5LHGA 4FAGA 2IA1A 4KWKA 3ISPA 1R1UA 2EJRA 3MAJA 2F2EA 2UYBA 1EYBA 3WW3A 4BXUA 4HV6A 2IC1A 1MD0A 1QPMA 2H27A 4WX9A 4L0ZB 2UXXA 1QNTA 5I0SA 3B02A 1Z6TA 1IN7A 2KIMA 2DPUA 4KA4A 2V1DA 2QJVA 1RUOA 2ZNYA 1IZ1A 1U5TB 2UY8A 4A0ZA 3IWFA 4U7DA 4E2QA 2ACJA 2PG4A 2VPVA 5L3FA 1NYWA 2C0ZA 3BPZA 3NQOA 1P6RA 4G8XA 4XFAA 3CUQB 2KIUA 1Y0UA 1IW7F 3VEPA 5KVRA 3GO5A 4HYEA 3SFZA 1ZX5A 2FMLA 2A61A 2YX7A 5KHIA 2UYAA 3FXQA 2QVOA 4G6DA 3U11A 5FQ0A 2KKOA 3WTSC 1OI6A 2GZWA 1ODDA 3F23A 4MGIE 4OINF 5FD6A 2HZTA 5I93A 4AIHA 4XFFA
chains in the Genus database with same CATH superfamily
1RUI2 3W20A 5FBJA 5LA1A 2Y26A 1PP7U 1OQYA 3EUHC 4Y22B 2L9SA 2A68F 1COV3 2LROA 2XHKA 1XD7A 2E6VA 1TTYA 1LU2A 1G6NA 3A0KA 3ZQ7A 2ORXA 1OA4A 1AJOA 2CUEA 3UK9A 2X6YA 1IJWC 3C3VA 3V0AB 1VNDA 4HT1T 3BYWA 4HOBA 1RUI3 3COAC 3OS2A 1TE1B 3Q9SA 2QKDA 2Y6KA 1OCRH 3MUZ1 1CX1A 3BU7A 1LENA 3K4ZA 4F8AA 4XNFA 4DUWA 4IHVA 1XNBA 5BUVA 1M4WA 4BY1J 3MV11 4G9SB 1UFMA 1A8DA 1T2XA 1U0AA 4TLGA 2FMYA 5BV6A 5TSWA 2BBYA 2K4JA 3DFGA 3GTPJ 3UKNA 1NLSA 5D1IA 4KL1A 2WZR1 2H09A 3TOAA 4CXYA 4EMSA 3I4MJ 1ZZ9A 1WGPA 3S6PA 2W87A 1V4RA 2JUCA 2F4IA 4XMAA 1W9YA 3UGHA 1B9MA 5F2SA 2WY8Q 4TTGA 4Y5Z0 3RQIA 3O5SA 4LBOA 5EG0B 3HSEA 1XGSA 3E7LA 5CLSA 4BQ5A 2STTA 2W1OA 2JDZA 2WV0A 2QEXI 4CP9B 3OYMA 3HWJA 1K5MB 1UOFA 4RGAA 3CDZB 5C8WA 4AG4A 4S2DA 1X2MA 4L9VA 5BNPA 3P9IA 1C0WA 5M3FJ 4XBNA 3PJQA 1US3A 2HOAA 4CHUA 3CJIC 1EH8A 2JSPA 1GZWA 5FWJA 2XB5A 2R071 3POYA 4GB33 5EPAA 1H8TC 1IRGA 1UOBA 2VCCA 1SANA 3WZ1A 2L0KA 4CDXC 4GYIA 5FPUA 5FMBA 2BJSA 1YFUA 2BWCA 2WB1A 1FTTA 5FAXA 5M5YJ 1XPXA 3KWVA 5FUNA 2R7DA 2OCEA 3GCWA 4IGOA 1H4GA 4MHRA 5L9BA 3CCQI 3I5UA 1KFUL 5T54A 4RM3A 3RI4A 4OI4A 4LBLA 1CIWA 1UMHA 2W1QA 1LPQA 2VNRA 3TBIA 2GN3A 1CJDA 3KM5A 2EIGA 2YFZA 4XTMA 3U10A 4I30A 4I6ZA 2ZGOA 4JDMA 4RLQA 1K83J 4A6EA 3RZKA 3MI8A 2DMTA 3MDPA 4YVSC 2IFWA 3K2OA 1DDNA 4NRPA 1S7EA 5CVRA 2IGMA 1XB9A 4NRQA 3A1YA 4IHXA 2LKSA 1A6QA 1F15A 1ND3A 5JSPA 4WM8C 1TW3A 4LIUA 4QWQA 3OYFA 3WG7H 2QQ8A 4J01A 4BEHA 1SFPA 4ONUA 2AXLA 2DK8A 4ZZDA 4OWRB 3QPSA 2ZMEC 3KP4A 4AVSA 2OC6A 3POSA 1J7KA 4RAFA 2ZKNA 2IT0A 1HW1A 4HF2A 1G2HA 3AJYA 3OBRA 2F6CA 4RS5A 3MICA 2WN2A 2IJLA 3WU1B 2G9ZA 3QPLA 1R1A2 1MH3A 2VOWA 1FPN2 4HN1A 4BB3A 4Q8LA 1BIAA 3O0WA 4QX5A 3LSIA 2Y0SA 1YHQI 2VN2A 3KEQA 3WGGA 2KZVA 3WXPA 1G9DA 3LAGA 4Z82A 4E7HA 4AQTA 4WZFA 5CNAA 1GICA 3HJRA 2EAAA 2ZX3A 4PBPA 3RDIA 1FC3A 1TG7A 2A5YB 2WNUA 2DCKA 2CHHA 3ZPLA 2L7FP 2Y9ZA 1M06G 2VE1A 3LOCA 2GU9A 5IATA 5F0HA 3CJRB 4DQ2A 3QU6A 1O3RA 3CQOA 2Y2ZA 3KB5A 3TL4X 4A3MJ 3S1NJ 1JYIA 1DQUA 2ADEA 3LWFA 2CYYA 2HBTA 1WPKA 1UU6A 2JICA 5DCMA 3LSKA 3MKWB 1CZTA 1E5IA 4L5IA 3T5XA 3HYIA 4FFIA 3VD4A 2BU9A 2K7LA 4LEJA 2OPKA 1H2LA 1UKRA 2GA1A 2MNGA 4EVIA 2KXLA 2YFUA 3S93A 1PVEA 3ZXKA 1ND2B 4A4AA 3RQ0A 2RM22 4UYBA 2HWD1 3H3ZA 5L3BA 3Q9VA 5C9AA 1VBC2 2WS92 2ZAAA 4C90A 4ZYAA 2XLFA 4DS0A 2W46A 5C5UA 3ILFA 1QJY3 1OYIA 4PI2A 1RUE2 5LASA 1LFBA 4D7TA 2DMQA 2QUOA 1M1EB 1GQPA 1WJFA 3DXTA 3CLQA 1H9GA 2BVBA 2JA6J 2OZUA 4J00A 4XHBA 2PHLA 3BKZA 5KWRA 1RUH2 5FYHA 4CUAA 1RUNA 3ELKA 2VMIA 5IP9J 2PMUA 2VBBA 1T0FC 1XCBA 4BGDA 4QDSA 2XBO3 3E1SA 4AHXA 2EPFA 3POWA 3CUQA 2W24A 4PJJA 5FZ6A 4PQQA 4QU2A 4AVCA 4NAMA 3ZQQA 2DI3A 3KPHA 1PZ9A 4JC1A 3BN6A 4FPJA 2Z99A 2ENRA 1LULA 4LKEA 4DOUA 2O6GE 3RSNA 1HQNA 5C4XJ 4A45A 3K9TA 3ZGKA 4RBOA 3EQEA 4FVVA 4OIRF 1MIJA 3FMRA 1H88C 4XJAA 2C6SA 2JDHA 5J47A 2WT2A 2PN5A 4ZZ8A 4HLTA 1HN0A 2KL4A 3U1XA 1J9IA 1MS4A 4CPBA 1BYHA 4UBGA 5L36A 3H8UA 4RR3B 4XIDA 1YCIA 4CU7A 4AHYA 2QUFA 3JSOA 1IRXA 2EILH 4H55A 3HAGA 3ST7A 5KXDA 1YQ6A 2LG4A 5F0CA 1R71A 3T1MA 4L9JA 1WWXA 4I99C 5FRNA 4LBQB 4II2A 2KISA 3DBRB 3P1IA 1R1ZA 1Z1DA 2W25A 2XRLA 3BY6A 3SMHA 4BJTA 4DUVA 1IPKA 5FYBA 3AMQA 5FMCA 5FXWA 4O61A 2Z79A 5C33A 2WT1A 1YIPA 2BW3A 1OKRA 2QNKA 3HEFA 2XJQA 1WCMJ 1XOYA 2RJLA 2CJJA 4B43A 2WABA 4AQSA 2MLGA 5IFTA 3CO7C 3ES1A 4EN6B 3D5SC 3L2HA 1S0DA 3ZX7A 1B8IA 1WLDA 5EYRA 2V1UA 4MNUA 1G3SA 3F8BA 1OQ1A 3THCA 3AYEA 1MS8A 1VBD2 5A6ZA 2VJ5A 3VN4A 1U9NA 5KBFA 2WIIB 4P9FA 1R5HA 2LM3A 3ES4A 4PFOA 4AVVA 4CDWA 4G7OF 4QMAA 2O3FA 1W1WE 3WSOA 4IV1C 5D5XB 4EYUA 3TDZC 1V6JA 3AKSA 5CADA 2JPBA 4HPKB 4LHKA 2P4WA 3WW4A 4MYEA 4AHWA 2BXYA 4C91A 2C6YA 2P8TA 3QYEA 1Y39A 1WWYA 2YBPA 2GMMA 5CB7A 1K45A 2JTVA 2EFPA 1X33A 4YVSB 2FDKA 4PZJA 3IL2A 3KT4A 1RUI1 5JOYA 5LEKA 2EV6A 3H3UA 3ZYJB 4HKOA 4LE3A 4HEA2 2WWSA 4R52A 5H2FC 3QQAA 1OOPC 1JTZX 4CYCB 3V0AA 2HWB3 2QQMA 1O6UA 1UZCA 4XORA 3POGA 5LEJA 2DYSH 4JRLA 4FFGA 5FWEA 2HQAA 2BY2A 2WL1A 2ZEXA 5IK7A 4RQPB 5AVPA 3VYTB 5DDGA 4GB31 4AVZA 2YDEA 4NMIA 4LUMA 1IG3A 3FN9A 3QWLA 4WM7A 1Y9QA 4E4DX 3A4CA 4MXWB 2R0FA 3DKWA 1CAWA 3ETQA 3O1VA 1FOD3 4TXWA 1HSJA 3LSRA 3ON7A 5B3SH 2W5FA 4OMCA 1LCLA 1K5MC 1SPPB 5D4SA 2E1NA 1USTA 4GCVA 3ACHA 3OGSA 3Q9OA 1TWCJ 1YHFA 3A2KA 2A5ZA 3NJZA 5FTTC 1BCXA 1ULYA 5C8CB 3F8MA 1BW5A 5BNPC 1TME2 4LKSA 2L9NA 1PZ7A 1X58A 3KZZA 1NQDA 2ETEA 3OJBA 5FB2A 4CCOA 4LKDA 5C3SA 3AMHA 2N7GA 4ZYGA 1NK2P 2JWTA 3BTXA 1WJBA 1QRYA 1D1CA 1AR93 3TOJA 4IW3A 2VECA 3A4UA 5JVTA 1LGCA 2YU3A 4RGSA 4BCUA 3IC7A 2OTJI 3AM2A 1I3QJ 3UGFA 5TISC 1X3WB 3KGZA 3WE3A 3W21A 1OOPB 2W47A 1OLME 3WTYC 1F35A 3ABTA 2ELKA 3VKLA 4A3ZA 5FXVA 3IDCB 3FZVA 4AFBA 1DF0A 1YRZA 2ZAHA 2R1DA 5JXIA 2DFEA 1DU3D 4KIGA 3DPLC 2GH2A 1KS5A 1EV12 3IH3A 2AREA 4D0PA 2OW4A 2WLQA 3ZYIB 1S2KA 1TMF3 1ENXA 1REFA 4B44A 3CP8A 1DQ5A 1W6QB 4PHZA 1AJKA 1ONVA 1T33A 5AC93 3D3AA 4QPGA 1GLHA 2XXZA 4Q0PA 4Q48A 5JMCA 4N53C 1ULFA 5EYXA 4UUVA 1X7NA 3AP9A 1E3HA 1VQ5I 1GMMA 3WHTA 1IF1A 4M9ZA 2P0WA 4G12A 5FFOC 2MA3A 1RGSA 4JGZA 3BR6A 2HWC1 1ON2A 4YW4A 3T0AA 3FC0A 2Q0OA 1Y1WJ 4NIDA 3H0DA 1PM7A 4N9IA 1ERDA 2DFBA 2RE9A 1QA6A 1O3TA 1WRJA 4RGRA 1NE6A 1C3HA 2ECCA 2Y6GA 2RS32 2ZX4A 4IOCF 5J1YA 4X1EA 3IKWA 2E34A 1Y43B 3JRHA 2VUCA 5E88A 2W52A 2B9VA 4LG3A 1L3LA 1MNMC 1POQA 5FLMJ 2RHPA 3OY8A 2VUDA 1SMYF 2P7VB 2M3AA 2VC9A 1SD6A 4XBLA 4GDFA 2BWAA 2VQGA 3ME2A 1W5SA 2FBIA 2RJ2A 4HMZA 2WNEA 2RS52 4RLFA 3OY9A 5C44J 1W0OA 4BBSJ 3BI3A 3HIFA 1LNSA 2PAEA 5DZFA 2OX0A 2IGOA 4NIAA 2EXJA 2Y8KA 3K4LA 1WA4A 3G4SI 4ENNA 2LTNA 3WP3A 2IXCA 3LSJA 2L9VA 1EKEA 2EXKA 5FZ3A 3D82A 3LEMA 3VDAA 3LPFA 1RHI3 2WSVA 2ELJA 1YE9A 3MD2A 5J1XA 3FK6A 4JAAA 5BYNA 1XC5A 3GLLA 1YIJI 5ILUA 2ZPXA 4AWDA 5FUPA 3EYPA 1EPWA 4R9AA 3G7DA 4FP2A 3H9GA 1BM9A 4Y20A 2D6MA 1H8AC 4MO7A 3MVPA 1JKRC 2JDKA 5ERIA 2E7WA 4D8MA 2RMU1 4UV8A 5A3TA 5F3IA 4BL0B 3ZMUA 2BERA 3CJTB 3ZYGA 3K48A 4IPAA 2V9PA 5F9TA 2MD0A 3T2TA 4BJ0A 2VW0A 4Q47A 3ABZA 4QHZA 2PQQA 2CRGA 1W5CC 4U88A 4YG6A 1W36D 4NPMA 5KXEA 2RDNA 5HS7A 4Y1YA 4NC7A 1BVVA 2D43A 1J3PA 1NCQA 1U5IA 4LD5A 4FQ4A 3VDDB 2GH8A 2ZHNA 2YG0A 5FYZA 1APLC 4Q5SF 1O3SA 4IRGA 2H0VA 1HC8A 4ZU5A 1WI9A 3AVRA 2GNDA 1MBKA 4L97A 3HPGA 2AGSA 4BQXA 4YZ5A 2IXSA 3M7GA 4XURA 3Q0UA 4KT6A 1YI7A 4F93B 5LBFA 4YLZA 2W48A 5A3LA 5FYVA 4U0VA 2VG9A 1XN7A 3LA2A 4R4XA 2HWC3 1GXPA 5EWSA 1HF0A 1K78A 2CW0F 4OIOF 1A78A 3DYPA 4XLFA 1WGXA 2FBHA 4I76A 4KT5C 1AR92 4LK1F 2HGCA 2WNUB 1RNLA 3KZ4C 3HC7A 1L7QA 2KRFA 1OFCX 1S4CA 4IXLA 2XONA 1ZVFA 1U0JA 4LB6B 2QBXA 2IVMA 3KETA 2YBSA 1HX6A 1MMAA 2BOJA 5GAEJ 2NYXA 3OUIA 1HRV1 3PDQA 5FK7A 3BZKA 1R00A 1CZSA 3KZIC 1AYN1 4LBNA 1HW5A 5D4RA 3ZMVA 3JRAA 4RSUA 4MLOA 5JCTA 2E26A 4Y52J 1BW6A 1OH4A 3S30A 5LATA 1XU2A 5D21A 5LRRA 2WFF3 4EJVA 2HTSA 3FUQA 2H8RA 4XF0A 1TWHJ 3THDA 1X2NA 2CQKA 3PIPF 4S0HB 4XRFA 3DU6A 2B0LA 2D5HA 4WZCA 3ABMH 5FO9B 1BI1A 3NV3A 4AEKA 1AHDP 4Q4Y3 3WG3A 4XCAA 2IAIA 1AYN2 1D8KA 1JZ5A 4XFIA 3V65A 2DMUA 1LRHA 4QXHA 4S04A 4MGQA 1PVC2 1SACA 4I3PA 3JD72 5FCCA 1T2KA 3ZDSA 1FI2A 5JFRA 4KICA 2FU4A 2J42A 3WTXC 2Q5TA 5CKMA 3VHPA 5K7HA 4F3QA 3L2UA 2YS9A 3CCUI 3LPGA 5DMYA 5M5XJ 1OKOA 3NJXA 4UFJA 5IVBA 1D0XA 3FXMA 4WXHA 3GVAA 1QJY1 2QQNA 3L2CA 4XQWA 5IVJA 1BEV2 5IVVA 4A7KA 2FDFA 3HQUA 4IX7A 1CZVA 1DU0A 2GIZA 1JZ4A 2IA0A 1PX4A 3TKYA 4WVMB 3VLBB 1AL0G 3R0AA 1KQRA 1UPIA 1LR5A 3IKVA 4CPBD 2HYFA 1OUSA 2JRMA 3I2KA 2K40A 2QDRA 3R4DB 4NAOA 1H8TA 2XJPA 1FXZA 1E0EA 3I0TA 1IN5A 1XDSA 1VQ4I 4HANA 3AZVA 3J81K 1XQNA 4FE4A 4BBRJ 1PHMA 3OYWA 1HA8A 4JHTA 5FMOL 4MFEA 4W6XA 1UNBA 4JCKA 5D2AA 3KCCA 2Y69H 1TZOA 3OBAA 3T1LA 4D6QA 2XG3A 3G6EI 2X1EA 5FOJB 4I3GA 2DQLA 1ZREA 1G3YA 2EZIA 2MW8A 2PTMA 2VT3A 2TEPA 2BNMA 3J26N 5LGTA 3TP0A 5K7ZA 3M8LA 5EZWA 2LRDA 2P5KA 4XK4A 5GPCA 1VMJA 3LD8A 3N35A 5GLZA 3EXUA 4G9YA 5I91A 1Z7S3 2HWD3 3C2GA 2VGDA 4WVZA 3CDHA 1ETQA 3G1MA 2ZXQA 1PZ8A 1VALA 2PBIA 1QOTA 4KQ7A 4KU8A 1Q1HA 3ML6A 3JD73 1DGWX 4HONA 2RN7A 1X82A 4Q4X2 2DCTA 2PHWA 2VLAA 5EJZB 2ZFWA 1ULEA 5FFXA 5HCHA 4PDWC 5D8AB 1OCOH 2CGNA 3SQNA 2O7OA 5CAZA 4DW6A 3RKWA 2VE9A 2VMCA 2WLPA 2BBVA 2LKPA 4E9KA 2V5DA 5BNGA 4JKKA 3N05A 2X10A 5A33A 5FD5A 2PMWB 1DLLA 4CSWA 4P9UA 4OIQF 4QPWA 3H9QA 3BB6A 2GNBA 1RC6A 3HDDA 1GR3A 3QRFF 5FY9A 4XHXA 2KRCA 4UVAA 2CFOA 2LK2A 4Q4V3 1FIPA 1MSFC 3TAYA 1VLNA 3ZFEB 3H1YA 4D7NA 2EIJH 5A3UA 4AVBA 1E2XA 1S3JA 5DDJ1 3VZKA 3VBFA 1V54H 4P08A 5A7QA 2QE3A 3JRBA 2RJKA 1BR4A 4ZTFA 4ET7A 1CQ9A 4NHMA 4HQEA 1RUD3 1NT0A 1TT0A 2WBKA 2TBVA 5FZ8A 1IAWA 5FYSA 4BXSV 2MFZA 3WU0A 4PFPA 4A69C 5A1LA 3Q8EA 1IS6A 5CA6A 2XQXA 1J1LA 3RPUD 4V2FA 2V4VA 2YU2A 5TJJA 2MC3A 1ZRDA 1PO23 5JHFA 4JTOA 3U14A 3WD5A 2GOXB 4FPHA 3N7JA 5FZAA 5FBZA 1JZ6A 2VMDA 2R063 1LB2A 3KQ4B 4XQDA 1ULGA 2DA7A 3OOUA 1OCCH 2HDWA 1EAH1 2HXOA 4QQ2A 5HS9A 2QENA 5F5AA 4IUGA 2VL8A 4DOZA 3TRSB 1OOPA 4AQ2A 1JTXA 5BQTA 3PUQA 4CCNA 3VFZA 2W57A 4IEOA 3FMGA 3PUFA 1PUEE 1HCRA 4AE2A 1U5TA 1VFCA 4DQAA 2DCJA 3WHBA 3MW2A 1Z67A 1Z05A 1MZ5A 4DYCA 3S2DJ 4NROA 4Y22A 1MEC2 4QLCU 1BJQA 1O7LA 2DW4A 3E1F1 5F6LB 4HF0A 4MXVA 3HRTA 1ZZ7A 4N0BA 2QZ8A 2ARAA 2JE7A 1H9PA 2ARXA 1YI2I 3USUB 4I0AA 2CO5A 2JKXA 1IPSA 2ID3A 3ZQLA 4CU8A 1MZFA 3P5JA 2GNMA 4D6SA 4D7SA 3LZZA 4FI9A 1W9SA 1YX5A 1EV7A 4XSXF 2ZEZA 2DMNA 3ASOH 5H6RA 1OYWA 2FCTA 2W91A 1Z6RA 1K5JA 3M3CA 1S72I 3WTWC 2VC1A 3DPRA 1R092 1UPSA 5J98B 3VKFC 2DFFA 1ASJ2 1K61A 1PX3A 3LWCA 3OS0A 4AI3A 4Q1RA 3PLQA 1Y9MA 4S05A 1N1YA 2BY1A 1LJ7A 1P2FA 5GLUA 4XR6A 4CH7A 5HCFA 3JBG1 3AMNA 2GP3A 2QCSB 4D94A 1JN2P 4QX0A 2Q2EB 1ETKA 1SPPA 1UU4A 3ZMSA 2W9XA 2J1AA 4RAZA 1R23A 3WQBA 3MF6A 1RHI1 4AAXA 1J1TA 4OULA 4XBQA 2ZX1A 2CWEA 1DP0A 1JOJA 5CJ9A 4EJOA 1RMU1 1B72A 1DYKA 2XPWA 1WKMA 1IGNA 1B09A 4JTNA 4E2GA 1JKOC 4URTA 2ZB9A 2ADUA 1XNKA 3Q8AA 1OQEA 1JYTA 2HYKA 3LDKA 1K6OA 2JDAA 3WQ1A 2E53A 4R1HA 3CCVI 1Z3XA 1YJ9I 4UI9L 1RITA 1RVF1 2EK5A 1X19A 1OT5A 1W6PA 5FP3A 2IXLA 1ETOA 1IDYA 2AZ5A 1T6GC 5EDNA 3GDBA 4XQFA 3FBYA 4RHV3 4V19K 4RHV2 1BOAA 2KRHA 2VUMJ 2JDUA 4D1QA 1LECA 1DZTA 2DU9A 4HXCA 2DOAA 2ZTNA 5JR3A 1YRNB 1VMFA 4K1YA 3B6CA 1OLMA 3WNLA 2K46A 1ZK8A 4XMYA 3J7ZI 4E7ZA 1ZA4A 4BQ4A 3ZPOA 1A6CA 3NAPA 3D5LA 1V9U1 3PURA 3DP7A 4EN7B 2JMWA 4QKNA 3AAFA 4PF5A 4ARXA 2QKLB 4F52A 4N9HA 5A1AA 5I0DA 4AFCA 2XUBA 5K5QA 4PJNA 2VCAA 3CF5F 1QJZA 2YC2A 4WWCA 3U1KA 2X8KA 3BOPA 4QHBA 4G7HF 4HSRA 3LMMA 3QOEA 5FLIA 3KLSA 4BISA 1W03A 3W9AA 3BGAA 5BNOC 5IT9K 2F5VA 1ZZ8A 2FDIA 1G8WA 3NARA 1Z7S2 4MGSA 3C7OA 1ZAOA 4Z1VA 1QDCA 4KU7A 4A3GJ 3L2VA 1HV1A 2D6KA 4DRRA 4C2UA 1QEXA 1NTCA 1T38A 4CXWA 3U4XA 5LA2A 5F1JA 4IQ4A 1OPCA 4U0WA 4ZY9A 3SHRA 5J7MA 3VHOA 1V6NA 1GANA 3M3QA 3VDBA 5IWFA 3L2RA 4BNCA 1W04A 3NEUA 3KT1A 3ECOA 5F5QA 5EZHA 1HKSA 5AIPA 2NM1A 1RJ8A 4CYCA 3RZDJ 5T3NA 4DJAA 2UUZA 2CG4A 3TP3A 4ZYHA 4E4SA 1AXKA 2ES3A 4A0XA 1OPOA 2XGXA 2BHYA 3GZ6A 2EIDA 1U12A 3EYIA 1XU1A 2IA1A 4KWKA 3MF9A 3SH4A 2Y31A 3N7LA 5GP9A 1R1UA 4HK9A 4XW3A 2EJRA 4AI2A 4Q5OA 4WM7B 2DURA 1S0FA 2UYBA 3H8RA 4BXUA 4HV6A 1OD3A 1MD0A 2WZR3 4C0HA 1AYM1 3B02A 4AR2A 1Z6TA 5CFDB 1UL9A 2BBAA 3ZMOA 2E33A 1U5TB 3H3VK 3BPZA 2WY7Q 1P6RA 1QIQA 3RGBA 5FZDA 2CY6A 4CCJA 2VVDA 3O0XA 5IAVA 2DCZA 3SFZA 3FIWA 3ACIA 3WQ0A 3AYCA 5KHIA 3N7MA 3MKYB 4SBVA 3OBTA 2VXRA 5FQ0A 2E1MC 3J7AY 1ODDA 3RZLA 4MGIE 1LOGA 4OINF 2HZTA 3K10A 2A1XA 5H20A 3DLAA 5AVAA 5AONA 4NWWA 1XYPA 5IP6A 4PSWA 4PJ0C 3MW3A 4C0BA 3VSLA 1HXS3 3BP8A 2DFIA 4K6BA 4LA3A 4EN0A 2EQRA 5BNNB 1U3EM 1HKTA 4UT5A 1W39A 2AHQA 1ZM1A 2JB4A 5FZLA 4FPYA 4EZ4A 3ZXGA 1S29A 2XUMA 3DN7A 4L99A 1W7PD 2L9RA 3I3MA 2JSCA 4HNTA 3FWEA 3IDBB 2D40A 4E7IA 5JZGA 4A44A 4I0BA 5F0FA 4PIZA 4AFDA 2XB6C 4N43A 1JZ3A 2OT7A 3HSFA 5C70A 5A7SA 1VQ7I 2QM3A 5KAIC 4TLFA 1LDDA 3VYRB 1OBNA 1QO0D 1PGW2 3KCYA 1I39A 1J0RA 3SLIA 4BKXA 2P17A 2IXJA 3HT2A 2MEV1 1GZTA 3LFMA 4MHGA 2D1VA 2C26A 1LAJA 2EVXA 1VBA3 2RS13 2YY1A 5DDJ3 4YIRX 3R4KA 5LW9A 1PUFA 2VL4A 3ZQFA 3IMMA 5HPOA 2F4PA 3RZMA 1SVMA 1VE0A 3MQ0A 1BR2A 3SNMA 2Y30A 2E35A 2Q8DA 1W3VA 4QIWN 2DT6A 2VOOA 2VQUA 5GZEA 2HNHA 1YC61 4QM9A 4M72A 2Y0IA 3WTVC 3I2IA 4ATFA 4O65A 3DWLE 1N1SA 2F5EA 4HNVA 2OTLI 5CU1A 4IZZA 5FY1A 4QX1A 3O1UA 4E4HA 3H0GJ 2O14A 2AXTC 2LUWA 4AVPA 3GX4X 1U8BA 2W4SA 5I8TA 3V7SA 3U9GA 5IT6A 2D7FA 1U78A 1T08B 5LFAA 3VZLA 3N3HA 3I58A 4JGYA 3LOBA 4DY5A 2ZACA 2HFHA 1F4HA 3QH6A 1FNNA 1W0NA 4UVCA 4HK8A 2CAUA 3J8F3 2JVHA 2K86A 1IV8A 2CV6A 5FJHA 4B47A 1QZEA 1N78A 3VD7A 2DYCA 3AYDA 4WM8A 4P9XA 4Z2WA 2I2SA 1J3RA 2EFQA 4L0PA 3ZR5A 3HPHA 3SYTA 3GCXA 4QGMA 2KJBA 1AR82 3SDBA 2QLZA 2OA2A 2V26A 1UJ8A 3FM5A 2Q8CA 5ABJB 2R7RA 3IHUA 3IAPA 4U36A 3A7QA 1RUE1 3M8JA 1ORKA 4CEWA 1V70A 1CONA 5GPAA 1XSDA 1ZZBA 3ZFEC 1DP3A 3W6JB 1OH3A 3VBUC 1UYZA 4JRAA 1VJ2A 2YB7A 2IEKA 3K4AA 4Q4X1 5KR7A 2XBO1 2PJPA 3OWTA 5E18F 4NUBA 3ZMDA 4XRMA 2OF7A 3T0BA 4HV5A 2COBA 1XMKA 2WINB 4EM0B 1WQ2A 2Q2EA 4E2SA 2XR4A 2DTRA 1LHVA 4RA0A 4M0HA 3UKVA 2YUEA 2VODA 1XNTA 3ZMTA 4QQOA 5C3RA 1AX0A 4MEXF 1MMSA 3SXYA 5C71A 2NN8A 3H3LA 3IV5A 4YPJA 4H0EA 1E3PA 1LKNA 4GMP3 3J4UH 2DFHA 2VNVA 5EZGA 4KN4X 4M9XA 1R5GA 4ZYEA 5K7FA 3PFIA 2IZWA 1IG0A 2LMDA 4PDKA 1VQNI 4LORA 2VAUA 2VT2A 2WFPA 2VD7A 3BC8A 2QQBA 5IYBJ 4Q4W1 1GKBA 2BZDA 2GDFA 3IAQA 2HZDA 1LE8A 1JGGA 2K9SA 4S2GA 5KHKA 2MYSA 4AC0A 1UIJA 1DPUA 5FRAA 4DNCA 1S0CA 1H4HA 3F8CA 5LA9A 3S3OA 4M73A 4DYQA 3L7WA 4E7LA 3AL6A 3JRGA 5ICEA 1UOJA 5F27A 2IP2A 2LTPA 1GV9A 5E1WA 4YFKF 2FCVA 4XQ4A 1PO22 2ZNZA 1ZARA 3LOIA 3Q8BA 4DZGA 1ODNA 3DBLB 4IGPA 4XUTA 2HVQA 3TGNA 4GFBA 4B7KA 3JBG3 1HQCA 2E19A 1W2UA 1Y56A 2WNVA 2YU9J 3DBHB 5FY0A 1LGNA 3MEPA 3AG2H 5C3EJ 1OLRA 2XJTA 4JDNA 3POFA 5IVCA 1WVRA 2R16A 1I5ZA 1FBUA 4K9SA 1CR7A 3BIWE 4YARA 1RUG2 1I1EA 3PIOF 2Q8OA 1MQTB 3KP3A 5DD8A 2K2SA 4RYDA 2E32A 5FKOA 2BGCA 2QQPA 2IA2A 1JUSA 4IEWA 1O4TA 1MEC3 4PGGA 4N43B 3LQQA 2HWF2 1IHMA 3MLLA 4N7IA 5BNNC 1HW2A 1JYCA 1A04A 4NWVA 5A80A 2M1BA 2WB1N 1S9HA 4HKLA 1QH7A 4HVRA 1ZR4A 2CDOA 2XJRA 4H3WA 2RQQA 2XSDC 2JEMA 3E97A 1SD4A 4QPGB 1SC7A 3Q0VA 5JAXA 1NK3P 4KISA 1WW7A 4AM3A 1LEAA 5L9RA 1VIWB 3ZN6A 3LDBA 3MZYA 2I45A 1GVJA 3OIOA 4J19A 1D0HA 5JI6A 4KWJA 1MJ9A 3W2AA 3RS6A 3NO8A 1DGRM 4A3DJ 4UW5A 3O8GA 2XJSA 4JGZB 1FOYA 1FX5A 1BMV2 3HNMA 4HOOA 3MKLA 2YHJA 5FZ7A 4OIPF 1Y8QB 1C8NA 1NA1B 4C2TA 4GB32 2Z2SB 4IETA 3H7JA 2RREA 1RUD2 3SCGA 2R061 4XXPA 5BPIA 1XYNA 2WFF2 1TVGA 2R7EB 5IJRA 1LHUA 4QDQA 1S1AA 3FXRA 3UT0A 4COWA 1MS0A 4QAWA 3POEA 5C5TA 3BPSA 1KA8A 4NVPA 4B8EA 4YW6A 1FIAA 1TW2A 3VBOB 4INDA 3A23A 5JR2A 4ENJA 3MW4A 4UBHA 1DQ1A 3WLUA 4FPLA 5BY5A 3DKQA 5FLXZ 2P34A 4NR1A 5FYTA 2ZMKA 5D5UB 5D6FA 2NNYA 3N97A 4JGYC 1GZ9A 1U9OA 3AP7A 3RJPA 2WA0A 5FFZA 2OQ7A 2MHFA 1IOAA 3PFYA 5J8FA 3V7CA 2D3PA 4K8RB 1Z77A 3ZDVA 5AIQA 3W3CA 4DXTA 1RVF2 5I0RA 1R1TA 3AXEA 3K1PA 3VBSA 2X6XA 2GM4A 4KWUA 1ZG5A 1BKZA 4GWIA 2VW1A 2PN6A 1VBE2 1BBYA 2PLV1 4EQQA 4GJZA 5BNOA 2Y9YA 3IRRA 2H1KA 1N1TA 3IAM2 4JVAA 3T2QA 2CU5A 1MGTA 2HU9A 1H2NA 1YFXA 4ASMB 4NQWB 1DP7P 3UESA 1IG7A 2CDPA 5FK8A 1JW6A 1UMZA 3PJYA 4N4NB 4AEJA 4IE0A 3ZFFC 2BHZA 2Y34A 4XF3A 3ZFFA 4QPQA 4YGCA 3RYPA 4XFGA 4Y13A 5ERLA 1W6QA 3M3OA 2OS2A 3WNNA 3GYDA 5GM0A 3MEXA 1EA3A 1AYN3 1LOFA 5IT3A 1NHAA 2HEVF 3R4UA 1S6LA 3LDRA 4DMIA 3PMSA 4A41A 1D0YA 4NJ4A 3GZEA 5DPNA 1K7AA 3HGYA 4FO9A 1XRUA 5JLWA 1NLRA 5A2QK 4IV3A 5A3MA 4FX4A 3KP2A 3J7YJ 3CCSI 2ETHA 1ZNPA 2WBMA 4XF9A 3VODA 3CKHA 3SQOA 2CQNA 4I0WB 3TNPB 1OFSA 3JQXA 5EYYA 1TNTA 3FX3A 2RAEA 5IAXA 4P9LA 1BOBA 1NCRB 4AAPA 5FP8A 5F5IA 1WD3A 1D4M1 4UV9A 2ERFA 2O8KA 1UYYA 2OZ6A 2H8WA 1FNZA 4Y4RA 1H89C 1N3OA 3ZR6A 3OYWB 1RIRA 1RVF3 5J40A 3DXJF 4Q1PA 2V79A 3E5QA 2R93J 1PGL1 1BR1A 2CV2A 2QF7A 3WCSA 2BP6A 1D2QA 4NIHA 5I0TA 1W8ZA 1LEBA 2QTWB 3LSGA 4A6DA 1Z3YA 1JGSA 4E4ZA 4OAZA 1AX2A 2FF4A 1VB2A 2P4EA 1N77A 3FL7A 1ZYRF 3X29B 2VC0A 4CDUC 2IXKA 4Z2AA 3DF0A 3ZLIA 3WOGA 4AIJA 2QQAA 3I56I 1D2SA 3CC7I 3ZSMA 4QPIA 2NNNA 5FPAA 2ILMA 1LOAA 4B1RA 3NAUA 4Q4X3 3K4KA 4COUA 2E5ZA 1C28A 4YW3A 1AWCA 3CU7A 4YRDA 4KITB 3J81Z 5LGNA 4NNJA 5C8CA 2G1MA 1VF9A 2JE8A 3O12A 4A3LJ 4GKXA 2L54A 4QGLA 3U37A 2RDQA 3BJAA 4LJZF 4ZDLA 2VJIA 1EUTA 1SEUA 3GBFA 3BTLA 4BACA 2UZKA 3DPRC 1EPZA 4KUMA 2J1UA 5K8SA 3D5RC 5I8YA 3U4SA 1PM4A 2AS5F 1GNYA 1C1FA 3N9MA 4GALA 3ZMNA 3FMQA 3LFKA 2WT0A 1UG2A 1P92A 4UWDA 5KXBA 3INAA 4IHTA 2PQ8A 4LMYA 2QSHX 4W50A 2RVCA 1YJKA 4QB1A 4YG3A 2D44A 2E2HJ 3QCWA 4UXAA 1XDUA 3DV8A 5A7OA 3FKJA 2JA2A 3GMEA 2BGPA 4XETA 3O1MA 3E3VA 4CDXA 2G7HA 2V5YA 3OYGA 1W6MA 5GAHJ 4PIYA 2G0EA 4OHYA 5GKAC 5AC92 4AIDA 2HDDA 4DUXA 3DCFA 4GH4B 3MIDA 2OKXA 5E3OA 1KITA 4OMDA 3F8NA 1F43A 2L3DA 1S2EA 1NCRA 3NNMA 2MBFA 4IJAA 1HJFA 1IRZA 3TOBA 3O1RA 2EIMH 4RD7A 1W8UA 3A02A 5L3DA 4DGWB 3HNYM 3ONQA 2XROA 4QPIC 3ZXLA 3WDWA 2AC1A 2HQRA 3VBRB 1GQHA 4DEQA 1OISA 3QBQA 1GSLA 3AKZA 2Z5WA 1UELB 5M3MJ 3JB8A 3VB9A 3UJOA 1BJZA 2WAAA 1KYWA 5CFCB 1YW7A 1JU3A 3VBOA 4BDVB 1WMFA 4XACA 1BI3A 3L00A 2L4AA 3UR3C 2DU0A 2JUGA 4QB6A 3DPTA 5A2QZ 4GO1A 1TME3 1A8MA 3PQJA 1JS9A 5CPRB 1SVOA 3I2FA 2YBKA 1OCPA 1W36C 5E17F 4ZH4F 1D4VB 2V7FA 2A6VA 2Y0MA 2RS33 1D8JA 1HXS1 5ACA1 2L7ZA 4L8QA 2XL9A 2VKVA 3GUDA 4AI9A 2W1SA 2HDCA 4W6YA 4FETA 1I6HJ 1ETYA 1XGNA 3HOUJ 1ITYA 4J1XA 3E6MA 5GAGJ 1U5YA 3KF3A 3W6KB 1AR91 3QYFA 2VKEA 3WDXA 5HCBA 5IVEA 3D0JA 5GALA 3WGHA 3R0RA 2B46X 4RS5B 1YO5C 3ZKYA 2R043 2ZABA 2HWE3 1FTZA 3T3YA 2BQPA 1X50A 1JYXA 3EO6A 2CV1A 2Z33A 2X05A 2HWB2 4A3FJ 4A5MA 3OYJA 2EFOA 3W2VA 4NRMA 1QGLA 4UF0A 4YG0A 1ENRA 1ZBA3 2W84A 5C9AC 3E6CC 5J8CA 1IS3A 3C2BA 4CCKA 4GH4A 2LNBA 1XX5A 2VTXJ 4P96A 1SG3A 2JG8B 5G04L 2Y48A 4QSHA 3SH3A 4YIIA 4TV7A 4B4QA 5IY5H 2ZHMA 3VD5A 2V09A 2PQSA 4XPVA 3GTKJ 3FKIJ 2DDAA 4FAHA 2P6TA 2KDZA 1UB9A 1YFYA 1EH7A 3PNAA 3OSFA 2D98A 3TN91 4Z07A 2CUZA 2VTFA 2A6HF 3X2QH 2LF7A 3I54A 3LA3A 2VZ1A 3V0BA 3A03A 2X5IA 3DKYA 2BUKA 3WP5A 2J22A 3M07A 5IYCJ 5E3MA 1ACCA 3MCZA 3IIIA 3RRDA 1Z7LA 1DLCA 5ANQA 2DO7A 4XRSG 4DBRA 3O0VA 1HB1A 3MO4A 1EY2A 3HOTA 5F32A 4MIMA 4ZXKA 1WMXA 5A7WA 2YX4A 3BTJA 3AZYA 2OQRA 3BODA 2V1XA 4XFHA 3MKZA 1G7YA 1QHDA 1V00A 1R083 2B9SA 1W8FA 4GAZA 1R7JA 5L7OC 1JE8A 1Q8OA 4PUSA 2IUWA 2JDPA 5JZGB 1FEXA 1QU3A 5A6YA 4CUGA 5EHDA 3RJ2X 5HODA 2LY9A 3OF1A 5A7WB 3KLNA 4UW4A 4JOMA 3HT1A 2ID4A 2EFWA 2DA2A 4KG0A 2MEV2 2KFDA 1GHCA 1JHJA 2NYYA 3ZXFA 2WSUA 3TEXA 4XBFA 1ZA7A 2WNVB 5FZKA 4MGTA 3ETPA 4MHUA 9ANTA 5A1FA 5JIAA 1NOVA 2XF7A 4PLOA 4Q4Y2 2F5CA 4XKVA 1MZBA 1GQGA 4COZA 3K2ZA 4ISRA 3CF6E 4FTHA 1IXSB 1P7JA 1SHWB 1QDOA 1FMWA 2FUG2 2GSYA 2DMPA 1NAEA 1F1ZA 2G4IA 3AK0A 1UZ0A 3IRQA 1YTYA 5A6XA 1BC7C 1LNWA 5T5PA 5FRMA 1UAAA 2PJRB 3AX4A 4XJUA 4J25A 1BXHA 1WBFA 1MS1A 2VCMA 2Q1MA 5GTHC 1WI3A 1LOCA 1QJU2 4CGZA 1AA7A 2OZJA 2ZGKA 4LK0F 2VO5A 1X36A 4RGKA 1WH7A 1RXGA 3MFAA 5CVUA 3HUGB 5ICGA 3K4MA 3UKTA 3OYCA 3EMRA 5FPBA 4ZHNA 3VBOC 4L9BA 4OHXA 1NA1A 1W06A 4HLXA 4XAEA 2J1TA 4Q2FA 4CU6A 1LVAA 3D1NI 1QNYA 3RI9A 1YX3A 3WF1A 2V73A 3JSPA 3ALQA 1HOMA 2D93A 1ND2C 2UWCA 1JZ2A 2R7UA 4GH4C 3O14A 3L9FA 3POBA 2DJNA 4BHCA 2G7UA 2WFF1 4HSLA 2OA4A 2C4XA 2WWYA 1RUF3 1Y9GA 4LO7A 1VQ9I 1WW4A 4PJMA 3RKQA 1N47A 1QVTA 1MMGA 3FF5A 3AKPA 2XPJA 4M3FA 1IN8A 3ECHA 5FZCA 2QQ9A 2XL7A 5EQUA 3VDDC 5L3GA 2WYSA 1NCQC 2VB6A 2NVYJ 5FJKA 1W0PA 4LHNA 5JPMB 3ZYHA 2DA3A 1R1VA 4AVAA 3F6VA 2MABA 4EN8B 1S0JA 1OJLA 1TQPA 1JZ7A 3BTZA 3OL4A 1H1IA 4XKWA 3KP6A 5TGTA 5FZHA 1N3QA 4M3CF 4DXRA 2AO9A 1EJ9A 4FPFA 2IS1A 4L9TA 1JUMA 3MWMA 4JYKA 4B8XA 3CJNA 4MGKE 2B7EA 1VBE1 3I8TA 1PIV3 4FT8A 1ZLJA 3M3YJ 2DTYA 1W8HA 5F37A 1UOGA 2J1RA 3I2JA 3NKTA 1DPRA 4BHPA 2QQLA 4LKFA 4XL9A 2P3IA 3MIEA 1RUJ2 2P7CB 5F8PA 2HXIA 3ZXEA 3BT9A 1VQMI 4EJUA 1ONAA 1WBLA 3CZJA 3PNVA 4AU7A 3HZJA 1IS5A 3VDCA 2Z69A 2DUPA 4CU9A 4XE9A 3ZQCA 2TNFA 2VZTA 1NXD1 2J1VA 4MGYE 3H5NA 2JWPA 2PMZN 2VZSA 2OYZA 3I59B 3FXOA 1R9TJ 3MIHA 2LYCA 5FREA 1WLWA 3J80K 3LCPA 4P9IA 4YNIA 1PK6B 4Q0QA 4OUEA 5JI9A 3DCQA 1ULCA 1OA2A 4H14A 2PJRA 1SD5A 3TEDA 3ZQHA 3ACFA 3H92A 5KC6A 4GZ9A 1MNDA 3QP6A 3BQZA 3I59A 1RRJA 1VBC3 2WS93 4HETA 1KU2A 1U2WA 1V0AA 2RV8A 1QJU3 2KQRA 3D8CA 1KS4A 4LMFA 3B00A 4G6QA 2EXHA 2DF7A 4LPLA 4XDQA 4QKBA 1ZELA 1H8TB 1B35A 3GTOJ 1ZRCA 1RESA 1SLAA 5LB6A 4X6RB 1BIBA 1MJBA 2WV1A 1FSEA 2E2JJ 1K79A 1ZZ6A 4NIIA 1IKPA 1HDKA 1OVSA 2I74A 1X8EA 4ARYA 4NN0A 4X8PA 4BQOA 2FCUA 4CO8A 1D5VA 1S0EA 3OMYA 2JG9B 1QQP1 5BNNA 3LSEA 2VVEA 4JV4A 3VBUB 5FKBA 4EROA 1Y1VJ 2HWF1 3J9SA 5DG2A 4HA8A 1OSGA 1PVC1 3AFHA 1GNHA 4K1ZA 3IMNA 3OUJA 3JD71 2O0YA 4EJRA 5FKMA 4NPRA 2V6CA 4CP2A 1WW6A 1NKGA 1JODA 5ABJC 1TWGJ 3A21A 2PAKA 3ZSJA 3K6GA 1W8NA 1DDLA 3BOQA 1MZ6A 5LWBA 3SFIA 1T95A 4YEJA 2JDYA 4B1MA 1S7OA 1W9TA 4RHV1 5C4JJ 1AR73 3KP7A 3PO2J 2E71A 4RM2A 1RUD1 1SAXA 2XHNA 4FOQA 4NHKA 1ETXA 4CA0A 5FP4A 1R093 2QQVA 3T1BA 5CISA 2XC7A 4MVTA 4HBNA 5HXMA 2CS3A 1X1BA 1FJLA 2FEZA 1PNFA 2GLOA 1X8MA 2EAKA 2IBDA 2KLOA 3VBRC 3OIPA 1VQKI 1FLIA 1JBCA 1WCDJ 2A7AA 1FY7A 2BDRA 5F39A 3L9JT 5FYIA 3NWKA 2D5FA 3CF2A 5FMDA 4IHSA 1LU1A 4YW5A 1VRH2 3SZTA 1W0UA 4QGNA 2FZ2A 2EICA 4K7JA 4B7EA 3FZ3A 2XDVA 3WHUA 1VBD1 4GA9A 4UFHA 1HRI2 2PLV2 5DUIA 1NG6A 1SD7A 2VE8A 2GIVA 5EEAA 4A3XA 4JGZC 2ZHKA 3OEBA 2E2IJ 2YMZA 2P6HA 3NJYA 1RB8G 4AIHA 5K4LA 1F8VA 4XRSA 4XDOA 3M70A 2M7AA 2VQ0A 3Q8FA 2NXNB 1LGBA 1ENHA 1QXPA 3FHIB 1LFUP 3IPVB 4XVHA 4KGQA 1GOGA 4M0NA 1P9QC 3WF0A 3BG3A 3RIRA 3AMPA 2X48A 1MVEA 3TWIA 3AC0A 4YSFA 2XB0X 1ZBA1 3OYIA 1PYVA 2JKBA 4AXOA 2DFCA 1XMAA 4LLOA 4ISQA 2BYVE 4XJ8A 1G3TA 2M7BA 1BA5A 1UY2A 2XF5A 3G71I 1I3HA 4C30A 4E7SA 4N43C 2P3KA 2CQXA 2RS53 5D8LB 3AL0B 3CCYA 2O9LA 1FV3A 3SCHA 3WCRA 4UAPA 2MD5A 1HRV2 4ZS2A 3WNKA 4BEHB 1GVDA 2ZO4A 1K4TA 1O8SA 4Q26A 2Z3YA 2EIBA 4Q0VA 1ENQA 3MIFA 3PIJA 4FPKA 3ROUA 2B7YA 3APBA 5E16A 1JJ6C 2VOVA 1KU3A 4IEJA 5T5LA 4Y20B 5F64A 1HB4A 5DUXA 4K2EA 2OVUA 3GTMJ 2QZ2A 2GC2A 1Z0HA 4CDUB 4JDOA 1Q1VA 1FMD1 2ARBA 3AG3H 6PAXA 2L02A 4RAGA 4CRQA 4KG8A 1VP6A 1GFF2 1W28A 1LUJB 3RZOJ 1UCRA 4FTSA 2P6SA 3M2MA 1HKQA 2H6BA 1BZWA 2EV5A 1ZYBA 3DGTA 4YZ3A 3S1RJ 5HS8A 1NE4A 4JK1X 3ILNA 2BV4A 2X5IC 5JSOA 3JR9A 5ACA3 4NHYA 3FBNB 2LC2A 3W6VA 3WUDA 3DU5A 5CG8A 3JRDA 1JYNA 2JA5J 2WDBA 3C1DA 4UFIA 4CDXB 1T8IA 1OUXA 5LBEA 4F91B 1IKQA 3BZ6A 5LHGA 3ISPA 4A3BJ 1E5HA 3MAJA 4CEYC 4XIOA 3WW3A 3WF4A 5FZBA 1QPMA 2H27A 3CDIA 2UXXA 1PO11 3K2AA 3OB8A 1IN7A 1VBE3 2DPUA 4KA4A 1PIV1 4NE9A 1FNYA 3R05A 3SEQA 5APAA 1OURA 5F5CA 1IZ1A 4N8MA 3PSIA 1CPNA 2YYOA 4AHZA 3GTQJ 2A73B 2VPVA 5L3FA 3MN2A 3NQOA 1LHOA 3MGUA 4G8XA 1ST8A 2KIUA 4Y1UA 1EUUA 1H8VA 1GUUA 2QQWA 1P7IA 1AUYA 5FMOS 3WDTA 1US2A 2A61A 1SZBA 4E8DA 1Z21A 1F2NA 4B48A 2WADA 1UZYA 3MLKA 4A6SA 3AG4H 2DTWA 1OI6A 1PO12 1RJ7A 4F3JA 3F23A 4NPLA 1YO8A 1YQ8A 3I97A 2L7KA 5I93A 1H2KA 2XF6A 5JXGA 4XFFA 4AEMA 3FXLA 2ZKLA 5FZEA 5ILSA 1CIYA 2W00A 2KP6A 5HLHA 3GJAA 1BEV3 5D6EA 2CUJA 3J8F1 2Y38A 1ON1A 1DQ4A 1R22A 1JOPA 1RETA 4FOWA 4NHJA 3P7NA 3ILRA 3V8KA 2JVGA 1Q56A 2DOFA 4QPOA 5JIUA 4IRHA 4ESFA 2ZEWA 2R7VA 4Q8KA 3RCOA 4X8NA 2AQEA 1RUF2 1EP0A 3S2WA 4P9GA 2XVGA 1ZN2A 2OUHA 4ZDOA 2HEWF 2L4MA 4YVSA 2ZBJA 2K27A 3RQ4A 3H5RA 5CIRA 4WF2A 3CJXA 1XMXA 1UMIA 3FBIB 3LE0A 3GHMA 5G05L 1V5GA 2QGUA 4UF0B 1XNDA 4HAMA 1UY3A 1WJDA 3R6SA 4PJYA 1RUE3 2LALA 1ZHFA 5IVYA 1FOD1 2BNNA 5FYMA 3BTCA 1CX4A 1W2AX 3VHNA 4JQRA 3CZ6A 4C1XA 3CJQB 2VH9A 2K4BA 5DAVA 4AQ6A 2JDNA 1UKGA 2OU2A 1QMJA 2VKDA 4ZONA 2XPVA 1J75A 2VQAA 2Y6LA 3M8FA 2ELHA 3M4OJ 1XGMA 4HX8A 3AZWA 3PVEA 4K3UA 1KGSA 2WWJA 3LEGA 2DV9A 3U75A 1KRIA 4L11A 1XE0A 5BNOB 1U6GA 4CUBA 5JMOA 1WCUA 5FO5A 4QT6A 3GLXA 2LD5A 4XOTA 4Y1XA 3MIGA 1YWKA 5BNQA 4GMP1 2GAUA 3KVAA 2JRTA 1V6OA 5F6FA 4BK5A 5DM7F 5ACA2 4Y33A 1COV2 3NJVA 4ES9A 3BIEA 2EFNA 2JENA 3HTSB 4CEWB 3KZYA 4X0GA 5K5OA 3LFIA 4XONA 1JUPA 5JOZA 4AEDB 2F5DA 1R64A 1MW7A 5FLHA 4S2FA 1IN4A 4ON0A 1HKDA 1JJ8C 2PYTA 5C7GA 1DU6A 2AUYA 2K9LA 5JSRA 3QU3A 2HWF3 1AL23 1OCZH 3FHZA 1IGOA 3RZGA 2KA3A 4GYGA 3WDYA 2EWNA 5F3GA 3EETA 2P3YA 2WO3A 3IZOA 3CLOA 4WM8B 2F4OB 2UWBA 2IS4A 3N9NA 2VMGA 1H0BA 3OV8A 2GXBA 4M3DA 1BVP1 3VOEA 4OHWA 2FA5A 3OSDA 3ABUA 2D3SA 1OPMA 3D5OA 4DRVA 3TW6A 2XUEA 3ZXDA 2KM2A 4BE2A 1W4MA 4IL7A 5FZIA 1MH4A 2WNOA 3H8OA 2GA2A 4P14A 1BBT1 5GTIC 3NNFA 2W39A 5FGMA 2PFWA 5IVFA 5KC5A 3ZXSA 1PK6A 3U0ZA 5I0UA 3ABLH 1NX9A 4FPCA 3SKJE 2GMPA 2EBIA 3RPQA 5FZOA 1AR62 1YFHA 5LD2C 4LA2A 2J1SA 4C3HJ 4GWMA 3EPZA 3FXJA 2EA2A 3IB3A 2R49A 1U5TC 4OMZA 2UV1A 3FXUA 1S55A 4LBQA 3TEYA 1NY72 4QXKA 5E1XA 2K02A 5H9QA 5JI7A 4L9NA 1AX1A 2VW2A 1KU9A 3FBMA 3O1SA 1PMIA 2PHTA 4ZC3A 4OCTA 2ZEYA 3ZIWA 4FASD 2R5ZA 3O8HA 1LODA 2V9VA 4E7KA 2M8EA 3CJIA 2X9DA 3F72A 1U5ZA 1KQ0A 2VBWA 3NL1A 3BR2A 2ZGQA 4I02A 2DVFA 2NQYA 2Y6HA 1ND2A 4IQJA 4M71A 3PQKA 1XGOA 4YRVA 5ICFA 2R5YA 1H2MA 1B4AA 1D3YA 4GQ7A 2XAGA 2K85A 3KYLA 1BEV1 3GZUC 3OYKA 4HDVA 3WY6A 2EF6A 4W8JA 2AEYA 2PHFA 3HM5A 3I2OA 4PBOA 3DEUA 3C18A 5A32A 3ULQB 3OCPA 3T09A 1E57A 4LFUA 1DYOA 1NUKA 4MADA 1J09A 2CSGA 2O8OA 1C57A 5HI0A 2B8MA 2XAUA 4GWNA 4MZUA 3USUA 4YVWC 1J59A 2TCTA 3KEOA 2WAQA 2CTVA 4OZOA 4DY3A 2JJ7A 3I53A 3J7NA 1LEDA 1QF3A 2UURA 2D6PA 5FJ8J 4NQWA 1FZPB 1CF7B 1RXFA 4QKFA 2L01A 2XH6A 4EEFG 1USSA 3NMBA 3CUOA 1UO9A 5B4NA 1AXYA 4XDPA 1JT6A 2ICWG 4AYBA 2OQ6A 2EZLA 3N4MA 1SLLA 2F48A 3HSRA 4C3JJ 3BR0A 2NZ9A 4H2AA 4QU1A 3S7EA 2FHRA 2UU8A 4CCCA 4A3EJ 1X9TA 2NMOA 4LE4A 1OMIA 1V55H 3I64A 2A6TA 1IXCA 5EEGA 1FP2A 3PVBB 4FFFA 1DIWA 5J37A 2ZJPF 1DZRA 3CEWA 2BTVC 3LIGA 1KXGA 2YROA 4A6OA 1R58A 2X85A 1DQ2A 3E0JB 4YVWB 1AKHA 4IVNA 1HBXG 5D8KB 3K4CA 1VTNC 2QQJA 2HTJA 3LAJA 3VB2A 2VONA 4FXGB 2RV9A 3QYBA 4R79A 4ANJA 3CP2A 3V4GA 1FT9A 3S16J 4CDQA 5C8CC 3VBFB 3C7EA 2AR6A 3V56A 1RUC1 1WJCA 2VQHA 4C2MJ 2Y0OA 5LBCA 2NPIA 1VBB2 4RB0A 1ULDA 3OPTA 2RR12 3POJA 3S1MJ 4M01A 3RWKX 3VBHB 2FNPA 4P5HA 3H36A 1LTEA 4YZ1A 4Q4W3 3IPVA 2HWE1 3ZVXA 2WZPP 1UZVA 4GGGA 2XKPA 3EB7A 3N9LA 2XLAA 2CFXA 2YPRA 1GZWB 4XILA 1VBA2 2RS12 4AVTA 1Z78A 2M9HA 3WR0A 1W05A 2EALA 2I10A 5DTDA 1JH5A 2D5VA 1ULPA 1K5MA 1KDMA 3BTIA 2LY1A 2WAQN 1D4M3 2XLGA 2JK3A 2MGQA 1FBQA 1PDNC 1GWMA 2UY9A 1KFXL 4DXSA 4ASNA 3EUAA 1FSHA 2WZ8A 3OR2C 1Q8SA 1G86A 2WWUA 3S14J 4DO0A 2Y64A 1BL0A 1A36A 1REPC 2JG8C 2P3JA 5HDNA 3ZN0A 3V7RA 3ZSEA 4I7HA 1GP4A 4AD9A 3WVJA 1I1GA 4F55A 3PTYA 5DD4A 1P4XA 2Z16A 1KDKA 2QDNA 4QXCA 3ZYPA 4HNUA 3VD3A 4D3WA 1V5FA 1PVC3 1MSEC 1PO13 3ZN5A 3G2BA 5FXXA 2A6YA 2CV0A 1HN1A 3AKQA 3LEKA 2HQ5A 4M9SA 2LKXA 4GMP0 1GZCA 4EWDA 1RMU2 2UXNA 2D97A 3I4NJ 3DL3A 4BA6A 3O1PA 3J8F2 3F3XA 1XSQA 5F04A 2D6NA 2HOTA 4IEUA 3VBHA 1ZRIA 1UIKA 2FNAA 4M6VA 5B1BH 2QFEA 4JZRA 2LFBA 5DCFA 3T4VA 4KMUX 1KEXA 2W7NA 2E7XA 2A3YA 2YPDA 2VZRA 2JZYA 3CMGA 1MS3A 1J84A 3C8XA 3B6AA 1GYKA 3M3EA 3H1MA 4DEVA 2FQPA 3KYDB 5C3QA 3KT7A 1IO2A 5LGUA 4MTDA 4RGUA 1N3PA 4BJ5C 2P6CA 1SBEA 3TO7A 4XABA 1OR7C 4LLLA 4XZUG 5JLVA 4CE8A 3W5NA 4AGGA 4MEYF 2ADDA 3SDGA 2DU1A 4W97A 5C3OA 5DAWA 4Q4ZF 3KV5A 1MDMA 4OOIA 2XMLA 2VCBA 3GZNB 1OF3A 1H1MA 1VR3A 3JBG2 2HH9A 4MO3M 5CKNA 1ZGAA 4ZKTB 5FV3A 2RS31 2PLYA 1MJAA 3NW4A 1CAWB 2SBAA 2WTEA 3WQ7A 1UY4A 4NBQA 3P3PA 4COVA 4LT5A 1XC6A 5LK7B 2D6LX 1T98A 4AIKA 2Q0AA 1EF4A 2AEZA 5LY1A 3V0BB 2P5LC 3MBWA 4M3CE 5CQEA 4V1PA 3C7FA 2LSOA 1VQOI 1GBGA 1A31A 1WJ5A 4Y4YA 3B01A 2ZHLA 3AFKA 3M8EA 3AP5A 1S0GA 3KQRA 2Q8KA 1V9U3 4YW2A 1BHGA 1QKQA 2Q4SA 2FD8A 3OYLA 4FOYA 4JX6A 5FQ0B 2CW7A 2HVSA 3OS1A 3LL7A 3K70C 4CTEA 4QQLA 3Q0WA 1J83A 4F83A 5IHRA 1OD5A 3F0CA 2PAMA 2GNTA 2CU7A 1MBEA 5ANNA 1MBJA 5FLJA 2MSYA 3ZRGA 2ZGLA 5B2GB 4YM0A 4FTBA 4M00A 4B3XA 4KJZA 5DV5A 2YGLA 5FZ9A 1BI0A 4RFRB 1SLTA 1WMEA 4JHZA 1ZBE1 5K1YA 4M3GA 2Y33A 3URFA 2DAOA 4K8FA 2R073 3C7HA 4KBZA 3WW1A 1RZ4A 4TWTA 4A3KJ 1XCVA 5KAFC 4M6YA 4UB8C 3CO6C 1REEA 4XF1A 1OHFA 2PELA 4PLNA 3SJMA 5FIXA 3QOPA 5DUKA 1RR8C 5K0UA 3BG7A 1G9AA 3VZOA 2E9QA 3AL5A 1W6MB 4EJWA 4UB6C 3V64A 1TBXA 2L7MP 4U0YA 4HW0A 3RZZA 2BVLA 1B35C 2XBO2 5FZGA 5GADJ 1WJEA 2M5WA 4P9JA 2J7MA 4WVWA 2RNJA 3LFUA 1JU4A 1VQLI 3U07A 2QQIA 3QH7A 1QJEA 1Z91A 3VZNA 2KMUA 2A70A 5FPXA 3PMEA 3W5MA 2CMPA 3UKGA 1OQDA 1VMHA 2VMHA 1QJY2 3IDAA 3CJIB 3M4FA 2DQRA 4RQPC 3FXKA 1VRH3 2Z42A 2R5ZB 3S32A 4FE7A 4YIFA 2LOOA 3WTZA 5E1RA 2KZGA 1XNAA 3WGIA 4CP9A 4HVOA 1Y0NA 3GYHX 1APNA 2VZQA 3A0NA 2WQ8A 4IGQA 3F6OA 1Y6IA 3KF5A 1KD7A 4JBAA 3UETA 3FUOA 3VBRA 5CEHA 2GXGA 1ZGWA 3GEZA 1R082 4UUTA 1ODMA 4DXZA 1DGRN 4LHSA 3A01A 5HNHA 4IV3C 4W65A 1DUXC 3ZYRA 3BG9A 5E8IA 5H9RA 3KP5A 1RINA 2WC2A 4HF1A 1AKHB 4IV1B 4PGHA 1Z9CA 1LOFC 1MMNA 4IQPA 4CXXA 1PO21 5L73A 2STWA 2R6QA 5H9PA 2R042 2FX0A 4N53B 4ZPIA 3ZIXA 3VDXA 4HRIA 1H9TA 4L18B 5A70A 1TQIA 3DQVC 2ESNA 3QODA 1IRFA 2R30A 4RL7A 5EP9A 4CYDA 2XVCA 4CCDA 2EV0A