3D0SA

Camp receptor protein from m.tuberculosis, camp-free form
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
224
structure length
224
Chain Sequence
MDEILARAGIFQGVEPSAIAALTKQLQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISDSERLARRAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REGULATORY PROTEIN
publication title Crystal structure of cAMP receptor protein from M. tuberculosis in the unliganded form
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
total genus 69
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3d0sA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3d0sA01
1UCRA 2IXCA 5J48A 1FWZA 2L54A 3QU3A 4KIGA 2V09A 3M70A 1OFNA 3SHRA 3RKWA 3QU6A 5J6XA 1JGSA 1D3YA 2L02A 1B1BA 1CAWA 1W5TA 1XGSA 3LOIA 1UIKA 2IT0A 4IESA 1JUHA 1ZZ8A 2FRHA 4PGHA 3RTRA 1U12A 4O6JA 2CAVA 3TO7A 2X4HA 3KE2A 1SFXA 3BZ6A 4META 2EA2A 4UV8A 1TNSA 3OGJA 2ZFWA 3SCGA 2DW4A 1PDNC 1JHFA 2FA5A 1H1MA 2A61A 4WK8F 2F5DA 1KU7A 2PHLA 3HYIA 5LGNA 1YS6A 3LA3A 1PP7U 5FB2A 3KZYA 1IXRC 3U9GA 5L3BA 4I98B 2HDCA 3KP7A 1UHMA 4OIQF 5ED4A 5HDGA 3LQQA 1BIAA 3GZ5A 3EJKA 1KU3A 2GWRA 3V7SA 3FHIB 2FEZA 4I3PA 5L3DA 3VFZA 2FBKA 5LLQA 3ZPLA 2ESHA 2YX7A 2RC4A 1CAVB 3EDPA 2BNOA 5I0RA 4L11A 3TDUC 2VN2A 3RKYA 4ZU4A 2PMUA 1W5SA 4I02A 3ZN0A 2E7XA 3HRTA 5KHGA 3RPUA 2L01A 3RJPA 1I5ZA 2GXBA 3BY6A 3ZN1A 4G7HF 3HSEA 5LHGA 4RB3C 3FX3A 2DCTA 2M8EA 2HR3A 4IEPA 4EV0A 3RZZA 1IN6A 4Q4ZF 1SMYF 2HOEA 3ROUA 5I93A 1CAVA 1FX7A 3VB2A 3N97A 1MD0A 4F8AA 1R1TA 4LFUA 5ICFA 3ETQA 5CVRA 2DO7A 4O9GA 3U1DA 1UCXA 3USSA 4R8HA 1YW7A 4HX7A 2KRFA 2KIMA 4KFCA 4L2NA 4OFGA 5E1ZB 2DQLA 5FDBA 3PNAA 1S6LA 2RN7A 4ORFA 2FQ3A 2STTA 4HOBA 1CAUA 2LKPA 2EA7A 2H6BA 2ZNZA 2OA2A 3ACLA 3ECOA 2EV6A 1UW8A 1T39A 2W85A 5DCFA 4MZUA 1ZH5A 4IERA 1QXJA 4Y15A 2CV6A 5HS8A 2Y75A 1YO5C 2ESNA 1GXPA 5BPXA 1WI9A 1TBXA 1MDMB 4OOIA 3HQXA 3CF6E 1EH7A 1K78A 4XFAA 2X0LA 4EJWA 1BI3A 4ENMA 1J3QA 1YHFA 3RDIA 2PQ8A 3HSRA 1DGWA 2IJLA 2Y0OA 4AVCA 1MDMA 2XAJA 3K2ZA 4L0ZB 1RNLA 1U5TA 3W6JB 4ESBA 3V7CA 3FMSA 2D1HA 2OD5A 3OV8A 4PDKA 3RYKA 4M6YA 4XFIA 1BOAA 3SXYA 1J7KA 2H6CA 2XASA 4MEXF 1YUDA 2EVXA 1MKMA 3LWCA 2OPKA 2EWNA 3K9TA 2QVSB 3ISPA 3E6DA 1F5TA 3FF5A 1KYWA 1O57A 1EH6A 1F1ZA 1R58A 2PFBA 3V8JA 2PMHA 2PI0A 5L3FA 1LNWA 2W25A 3CUQB 4ZZLA 1EPZA 4L9NA 2V79A 2MNGA 2BNNA 4XSZF 2EV5A 2O61A 2DU9A 4YIIA 5KVRA 3U10A 1HKQA 2OYZA 5FFXA 2QBYB 2VXZA 1G6NA 2E1NA 3RYRA 3QRFF 2MLKA 4UXNA 4PIZA 4HLXA 4EWDA 2GXGA 1Y0UA 2O3FA 3CUQA 2F2EA 4L5JA 3BOQA 1I27A 2HGCA 4OIPF 2AS5F 2VQAA 3ABTA 4UHTA 1G4DA 1FLIA 3E5XA 3I54A 3BROA 2QBYA 2DPDA 2GC3A 5H6QA 4KMUX 1LRHA 1ZVFA 2R7DA 1ZZ7A 4LMYA 4PIXA 3IWFA 1ZAOA 2Z99A 4MQ9F 1YFHA 4KNYA 2Y0MA 2ZCWA 5KHHA 5KHJA 1LR5A 4L9JA 1VTNC 1FSEA 3CO7C 4HQEA 4CGZA 3Q5FA 2C6YA 4HLTA 2PA7A 2XL9A 3CJXA 3PQJA 4M9ZA 5ILUA 1IAWA 2XAQA 4EROA 4LB5A 3SXWA 5LGUA 3GWZA 5ICGA 3RNSA 2UY8A 3BJOA 4IEXA 3LQRA 2P7CB 5HDKA 4UV9A 4HDVA 3NEUA 3FWEA 3IRRA 3IDCB 2K9ZA 1ULYA 4IF4A 4P96A 4M73A 1FBQA 3DEUA 3D82A 4S04A 3FXRA 2ISZA 4D7TA 4EWEA 1ZN2A 4FAGA 3G3ZA 3GFMA 4LK0F 4KL1A 2C0ZA 1X8MA 2FMLA 3MAJA 1O3SA 1ZRCA 2HZTA 5BS6A 2EFPA 1KQ9A 5E8IA 3H8UA 1IW7F 1LKNA 3NW4A 1XMAA 1OMIA 4X6RB 3VHRA 1UIJA 3DQVC 1HQCA 3C7JA 2PHDA 3BWGA 3P7NA 3KGZA 2M87A 1TTYA 3KLNA 4YFXF 1X82A 4YFKF 4ZYEA 1XE8A 2PBIA 5HLGA 2A6EF 2P6TA 1FBUA 4IXAA 5BMZA 4XF9A 1YS7A 3VODA 3T8TA 1XDSA 1ZLJA 2ZO4A 3GYDA 3I59B 1NZCA 1D5VA 3R61A 3DPTA 4WXHA 1H0MA 3D0JA 2MH9A 2OA4A 3E3VA 3HOTA 3KGLA 2EV0A 2PAMA 3WTTC 4Q48A 1MGTA 1H9TA 4MTEA 1K7AA 1XGMA 3V8LA 4M72A 4ETSA 5CVIA 3WW1A 3GZ6A 2DI3A 3IC7A 2Z9OA 2D40A 1QZYA 1U2WA 3ABUA 4CZZA 1RC6A 4FX0A 1QXRA 2QM3A 1PM7A 2P7VB 1OYWA 3R60A 3EYYA 4MGZE 1VJ2A 2PTMA 5HVQC 3NJZA 5FCCA 1WLTA 2W57A 2B5HA 1TQPA 3GBFA 4XEZA 1O3QA 4M74A 5BOXA 1EP0A 3NRVA 5D5UB 1WRJA 5KBFA 4ESJA 1DPRA 4YG2F 3NVCA 1O5UA 1SAXA 4G9YA 1MZBA 4Q0VA 2HQNA 3SZTA 4U88A 3K1MA 3WTZA 1ZNPA 3TGNA 3BJ6A 5DUIA 3SQNA 4BXUA 1DP7P 1FC3A 3ES1A 2XIGA 2OBPA 4ZZDA 3F8NA 3F8CA 1NE6A 3Q9VA 2Y48A 4HVRA 3NL1A 1LEAA 3SZPA 2BEOA 1J3RA 2QDRA 3ZDSA 4P9FA 2O1QA 2J5OA 2VONA 4GYIA 1ZREA 1CF7A 2CO5A 4MNUA 4LLOA 4BHBA 3O3KA 5DCMA 3HTUA 1GXQA 1X3UA 4XFGA 4HF1A 1HXDA 4AVPA 3JAMK 2XL7A 3TKYA 1ZARA 4MGIE 3FJSA 3AAFA 1S7OA 3HUGA 4QGLA 2BBYA 2RNJA 5AIPA 5D5WB 3IBMA 3GFJA 4RGSA 5J8CA 2DLLA 1R1UA 2OQRA 2CW0F 4HAMA 5LHHA 4JK1X 3FE5A 4LB6B 1R23A 5HLHA 1CAXB 3I53A 2W24A 2YU3A 1ZRRA 5AIQA 5I8YA 3WW4A 2VBYA 4I0BA 2STWA 3ZQ7A 3RIRA 2ZNYA 2XUBA 2Z33A 4XFBA 1J75A 1P6RA 1P4XA 2ET7A 1GQGA 4HF2A 1RIOH 3M8EA 1ZRFA 2WTEA 2VOPA 4Q0PA 3DPLC 4IVNA 2MC3A 2Q2EA 1P2FA 4G7OF 2WV0A 4RGXA 1F4KA 2JT1A 3MPBA 3P9CA 2KKOA 2KJBA 2VT2A 4D7SA 5L3CA 4GGGA 1FZPB 3HHHA 1I6XA 1YFUA 3ELNA 4YRDA 1RUNA 1USTA 1NE4A 2RQPA 3WTSC 3P9KA 1HW1A 2ETHA 5D6EA 3WTWC 2K4JA 5IT9Z 5LEKA 3LWFA 2VODA 2P5KA 3CTAA 4EM0B 3EQLF 3V8KA 1BI2A 2CGPA 4L5IA 1R1VA 2UYAA 2CYYA 1FYKA 4LG0B 2IXLA 5IT3A 5L3GA 2HKXA 5J7MA 1CGPA 1DPUA 3RPQA 4BHCA 3WW2A 3FM3A 1TQMA 4UXAA 2UYBA 1YW8A 1EY2A 4XETA 2XKPA 2UXNA 2MBFA 3HT2A 1XDUA 3KEOA 1PP8F 1SD7A 2WWYA 4G8XA 2PJPA 4A5NA 2VOOA 4LG0A 4HQMA 1TW2A 4U0YA 3UKVA 3WE2A 3FXQA 1DDNA 4QXKA 4IJAA 1Q1HA 2DAOA 2L4MA 2VBWA 3F8MA 2D45A 2F4PA 4KICA 5JCTA 2DTRA 3KLOA 2EB7A 4ZYHA 3OTFA 4IEUA 4PCQA 2FBHA 4ESFA 2HFHA 2ZMEB 2CWEA 4E2QA 3GFLA 3WE3A 3E6CC 4KYWA 2Q4SA 1S29A 5ERIA 2BNMA 4MTDA 1SFUA 2HKOA 5FPXA 5JR3A 2YPRA 1ONVA 4Y13A 3DP7A 1IN7A 3TOBA 1ZX5A 3BPZA 3S0MA 3GYHX 5DD8A 3EYIA 2P5VA 2ACJA 5EZWA 5D6FA 2G9WA 2G7UA 1ZHFA 2NS0A 5BUVA 2NNNA 1JHHA 2V1XA 4LGWA 2VE8A 2PFWA 2Z5UA 4AIKA 3MDPA 4UUVA 3H7JA 1XCVA 2RDPA 3JTGA 3WW3A 3N4MA 1J1LA 3KP3A 2QUFA 2D1VA 4FX4A 2V1UA 4MQVA 1NYWA 3GW2A 3K1NA 3RKXA 2MD5A 5AVPA 2NNYA 2IVMA 3IIAA 2GQQA 1BC8C 5EEGA 3ZMVA 1FOKA 4XF1A 3J81Z 3P9IA 1I1SA 4RD7A 2DK5A 2FE3A 2A3SA 5KK1A 1WA4A 2HYGD 4M9XA 2XLGA 4NVPA 3EETA 4LTAA 4FAHA 4ENKA 1Q5OA 2VE9A 4G6QA 5IT9K 3CL1A 1P4WA 3F72A 4K8FA 3S7EA 4WCGA 3E6BA 3SMHA 2XLAA 4EM1A 1P4AA 3T8RA 1O3RA 5JFRA 2FNPA 3KFWX 1R7JA 1P92A 1BM9A 3EO6A 3GO5A 2PQQA 4M6XA 2RGVA 1HSTA 3FZ3A 3NSTA 5E17F 4XF4A 1QWRA 4AIHA 2XAHA 1H1IA 2FMYA 2L4AA 1IF1A 2NAZA 3O2PE 1LQ1A 3GEZA 4IRGA 4HVOA 1FNNA 4QM8A 4AWXB 4YIFA 1YTYA 1Q43A 1J58A 5TRDA 3LAJA 2Q1ZB 2MHFA 4AXOA 4ENJA 1W7PD 4NHJA 2RVCA 5D4RA 4BH9A 4K2EA 1DZTA 4AVAA 3F8BA 2WC2A 4AQ6A 1Z6TA 2P6SA 4ONUA 4B8XA 1Z91A 2D5FA 3BU7A 4A0YA 2EFNA 1DUXC 2W84A 5JAXA 4WWCA 1FXZA 2IC1A 3HT1A 4IETA 3EBRA 2M30A 4QMAA 1ZRDA 2A68F 4I7HA 3WG9A 3NKTA 1U5TC 4EGYA 1JE8A 3LSTA 3M8FA 3B73A 1YFYA 3KEQA 4JV4A 1IRGA 2GAUA 1SD4A 1XE7A 4KMFA 4D0PA 5I8SA 3GUDA 2PYTA 1IN4A 3H3UA 4PGGA 2XV4S 2VPVA 4IRIA 4I09A 2IP2A 3O6BB 4YFNF 4ON0A 1YG2A 3VEPA 3CDHA 2GU9A 4CHUA 1GHCA 3IRQA 5KHIA 2HYFA 4IPAA 4KUMA 4KDPA 2ISYA 2OAZA 1NXMA 1LJ9A 1BI1A 2LSOA 1O7FA 3F21A 5DV5A 1YYVA 2OZ6A 3ZMZA 5JR7B 2VC0A 3C18A 2IA1A 3G73A 4GULA 1WKMA 3J81K 4E2GA 4J1WA 2K4BA 1FBSA 3CUQC 3REOA 2A5YB 3ST7A 3WGIA 5I0UA 2QCSB 5E1WA 4MUVA 2IXHA 3HIFA 1L3JA 3OD0A 4DINB 5A2QZ 2FBIA 3E5QA 5H6RA 1U6GA 1K6OA 5CVUA 2PLYA 4GYGA 4OMYA 5E1XA 2GC2A 2OQGA 3LAGA 1T38A 1OYYA 1ZZ6A 1EV7A 4QLCU 5FPZA 4XLPF 1EH8A 2QENA 3COAC 3WU0A 1C0WA 3H50A 5JVTA 1FY7A 3WGGA 4HW0A 3M7GA 2JTVA 3JAMZ 1XRUA 1XGNA 1G3TA 1EYBA 3IHUA 5L3EA 4HX8A 3IDBB 4WXDA 5BQTA 4FHTA 4U7BA 4Z2YA 1HW5A 3BDDA 3DN7A 4UNOA 4LD5A 2VECA 5F64A 3J7AO 2F5EA 1Z9CA 4LA2A 2K27A 3QAHA 4ZU7A 1YIOA 5EEHA 4OINF 3SFZA 1T0FA 1FT9A 2M1BA 4EM2A 3FMQA 4LLLA 1R00A 3CLOA 2XVCA 1MJAA 2IA2A 5E16A 4F7ZA 3HOSA 1TNTA 1U78A 4PZJA 4WBBA 5CU1A 5D5XB 3BALA 1SFEA 4G94A 1D8JA 4M71A 1B6AA 4IEWA 4YARA 3I59A 2GC1A 3FM5A 3UKTA 1ZLKA 3H7YA 4MH0E 2XKOA 5JHUA 4HA8A 2BV6A 4BIFA 1V70A 1H9GA 1L3LA 4YSFA 4ZU5A 2I45A 4QGNA 4HBLA 3LZZA 1Q3EA 5LBQA 1XSVA 3MZHA 1XGOA 4LA3A 1JXSA 3MQ0A 2VBZA 3KP2A 4NB5A 5LHIA 1XCBA 5AONA 4JTNA 3MEXA 5CADA 4B29A 5D5VB 4EJTA 2B9UA 5HLIA 1FSHA 1RTVA 3WGHA 5CVVA 3F22A 4LLNA 4QM9A 3KP5A 2Q8KA 2JPBA 2BYVE 2G7HA 1SEFA 4A6EA 4HSJA 2JPCA 1W7PB 3M9AA 5A2QK 1F9NA 1K79A 2FXAA 3L09A 4MGKE 2LF8A 3FFQA 2ADUA 3IKVA 1R5GA 1KU9A 1I1GA 1ZYRF 1FYMA 4XFFA 5HS9A 4LK1F 2EFQA 1BC7C 2P5LC 3CJNA 4OMZA 1QY4A 4XFCA 1IZ1A 1W7PA 4G6DA 1HBXG 2DFIA 2ETEA 1TQIA 4WXCA 1KYZA 3TNPB 1QNTA 2R3SA 5JSPA 2B0LA 3FMRA 3WTVC 2KXLA 3WTYC 3JZVA 3U0ZA 2BGCA 3VOEA 3HRUA 2NYXA 5F6FA 1RI7A 3IKTA 1Z6RA 3F6OA 3C3WA 1FP2A 2LDUA 2FOKA 3QP5A 2H09A 5E8GA 1TW3A 1DZRA 1QPMA 1XD7A 2PN6A 4HN1A 4PIYA 1REPC 1ODDA 4QWQA 1S8NA 2RV8A 3EQEA 3GVAA 4KWJA 1MJ9A 1WQ2A 3SHFA 1W4MA 3HSFA 1OYIA 2Q30A 1CAXA 1G3YA 5FLXZ 3ZMUA 4QGMA 4EQQA 5JSOA 4G7ZF 2V6CA 3FZVA 2MA3A 2GA2A 3F8FA 1ZZCA 2ZKZA 4R1HA 3KP4A 4WVZA 4JQFA 3KETA 3HRSA 2CQKA 2LF7A 1BI0A 1U3EM 3I5UA 2O8QA 1VR3A 4IRHA 4N0BA 1CAWB 5BPDA 3F3XA 3I71A 5HS7A 4KIBA 2EJRA 4IEVA 4Q47A 1Y3TA 3K69A 3H1YA 1LVAA 2D93A 3CUOA 3R0AA 5FQ0B 3JSOA 4I2OA 1XSDA 4N9HA 3U2RA 4L9VA 3F6VA 2Z69A 5ILVA 4DNCA 2K0GA 4OLLA 1PMIA 1IPJA 2NRAC 2ATFA 2EFOA 5ILSA 1XB4A 2K02A 4RGRA 3EUHA 3G7DA 5F1RA 2JRTA 4RB1A 4IEOA 3S2WA 5I91A 4Q5SF 3S7IA 5FQ0A 1J59A 4Z07A 4UVAA 4IHSA 1ZG3A 2DT5A 4X6QB 1T6SA 1KU2A 4P9UA 1RL3A 4IEYA 3F23A 5K1YA 4WZCA 1XMKA 1VP6A 1OKRA 4HDUA 1QBJA 3GF2A 1LDDA 4WF2A 2D5HA 3E97A 3LFKA 4DQ2A 4O9EA 1YLLA 2IW5A 2H0VA 4HBNA 3GLXA 2XLFA 3HRMA 2HEOA 5E18F 3OF1A 1V3FA 3V4GA 2JZYA 2BE5F 1LEBA 3B02A 5DYMA 4ENNA 3L2CA 4KN4X 2H27A 4UBHA 4P9GA 3ML6A 5FD6A 4Q29A 4XBFA 2EAAA 1LDJA 1QO0D 3WTUC 2HQRA 4LUKA 5K5QA 2D2WA 2COMA 2QYOA 1YLFA 1NHAA 1RGSA 2FNAA 4MHGA 1OD5A 2YX4A 2P8TA 1WSUA 2EA4A 4J1XA 2XGXA 3PFIA 3I64A 2ZMEA 4P5OA 1YWKA 3R0JA 3NQOA 1FPQA 5I0TA 4CO8A 3MWMA 4IEQA 1WWXA 3I58A 1YFWA 1V4RA 2GZWA 4HVQA 1O7LA 5FLXK 5J8FA 4RAYA 1CAUB 3FXUA 5D4SA 5HDNA 3ZMTA 1X7NA 2MH2A 2FQPA 4KU8A 1ON2A 4R52A 4AVBA 4JTOA 4UVCA 2UZKA 2N7GA 1S3JA 1T2KA 2FF4A 4A0ZA 2QVOA 5BXXA 5H20A 4LJZF 2O6GE 4E2SA 5C6CA 1SD6A 5DD4A 3MFKA 6PAXA 1RUOA 4MX3A 3IL2A 1HKTA 4H7LA 1XSXA 1UHWA 1K78B 4BNCA 2IXIA 1XN7A 3BPXA 1KGSA 3ES4A 3L7WA 2DQRA 4B09A 3T0YA 1ZGJA 1TLHB 1Z7UA 5C8WA 3GFIA 2O0YA 4EGZA 3QPHA 1U5TB 3TQNA 2OU2A 3Q9SA 4HZFA 1X8EA 1UB9A 1OR7A 1CX4A 4MEYF 1ZG1A 1U8RA 2Q0AA 2K86A 1YW9A 3DF8A 1J9IA 3RYPA 4GCVA 4IHTA 5T3NA 5D8LB 1UPIA 1SD5A 5LEJA 1R22A 3PLQA 4EJOA 2TDXA 2XAFA 1BJAA 5I8TA 1G3WA 1O4TA 3SCHA 3I7DA 1B59A 3C1DA 2VBXA 3JSPA 3CEWA 2YSRA 3DKWA 4BQAA 1AWCA 2UY9A 2XAGA 4HV5A 3JW4A 4U0WA 2E7WA 3ERED 2XHKA 2HTJA 2EK5A 5BV6A 2K7LA 1E17A 3DV8A 5HI0A 3BPVA 4WX9A 2O03A 3QOPA 2QJVA 2ZJ2A 2EFWA 4RS8A 5K5RA 1O3TA 3E6MA 4RB0A 2ET1A 4N9IA 3KMHA 2CG4A 1QQIA 1FP1D 4HF0A 3J80Z 3TDZC 5LRSA 5ICEA 1AOYA 1S7AA 3EHKA 3R4KA 4RB2C 3MYXA 5K8SA 4CXFA 4ZH4F 3O14A 1B4AA 1STZA 3WU1B 2MLGA 1IN8A 1IUYA 2PEXA 5FLJA 4H0EA 1HKSA 1BBYA 3BJAA 3R6SA 3WODF 2GC0A 4E70A 3D5LA 3CO2A 1SFNA 4KU7A 1KQ0A 2L3DA 4ZYDA 4EVIA 5FLIA 4HN0A 3GX4X 1Z05A 4HMZA 1IXCA 4MGYE 1QZZA 2E1CA 3DXJF 4KWKA 1R36A 2QZ8A 4BHPA 4CICA 1ZZ9A 3BB6A 2B8MA 2Q0OA 3SCFA 1T98A 3KZZA 3ZMSA 5FFZA 4RGUA 4LUMA 4PJYA 1B9MA 3H92A 2ZBKA 2XROA 4M9SA 4ZYGA 1SQ4A 4OIRF 3ECHA 4YNIA 3CO6C 1YQAA 3UKNA 4I0AA 2DK8A 4L0YB 3PVBB 3H1MA 5LRRA 2FU4A 2PG4A 4BAYA 1B9NA 2A07F 4NQWA 4KN7X 2ZKLA 1UD1A 3ZP5A 2V1DA 5KHKA 3ZMDA 4KWLA 1E2XA 5CVJA 1OPCA 1IN5A 2Z2SB 3W6KB 2IXJA 3V7RA 2E9QA 3KP6A 2XRNA 3I4PA 4MGRA 5ICCA 2Z3YA 4FT8A 2VT3A 2CSOA 5TJJA 5FD5A 2IRFG 3BCWA 4HLYA 3JTHA 5CYVA 4Y17A 5BY5A 5CLSA 1ON1A 4KIFA 3E5UA 2HTSA 4JVAA 4CYDA 5FGMA 4AD9A 2JSCA 1FI2A 2CAUA 1ZZBA 3IWZA 3TO6A 4IEZA 1SMTA 1PUEE 3HHGA 3J80K 2P4WA 1J3PA 4AQ2A 5J3UA 3KCCA 4TV7A 3TO9A 3ULQB 4O3MA 4UVBA 2GH2A 2OZUA 1R5HA 3QPTA 5D1IA 4S05A 3MZYA 1Z1DA 3QACA 2QWWA 4I01A 4A5MA 1GQHA 4FBFA 3TOAA 2F5FA 3LA7A 2F5CA 4QX5A 2VC1A 2FSWA 4R79A 3WTXC 2GIVA 2QLZA 1RZ4A 2QQBA 1OI6A 2RKHA 2O8XA 3K0LA 3TNQA 2GA1A 3LA2A 2LNBA 2KIFA 5D8KB 3K1PA 4A12A 3KSCA 4LEJA 5DDGA 3ELKA 4XF0A 4KT5C 3M1EA 4EMSA 5E1RA 3T5XA 4MV2A 2QNKA 3PQKA 4U7DA 4Z82A 3RI4A 4A0XA 1L0OC 1FYLA 2M5WA 1ZG5A 4XSXF 1J5YA 4LULA 2QQ9A 2A69F 3BP8A 3MCZA 1ZGAA 1CF7B 5BPIA 5E20A 1J2XA 2V9VA 1BIBA 1UFMA 3OOPA 5LGTA 4HX4A 5DCMB 1D8KA 5DEQA 2WFPA 2OZJA 5K5OA 4CDGA 2HWVA 4Q0SA 2ELHA 3CLPA 4A6DA 2A6HF 5CJ9A 4OU0A 3H9AA 3FHZA 4HV6A 4EJVA 5FO5A 5FLHA 1IPKA 4XFHA 5JSRA 3U11A 2HJIA 2UXXA 3H3ZA 1G3SA 4GO1A 1IRFA 2KJCA 3M3IA 5EFUA 4EWAA 3D0SA 2AXLA 1TQ5A 1WGPA 3L9FA 1HW2A 4L18B 2IXKA 4GXOA 1O5LA 1A04A 1YFXA 2H94A 2IPQX 5HOOA 4AIJA 5I0SA 4RAZA 1DGRA 4XRFA 3OCPA 2IA0A 2QQAA 1IXSB 1HSJA 1USSA 4YYOA 3T1BA 4UBGA 4P55A 3C3VA 4KA4A 4A2UA 4LLGF 4XF3A 4Q0QA 2HS5A 3HTSB 1KA8A 2R7FA 4O5VA 2DPUA 2M45A 1BN5A 1GVJA 4EJUA 2P17A 2YR2A 2PAKA 5DUKA 2ZXJA 4HYEA 2CFXA 2DBBA 3L00A 3DL3A 4BYYA 4JBAA 3LAPA 2J5PA 3DFGA 4OIOF 2KIUA 2MPFA 3H1WA 4TLFA 1J0RA 1QGPA 2PAEA 3L2HA 1KQ8A 4XLNF 1Y9QA 5JI6A 3GXOA 4L9TA 1MJBA 1LDKB 3QP6A 4Q0UA 2UWMA 3I0TA 4HSLA 1LB2A 4ASNA 4U0VA
chains in the Genus database with same CATH superfamily
4ARXA 1MH3A 5FY7A 2BOLA 1KDKA 1X1DA 2L54A 3M70A 4PDWB 4IE6A 1OFNA 3SHRA 1B72B 3OIQA 1D3YA 1RIRA 1CAWA 2BGPA 1Z21A 4UFJA 5FZ0A 1FMD2 4AHYA 2IT0A 1W6PB 4E7ZA 1JUHA 1JKOC 2BZTA 1JXNA 2HLEA 2RHPA 2ZXHA 2WNEA 4O6JA 2XJTA 4CCCA 3KE2A 2H1KA 5E3LA 1SFXA 3JD73 2EA2A 3CD6I 4C91A 3SCGA 1JHFA 2FA5A 2M9HA 1PO23 1XXNA 1OOPA 1ZBE3 3FBNB 1COV2 2ZSHB 2CQQA 4CUAA 3DECA 3AKSA 4HSRA 3U9GA 4I98B 2AENA 5ED4A 1ITYA 5HDGA 3EJKA 3FHIB 1OH3A 2FEZA 1VIWB 4I3PA 5FPBA 1LFUP 2MABA 4S2GA 5LLQA 3ZPLA 3DUIA 3P3PA 4CUBA 1X58A 1K42A 1I3HA 4I02A 5KHGA 3RJPA 3PIPF 3BY6A 3JCUC 3ZN1A 2WZPP 4P9IA 2YY1A 3Q0VA 3FX3A 2DCTA 2HR3A 4C90A 3VDCA 4IEPA 4EV0A 3RZZA 2HOEA 1CAVA 2ZX2A 3WV6A 3VB2A 2VW1A 1Y1WJ 1NG7A 4GJZA 2HYKA 4GA9A 4O9GA 3U1DA 1R1A1 2K2SA 2VUDA 4L2NA 5FRAA 2DFFA 2P3IA 2GBYA 4G3YC 5LBBA 2P34A 5E1ZB 5JPMB 1ODMA 1ZYBA 5F39A 1PIV3 9ANTA 4D8MA 3BTJA 4MG2A 1UAIA 4HOBA 3BR0A 3HEIA 5IYCJ 1CAUA 4TWTA 1JHNA 2LKPA 4PLOA 3ECOA 2R1DA 4XL9A 1ZH5A 2DCJA 4BL0B 3CCRI 1APLC 4CP9B 3WP5A 1WI9A 4RM3A 4B3NA 4OOIA 3HQXA 1GV2A 2IGOA 5TGTA 4B48A 5F6LB 3NV2A 4DZJA 4W6XA 5FZMA 2ZX4A 1J3QA 3JRBA 1VQNI 4B44A 5T55A 3M4FA 4G12A 1DGWX 2XAJA 4ESBA 3DGTA 3V7CA 1FV3A 3ZKUA 2OD5A 3OV8A 1O4ZA 1A78A 2X5IA 2WO3A 3RYKA 2XASA 4MEXF 2IFWA 2YFZA 2DFEA 3SLIA 4AYBA 3ZIXA 1MEC1 2VTXJ 3S57A 2NS7A 2NVQJ 1JU3A 1MNEA 1F1ZA 2PFBA 1JOPA 2RM22 3BTXA 2PI0A 4GH4A 3VBUA 3CUQB 4LORA 2Z16A 3OYLA 2O61A 4IUGA 3GTGJ 1H8TA 1HKQA 4IE5A 5GLZA 3INAA 3H8OA 4LO6B 4BE1A 4FPHA 3RJRA 1ZBA3 3ZQIA 1VMJA 4GIQA 3I3MA 1Y0UA 2F2EA 3QWLA 4HPQA 4L5JA 2Y64A 2WA0A 4RBOA 3B00A 2VQAA 3ABTA 2BP6A 1G4DA 1FLIA 2ZS6B 2WABA 2V4VA 5M5WJ 2XGEA 3BROA 2XR4A 2D97A 1A3KA 1R093 5H6QA 4FOYA 2G4IA 4N8MA 2A6XA 5C9AA 1W90A 3A0KA 4XYXA 3IWFA 1ZAOA 3POBA 4ZDOA 3D1NI 2QQ8A 4BJ5C 4MQ9F 2X6YA 1LR5A 4YIRX 4ITCA 3CO7C 4CCJA 2I5UA 2C6YA 1KFUL 3G71I 1RITA 2XL9A 5FZEA 5F5CA 2R062 3WHCA 5FOJB 4EROA 2PJRB 2XSJC 4XJAA 2V5YA 2GMPA 1N3OA 1W1WE 4UW4A 1V6LA 1H9PA 2Q8CA 2C9KA 5ACA2 1W9SA 3NEUA 1JOBA 1SFOJ 4JAAA 3RI8A 3WEZA 4DRVA 4IF4A 1VBB3 1A34A 3DEUA 3TP0A 1Y39A 2AQFA 4SLIA 3VZNA 4M3EA 4LK0F 4KL1A 4AAPA 3USUB 1AYM2 3H8UA 1LKNA 5FZBA 1OVPA 4CDXA 1UIJA 3DQVC 1HQCA 5C5TA 2PHDA 3KGZA 4XMYA 4J6GA 3MHZA 5FZ3A 2HBTA 4W1UA 4YFKF 4NAOA 2PBIA 1UMIA 1X3ZB 4OHXA 2JE9A 2RMU2 4AC0A 2KDOA 3D0JA 2OA4A 2V9KA 2QQJA 4Y1XA 2XSDC 3WR0A 1T2XA 2MEV1 2IVIB 4XIKA 4TZDA 2W1SA 4XRSG 1JZ5A 4MTEA 1XGMA 1NAEA 4ETSA 4JGYA 2KM2A 5GLTA 4XRMA 4XLAA 5GPCA 2Z9OA 2D40A 1AJKA 1QZYA 1U2WA 2D44A 4CZZA 2AREA 3ABMH 4CDQC 2P7VB 3ZQCA 3R0RA 3D3AA 5FCCA 1WLTA 2W57A 1RETA 2B5HA 1TQPA 4GDFA 3WG3A 5F6KA 3ZO0B 4Y1UA 3VDDA 2QKLB 2MFZA 4HNUA 1EP0A 3FHQA 4LKDA 1QJFA 4M3BA 2EXKA 2GM4A 1AHDP 2CGNA 5B2GB 1F36A 2M4GA 2VMIA 1S2KA 2HQNA 1QOTA 4XJ8A 4XN3A 3A0BC 2XOMA 4BLJA 3ZFEC 2JDPA 4M3FA 2XJSA 3WT3A 3BJ6A 4BXUA 1OBNA 1FC3A 2A3XA 5C4WB 3V0BB 4ZZDA 1C8NA 2BVBA 4MGSA 3Q9VA 2JG9B 1LEAA 2V7FA 1JZ4A 1J3RA 2QDRA 2J1RA 1WGXA 3PO3J 2FZ2A 2VW2A 1E3PA 2ZJCA 3F95A 5KCMA 5DAXA 3MKLA 4HF1A 1HXDA 3JAMK 2R7TA 2XL7A 1TWFJ 3TKYA 3UK9A 2JA8J 1UZCA 1SAUA 3VB9A 3BIWE 1MBGA 3AAFA 2VZUA 2ZGNA 5D5WB 4LO5B 3IBMA 2BUKA 2G0EA 4KBZA 2WIIB 2DT6A 2HVRA 4KBBA 5A3LA 1VQ7I 4I0WB 1SACA 1Z7S1 2YU3A 1ZRRA 5FJHA 2KMUA 2O0OA 4I0BA 2BDRA 4QPGB 3RIRA 2XUBA 2KL4A 2YC4A 1GQGA 3NNGA 2DA3A 1DDLA 4HF2A 1HDDC 4YGDA 1E5HA 3CCVI 4XUQA 1VQ5I 3DPLC 2LP0A 4IVNA 2JICA 2MC3A 2Q2EA 4C1WA 1W0PA 3WNXA 2W87A 4NUBA 4MXWB 1F4KA 3W21A 5A6XA 2ZJPF 2P5BA 2KJBA 2VT2A 5L3CA 4ZONA 4OI2A 2EF6A 2CU7A 5FXVA 1WD3A 1USTA 5IVJA 4JX0A 2AHQA 1IDZA 2DA4A 4UT5A 5D6EA 3OYWB 5LEKA 1X19A 3LWFA 3HZJA 4CSWA 1FTZA 3JRAA 4DOUA 3CTAA 1R082 1NZIA 1K12A 1BI2A 2CGPA 1KJLA 2UYAA 4LG0B 5IT3A 2HKXA 4WVMB 4UB6C 4A3XA 5EIYB 2NVUB 4ZDPA 5IFTA 3FM3A 5FYSA 1DG6A 2UYBA 4RQPC 3F0CA 3R05A 1YW8A 1EY2A 1MZ6A 3FDYA 3T2TA 3OYMA 3KEOA 1PP8F 4G8XA 4HQMA 4FPOB 3UKVA 1AR61 3NV1A 1ZKGA 1YJLA 4AVZA 1VBA3 2VBWA 2F4PA 4KICA 1MMDA 3ONQA 1QVUA 2DTRA 2ZMNA 4B3AA 3J7HA 2UWCA 4IHWA 1LHOA 2FBHA 2J22A 2JJ6A 3KV6A 4GKXA 4XAEA 3WHTA 2A6YA 3UNPA 4ESFA 2HFHA 1I1EA 3ZQLA 3WE3A 2LREA 3E6CC 3ZXFA 2E19A 4NC7A 1E57A 4DGWB 2XJPA 4Y13A 4AGRA 3O1RA 1IN7A 3ABLH 5IY5H 3TOBA 1ZX5A 2HQ5A 1XBFA 1HN1A 4BWOA 2WZ8A 3VGIA 5D6FA 4E7KA 1Y0NA 1C8M2 2G9WA 4EATA 4IL6C 1BJQA 2ZGTA 4QPYA 2W47A 1A36A 1UY2A 2ZGSA 1LOFC 1KXGA 1CPMA 4SBVA 1W0NA 1W8ZA 4DXTA 4IE4A 4CA0A 2V1UA 4XLCA 4MQVA 3LEMA 4MFEA 2M3AA 1D2QA 3K1NA 2GQQA 3MIGA 4YG6A 1FOYA 2OJED 3P9IA 4DFSA 3O8GA 1DZQA 3WDYA 1OC1A 4V2GA 3EETA 4ENKA 4G6QA 3K4JA 2K9SA 4G6TB 5JXJA 1P4WA 2CUJA 2VBBA 4WCGA 2M4KA 1RUJ2 2K46A 2BY0A 1X33A 4R4XA 4AYBN 5JFRA 3V42A 5F1JA 3LD8A 3G1OA 5FRMA 4YM0A 1N3PA 3KFWX 2VY0A 1CQ9A 5FUPA 4QPQA 4EQVA 4BEHB 1P92A 3EO6A 4BQ2A 1XPWA 3GO5A 2PQQA 1BCXA 4INDA 1YI7A 2RGVA 1HSTA 1OLME 4W6YA 3NSTA 4A3FJ 2XAHA 4GQ7A 2FMYA 1W9WA 2NAZA 3O2PE 4IRGA 4HVOA 2Q8OA 4AEDA 1Q56A 2GH8A 3BIEA 1O8PA 1LU1A 4AWXB 4YIFA 1YTYA 2DWRA 4AXOA 4DIQA 4RL7A 2GLOA 5CBLA 3VYUB 4YWAA 5D4RA 3PNVA 3ILRA 2PMWB 4AVAA 3F8BA 2WC2A 4AQ6A 4B8XA 1KITA 1Z91A 2AXTC 1IRZA 1NKGA 2W84A 3HPGA 1H30A 1JU4A 4JQTA 1ULFA 3V56A 4IETA 1XSQA 3MFAA 2YGLA 4A3EJ 1ZRDA 4GMP0 2HWD2 1ZR2A 4LHSA 2LY1A 1VRH3 1K6YA 3LSJA 1U5TC 1SANA 4CVUA 3N05A 3M8FA 5C44J 4JV4A 1IRGA 2Z1DA 2E53A 1I3QJ 2LALA 2IS6A 1E3OC 1XE7A 2VBDA 1N3QA 1SFPA 5F5AA 5I8SA 4CH7A 3KB5A 4FTBA 2XBO3 2ILMA 2VPVA 1ND2A 4E7SA 2R072 3O6BB 1HC8A 4N43A 2WNOA 2GU9A 4CHUA 3PMSA 3IRQA 5KHIA 2HYFA 4IPAA 4KUMA 2WAOA 2ISYA 2OAZA 1LJ9A 1UNBA 1BI1A 4GD4A 1O7FA 1D4M3 5DV5A 5A6QA 2RS53 3ZMZA 3S14J 4ASMB 3SH4A 1VBD2 5JR7B 2VC0A 2FQ4A 3G73A 1WKMA 1W05A 2JDKA 4E8CA 3Q9OA 3ZSEA 2A5YB 5J3LA 3WGIA 5I0UA 4Q4Y2 4CU6A 3GTOJ 3C7GA 4MUVA 3HIFA 3OD0A 1UZYA 5A2QZ 1RUH3 4RSUA 5H6RA 2JEMA 3K2AA 1PK6C 2WY8Q 4GB31 5FWEA 2GC2A 3G6EI 5A7OA 5DZFA 1T38A 2BV4A 1EA3A 5EQUA 3ZQGA 4F52A 2L9RA 3H50A 4B1LA 2YU1A 1UMZA 3K77A 4R9AA 3WDUA 2AYHA 4HX8A 3IDBB 5L7OB 4WXDA 3NWSA 2GMMA 4AQTA 3ZYFA 2LUWA 2VJ4A 4U7BA 3MW3A 2E36A 2X85A 4GRIA 1QVTA 4AOCA 4M3DA 2ZHMA 2LMDA 5F64A 1TZOA 3J7AO 3K10A 3R4SA 1Z9CA 3GMEA 3I2DA 2MD0A 3HL2A 4ZU7A 1YIOA 2E7QA 2R30A 3FXKA 3FMQA 5B3SH 4LLLA 4DEVA 1NK2P 5EGOB 5FMOS 2DVBA 2V6EA 5E16A 5A3WA 5LCWL 1K4TA 5CU1A 1VLNA 2A5WA 4LE3A 1A8MA 4YARA 2WAAA 3FM5A 1ZLKA 1WVRA 4MH0E 1KS4A 1V70A 1VAMA 5C3SA 5HV4A 5LBQA 1SEUA 2D6KA 4AK3A 1R4MB 1XSVA 3VKFC 2KIQA 1JXSA 3GCMA 3GJBA 2NMNA 4NHMA 4HXCA 5LHIA 1RUF3 3MEXA 3P6BA 2WV1A 4OHVA 1G8XA 5CVVA 3F22A 3J7ZI 4BXXJ 5JXGA 4JQRA 2JA2A 4PCRA 4LITA 4MSVA 1A6IA 5EJCA 1WWYA 2QQOA 3GTQJ 3IAM2 1W7PB 1WZ2A 4FPYA 3WP6A 2XXZA 1W8OA 3MPPG 3W59A 3L09A 2LF8A 5FPAA 2Y60A 3FFQA 3N7MA 1NTCA 1VI0A 4KH9A 4XE9A 3IKWA 1FYMA 4XFFA 1QIQA 1BC7C 5FRNA 3CJNA 1R1A2 2LC2A 1IZ1A 3BTCA 4P08A 1HBXG 2ZAAA 1VQPI 2DFIA 2LTNA 4X8NA 4LXLA 2CL2A 1DQ6A 2RS13 3POYA 3SDBA 5CQGA 5F2SA 2JVHA 2B0LA 3FMRA 4XK4A 2O14A 3OBRA 1RRJA 4JDOA 4FCYA 4JGZC 1VPHA 1A6CA 2Z79A 3U0ZA 3QCWA 1RI7A 3AL0C 5FZ8A 1FP2A 1UY3A 2LDUA 3M8JA 3AKQA 2H09A 3PUSA 4CE8A 2CV2A 3AMQA 3S30A 2PN6A 2VGDA 4XURA 4DUWA 2DU0A 3H9QA 1NQJA 3EQEA 4A3KJ 3WF4A 4KWJA 2Y9YA 3FHNA 1W4MA 3I4IA 3DXUA 5HCFA 3PUHA 1CAXA 1G3YA 5FLXZ 1JJ8C 1YCIA 2LKXA 1U5YA 4LKFA 3IMMA 1JI6A 1PNFA 3TRSB 3SISA 4WVZA 2JE7A 4PJJA 4KI5M 2QQKA 3I5UA 2B9VA 4WM7B 2A70A 3FKJA 5T50A 4IRHA 2QE3A 1R71A 1W6MB 3F3XA 1I39A 1MEC2 3LFUA 1ULPA 1Y3TA 1LVAA 4C3IJ 2D93A 2VNVA 1VBE1 3FKIJ 3E7LA 4L9VA 3ZYGA 2Z69A 4DNCA 1NA1B 3GZAA 5GAEJ 4YRVA 4RHV3 1QNYA 1REFA 1V0AA 5ILSA 2VKVA 1U5ZA 1AXZA 2K02A 3T0DA 4RA0A 3G7DA 4XMAA 1AKHB 2ZAHA 2JRTA 4ISRA 1APNA 1IV6A 3HC7A 4Q5SF 3SEEA 3IDEA 5DDJ3 3N9NA 3DBHB 2DT5A 2WN3A 1HRV1 4IV1C 4Z8BA 4CPBA 1QOOA 1KU2A 4D9JA 1KGYA 3APBA 1BBT1 5FPVA 2RR11 1RYYA 2DA1A 4DYQA 2WYSA 3PIGA 1OKRA 1FTTA 1GOHA 3THDA 5FLVA 1JYWA 4MADA 2MG4A 5A3MA 2FDKA 4DQ2A 4HBNA 3GLXA 3AYEA 2BGOA 2XLFA 3HRMA 1MMGA 3HNYM 3OF1A 3UJOA 4PFPA 4B8EA 4UBHA 1UYYA 4XQFA 5FD6A 4IXLA 1WMXA 3PIJA 1QO0D 3POSA 2W39A 2COMA 1QHDA 2QYOA 1YLFA 2GNDA 3FLRA 2FNAA 3BG3A 2ZEYA 3CLQA 1W6OA 1W6NA 3B9CA 3WD5A 1MBHA 4YW5A 2O9LA 3ACIA 2TRTA 1AR81 5EYYA 3MWMA 1MBKA 2D3SA 4ITVA 4ZC3A 3HPNA 2BWCA 1O7LA 3ABZA 3EXUA 4A3DJ 3A4UA 1X7NA 4XKVA 1XYPA 2MH2A 4KU8A 1MS8A 4KGGA 2NVXJ 2F17A 1VRBA 1T2KA 3A01A 1UMQA 2QVOA 5BXXA 4LHLA 4E2SA 3BCBA 4OQ8A 4Z6YA 3JB4C 4COZA 1RUOA 3AZXA 1UHWA 4BNCA 1N1YA 3NMBA 5CPRB 2D6PA 2BQPA 2LVSA 1M4WA 2DQRA 4BBSJ 3KEYA 1W2AX 1R5ID 1TLHB 4HOOA 3M3OA 4FQ4A 1MS9A 4P9XA 1ASJ2 3A4CA 4C2UA 1S0EA 2Q1FA 4BXSV 2KP6A 1IGOA 2OT7A 1ZG1A 2XF5A 2BY2A 2DF7A 3J7YJ 1E5RA 2HWC3 1KQRA 2MEV2 1WA6X 1UPIA 1SD5A 1JGGA 3HBKA 2M8GX 2TDXA 2WSVA 5I8TA 1G3WA 3U1KA 3C1DA 3PL8A 3OBTA 2YSRA 5LA2A 2ZHNA 4RGAA 1AWCA 2E7WA 2R16A 2XHKA 4XJ9A 1SLTA 5EZHA 1POV3 5ISLA 2K7LA 1E17A 2CUEA 2AGSA 5C8CB 3RS6A 4EYUA 2EFWA 3RWKX 5F37A 5A70A 4RB0A 4HEA2 1HKDA 2CG4A 2YZ4A 4UFMA 5FIXA 1FP1D 4HF0A 3J80Z 2W1UA 5LRSA 5ICEA 3W58A 3ZXGA 3EHKA 2ZXIA 3K70C 2XB6C 3FLPA 5FYCA 5JOXA 5K8SA 5FUNA 4ZH4F 1B4AA 3IZOA 1L7QA 2CY6A 2PEXA 2Y6LA 1YO8A 1Z77A 4Y4RA 1HKSA 3DPUA 3R6SA 3WODF 4E70A 3D5LA 4Y1VA 3ZXAC 1NK3P 4C9YA 2VMGA 2AEYA 3WUDA 1IS3A 2EXJA 3SEQA 2VCAA 5IPAA 3OSDA 1V6IA 3BI3A 1X4PA 5AFBA 4FO9A 3FBIB 3LNQA 2ZJRF 1AR73 5FFZA 5HBAA 3UESA 4YPJA 3VD9A 2LROA 1X3WB 3OYGA 4LUMA 1RVF1 2VPLA 2J1EA 1FMD3 3WX5A 2F5VA 2HWB3 2L9VA 4ZYGA 1SQ4A 3WDWA 1OT5A 1Z7S2 1ACCA 2DA7A 1UHSA 1OQDA 4YNIA 1YQAA 3UKNA 1DLCA 1ULEA 5EG0A 5HPOA 5JZGC 4KWUA 2YBPA 4KN7X 4DMIA 4Y52J 1UU6A 1TWHJ 4TYSA 2GN3A 2V1DA 5FY9A 1COV3 2AC1A 3OYIA 2E34A 3IH3A 3MW4A 4FP3A 1ZGWA 3NJYA 1IN5A 3LQCA 2XRNA 3OYBA 3TN92 3V65A 1QQP1 2PLV1 1KJRA 2X53S 4B7KA 2HWE1 2CSOA 4CDQA 2EZIA 2IS1A 2VM9A 3BCWA 5JUVA 3JTHA 3NARA 1YOVB 4KIFA 3H0GJ 4BE2A 2HTSA 1QOSA 4CYDA 4AD9A 1FI2A 1QJY1 2DDBA 3TO6A 2K5CA 4A93J 3SJMA 3HHGA 5CKQA 3I9V2 3TO9A 4O3MA 1RKTA 4M3GA 3HAGA 2GH2A 4BMEA 3ZFEA 1OUSA 1GV5A 5TISC 2OUHA 1Z1DA 4A5MA 1K4SA 1GQHA 2F5FA 5FO7B 1FPN3 2G9FA 2CH0A 2GIVA 1RZ4A 1OI6A 4B4RA 2RKHA 3K0LA 5DAQA 2HOSA 1AR62 3K4AA 3POGA 5EYRA 3H9GA 5FZIA 2WNUB 3LA2A 4KJZA 3KSCA 3H3LA 4LEJA 2RQQA 4KT6A 4II2A 4A3ZA 1PZ9A 4EMSA 1OFSA 1GDTA 2DBNA 2HWF1 2CUFA 2LRPA 2B7YA 4FISA 3LDBA 3PQKA 3O1TA 1POQA 2DDUA 1L7LA 1YITI 2WS93 3AZZA 1FYLA 3GTPJ 3AKTA 3B7MA 1FOD1 1ZG5A 5LY1A 4LULA 2R7OA 3BP8A 1MBEA 2DCKA 2XF7A 3OBAA 5BPIA 2VL8A 2V9VA 1BIBA 3OOPA 3KYCB 5F27A 4GAZA 4HX4A 3E0JB 2WFPA 1IO2A 4CDGA 3NNJA 3ZXSA 3OUJA 2X8KA 1GOGA 3V0AA 1OCTC 4A6DA 5C3PA 2WBKA 2A6HF 2ZHLA 3MIFA 4OU0A 3C7OA 5FO5A 5FLHA 2ZHKA 3K4NA 4CCKA 3U11A 5FKKA 2TNFA 4QPIB 1PO13 2UXXA 1G3SA 2XUMA 3I49A 1UJ8A 3W2VA 4CCNA 2RM23 3DEWA 1C5IA 2RREA 4A7KA 2AXLA 4FTEA 1WGPA 5CFDB 3L9FA 5C3EJ 1HW2A 4O61A 5A3UA 3WQBA 1DBNA 3ZSMA 3VZJA 1CR7A 3KD4A 5HOOA 4AIJA 1JUSA 5I0SA 2IA0A 1HSJA 3ZYHA 4PQQA 1MVEA 1P8JA 2JD4A 4LBQB 1PO21 1OLMA 2HS5A 3AXDA 2K9MA 2JUGA 1ZBE1 1WJAA 1S1AA 1TME3 1GVJA 2B7EA 3J26N 2W52A 1ENXA 3L2YA 4YVSB 4QDQA 3JRIA 1HJGA 2JG9C 3TWIA 4BYYA 1HQWA 4JBAA 1W8HA 4OIOF 2KIUA 4TLFA 4RQPA 1QGPA 4K6BA 1MJBA 4RFRB 3I0TA 1FIPA 4I99C 4PQ9A 4OI0A 4RGGA 5LA9A 4BU2A 4E27A 5J48A 2EAKA 5LK7B 4KIGA 2V09A 3IP4B 2F4OB 1BKZA 5LD2C 4C2MJ 1LOGA 2L02A 1B1BA 1JT0A 4YGCA 5CB7A 2HDDA 2R063 1NG6A 2VG9A 1XGSA 3K4KA 2FDHA 1OCPA 2DFBA 3A0HC 2FRHA 3GBGA 1UU5A 1WPKA 2YPDA 4DW6A 1VAKA 3RTRA 1U12A 4R9BA 5ACA3 2X4HA 1VQ8I 1RUG1 4META 4HKOA 3HQRA 2FHRA 1PDNC 2CQXA 2FDJA 2ORZA 2F5DA 4UF0B 3WQ0A 1JUIA 1DFQA 1QJX3 3THPA 4BLIA 1BK1A 3JR9A 2BHYA 1LOFA 1HB2A 1VQ9I 3KP7A 1UHMA 3L2VA 4M3CE 5DN2A 3GCXA 5LK5A 2XPJA 3OD4A 2IEKA 3U07A 2AACA 2RAEA 1AYM3 1C1FA 4RS5B 3IH4A 2ZGLA 3MZ8A 2ESHA 3MV11 1CAVB 4Q4W1 5I0RA 2NMOA 4OZXA 3ME2A 2E7XA 3HRTA 3RPUA 2L01A 4LBLA 1I5ZA 3B6CA 2A6VA 3CCEI 3A0NA 5LHGA 4E4HA 1H2KA 1XYNA 4LIUA 3N9MA 4S0HB 3PM1A 2RMU3 3ZXLA 3AL5A 5CEHA 4I76A 3G1LA 3OWTA 1JZ2A 1FX7A 4XAAA 2E1MC 1R1TA 1DGWY 5ICFA 1AF9A 5CVRA 4GB32 4MVTA 5ABJB 2ES3A 2QZ2A 3M1HA 2KRFA 1CQTA 1D0GA 2QKMB 4KFCA 4OFGA 2CDPA 2GN7A 5GZFA 4QQ2A 3LSKA 1LODA 2NVTJ 3HOYJ 1CIYA 1QJZA 1YJKA 2LRDA 4ORFA 1SDWA 5F0HA 1V5EA 2ADDA 2EA7A 3FL7A 3SNMA 4A41A 2CNAA 1T39A 3Q8CA 2W85A 2VNRA 2VO5A 1QXJA 1P7JA 3SYTA 4Y15A 3ACGA 2ZJQF 2CV6A 3WVJA 5J1UA 1ZBA1 5KXCA 2DFCA 5B4XA 5HS8A 5E88A 5M0TA 3KF5A 4XDPA 1F5FA 1TBXA 2VMEA 2LK2A 4ANJA 2XPWA 4LO4B 3DEEA 4JC1A 1EH7A 5FY8A 1K78A 2KFDA 1V6OA 2ECCA 5EV7A 4XFAA 4EJWA 1BI3A 4UWDA 4AEKA 2XWBB 1R091 5F7UA 5FZ6A 4YELA 1Y8QB 3HSRA 2IVJA 4MYEA 2IJLA 4AVCA 1MDMA 3P5BA 3VBUB 1RNLA 1U5TA 5H2FC 3W6JB 4XICA 2R49A 3OYEA 3PJQA 2WY7Q 1PVC1 2IBDA 3QYEA 4LBNA 1W6QA 1V5GA 4Y5Z0 3LSIA 3FF5A 1KYWA 2VZVA 3AKRA 3OYHA 5L3FA 3QQAA 5IOYA 1EPZA 1KD7A 3O8HA 2BNNA 4MGQA 4XSZF 2EV5A 2JENA 2DU9A 3PVOA 5JMCA 5KVRA 3I3EA 3BTIA 5FFXA 2UURA 1DYOA 3QRFF 2MLKA 4PIZA 4QPOA 5BNOB 2GXGA 1DLLA 1Q8OA 1HV0A 1I27A 1SCSA 4OIPF 1JZ8A 3M07A 4XDQA 4NAMA 3CDLA 2ZOEB 3IH2A 4Z92B 2K9QA 1PK6A 2QBYA 2DPDA 1VBC1 4DBQA 1LGCA 4CXWA 3HPHA 3ASNH 3AG2H 3FIWA 1ENSA 1GVDA 4LMYA 2ZGQA 1JKQC 1BEV1 5JXIA 4FFHA 2Z99A 2L7FP 1PVEA 2LBFA 2DMTA 2ZCWA 5JDBA 2IS2A 3DU5A 5KHHA 1JTXA 2VNGA 5KHJA 1XPXA 5BNNC 4YGBA 3OSGA 4L9JA 1LTEA 3DXTA 1XOYA 4AFBA 4CGZA 4COYA 2FDIA 2PA7A 1W39A 1W5CC 4RMNA 4Y22A 2HYXA 2VZ1A 4XJWA 2KA3A 4L0PA 3RRDA 1IAWA 4JDMA 4JOMA 3SXWA 4V19K 1MZFA 2NZ9A 2UY8A 4IEXA 3WQ1A 2P7CB 3FHAA 1EAH1 4BK4A 2VUCA 1Y8RB 3MBWA 1QJU3 5KR7A 3OYJA 4RLQA 1D0ZA 3IDCB 4A3LJ 1QXPA 4D94A 2ARXA 4X8PA 4JDNA 3WDVA 3C8XA 4M73A 4CDXB 1OQ1A 3ZLIA 3D82A 2Y69H 1WCKA 3ZGKA 2ISZA 3ECQA 4K1ZA 4D7TA 1ZN2A 4FFFA 2JWPA 3S2DJ 2VASA 3ZRGA 1T56A 1LENA 4CPBD 1MS0A 3MAJA 1ZRCA 2HZTA 5BS6A 2EPFA 5E8IA 4M00A 1XMAA 1OMIA 2V72A 3C7JA 2UUZA 5LW9A 3GTKJ 4LOTA 1VBE2 4HPKB 3BPSA 5HLGA 2P6TA 1FBUA 3VWBA 4LQRA 1XDSA 4JGYB 1F5JA 1H2LA 3GYDA 2LLKA 2R93J 2B63J 3CC7I 1GNHA 3O0XA 3E3VA 2R6QA 1BZWA 3KGLA 2EV0A 1C8M3 5HXVA 3DLLF 4DS0A 4LBOA 4ABZA 3NV3A 4FPFA 5A32A 2ZA9A 4XKWA 1HRV2 3VD3A 3V8LA 3VDDB 2J42A 1BBT2 4BQ5A 3WW1A 3S2HJ 2RR12 2ZEZA 2Y2ZA 4NNJA 1QXRA 3ON7A 2QM3A 1CZVA 1PM7A 1G59A 3SC7X 1XMXA 3J7LA 4BE0A 4Z1VA 2R1BA 2PTMA 5HVQC 3NJZA 1YX3A 1QNWA 3GBFA 1JYIA 1JUMA 3N3HA 4G9SB 5BOXA 3RQIA 1DPRA 4YG2F 1NG0A 3UETA 3VL9A 1QZEA 1MZBA 2ELKA 4JGZA 4Q0VA 4NWVA 4U88A 4QX2A 4NHKA 2WFF1 1RUJ3 1ZNPA 1ETKA 4N53B 4NDLA 4K7JA 2XIGA 3KCXA 1YX5A 5FKOA 3F8NA 4NMIA 3F8CA 2EZKA 1AHSA 1NE6A 3I2OA 3NL1A 1AR82 3SKJE 2BEOA 5F32A 2VZTA 2VL4A 2J5OA 4GYIA 1XJAA 2COBA 3EUKL 1ZREA 1CF7A 2CO5A 2VQLA 3JQWA 4AFMA 4CUCA 5FZ9A 1GXQA 4XFGA 1KRIA 3S1QJ 1BR2A 2ZXWH 1U8BA 4FPEA 2Y0SA 4TLGA 2VVDA 4MGIE 3FJSA 1TEIA 4FFGA 5AIPA 4XCAA 3GFJA 1AYN3 5J8CA 1PZ7A 2P3JA 5GZGA 4MGTA 3WDXA 4A45A 2CW0F 3AK0A 4HAMA 5LHHA 1HRI2 1GWKA 4LB6B 3RSJA 5HLHA 4ZS2A 3I53A 3U1XA 2VQHA 2DVGA 1RR8C 2R7SA 4CEYB 5FWJA 5AIQA 2DFHA 2Q2EB 3WW4A 3AVSA 2HWD3 1QA6A 4BB3A 1UZVA 3JRGA 2CDOA 4HONA 1T6BX 2ZNYA 4Y33A 4XFBA 1P6RA 1QHHD 2ET7A 4J25A 3VBRC 1WCSA 2QQVA 1ZRFA 3ZFFB 3R4DB 1S0DA 4IV1A 4UFLA 1WD4A 1P2FA 2WV0A 2R073 3N9OA 2R041 4RGXA 2JT1A 1W9YA 2WA3A 2A05A 4C3HJ 1RUE1 4MXVA 4PI2A 4GGGA 1IG0A 3SDGA 4B4QA 4OUMA 2VKEA 2W08A 2BW3B 1RUNA 3PL0A 3WNOA 1RXGA 4OHYA 4XTMA 2B45X 4K40A 3MF6A 3WTSC 2EH3A 3VBSB 4YW6A 2C5DA 2ETHA 3WTWC 2R7EB 1RUC2 2FOWA 4BDYA 5IT9Z 2DODA 5FR3A 1N1TA 1GYKA 1B72A 2XVLA 5LFAA 4AAXA 4L5IA 1R1VA 3CC2I 1V9U2 3AFKA 1FYKA 1G8WA 2IXLA 2W1OA 5J7MA 3EPZA 3CJIB 1W6PA 2E63A 2DJIA 4UXAA 1GV9A 5AC91 2Y0IA 4XETA 2XKPA 2QTWB 4NE9A 3HT2A 4A6SA 2YC0A 2VOOA 1TW2A 3WE2A 2XC7A 3FXQA 2RDQA 3LPGA 3WHBA 4QXKA 1US2A 2E2IJ 4XN0A 4B4PA 3F8MA 2D45A 1K83J 4WM7C 1S4CA 2CS3A 4ZYHA 3NQHA 3OTFA 4NIAA 2FJ1A 2P6CA 3KQRA 2E2HJ 5M5YJ 3CCLI 4J00A 3KV4A 2ZMEB 2CWEA 3ZFGC 4E2QA 1T8IA 1S29A 3CU7A 1NA1C 5ERIA 4MTDA 2DMPA 1SFUA 1U0AA 1RVF2 5FPXA 5JR3A 1OQEA 5F8PA 4RDUA 5T5OA 1W8NA 3DP7A 3VBFB 1SLCA 3VPRA 1C28A 2E31A 3GYHX 1BW5A 1X2MA 2EXIA 2A5ZA 5EZWA 1RINA 2PHFA 2X09A 2NS0A 2W92A 3IAPA 5BUVA 5K0UB 1JHHA 2BZDA 1WW4A 4D6QA 3CMGA 2OXBA 3N9PA 1S0CA 2DMUA 4NC8A 2W1WA 4HETA 3JTGA 4FXGB 3HOVJ 3N4MA 5J4YA 5JIAA 3JBG1 2NNYA 4ZZ8A 2IVMA 1JW6A 4O65A 1O59A 2XGCA 1QQP2 2PLV2 4IKFA 2HWE2 1SG3A 1SBFA 5KK1A 1PNGA 3LDKA 2HYGD 2XLGA 2VE9A 4BOWA 3WU2C 1KZHA 1ONAA 3CL1A 4IHXA 3HR9A 4K8FA 3J7MA 3E6BA 1QJY2 3ZN6A 2D5VA 4CP9A 1P4AA 2A6WA 3CESA 4D6RA 4AEDB 3URFA 3EMRA 1R7JA 3N9QA 5KC5A 4L99A 3VHPA 1TNRA 1LFBA 1TNFA 2XRLA 2VOXA 3OYDA 1R1A3 3TL4X 1QWRA 2J1SA 1HDPA 4AIHA 1BYHA 1H1IA 4XPVA 2L4AA 1H88C 3BG5A 1D4M1 4BDZA 2GIZA 1WLDA 1FNNA 2OF7A 4QM8A 1Q43A 2MHFA 1D5YA 4NHJA 4ES9A 5F3GA 5J47A 4K2EA 4NRMA 5H9QA 1X9TA 4QTRA 1HDKA 1TG7A 4GXLA 1YI2I 5FMDA 2P6SA 1LKXA 1RC9A 1RUH1 3NRUA 1V5FA 3AC0A 4A0YA 1DUXC 1ETXA 5JAXA 4WWCA 2VMFA 2HWF2 1R081 2M30A 1OLTA 3LPFA 2ZACA 5DTDA 1MS1A 5M3FJ 2A75A 3NJVA 4EGYA 4N43B 3U4SA 1FOD2 3B73A 1MZEA 1U9NA 3KEQA 4FPKA 5DUWA 3PFYA 1F15A 3O1VA 2GAUA 1SD4A 4F3QA 1NXD1 3JXSA 3VSKA 1ETOA 1D7PM 1IN4A 5L73A 1CN1A 5JZGA 4PGGA 4BQ1A 4IGOA 4I09A 2XWJB 3OIOA 3M4OJ 4LHNA 3HBLA 4D3WA 1RUD1 2QQPA 1NXMA 1MEC3 4UUSA 1OLRA 2WUHA 3F21A 1GNYA 1ETWA 1IKPA 2OS2A 3O5SA 3TBIA 3C18A 2WL1A 1YQ6A 4C1XA 4JP0A 4BKXA 4JX4A 3HKZA 3VDBA 2QCSB 2PXJA 2WRAA 2IXHA 1YNAA 1N47A 4MO3M 4Y24A 1LECA 4QPWA 5B66C 1K6OA 2PLYA 4XC9A 2IWGB 4GYGA 2VVFA 4AZZA 5E1XA 1PO22 3LAGA 4A7YA 3IT8A 3U4XA 1OYYA 2F6CA 1UXXX 1ZBE2 2PJRA 4XLPF 1EH8A 2QENA 1C0WA 4NPLA 2Q5TA 3S3OA 3JAMZ 3S8PA 3QODA 4XHBA 1EYBA 2O8KA 3HEFA 3RMYA 4DRRA 2R7RA 3SH5A 1MPXA 4FHTA 4CP1A 4Z2YA 3W5NA 1HW5A 3FK7A 1SVLA 4M0HA 1GANA 4UNOA 2F5EA 2K27A 5EWSA 4QXBA 5JVVA 1J1TA 5BNPC 3RVHA 3USUA 3PO2J 3O1UA 4MHUA 5CZKA 3ZVXA 3QH6A 3K3NA 1KFXL 2C9AA 5M3MJ 1VQKI 1MJAA 1TT5B 1LESA 4F7ZA 1TNTA 1TL8A 4B47A 4B3XA 2GNBA 3RPUD 1ULDA 3MV01 3BALA 4G94A 4YM2A 3UT0A 4BXFA 4M3CA 3UKTA 4IZZA 2RG4A 1VALA 4AVSA 4BIFA 1H9GA 3KWVA 5JLVA 4QGNA 1J83A 4HBLA 3LZZA 4FOQA 5FYIA 4MFDA 1Q3EA 3AMPA 4LIVA 3MZHA 4V1PA 1XGOA 3WXPA 4CYCA 5C4XJ 3AJZA 3OMYA 1IHMA 3TW7A 3KP2A 1CONA 3R4UA 5AONA 2RS31 1GR3A 1N1SA 2VZRA 4OULA 4LLNA 3DCFA 3KZIC 2ZGRA 5E3MA 1HB4A 1WJDA 4Q4W2 2G7HA 3H0OA 2XB0X 1XU1A 4E7JA 1Q1VA 5FYUA 5E3OA 1OLQA 2HDWA 3LSDA 2HI3A 2X6OA 1M06G 2A6ZA 5A2QK 1F9NA 3POJA 4A3JJ 4GALA 3X29B 2AO9A 2FXAA 4MGKE 5IP7J 3UKGA 4GFBA 3O1SA 1HXS1 4PBPA 2EXHA 2Y0SN 1KU9A 2WN2A 3J9SA 3ZYBA 2EFQA 2VJ5A 4OMZA 3ZMNA 1QY4A 1VNDA 2QDNA 3BUCA 3V0BA 2Y26A 3FFZA 4Q4X1 2I8DA 2VW0A 4FPLA 5D21A 1KYZA 1D2SA 1QNTA 4AU7A 4Y5TA 1QH6A 5JSPA 3WTVC 1K3IA 4RHV1 1H9WA 5IWFA 3WTYC 2WNVB 1YXWA 3CP8A 2WNUC 2BGCA 3VOEA 2FCTA 3BQYA 2DCYA 2IXSA 4OAYA 3IKTA 1NCQC 4ZY9A 1TWGJ 3F6OA 1RMU3 3WNNA 1ZBA2 1HIXA 2CW8A 2X51A 1DZRA 3H8RA 2OUMA 4PIYA 3CCUI 3I3LA 3CQOA 1LAJA 4TTGA 2HEYF 2RV8A 1MJ9A 1WQ2A 2Q30A 1R092 4BISA 5C71A 2L0KA 3ZMUA 2I2SA 4JKLA 4G7ZF 2V6CA 3FZVA 2MA3A 3DTIA 1X1PA 4XZPA 2RDRA 3HRSA 2LF7A 1PVC2 2EINH 2O8QA 2F4LA 4QPIC 3CCJI 1C1LA 4IEVA 3K69A 3H1YA 4C0BA 3CUOA 3R0AA 5ANNA 1XSDA 4AVVA 3HOUJ 3F6VA 5CFDC 3KF3A 4W4ZA 2ATFA 1B35B 1RR7A 1VF9A 2CQNA 1ND3B 4FASD 1LGBA 3A7QA 1YQ5A 4IE7A 3IUOA 2WBMA 4UI9L 1Z7S3 1GT0C 1ZQ3P 1J59A 4Z07A 3OYWA 5CKTA 4X6QB 1CZSA 3VYRB 2HBUA 2XG3A 1ENRA 2ADEA 4P9UA 4FETA 3IN9A 5EJ3A 4IEYA 2Z4FA 3F23A 5K1YA 3NAPB 2QA4I 4WZCA 3HN1A 4AE2A 4UB8C 1TP4A 3SEPA 1XMKA 4YVSC 1VBC2 4WVMA 1X50A 4WF2A 3RZDJ 1SPPB 3VBHC 2M34A 1I9RA 1NOVA 4J01A 4OQ9A 3PHMA 3LFKA 4O9EA 2JA6J 2IW5A 1BEV2 4WM8B 5A7SA 2WWJA 3N36A 2AQEA 2BE5F 3B02A 2JDHA 5DYMA 1QJEA 5FMOL 1AXYA 4BJ0A 3AXEA 2HQRA 1UOFA 1OD5A 4PI0A 5FAXA 2P8TA 1WSUA 4J1XA 2Q8DA 2XGXA 4P5OA 2FD5A 2HWC1 3R0JA 1FPQA 2JA5J 4CO8A 1EAH2 4ZZ5A 4IEQA 1HCRA 2GZWA 2NPIA 4HVQA 1VFCA 5FLXK 5J8FA 3S3MA 2JB4A 3FXUA 5HDNA 3ZMTA 2X1CA 2QQIA 5KC6A 1WJEA 1AR93 4OZOA 4UVCA 2W46A 5JLWA 4NIGA 3LEKA 4DB5A 2JX9A 2W2IA 4RR3C 1AR63 5JVGF 2QQWA 2R5YB 2CU5A 3GALA 3MFKA 3IL2A 5K7ZA 1HKTA 1XSXA 4RM2A 1S2BA 4QAWA 4RS5C 3S5AA 4XKBA 3ES4A 3KT1A 4COWA 4B09A 3TEZA 1EKEA 4YFWA 1LJ7A 2W82A 1PM4A 3GFIA 3AVRA 2JDAA 3A03A 2OQ7A 3OOXA 1BR1A 4XTPA 3CJRB 3WG2A 3W3CA 2CV1A 3UGGA 1N25A 4C3JJ 2WSUA 2XUEA 2K86A 1YW9A 1W36D 3DF8A 5GM0A 1JHJA 4YW2A 4GCVA 5T3NA 5D8LB 5ABJC 1R22A 4CXXA 4YZ4A 1MIJA 4EJOA 2E60A 4URTA 1O4TA 3SCHA 1XC6A 3MO4A 1IQAA 1T95A 2VBXA 3JSPA 3CEWA 1REDA 5IOZA 2XAGA 2D98A 3MD2A 5LWBA 3C2GA 1AR71 2DCEA 2HZDA 3ERED 2HTJA 1WUVA 2EK5A 1LVKA 1IQDC 4Q26A 4X1EA 5HI0A 3H1CA 4QIWN 2WJSA 4GWNA 1HX6A 2QJVA 5BNNA 1J09A 3S15J 3I3BA 5K5RA 3PVEA 3E6MA 3FK6A 4N9IA 2VMDA 3KMHA 3B3QE 1QQIA 3TDZC 2ME6A 1AOYA 1BL0A 2WFF2 5LA0A 1VE0A 4XR6A 4FP2A 1V6MA 4N4OB 1YIJI 3WU1B 4XUNA 3KHCA 1DU3D 5FLJA 3BJAA 3I4MJ 5A80A 1AX0A 2VTFA 4GWIA 3HKZN 4ZYDA 4L5EA 1I50J 4II3A 4DY5A 3GX4X 1Z05A 3H36A 4MGYE 1MBFA 5KXDA 2E1CA 4QB2A 4KWKA 1R36A 2QZ8A 4BHPA 2F4MB 1ZZ9A 4LMFA 2IZWA 2XQRA 4RGUA 4PJYA 5C3RA 2GP3A 4ATFA 4E7LA 2WYFA 3K2OA 5HCHA 3OB8A 3U21A 5GZCA 4OIRF 4DPNA 5BNOC 4L0YB 2VCBA 5LRRA 2FU4A 2PMZA 2V9PA 4LBKA 3OR2C 1FPN1 2EQRA 2B39A 3AZVA 1UD1A 3ZP5A 3ZM8A 3KV5A 3CBNA 3HD8B 1VBA2 3TEWA 4E4SA 1BXHA 1FJLA 2IXJA 3V7RA 3LSMA 3KP6A 1UN1A 3H3VK 2R042 3P1IA 3Q0UA 4PLMA 3ASIA 2VT3A 1RUE2 5T5LA 2OTJI 1O4XA 4BJTA 4CDWB 2BOJA 1I3AA 2WS91 5CLSA 2IGKA 3AFGA 5KXBA 2JDZA 1I6HJ 2E5NA 1VQ6I 5FZFA 3S93A 3J7AY 4A3IJ 2CWMA 1RHI3 1SMTA 1IKQA 1ASJ1 1XTAA 3F9KA 2JSPA 2OCEA 2VLAA 4AW7A 4KG8A 1PUEE 1RESA 3J80K 2P4WA 3NV4A 5FZ7A 3AB0A 3KCCA 4TV7A 2DMQA 1CX1A 3ULQB 4W50A 1DQ2A 2VPRA 1R5HA 2YGMA 5FMBA 2VUMJ 3QACA 1PGSA 4I01A 5DZGA 5EGOA 4FBFA 3TOAA 5FZCA 3BR2A 3LA7A 2NQYA 1S0JA 5AC92 1Y6IA 3C7HA 1ZR4A 4LBMA 1JJ6C 4RGKA 2DVAA 2QLZA 3KX2A 3M2MA 3CF5F 4OMCA 3AG3H 1O6UA 2KIFA 1BMV1 4GJYA 2VXJA 3ELKA 2TUNA 3UNGC 4XF0A 3M1EA 3QH7A 4IE0A 4MOAA 5E1RA 2DA6A 2HOAA 2QNKA 1U9OA 4IQJA 4CCLA 2W91A 4A0XA 3GGLA 1TME1 1L0OC 3S3NA 1CJDA 3KS7A 1VAVA 1BOBA 3AYAA 2A69F 3D5SC 3MCZA 1ZGAA 5DUXA 5GLUA 5E20A 1GWMA 2C1FA 5DCMB 4E4ZA 5FROA 4Q0SA 3B6AA 2C6SA 3CLPA 5JWPA 3WDTA 1WI3A 1IS4A 3VBRA 2X1EA 3FHZA 3G1MA 2E5ZA 5GTHC 4EJVA 4N7UA 2JDYA 1IPKA 2MW8A 5JMOA 5JSRA 3HG9A 3H9JA 2XH6A 3H3ZA 2KJCA 4BQNA 5EFUA 2W48A 2RE9A 1GUIA 1OD3A 3JBG2 3K70D 5IK8A 1MNDA 5D8AB 3B01A 1O5LA 1YFXA 5F9TA 2IPQX 1DGRA 3ZQQA 1LOEA 3T1BA 1XNBA 4P55A 3C3VA 4KA4A 4XF3A 3UJQA 5EYXA 1KA8A 3AYDA 2WWSA 4O5VA 1LFPA 3WG4A 3HOBA 4QKDA 4N53C 5DUKA 3TMOA 3DPRB 4E6KG 4QKBA 5DUUA 3ZN5A 3L00A 3T08A 2HXIA 2J5PA 4QQOA 1T6GC 2MPFA 2WB1A 2PAEA 3L2HA 1KQ8A 4OAZA 1Y9QA 2EIJH 5JI6A 2EIEA 4YVWC 4L9TA 3VD7A 2CFOA 1D4M2 2GNMA 4Y5SA 3QP6A 3K48A 1IC8A 3TN91 1UAAA 4U0VA 2OC6A 1CESA 3QU3A 3GTJJ 1CIWA 1REEA 3RKWA 3QU6A 5J6XA 5IT6A 2DYSH 4WM7A 5C33A 4QXCA 3HVDA 1JGSA 3OBZA 4YW1A 4E7IA 4QKFA 4QX7A 1K45A 3M3QA 2Q8EA 2WLQA 1TMF3 1SLIA 4HK8A 3LOIA 1UIKA 2NM1A 1RUH2 3ZFGA 2W3JA 4BY1J 1NA1A 5TSWA 3WP3A 4CEYC 2FD8A 1C3HA 2CAVA 2E51A 3W2WA 2WZR1 2JKXA 1SZBA 3HM5A 2ERFA 5EP9A 4UV8A 1TNSA 3OGJA 2DW4A 1DQ0A 3ZXJA 2A61A 1N75A 1KU7A 2J1AA 1Z7LA 3BTLA 2CRGA 3FISA 5LGNA 3ZFFC 1H6XA 4HNVA 3LFMA 2XPUA 1IXRC 4CCMA 2HDCA 4AIDA 4OIQF 2BVVA 3U14A 4HL0A 4Y20A 3LQQA 1BIAA 3GZ5A 1DU0A 2GWRA 2CWSA 1NQDA 5L3DA 1RUD2 4RLFA 1OVSA 2YX7A 1H1AA 2RC4A 3EDPA 4L11A 3TDUC 3RKYA 1VBE3 4ZU4A 3ZN0A 2LY9A 3DBRB 2BFUS 4G7HF 2VJIA 3HSEA 1FNYA 1AL0G 2BBAA 4RB3C 3VBSC 2E7TA 2VNOA 2M8EA 2EIMH 1SLBA 1GUUA 1WJ5A 5H9RA 2YPJA 3ROUA 1FX5A 5I93A 3A1YA 1GBGA 4N7IA 3OS2A 4WVWA 2R7UA 3O1PA 3N97A 1MD0A 4F8AA 2DMNA 3OYAA 5L9VA 4LKEA 1FOXA 3CJIC 1K61A 3DBLB 1HRV3 1UCXA 1CWPA 3DTEA 1YW7A 1MR5A 4HX7A 1BBT3 2EIDA 5T5PA 1UQXA 2RR13 4PLNA 4XQWA 1UY1A 3WP4A 1G9CA 4HG2A 1S6LA 1RUF2 1PGW2 4BQXA 4YFZA 5EZGA 3TB0A 3L2QA 3BVCA 3I2GA 4MZUA 3JUUA 5CNAA 2OPTA 1MBJA 2XPVA 3L2UA 4IHVA 2VOKA 1GXPA 5BPXA 3VUOA 5J1XA 2HXOA 1MDMB 5A7PA 4YZ1A 2G1MA 2ZMEC 1GWLA 3QPLA 3PSIA 2JMWA 2DU1A 3PUQA 1GZWB 4ZS3A 3OR1C 4RAGA 5IJRA 2X0LA 1W6QB 4ENMA 1WBFA 4HANA 3BT9A 3VBFC 3RDIA 2ZGKA 3WG1A 1MH4A 4ZTJA 1MQTB 2JDMA 3K2ZA 2A6TA 3CMYA 4PDKA 5K0UC 1OA2A 4QWNA 1T33A 5JOYA 3DYPA 3SXYA 1J7KA 1WH7A 2H6CA 5C7GA 1YUDA 2EVXA 1MKMA 5EHDA 2OPKA 1XB9A 2RS12 3PURA 1RJ8A 2R5ZA 1HA8A 1HJFA 3ISPA 3E6DA 1F5TA 4W65A 3VKLA 1EH6A 1R58A 1WJCA 3UGHA 2PMHA 2L7ZA 1DHKB 1LNWA 2QCOA 4ZZLA 5A1FA 4L9NA 3MW2A 2V79A 2RS32 3I2IA 3OEAA 3O7OA 2YU2A 1PK6B 2QBYB 3T4HB 2VXZA 1G6NA 3WCSA 1OR7C 3SZGA 4HLXA 3PIOF 2O3FA 4FCAA 2HGCA 4QXHA 5LASA 2BHZA 3S1RJ 2LBFB 3OPZA 3O0VA 5J98B 3E5XA 3WLUA 5A7NA 1S0BA 3HNBM 1HXS2 3AFHA 4WZFA 4W97A 3ZSJA 4C0HA 2PHRA 4KMUX 1NCRB 1JTYA 1LRHA 1ZVFA 3J4UH 1YFHA 4Q4X2 4KNYA 2L9NA 1D0YA 4I30A 3E1F1 1FSEA 1ULCA 2JECA 4RHV2 3Q5FA 5J1RA 4JRAA 1PGL1 2PMZN 1QMJA 3PQJA 4M9ZA 1QEXA 3HJRA 5ILUA 2XAQA 5EPAA 5FY4A 4LB5A 1M1EB 5DDJ2 5ICGA 3KM5A 5BNPA 3VYSB 5DG1A 3L1PA 5FXWA 4HDVA 3FWEA 3IRRA 3FXLA 1AL21 1K5MB 3GZUC 3VBOC 1ULYA 4P96A 4M0NA 1IUFA 1YEWA 2ID3A 1XU2A 1FBQA 5GLWA 4S04A 1UOJA 3FXRA 3PNYA 2JG8B 4EWEA 1IDYA 5DAVA 4XABA 1C4RA 3HQUA 1X1BA 2XAUA 2FMLA 4AHXA 2HNHA 1VQOI 2EFPA 1KQ9A 5KNLA 1LEDA 1OSGA 4IV3C 4BQYA 1IW7F 3WUCA 3P7NA 2X29A 2M87A 5GTIC 5FZAA 4YFXF 2C26A 1X82A 2PHWA 4ZYEA 2A6EF 3LE0A 4NIIA 5BMZA 4ET7A 1WCUA 2X05A 3VODA 3ZYIB 1RVF3 3T8TA 2ZO4A 3I59B 1NZCA 4WXHA 1H0MA 1H2MA 3K4DA 1H2NA 1Q8QA 4NHYA 3JRFA 2HPMA 4A3CJ 4HKLA 1F31A 1YRZA 3VKMA 4DUXA 4COUA 1H9TA 3OOUA 3CDZB 2DUPA 2VQUA 2DI3A 3IC7A 1OCRH 3WZ1A 1JZ7A 3ABUA 3HGGA 4B4CA 4QX1A 4FSJA 2J7MA 4JGZB 3T30A 4EN7B 2VZPA 3AM2A 2QF7A 3R60A 3FC0A 4MGZE 1Y1VJ 3AKZA 1DU6A 3T0BA 1JS9A 1LHWA 1QQP3 1O3QA 2PLV3 3LSHA 3KV9A 2HWE3 3NRVA 4LO7A 4XW3A 5KBFA 5FJKA 2CTVA 2KRHA 2W7NA 1O91A 2GSYA 4YM3A 4LR4A 5CFCB 4G9YA 3A21A 5IP6A 1MZ5A 2WNUA 2RJKA 3SZTA 2JK3A 1W9TA 1D1CA 3ZYPA 5H9PA 1B8IB 1IRXA 1NCQA 3GDBA 1QJY3 2RDSA 5DUIA 4TSVA 3O12A 1OFCX 1DP7P 2BOIA 3ENRA 2KPMA 1VZ0A 4DJAA 2HWC2 4RYDA 2Y48A 4HVRA 4H2AA 2F48A 2XJVA 4FOWA 3ZDSA 2D6NA 2DYCA 3I2HA 1RKWA 4CDUC 4MNUA 3H0DA 2R4GA 5FPUA 4BHBA 3O3KA 1W9FA 4S2HA 1DGRN 3HTUA 1X3UA 1GP5A 3CZJA 4AVPA 1WCMJ 2DCZA 1YE9A 1ZARA 1YJWI 3HUGA 1JZ6A 2RNJA 4RGSA 1W36C 2DLLA 4QPIA 1GP6A 1R1UA 3K4MA 4JK1X 1R23A 2HWF3 1FV2A 5CFDA 5DS9A 2W24A 3LEIA 5I8YA 2DXIA 4IV1B 2VBYA 3RSNA 2STWA 4XQDA 3CIHA 2WB1N 3ZQ7A 4P1WA 3QPSA 4NN0A 3VZMA 1FOD3 2Z33A 2ZABA 2KZVA 1J75A 1P4XA 3MI8A 2JA7J 2VOTA 3JRDA 2ZEWA 4AGGA 3VLBB 2WTEA 3W6VA 4LBQA 3O0WA 4A3MJ 1Z0XA 3NNMA 3PTYA 1POGA 2E35A 3K6GA 3FN9A 4YVSA 3P9CA 1G9FA 2KKOA 5A3PA 3EUAA 3D5RC 3BZCA 3HHHA 1I6XA 3VBHA 1A31A 3OY8B 2ZGOA 3ELNA 4YRDA 1AR72 2WNVC 2FBEA 2RQPA 1OKQA 3P9KA 1HW1A 2HWB2 1BLZA 1XE0A 1RUI1 2WDBA 2LS6A 4EM0B 5A33A 3KQ4B 2QUOA 5G05L 3V8KA 3GZEA 1DQ5A 4XORA 2B42B 5L3GA 2NP0A 2DOEA 1YRNB 3RPQA 1AVBA 4BHCA 1YQ2A 2YROA 5JHFA 1ALYA 4Q4V1 5J37A 2Q1MA 4HK9A 1NH3A 2ZKNA 1XNCA 2R0FA 3KT7A 1SD7A 2KDZA 2PJPA 1ZELA 1OISA 2QQNA 4Z2WA 4U0YA 1HQNA 1MNMC 4P00B 4FQZA 4IJAA 3MLLA 2L4MA 4MHRA 1LNSA 1VMHA 5IATA 2E2JJ 4UF0A 2EB7A 2MGQA 2AUYA 2Y8KA 4RR3A 1D1BA 5EXOA 3CNAA 3HN3A 2E6VA 4XLHA 3OS0A 2EICA 2XGDA 2VZ3A 2Q4SA 4FQGA 4UAPA 4OYUA 3FUOA 4GMP1 4PDWC 4RS5A 2V26A 2VI6A 1BHGA 3ACHA 2HKOA 1B35C 1ONVA 1YHQI 1G86A 4H55A 1ND3C 2WA4A 3X2QH 3BPZA 3S0MA 3KT4A 5DD8A 2Z5WA 3EYIA 2BWAA 4KG0A 2WT2A 3J8F1 2G7UA 1DYKA 2KHMA 1ZHFA 1NLQA 4XVHA 5LY2A 2NNNA 2V1XA 1RUG3 3FBYA 2VE8A 4PSWA 1FPN2 2PFWA 2WZEA 2Z5UA 4AIKA 4HFSA 2W1QA 2I74A 5SV5A 4UUVA 2HEWF 5GZDA 5L9BA 1XCVA 3NAPC 3WW3A 2QUFA 5ABJA 2DA2A 4JKMA 2D1VA 1NYWA 4NOTA 3AMMA 3IIAA 3ZN6B 2A73B 5EEGA 5E89A 3BC8A 1FOKA 4WM8C 3NNFA 3J81Z 4XF1A 3RZJA 1I1SA 4RD7A 2QQUA 4XOTA 4L97A 4J19A 4Q4W3 2L5QA 1WA4A 1Y43B 4NVPA 5E6HA 5F5QA 4FAHA 1EV13 3RJ2X 2WS92 1HRI1 4XBNA 2FDGA 2ZFUA 5IT9K 3B69A 4IGPA 4EM1A 3T8RA 1O3RA 2QQLA 2HVSA 1G9DA 2GOMA 3K7AJ 2XQXA 2DBIA 4M3CF 1BM9A 4ZJZA 4XLEA 1ZA7A 5LBCA 2NVYJ 3PUIA 5FFOC 5FBZA 4DZPA 2YU9J 2J1UA 5E17F 3GHNA 1KDMA 4XF4A 2LR8A 1S72I 1IF1A 1PO12 1LHNA 1LQ1A 3GEZA 2H8RA 5M5XJ 2CV0A 2P0WA 3T2OA 1DCSA 3ZCOA 2Q1ZB 1V6JA 4NRPA 4HT1T 1W7PD 2RVCA 2P3KA 4BH9A 2DTYA 4L8QA 1BMV2 3ABKH 1AXKA 4E8DA 1XNDA 2D5FA 3BU7A 3OGVA 1RUC1 1FXZA 2IC1A 1A35A 3EBRA 5IK5A 4YG3A 5JZGB 2MC4A 2A68F 4I7HA 5IYYA 2GNTA 1TME2 1V9U1 3NKTA 4A42A 3LSTA 2XMLA 3RI9A 2TCTA 1OA3A 2EIGA 2V4AA 4COVA 1PMJX 1OH4A 5BNOA 4UUSB 4M01A 2NYYA 2YMZA 3AJYA 2NLRA 3H3UA 2A3YA 2W68A 5JI9A 2XV4S 2VB6A 4IRIA 4D6SA 3AG4H 3PTRB 3BG9A 2VXRA 1PVC3 1SMVA 3VEPA 1GHCA 2VULA 4HKWA 4KDPA 4LLFA 4X6AJ 2DUOA 2LSOA 4R4ZA 4R9DA 1MS4A 3W9AA 1YYVA 2OZ6A 2LG4A 2EALA 2KISA 5IVYA 4TXWA 2IA1A 4GULA 3OJBA 5DPNA 3UYJA 5IAVA 1NLSA 3CUQC 3REOA 2ZGMA 2DTWA 3ST7A 5IVBA 5FZ4A 5E1WA 1L3JA 4DINB 2O7OA