3D0SA

Camp receptor protein from m.tuberculosis, camp-free form
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
224
structure length
224
Chain Sequence
MDEILARAGIFQGVEPSAIAALTKQLQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISDSERLARRAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of cAMP receptor protein from M. tuberculosis in the unliganded form
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
molecule keywords TRANSCRIPTIONAL REGULATORY PROTEIN
total genus 69
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3d0sA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3d0sA01
3R61A 4CDGA 3LWFA 3E5XA 2PI0A 5I8SA 1BOAA 1U2WA 2ETHA 2YSRA 4HDVA 5F64A 2Z3YA 3GFIA 4KL1A 5HVQC 1IN8A 3KGZA 4YFNF 5ICCA 4P5OA 1HW5A 2PEXA 2VT3A 1H9TA 3OV8A 2V09A 2OPKA 4LK0F 4XFCA 4JBAA 3MFKA 3CEWA 2IRFG 5JVTA 2YX7A 3PLQA 3USSA 3ST7A 1G4DA 2KJCA 2EV5A 3O14A 4UVAA 5FQ0A 4F7ZA 3WTYC 3VB2A 3IRRA 3GXOA 5I93A 1HSTA 3TO7A 2KIMA 3DN7A 5E20A 2MD5A 3ABTA 3HSRA 4QGLA 3C1DA 2FU4A 1HBXG 1O7LA 4K8FA 3RNSA 1SD7A 2VBZA 4L0YB 1TQ5A 2UY9A 1J3PA 3R0AA 5FPXA 4HLYA 4CHUA 2D1VA 3EYIA 1QZYA 2ADUA 3SXWA 4LD5A 1TW2A 3KP3A 4L5IA 4ZZLA 4IEPA 1R23A 1RUNA 2ET7A 5D5XB 1V70A 3V8KA 4XF1A 1OD5A 4RGRA 3C3WA 4HW0A 1R1TA 1F4KA 5E16A 1G3SA 2VQAA 2W85A 3I59A 3KEQA 4JK1X 3BPVA 2GA2A 2XLGA 2B8MA 3WTZA 1YTYA 1S3JA 2Z99A 1ZZ7A 2HQRA 4KYWA 4OMZA 3QP5A 3H3UA 4EJTA 2L4AA 2L02A 2PAKA 3V4GA 4RGUA 3KZYA 1PP8F 1PUEE 5ILSA 2W57A 5BUVA 2O8QA 4BXUA 2EB7A 1IRFA 3NW4A 5T3NA 4B29A 3CO6C 4XF4A 4L2NA 5DCFA 4ORFA 3H1MA 2IA2A 5K5OA 2YR2A 3GUDA 3ELKA 1QNTA 2ZNZA 1D3YA 4BHCA 3MEXA 4LTAA 3HRMA 4FAGA 4G6DA 1K79A 1W7PA 1YS6A 3ERED 2XHKA 4ZZDA 1BI3A 3M9AA 2NNYA 5LGTA 4R79A 1G3TA 4NHJA 1V4RA 2DQRA 1XGMA 4NB5A 2GAUA 4XEZA 5E18F 2WFPA 1YS7A 5L3BA 3JSPA 4A6EA 4GO1A 2O61A 1CAWB 2H0VA 1DDNA 4G8XA 5E1WA 5ILUA 4PIYA 3FM5A 2IPQX 3F72A 4M9ZA 1KYZA 2CWEA 2PMUA 3SQNA 5K5QA 1HKTA 4Z2YA 1WWXA 5EZWA 4IHSA 4ZYEA 4JVAA 3L2HA 3KZZA 4L9JA 3K9TA 3IC7A 5FLIA 3KE2A 4PDKA 1NXMA 1CAWA 1O7FA 3VODA 3C7JA 2A3SA 1O3QA 2NAZA 1YQAA 1YFWA 1R7JA 3E6CC 2D2WA 5HLIA 5JI6A 3J81K 3P9IA 1TLHB 2ZMEB 1Z91A 3OOPA 4XRFA 1R1VA 4U7BA 2UYAA 2AS5F 2XUBA 1WLTA 1OPCA 5DEQA 3LSTA 5E1XA 3RJPA 5JHUA 2GZWA 2VN2A 5LHIA 2H09A 4HF0A 3S0MA 1TNTA 1YO5C 3TOBA 4MEYF 2VOPA 1B1BA 4Q29A 3RTRA 2ACJA 1J7KA 4QWQA 1F9NA 1K78B 2JPCA 3SFZA 4UBGA 2K02A 4XFBA 2M87A 3T0YA 2QWWA 5L3GA 4FAHA 3QPHA 2E9QA 5HDGA 3F3XA 4KICA 3KCCA 3E5QA 4Q0SA 3F8FA 1R5GA 4IVNA 2ZKLA 3HT1A 2RDPA 2E7XA 3PFIA 1J58A 2FQ3A 2PQ8A 1L3LA 3SCGA 4RAYA 4L9TA 5EEHA 4GCVA 1IXSB 1SAXA 4XSXF 4LUMA 4WX9A 3ES4A 1TTYA 1SQ4A 2ZCWA 2XAJA 5DUKA 3UKNA 2QM3A 4EVIA 2B9UA 4IESA 2QDRA 2VBXA 3R0JA 3VEPA 2ESHA 2W25A 1BIAA 4GULA 5LEKA 1YWKA 4JV4A 3RYKA 4HLXA 3EQLF 2FBIA 1LRHA 3V7RA 3WW1A 3WTXC 1GVJA 2FSWA 5FQ0B 1FWZA 5CVUA 4M71A 2CYYA 2VT2A 2ET1A 2CQKA 5HS8A 1I6XA 4OMYA 5HI0A 3K1PA 3IKTA 1NE4A 4IPAA 3HIFA 4ESFA 1R36A 5DDGA 4EQQA 5J7MA 5ICFA 5CADA 1X82A 5LHHA 2FNPA 1CF7B 1X8EA 5LRRA 3GFMA 2F5CA 1B9MA 3KETA 2RKHA 5FCCA 4HAMA 1YUDA 5L3DA 4P55A 4EJVA 2DK8A 3GZ6A 3GEZA 2IXCA 2OQRA 5CYVA 3ECOA 4RS8A 2BGCA 3RPQA 1OKRA 3F8CA 2GU9A 1FOKA 5CVVA 4U0VA 1VTNC 1QO0D 1R58A 2XGXA 3EETA 3LFKA 4UVBA 4EROA 3TNPB 2I45A 2XLFA 2A6HF 4N9IA 4RAZA 1F5TA 3TKYA 2ZXJA 5HLGA 2EA2A 1FNNA 3HQXA 1JHHA 1R1UA 1ZG3A 2KXLA 1DP7P 2CFXA 1X7NA 4FX0A 2HS5A 3Q5FA 4HMZA 1SMYF 4L11A 3HSFA 4XFIA 3VHRA 2COMA 3C3VA 4LA2A 1S6LA 4HQEA 4PIXA 1AWCA 2FRHA 1L0OC 2VECA 4Q47A 5CVIA 1CAXB 5J8CA 4ESJA 1J1LA 4EJOA 4J1WA 4HX7A 1ZLJA 4I01A 2P5KA 1FLIA 4WVZA 4MQ9F 5JAXA 2XVCA 2FE3A 2GH2A 5DD4A 1RI7A 1SFNA 1TQMA 4CO8A 1F1ZA 1LDDA 1XB4A 2D93A 4TLFA 4G94A 3F8NA 2FA5A 4OIRF 4HV6A 4HN0A 2MH2A 1ZZ8A 1XE7A 1YFXA 2RN7A 2CGPA 3SMHA 3I7DA 4WF2A 1RZ4A 4YARA 1OMIA 1ZZBA 4JTNA 4XFHA 2QVSB 2IJLA 2QENA 3BALA 3IWFA 3SCFA 3S7EA 4HA8A 2PN6A 2C0ZA 2F5DA 2WV0A 1MZBA 5FLXK 2DPDA 4HF1A 5LEJA 2FBKA 2VC0A 3EHKA 5EFUA 3O3KA 1OI6A 4QM9A 4MTEA 2QUFA 3DPLC 4XFAA 4P96A 1Z6RA 2RGVA 4XSZF 5BV6A 1WRJA 4WWCA 1BC7C 2VE9A 4GGGA 1JE8A 4M74A 3BOQA 3GO5A 1IXCA 4ONUA 1SD4A 3K2ZA 2P7CB 3CUQA 3KP2A 2IC1A 1UB9A 2A5YB 4EM1A 1ZNPA 2EV6A 4G9YA 3EO6A 5I8TA 2NNNA 4RB1A 3HOSA 4L5JA 1UW8A 4QGNA 1D5VA 2P5LC 2KJBA 4I7HA 4ZU5A 4FBFA 1ZGJA 1KU2A 5BY5A 4ZYGA 2PJPA 2G7UA 1ZHFA 4RB0A 4HSLA 3DL3A 2P5VA 2XKPA 4E2GA 1YW7A 4Z82A 3D5LA 3F8BA 4B09A 4A5MA 4ASNA 2Y75A 3WTVC 1I27A 1FBSA 4XETA 1S8NA 2DO7A 2BBYA 1XRUA 3B02A 3HRSA 5D4RA 5CVRA 3ZMUA 3SZTA 1SEFA 1XMKA 2UXNA 1QXJA 4OOIA 4EV0A 1K78A 3U0ZA 1TBXA 3IRQA 5ERIA 5I91A 2ZFWA 4YSFA 2PHDA 1XN7A 3LA7A 2IXIA 4IEYA 3QU6A 2CW0F 1UIJA 3BCWA 4HBNA 2GXGA 3KGLA 3Q9VA 1DPRA 1NE6A 5I8YA 5E1RA 2P6SA 4AVBA 2H94A 1UFMA 1RUOA 3FJSA 2G9WA 3FF5A 4Q0QA 4LMYA 1XGNA 3ZP5A 1LB2A 1GHCA 4EWAA 1P2FA 4M72A 5D5VB 4HVQA 3CUQB 3M8EA 2JT1A 2Z2SB 2Q0OA 2QLZA 4BIFA 3AAFA 1XDSA 3WTTC 3HHGA 3TDUC 4N9HA 2VE8A 3JAMZ 5E8GA 5L3CA 6PAXA 5F6FA 3DQVC 5CU1A 3RZZA 2K9ZA 2XROA 1RNLA 2ZBKA 4RB2C 3T8RA 1KU3A 1A04A 4EM2A 4KMUX 4UV9A 2VC1A 2O6GE 4BH9A 4QX5A 3PQKA 4P9GA 4ON0A 4LB5A 1XD7A 2P8TA 2B5HA 1UPIA 2UXXA 2K4BA 5KHIA 4OFGA 4LLGF 2PFBA 4A2UA 2ZMEA 5K8SA 3GFJA 4E2QA 5I0RA 4Q4ZF 4MHGA 4I0AA 4O9GA 2H6BA 3G3ZA 5BQTA 4G7ZF 1EYBA 2J5OA 2IA1A 2DCTA 1SFXA 3OD0A 2LDUA 1IN6A 2ZNYA 2P17A 5CVJA 1J3QA 2O0YA 4N0BA 4HV5A 3IBMA 2DT5A 2RNJA 3N4MA 1JXSA 3SZPA 2PFWA 5D6FA 5BPXA 3FX3A 2LNBA 2DK5A 5FO5A 1XSDA 4OIPF 1FPQA 1H1MA 4HX4A 5AVPA 3BJAA 3E97A 1MJ9A 2TDXA 4M9SA 1VP6A 4XFFA 2QQBA 3CLPA 2UZKA 3N97A 3QAHA 4H0EA 5I0TA 4MZUA 5BOXA 5FB2A 2HYFA 2E1CA 2JRTA 3F6VA 4CGZA 4ZYDA 4XF0A 4UUVA 5D5WB 2A61A 3RDIA 2K7LA 1EH8A 1U5TB 4D7TA 2K27A 2X0LA 3LOIA 3JZVA 5D4SA 3WW4A 2E1NA 1LVAA 1O5LA 3E6BA 4A0ZA 4IEVA 3Q9SA 2DQLA 4IF4A 3K1MA 1HW1A 5EEGA 5JR3A 5KHJA 5FFZA 1GQHA 3M1EA 2W84A 3ROUA 2OAZA 4BAYA 4DINB 4G7OF 3CO2A 1BM9A 1PP7U 4YNIA 1YHFA 3VFZA 3KSCA 1ZREA 2L3DA 4L18B 3WGGA 2LF7A 1RL3A 2FOKA 3KLOA 1YIOA 5H6QA 4RGSA 4XFGA 1CF7A 4K2EA 2IXJA 3K0LA 2OYZA 2WTEA 1GXQA 1YYVA 2PBIA 3MZYA 3V7SA 3SHRA 2ZKZA 4HX8A 2HZTA 4KT5C 2ATFA 2ZJ2A 2HGCA 3TNQA 3WU1B 3KP4A 1Z7UA 3BDDA 2MNGA 2VBYA 3WG9A 4OINF 5FD6A 3HTSB 2FNAA 2CO5A 1I1GA 3FXQA 3ML6A 4DNCA 1O3SA 2RV8A 2P4WA 5IT9Z 1UHMA 3LQQA 2EFNA 2CAVA 1QPMA 3U9GA 4UVCA 4OLLA 4A5NA 4AIJA 1E2XA 4CYDA 1HXDA 3MWMA 5FGMA 2L01A 2IP2A 3GYHX 3PQJA 2H27A 4XLPF 1T98A 4EWDA 3B73A 3R6SA 1RIOH 2RQPA 1ZH5A 5DYMA 2YU3A 2QBYB 4CZZA 3CDHA 1G3YA 4WXCA 4U0YA 2EFPA 2HWVA 2XL9A 5IT9K 2E7WA 2EVXA 5K5RA 5D1IA 1TNSA 3BB6A 3WE3A 4LGWA 3TQNA 4EGYA 3ZN0A 4Y17A 4WCGA 2PQQA 4MH0E 5A2QZ 2PAEA 5AIPA 1XSXA 4WXHA 4L9VA 1QQIA 5LGUA 1ZN2A 4H7LA 2KRFA 2O8XA 5BMZA 4HSJA 2K86A 4MEXF 1Y0UA 1W4MA 3FE5A 1U5TA 1U6GA 4I98B 4IEWA 2XKOA 4Q48A 4IRIA 2OU2A 5D6EA 1FZPB 1BC8C 4KWKA 2KIFA 1J9IA 4EMSA 1IAWA 3K69A 2GIVA 3L09A 2FQPA 4HYEA 3WE2A 1FX7A 3ULQB 3T1BA 2RC4A 4HF2A 1CAXA 1P4XA 4WBBA 4META 3KP6A 2HOEA 4HQMA 2Z69A 5KK1A 2XAGA 4Q5SF 1ZVFA 3L7WA 2K0GA 3G7DA 1YG2A 3E3VA 3ZN1A 1QXRA 3VOEA 5ICEA 5K1YA 2PMHA 3K1NA 4KWLA 5D5UB 5JR7B 1MGTA 2FBHA 4LUKA 1YFHA 2OD5A 4IETA 1S7OA 1P4WA 4AWXB 3GZ5A 4KNYA 1EH7A 4MGZE 1ZRRA 2OZJA 1YW8A 3F23A 4I3PA 3ETQA 4AQ6A 2Y0OA 1Q1HA 3J81Z 3H50A 2O3FA 1Z05A 3TO6A 1ZGAA 1B9NA 3P7NA 1DZTA 4GXOA 3IWZA 3CTAA 2ELHA 2BNNA 1TQIA 4ESBA 2R3SA 1BBYA 4M6XA 2VODA 4UV8A 3TO9A 3ZMDA 2D5HA 3BPZA 4EWEA 1LEBA 1YLFA 4LLNA 2QJVA 2Z5UA 1QZZA 1YFUA 1T6SA 4D7SA 1E17A 3MDPA 1ZRFA 3GBFA 1DUXC 4Q0UA 3C18A 1XCBA 2HDCA 1KQ9A 3F22A 1YW9A 4F8AA 4MGIE 3NSTA 2FEZA 2IXKA 4GYGA 1PM7A 5FFXA 1R00A 2R7FA 1QBJA 2PHLA 3U11A 4YRDA 2EFQA 2DPUA 3FMRA 4AVAA 3DV8A 4MGKE 3JSOA 1MJBA 2ETEA 4QGMA 4LJZF 1J75A 2DW4A 2KIUA 1P92A 1O5UA 2Q30A 3WGIA 4ETSA 4UBHA 3PNAA 1LKNA 4MQVA 3FZ3A 3V7CA 2B0LA 1KGSA 4KIBA 1MDMB 1PMIA 1JHFA 1ZAOA 5CJ9A 3ZPLA 1ZZ9A 2W24A 2PYTA 3GYDA 2M1BA 1YLLA 1IXRC 2NYXA 4X6QB 2R7DA 4JQFA 5BXXA 2WC2A 2PAMA 2IW5A 1L3JA 2IXHA 2Q1ZB 4YFKF 1Y3TA 1P4AA 1O57A 3MAJA 2DTRA 4LLOA 3NVCA 4PZJA 1IN4A 4KWJA 3IIAA 3W6JB 1QGPA 2ISZA 2N7GA 1OYIA 3DF8A 3S2WA 4OU0A 4L9NA 4KIFA 2VBWA 4CICA 4GYIA 2PTMA 5KBFA 4J1XA 1LJ9A 1LDKB 3SXYA 1VJ2A 2IVMA 3H92A 4PGGA 3ACLA 1HW2A 4AXOA 1EV7A 2XAFA 3EUHA 2XIGA 1FP2A 1W5TA 4QLCU 3ABUA 3DPTA 3U2RA 3BZ6A 4OIOF 3DFGA 2HTSA 1MDMA 2BNOA 3RYRA 1HKSA 4MNUA 3T8TA 2CV6A 1I1SA 3IDBB 4KN4X 2IT0A 3QP6A 2DLLA 2ISYA 4XBFA 1IPJA 2Q2EA 3I53A 1HQCA 4QMAA 3CLOA 1OYWA 2O1QA 1UCRA 2LF8A 1T39A 3F6OA 2STWA 4MX3A 5HLHA 4Q0PA 1R5HA 1G3WA 5LBQA 3IHUA 2FF4A 4FT8A 1K7AA 1BJAA 4E2SA 1B4AA 1CAUA 1ZRDA 3WW2A 3R4KA 4YFXF 3IL2A 1KQ8A 2EK5A 5DCMA 2OA2A 3GLXA 4IRGA 1C0WA 5FLJA 2XL7A 3MCZA 3QU3A 4B8XA 3H1WA 4Y15A 1ZYRF 4UHTA 1FYMA 3FM3A 3KP5A 3LZZA 4KU8A 4ZYHA 1Q43A 4M6YA 2WWYA 3DKWA 5KHKA 1W7PB 4I09A 5TJJA 3CJNA 1IUYA 2JPBA 3NRVA 4R52A 5KHHA 2QZ8A 2HQNA 4IEOA 1UCXA 4E70A 5DD8A 1HSJA 1XE8A 1CGPA 4ENNA 1U12A 2BYVE 3BY6A 4S04A 1PDNC 3CL1A 2Y0MA 1Y9QA 2P7VB 1KQ0A 3FXUA 4BHBA 3WGHA 3H3ZA 4A0YA 1S29A 4HBLA 2YX4A 3BJOA 4XLNF 4IRHA 5DV5A 2MPFA 2FMYA 1D8JA 2EA7A 3I59B 4BNCA 2JTVA 1EY2A 2XLAA 4PIZA 5AIQA 3JAMK 2GC3A 1FI2A 1X3UA 5KVRA 3LAJA 1SFUA 2UY8A 4AVCA 4LG0B 5I0UA 4LB6B 4O3MA 5FLXZ 1XCVA 1T38A 4Z07A 1J59A 4DQ2A 5ICGA 1FT9A 2DBBA 3NL1A 3JTHA 3LAPA 2V1XA 2P6TA 2V6CA 3V8LA 2GC2A 2EFOA 4MGRA 3OGJA 4QM8A 1LQ1A 1MKMA 2EWNA 3I5UA 3OTFA 4HN1A 1ZG1A 2D5FA 3KMHA 5ILVA 3FMQA 2A6EF 3D82A 4LLLA 2Q4SA 2F5FA 1NHAA 5FLHA 1CX4A 4HZFA 3REOA 1WA4A 3O2PE 3T5XA 1X8MA 2IXLA 4EJUA 1B6AA 3QRFF 4MUVA 5LRSA 4LK1F 2KKOA 1O3TA 3U10A 2GC1A 1SD6A 4X6RB 3RIRA 1KU7A 1CAVA 1FSHA 4IEZA 3WW3A 3RKYA 1FBQA 1USSA 3HTUA 5LLQA 3EBRA 3RYPA 2FXAA 4U88A 2HR3A 3FWEA 5E8IA 1IF1A 2BV6A 3OF1A 5J48A 2PG4A 5JSRA 4P9FA 4AIKA 3NKTA 1OFNA 1B59A 2EJRA 1BI1A 5H20A 2MBFA 3I64A 1JUHA 4FX4A 1J0RA 3KLNA 3KEOA 4BYYA 4I2OA 1SD5A 2V1UA 1YFYA 2D45A 3QACA 4LA3A 3JW4A 3BROA 3GX4X 2OBPA 3H1YA 2GQQA 3CJXA 2OZ6A 4P9UA 2A69F 5JSOA 2K4JA 3LAGA 4NVPA 4AVPA 4Y13A 5C8WA 5IT3A 1IPKA 3J7AO 3RPUA 3BU7A 3I58A 2QYOA 1KU9A 4IJAA 3NEUA 1IN5A 1FBUA 1Z6TA 1GQGA 4IEQA 3CUOA 1CAVB 2O03A 4PJYA 1BIBA 1IW7F 3PVBB 4UXAA 2OA4A 3L9FA 5E17F 1FYKA 5FD5A 1ON2A 3COAC 2BE5F 2H6CA 2IA0A 4ENKA 2BNMA 1FXZA 3TDZC 3FZVA 4BQAA 1SMTA 3F21A 2DU9A 1W7PD 3IKVA 5DUIA 2M45A 1XGSA 5D8LB 1S7AA 3H8UA 4I02A 1ZG5A 1Z1DA 3H7JA 1Q3EA 3I54A 3EDPA 3E6DA 3LWCA 4YYOA 2QQAA 2MA3A 3LA2A 1BI0A 4CXFA 2NRAC 3ZMSA 2BEOA 1UD1A 3HYIA 2XV4S 2VPVA 2M8EA 1XGOA 4UNOA 5HS7A 4Q0VA 4HVOA 3QPTA 1ZLKA 4BHPA 3S7IA 3ZMVA 1RC6A 2F4PA 1U3EM 2VXZA 4LFUA 1DZRA 5FPZA 2HTJA 4U7DA 4IEUA 3DXJF 3I71A 2EA4A 5L3FA 3RI4A 1KYWA 3HOTA 5TRDA 1O3RA 2UWMA 4WK8F 3I0TA 5HOOA 5C6CA 3BPXA 4HVRA 4KDPA 2EV0A 3EYYA 4O6JA 4S05A 3P9CA 4LEJA 1WKMA 3WTSC 4IERA 1FYLA 3MQ0A 4HOBA 1RTVA 1JGSA 5J3UA 3M7GA 3BP8A 3H9AA 3UKTA 1BN5A 3F8MA 1H9GA 3W6KB 1FP1D 4D0PA 1ZX5A 5J8FA 3HHHA 4RGXA 3FHIB 2QVOA 4XF3A 3EQEA 1T0FA 3CF6E 3OCPA 5JCTA 1ONVA 2OQGA 2Z33A 2F5EA 1CAUB 5F1RA 1Q5OA 4KMFA 2V1DA 3MYXA 3GWZA 1REPC 3J80Z 3D0SA 5KHGA 3BWGA 3SCHA 3LQRA 4LULA 4XF9A 3FFQA 4IHTA 1FC3A 5CLSA 1AOYA 1RGSA 4YIFA 2HJIA 4WXDA 5FDBA 2JZYA 4WZCA 3L2CA 4EGZA 1XDUA 2ESNA 2Q0AA 3KP7A 2LSOA 4ZU4A 2C6YA 1ULYA 5JFRA 4G7HF 2HYGD 2JSCA 2CSOA 2UYBA 1DPUA 1KA8A 3P9KA 1H1IA 3QOPA 1XSVA 2V9VA 1FY7A 3H7YA 5L3EA 3DEUA 2FMLA 4M73A 1TQPA 2A07F 4L0ZB 2HKOA 4R1HA 4MGYE 1ZZ6A 3ECHA 3O6BB 4OIQF 2D40A 1OR7A 4O5VA 5H6RA 5BS6A 4KUMA 3SHFA 3UKVA 4YG2F 3D0JA 2HEOA 5BPDA 2MH9A 1IZ1A 1VR3A 2M5WA 1QY4A 2MLKA 4KU7A 2Y48A 5LGNA 2AXLA 1Z9CA 1H0MA 5AONA 1IRGA 1BI2A 3IDCB 3TOAA 2RVCA 1ZARA 2Z9OA 1J2XA 3NJZA 1T2KA 3CO7C 2Q8KA 4M9XA 2XAQA 3HUGA 2PLYA 4TV7A 1FSEA 2YPRA 4EM0B 4AD9A 3GW2A 1NYWA 1P6RA 1G6NA 4YIIA 2L4MA 1TW3A 4G6QA 5J6XA 3ES1A 2VONA 1USTA 4ZU7A 1UHWA 4O9EA 2D1HA 1DGRA 4R8HA 2XASA 1SFEA 3R60A 5A2QK 3FMSA 3M8FA 4PCQA 1U8RA 1UIKA 1QWRA 1U5TC 1WSUA 1LR5A 1J3RA 2OZUA 2LKPA 1WGPA 2MHFA 5BPIA 3L00A 4ENMA 2VOOA 3HT2A 3WTWC 3EJKA 5HDNA 3FHZA 1ON1A 1OYYA 2DAOA 4LG0A 1MD0A 4A6DA 3RKXA 4MV2A 3JTGA 4KN7X 2STTA 1WI9A 3WTUC 2EFWA 2HFHA 2QQ9A 4I0BA 3GF2A 2CAUA 5E1ZB 3ZDSA 2G7HA 4NQWA 4JTOA 4UXNA 4IEXA 3GVAA 4AQ2A 2XAHA 2MLGA 2X4HA 4MTDA 5I0SA 1I5ZA 1V3FA 1EH6A 4A12A 1ZZCA 4QXKA 2CG4A 2DI3A 1ZRCA 2GC0A 3ZQ7A 4KA4A 3ZMTA 4ZH4F 5LHGA 2PA7A 2M30A 4RB3C 5HDKA 4PGHA 1EP0A 3U1DA 3ZMZA 3LA3A 1GXPA 4FHTA 4A0XA 2MC3A 1MJAA 4HDUA 1XMAA 3HSEA 3M3IA 3HRUA 3V8JA 2J5PA 3NQOA 2QNKA 3J80K 2L54A 1O4TA 4ENJA 2QBYA 3M70A 1ODDA 3G73A 5DCMB 4EJWA 2HKXA 1LDJA 3KFWX 4U0WA 3E5UA 3MPBA 1DGWA 1W5SA 3WODF 1EPZA 2F2EA 3GFLA 3DP7A 2GA1A 5ED4A 3I4PA 1LNWA 3FXRA 4RD7A 3E6MA 1NZCA 4AIHA 1IN7A 2EAAA 3WU0A 4IXAA 4KFCA 3TGNA 1HKQA 3HRTA 3MZHA 1U78A 2GWRA 2NS0A 1STZA 4HLTA 1R22A 2ZO4A 1J5YA 3ISPA 1D8KA 3CUQC 2QCSB 3ELNA 1LEAA 2GXBA 2A68F 1WQ2A 1K6OA 2DFIA 5D8KB 4KIGA 3BJ6A 5JSPA 2XRNA 2V79A 5HS9A 3RKWA
chains in the Genus database with same CATH superfamily
3E5XA 2PI0A 2B7YA 1BOAA 1U2WA 4HDVA 2PQSA 2Z3YA 2VVDA 2HYXA 1UXXX 2FDJA 4YFNF 5ICCA 4P5OA 4M3CF 3BG5A 2OPKA 3AYDA 4QDQA 4XFCA 4GH4B 3MFKA 3DWLE 4O7XA 1SLBA 5GZGA 4DOUA 3ATGA 3BI3A 2IRFG 5JVTA 3UL2A 4IOAF 2J1TA 1IC8A 2KJCA 4WVVA 4HG6B 2CQ7A 5EJCA 1JTXA 1Y6IA 4YVSC 4IGPA 4NPRA 1B72B 5FP8A 3IRRA 3GXOA 2WV1A 2KIMA 4AEDB 2G19A 3DN7A 5E20A 5JMCA 5GP9A 3K4KA 3OS1A 4M3FA 2WINB 2YY1A 1O7LA 5T5PA 3EUHC 4K8FA 1SD7A 1TQ5A 2IFRA 5FPXA 3CP2A 1G9FA 2K2SA 1MBEA 1RUNA 5C9AC 2A6TA 3ACFA 4CCCA 1DQ6A 5E16A 3JRGA 1C3HA 1F5JA 3KEQA 3WTZA 4BY1J 4ZDPA 1D1AA 1ZZ7A 4AU7A 2HQRA 2QDNA 3OL3A 3OYCA 3OBZA 1NOVA 2L4AA 5T5LA 4RGUA 1HB3A 5A3OA 3RI8A 3LSEA 4BWOA 1PP8F 1PUEE 1R6RA 2O8QA 2LRPA 2EB7A 4YFZA 1OLTA 3CESA 3CO6C 4XF4A 1HX6A 4E4ZA 1X4PA 4ASMB 1YJWI 5DCFA 4Q4W3 4Q4W1 4J6GA 2FD5A 4A3ZA 5K5OA 2YR2A 3GUDA 3ELKA 2XC7A 1D3YA 2E26A 1W7PA 2VKDA 2XHKA 2ELKA 1CN1A 3KHCA 2NNYA 2NPIA 1UOJA 1G3TA 3A0NA 3QPSA 2PELA 5CIRA 2DUPA 3MD2A 3K4JA 2WFPA 4ARXA 2Y0IA 5L3BA 4A6EA 1S0IA 1QEXA 1EKEA 1CAWB 4BQYA 1DDNA 4RA2A 1W9TA 4PIYA 2IPQX 3F72A 2E34A 4BE2A 1MMDA 3SQNA 3DLLF 1WLWA 4SBVA 5K5QA 1HKTA 2R32A 4KH9A 3WNNA 5EZWA 4IHSA 3S1QJ 4D7NA 4L9JA 3K9TA 3WNMA 4HK9A 3I9V2 3R4SA 3CDLA 3A02A 4XMYA 1O7FA 1CESA 1O3QA 2WSUA 2NAZA 5J96B 4KNCA 2ZXHA 5FYBA 3E6CC 2D2WA 1V6LA 5HPOA 5FMDA 4U7BA 1WLTA 3FBIB 1Z0XA 1G7YA 1XYOA 1Z67A 3GZUC 3S5AA 3LSTA 3RJPA 2K85A 5JHUA 1GZWB 2A3YA 1EV11 1EV13 3WG3A 5FOJB 5LHIA 2H09A 3N7MA 1TNTA 1YO5C 1WZXA 5L7OB 2X5IC 1B1BA 4FFHA 2LREA 3K2AA 1F9NA 1K78B 2JPCA 1YC61 2ZA9A 5ERLA 3SITA 2M87A 3OD4A 5L3GA 1H4HA 3QPHA 2E9QA 5HDGA 4YW3A 1XG1A 4JRLA 4IVNA 2RDPA 1J58A 4CPBD 1R1ZA 5JPMB 3ZXSA 2BY1A 1L3LA 3P5BA 3JQWA 2LH9A 1S2KA 2P3YA 1IXSB 2G9ZA 4GXLA 5L9VA 1TWCJ 1SAXA 2RS32 4TTGA 5IPAA 2QM3A 4N53B 4IESA 3KHBA 1OURA 2W25A 1BIAA 1YWKA 1Y7BA 2VL8A 4JV4A 4AK3A 1S5LC 4B4PA 1Q8PA 4WV8A 3HPGA 1GYKA 1MSFC 1K5MA 2CYFA 3PU3A 4M71A 2CYYA 4A3XA 3VHPA 2VT2A 3I2FA 1GANA 1SCSA 2W68A 2CQKA 2JIJA 4IHVA 2JUCA 3K1PA 4IPAA 3MI8A 4NC7A 1GNHA 1FOXA 4CEYC 5CADA 4A7YA 1X8EA 2YB7A 3L2RA 1T08B 3K4CA 2F5CA 1WJAA 4CDWB 3FKJA 2RKHA 2OPTA 4RSUA 5L3DA 4P55A 4EJVA 3W6VA 1NLSA 1SC7A 3PVOA 3T1MA 3MKZA 3KYCB 4ZTJA 3ZXGA 1BA5A 4P02B 5KXBA 4RS8A 4KG8A 1W3VA 3RPQA 1MS3A 3TN91 3TN93 1I9RA 4R9CA 4FQGA 1FOKA 5F5CA 3K70C 3IUOA 1BXHA 3LFKA 1H9WA 3TNPB 3OGRA 4QPGB 2HOSA 1F5TA 3TKYA 4Z1VA 4GH4C 1TL8A 2CFXA 1RETA 1LOEA 4JX6A 4FX0A 4FOYA 2XVLA 4OZOA 3RMYA 1WW7A 3HPHA 3VHRA 3NNMA 5DDJ2 3C3VA 4LA2A 2V26A 4HQEA 4L92A 2WLQA 3UYJA 2GOXB 1A36A 1KITA 5LY1A 4XOGA 5FJ8J 4GWMA 4OHXA 5J8CA 4ESJA 3M7AA 1IRZA 2HEWF 4J1WA 1JXNA 3FN9A 1NZIA 4I01A 1FLIA 5C7GA 4KI5M 3KF5A 2E7AA 4BIOA 3NV1A 5FZ3A 4CO8A 1F1ZA 4BK5A 1HA8A 1H8TB 4G94A 3RQIA 2VUCA 2FCTA 4HV6A 2MH2A 1XE7A 2RN7A 2CGPA 2EIBA 4WF2A 5IP9J 3BC8A 1ZZBA 4AYBA 4N7UA 2ZHMA 3T30A 5CPRB 4XFHA 1ZA4A 1ETQA 1YIFA 1YRNB 5EF6A 4NQWB 1W6NA 2JECA 3NMBA 2C0ZA 2LM3A 2WV0A 4AAPA 5FLXK 3IPVB 1LFBA 4HF1A 4RBOA 1K4SA 4BXXJ 5EFUA 1Z77A 4CUCA 5J1XA 2ADDA 4MTEA 2QUFA 4XFAA 4DUVA 4AI0A 2BP6A 4AHWA 3A23A 4NC6A 1WMDA 4YW7A 2P5BA 3ZFEA 3BOQA 1IXCA 4ONUA 3K2ZA 2XR4A 4QPYA 2R1DA 1X36A 1JZ8A 2CFOA 4EM1A 2EV6A 4G9YA 5IATA 3EO6A 2X6YA 5CFCC 5FZ8A 1MACA 2Q2EB 5EG0A 3BKZA 1TME2 4A6OA 1R1A3 1R1A1 3A21A 3ERMA 4ZDLA 5TISC 5BY5A 2CTVA 4XHBA 1V55H 1GNYA 1GP6A 1RMU3 1RMU1 4DNYA 4HSLA 3DL3A 2P5VA 2RS12 5FZAA 1PVEA 4YW2A 3OYAA 2XKPA 2HI3A 4M4PA 2JA6J 4YM2A 2KA3A 4Z82A 3A0BC 3D5LA 2OQ6A 1X2MA 4B09A 5FYSA 5KXDA 5FP7A 1BK1A 3GNEA 1ETKA 1TWHJ 1JYXA 1FBSA 1S8NA 1APNA 1RUE1 1RUE3 2VNGA 1O4ZA 3AVSA 3T0BA 5D4RA 3O1MA 2JG9B 1IQAA 2VQTA 4UF0B 1SEFA 3CCUI 5C4XJ 3ZR8X 4NHKA 4IDZA 2ZFWA 5JR2A 4EN9B 4C1XA 4UY8I 4D7MA 2HEYF 3P1IA 3WQBA 2ZJCA 1UIJA 1CVNA 4CDUB 1Y9MA 2HDDA 2AH2A 3HB9A 3Q9VA 4WM7A 1YJLA 5I8YA 2P6SA 3K4NA 3DF0A 2H94A 1BVP1 4QX3A 3NNFA 1JGGA 2G9WA 1HN1A 5FY5A 2OKXA 1MEC2 4EATA 2R7VA 4D6SA 4OHWA 2W48A 2Q0OA 3SEPA 3H0DA 1UAAA 2BY0A 1XDSA 1UG0A 4BDZA 4N9HA 3T09A 2PJRA 2VE8A 5E8GA 2NM1A 5F6FA 3DQVC 5CU1A 1XQNA 2K9ZA 2QQNA 1RNLA 4RB2C 5G04L 2VC1A 3H5NA 4HANA 4XUNA 5FRNA 3PQKA 1ZELA 4ON0A 4AGGA 2ZMLA 3AL5A 1OHFA 2KMUA 1POGA 1RHI1 1RHI3 2R7ZJ 1U5ZA 3OSGA 2ZSIB 3FBNB 4Q4V1 4Q4V3 4A2UA 4IO9F 4FQZA 4S2HA 5K8SA 4LORA 2ZFUA 4AVTA 2M2EA 3BCAA 1CZTA 3SYTA 4IX7A 4XHXA 4O9GA 5C3OA 1CR7A 4PF5A 5BQTA 1QH6A 5FREA 4BS9A 3DBHB 1C1FA 3S32A 2V72A 4O65A 1Q56A 4RYDA 4TYSA 4CUAA 3K3OA 1DGWY 2P17A 3RSNA 2VJ5A 4PSWA 3OYLA 5J1UA 2NZ9A 3TRSB 1W28A 2RNJA 3N4MA 2COBA 5LASA 2QGUA 2LNBA 4OIPF 1FPQA 2W47A 3JBG2 5A3MA 3E97A 4CP0A 3S16J 1VP6A 3PUAA 3TOJA 3LD8A 3FC0A 3ZOIA 4H0EA 5I0TA 3H5RA 4MZUA 3ABKH 1JHJA 4CE8A 3WG1A 2MEV2 3U21A 4ZYDA 2L5QA 4XF0A 4UUVA 1RPWA 4RFRB 1DIWA 3I2KA 5D5WB 4Y4RA 1UY0A 5FYUA 5DMYA 3LOIA 2RJLA 3WW4A 1Y1WJ 4JHZA 2X1DA 1W8NA 1QJFA 3DYMA 3ZDVA 2DQLA 2NN8A 1HW1A 1AVBA 3M1EA 3ROUA 3RKQA 3SZGA 5CG8A 1IG3A 1KZHA 4FOQA 1YHFA 3VFZA 1E3PA 1JJ6C 1JTYA 2XJRA 3ZIXA 1QJY3 1QJY1 4RGSA 1CF7A 4XCAA 4K2EA 2OYZA 2EBIA 2GMMA 1RITA 1YYVA 3DU6A 3V7SA 2B9VA 3S3MA 1GZCA 3G2BA 4HX8A 1F4AA 4K9SA 1MVEA 3BTZA 2HGCA 3TNQA 4FTEA 1HQNA 5FJHA 1VB4A 3AL0C 1SLCA 4UUSA 3J4UH 3SC7X 2I10A 2FNAA 5EWSA 2CO5A 1I1GA 4OI0A 1WGXA 3RZJA 5IT9Z 3K3NA 1P9QC 4EN7B 2RMU2 4JC1A 4FFIA 3JXSA 1E2XA 1Q8VA 1LOFC 1FTTA 2DU1A 2L01A 1UHSA 4XDOA 4XLPF 2XWJB 5FV3A 4YW1A 3B73A 2GP3A 1RIOH 2O0OA 4N43C 1R092 5DAQA 4LXLA 2HBTA 2WKKA 3CDHA 1G3YA 4WXCA 3ZN5A 5FKBA 2XUEA 4U0YA 2HWVA 2EVXA 4LR4A 4AHYA 4B7EA 5D21A 3BB6A 2NXNB 3GJAA 3TQNA 1IG7A 4EGYA 3ZN0A 4ZKTB 4WCGA 4U36A 1H2KA 5LK5A 2EAKA 3G6EI 5KR7A 5AIPA 4PQQA 3T2QA 4MHUA 3GJBA 4L9VA 4H7LA 5DPNA 2HQ5A 4N4NB 2K86A 4HSJA 1Y0UA 4YVSB 4I0WB 5E89A 2CUZA 4V2FA 2L9RA 3URFA 4ISQA 4IRIA 2JRMA 2OU2A 2BVMA 5D6EA 1FZPB 1ODNA 4EMSA 3K69A 2GIVA 1GUIA 4PUSA 4BPZA 1AKHA 2FQPA 3Q9OA 5FZGA 4N4OB 3M3CA 4META 4GA9A 2Y9ZA 1PK6C 2HOEA 4HQMA 5KK1A 4Q5SF 1ZVFA 3ZN1A 3VOEA 5D5UB 2BVVA 2AACA 1PVXA 4D8MA 3B3QE 1JU3A 3GZ5A 2WNEA 5FZKA 4OHVA 1PHMA 1Q1HA 3H50A 1NA1C 3U4SA 1ZGAA 1R71A 1DZTA 4GXOA 3IWZA 4IE7A 2ZGNA 1ETXA 3TO9A 5FPLA 1LOCA 3KV9A 1YLFA 2CQNA 2Z5UA 1QZZA 1EAH1 1EAH3 1VRBA 1T6SA 1N1SA 4Y1XA 4ZJZA 1VQ6I 4Z2AA 3KT1A 3GBFA 1F5FA 3OPWA 5DUWA 2K9LA 1BMV2 3MICA 4QD2A 3WDYA 3ALQA 4QKFA 4Y20B 3UK9A 1RYYA 1TT5B 3RZKA 3FMGA 3I4IA 4IQ4A 3F0CA 1DYKA 5IYCJ 1GVDA 5FFXA 2P3IA 5IVBA 4XLEA 3BOWA 4BZ4A 3CJIB 1R00A 1JU4A 2EFQA 5C4WC 3S14J 1O4YA 3FMRA 2QQKA 2IEKA 1E57A 2ZHNA 3VKOA 1AR82 4MGKE 3N36A 1FPN1 1MJBA 1FPN3 4QGMA 3DCFA 2KRCA 3TYJA 4LJZF 3ZYIB 2J1VA 2WZPP 4XQ4A 5A3PA 2KIUA 5AFEA 2ID6A 1O5UA 2R4GA 1AR93 1AR91 4QKDA 4AI8A 4MQVA 3K7AJ 4KIBA 3LDBA 1RXGA 4FCYA 2M1BA 1YLLA 2EZHA 1QIQA 3MIGA 1L3JA 1Y56A 2Q1ZB 1ULOA 2IXSA 5CZKA 5BNOA 2FUG2 3VD7A 1CJDA 2DTRA 3CD6I 4PZJA 1IN4A 4BQWA 3KYLA 4R9DA 4FPCA 3R0RA 3S2WA 4OU0A 3I3BA 3R05A 4PDWC 3TWIA 2VBWA 4D94A 4CICA 2FD8A 3HZJA 4GYIA 2WA4A 4LKSA 5KBFA 4LHNA 4LKDA 1Z7S2 2FJ1A 2W92A 2A3XA 2VMIA 2XAFA 1W5TA 1W8OA 3BZ6A 4OIOF 4P5HA 2XWBB 4XL9A 3LSKA 1H30A 5T52A 3FISA 4ZTFA 4MFEA 4MNUA 3POBA 1VALA 5DM6F 1I1SA 4ITCA 4E4DX 3I3DA 1QJEA 3I8TA 2F17A 2JUGA 1UWWA 2VTXA 3IAQA 4Q27A 2XF6A 3CLOA 4UW6A 2K46A 3OR2C 2D97A 3CMEI 2DUOA 2STWA 1R5HA 1WMFA 2AGSA 5LBQA 2FF4A 2HVQA 1ND2B 5J1YA 1UMIA 4AQTA 1XC6A 1ZRDA 2OUHA 4D6QA 4BE0A 1U9OA 3R4KA 4YFXF 5FOBB 1KQ8A 4E9KA 5FLJA 3HOZJ 2YBPA 1MS5A 3M3OA 1SPPA 1W2TA 1PX3A 4B8XA 2LMDA 1BZWA 2ZMEC 1XU1A 2Y6HA 5EP9A 3VN4A 4BOWA 2Y9YA 1CZSA 1LFPA 5C3QA 2I74A 3A7QA 1W8FA 3J7YJ 1WMEA 3QH7A 2H8WA 3ZPYA 2YFUA 3MLLA 5EJ1B 4CEWC 5KHHA 4IEOA 1BLZA 2DYSH 4YVSA 3K51A 3T08A 1JZ4A 3BY6A 1BMV1 3AKTA 5JI9A 2K9MA 4RLQA 4QPGC 3BPSA 1KFXL 1S29A 2P4EA 5EHDA 4HBLA 3T0AA 3WF1A 4UW4A 1KDKA 2WBMA 2MPFA 5C5TA 2CHHA 4BNCA 3KV4A 2JTVA 2E36A 4AHZA 3JAMK 1FI2A 3K4BA 1W0NA 1FPN2 2WIIB 1PM4A 2E6VA 1XCVA 4R4ZA 4BQNA 3BG3A 3W2VA 4A3BJ 1S0JA 3LAPA 2P6TA 2V6CA 3P5JA 4LBJA 3S3OA 4MGRA 3LSIA 3WD5A 3H42B 2EIJH 2Y8KA 2E33A 1K5MB 3BR3A 2D5FA 5CISA 2JB4A 1D4VB 2A6EF 3D82A 1Y1VJ 4UFMA 1C57A 1NHAA 3LEGA 1CX4A 3IN9A 3KV6A 2QQMA 1SAUA 1ZBA2 3PUHA 1X8MA 3OUHA 1B6AA 1V9U3 1V9U1 3ZQCA 2WFF2 2KKOA 4HEA2 3U10A 1SD6A 2X6WA 3RIRA 1KU7A 4BQ2A 3VDBA 1FSHA 1C8M3 1C8M1 2C4XA 4V2GA 1WI3A 3RKYA 9ANTA 2D3SA 5LLQA 3EBRA 3OS2A 4U88A 4CU8A 2HR3A 4CCMA 3ZSKA 3FWEA 2R7XA 1XXNA 5E8IA 5J48A 1IOAA 5JSRA 4L5EA 4AIKA 3KQRA 3NKTA 1OFNA 1MVQA 1B59A 1BI1A 5A6YA 1AYN3 1AYN1 2Y34A 2DV9A 1U8BA 1V5FA 3PVNA 4LA3A 2D45A 1XYPA 2KDZA 4Q1PA 1QOSA 2GQQA 1VBB2 3B01A 3ZPOA 5FXVA 1WJCA 4Y13A 1W36D 3WDTA 2BHZA 3K46A 4XOPA 3NEUA 1FBUA 3BZCA 2W00A 1DU3D 2Y38A 4PJYA 4AFBA 2LP0A 3U75A 4QKBA 4UXAA 5E17F 2Z79A 2Y6GA 4ENKA 4B44A 2W5FA 2FDIA 3KB5A 1JI8A 3TDZC 1N75A 1IS6A 2XMLA 3CZJA 2YGLA 2YUEA 3LB9A 3FZVA 4BQAA 1SMTA 3F21A 3VKLA 1Q8OA 1W7PD 4YRVA 3PL8A 2R0FA 4GKYA 5D8LB 2XF7A 5FWJA 3H7JA 4UW3A 3I54A 2X5IB 3EDPA 2VMHA 3E6DA 4IV3B 2MA3A 3LA2A 1BI0A 3ZSMA 3HYIA 5IK4A 2M8EA 5FYZA 3TP0A 5J40A 5AVAA 4RGAA 4BHPA 4OAZA 3LKJA 3OGGA 4XK4A 5A3LA 2ZX1A 2EXHA 1OA4A 1XU2A 2HTJA 2VCCA 2OT7A 3I71A 2WLPA 3RJ2X 3RWNA 3HOTA 3AP9A 4LE4A 4AEDC 1AZDA 3LSGA 4KJZA 2RR11 2RR13 2W39A 2R5YB 3K4LA 1GOFA 4DXSA 3BPXA 2Y6LA 5FR3A 2CSGA 1V0AA 4KDPA 4TN7A 4RA0A 4S05A 3OSFA 4M00A 2R6QA 5DZFA 4LEJA 4IERA 3PMSA 1FYLA 4HOBA 1Y8RB 3TEDA 2KISA 1JGSA 2LY2A 1OLRA 2BWAA 3OEBA 4ZONA 2F6BA 2V73A 3LIGA 4CDUA 1H9GA 3WP5A 1FP1D 2D6PA 4D0PA 1ZX5A 3HHHA 3SQOA 2JDKA 3FHIB 3PUBA 2VW1A 5C5UA 2MABA 3OCPA 4GDFA 5JCTA 1VQ4I 2OQGA 2XB0X 5L36A 1CAUB 5EYXA 2W1UA 3MYXA 1REPC 3ASIA 4GH4A 3BWGA 1HDPA 2JA7J 4XF9A 1FC3A 5CLSA 4LK6A 3P3NA 5BNOB 4YIFA 4CYCB 4WXDA 2Q0AA 1XYNA 2LSOA 2NVYJ 3GTMJ 2C6YA 1Y39A 4IV1A 4G7HF 2JSCA 3MVPA 1RESA 3W58A 2VKHA 1H1IA 1XSVA 3BR1A 3KF3A 2FMLA 4JKKA 2HVSA 1TQPA 4IV1B 4NIHA 4L0ZB 2HKOA 3M2MA 1ZZ6A 2DTWA 3O6BB 2EXKA 2CWSA 4O5VA 5H6RA 2Y6KA 3UKVA 5ABJA 2LTPA 5BPDA 1YJKA 2ZGOA 2M5WA 4OHYA 2M0CA 2Y48A 1S4CA 2ZMNA 2YMZA 2E1MC 3G1OA 4B7KA 4Q4V2 3L9JT 1XNTA 3NJVA 1FJLA 3IDCB 1AXKA 2F4OB 3TOAA 1TNRA 4PQ9A 1WUVA 4D3WA 4DIQA 4YFWA 1GZTA 3OUJA 3WP6A 2Q8KA 3VKNA 5J36A 2C1FA 2L0KA 4TV7A 3K6GA 4LBQD 2Y6JA 2A6ZA 2CGOA 2E63A 3BIWE 3H9GA 3GW2A 1FNYA 3FXLA 3AKPA 1P6RA 3CDZB 1X4OA 1WPKA 2W1WA 4OI2A 3ES1A 2VOTA 3BTCA 1HRI2 1UHWA 2D1HA 1W2UA 5IT6A 2QF7A 3WG7H 4H4KC 2CUJA 2I5UA 3VD9A 3R60A 5FY9A 3FMSA 4DPNA 4PCQA 2VXDA 4Y1ZA 2O5RA 1WSUA 1LEMA 1AJKA 3A0KA 4PJMA 2AXTC 3NJYA 1J3RA 1WGPA 2R7UA 1H8AC 4EJRA 5BPIA 3VYRB 3L00A 3HT2A 4UI9L 3BR5A 2ZKNA 3EJKA 4PJ0C 3DTEA 1ON1A 2DAOA 2ZXQA 3OYDA 4LOTA 4MV2A 3VBUA 3K70D 5A3TA 3SDBA 1WI9A 3WTUC 2QQ9A 1PK6A 2VE1A 5FKCA 2G7HA 1VRH1 1VRH3 2VXJA 5IUQA 4BB3A 1AKHB 4W4ZA 4E7IA 3K48A 1S0FA 3MV01 2X4HA 1MBFA 4MTDA 5IP6A 1I5ZA 2ZZJA 3POFA 4IV3A 4A12A 3B7MA 3MN2A 3WX5A 4NPLA 3WEZA 2GC0A 3ZQ7A 1W3XA 1CONA 4H55A 2OIIA 2VIXA 4A3DJ 4XIKA 4PGHA 2J1SA 3LA3A 2WQ4A 2YU1A 2JDAA 1GXPA 5C3EJ 3ZYPA 5F5QA 1E5HA 4KITB 1RUG2 5FP4A 1XMAA 4A41A 4WVWA 1F8VA 3OIPA 3J80K 1O4TA 1HXS2 3M1CA 4FP3A 3M70A 1U0AA 4QPQA 3THDA 3MFAA 4EJWA 2R7WA 2VZSA 2DFHA 2DJIA 5H9RA 2WNOA 3WODF 3GFLA 4BXSV 5ED4A 1O8PA 3JB8A 4OCTA 5KHDA 4B4QA 4AIHA 3JU9A 1KFUL 1HKQA 4AHXA 4QX2A 2LYCA 1STZA 2JEMA 1RUI3 1RUI1 2D6NA 2OXBA 1UOBA 1R22A 1MZEA 4XJWA 3M3YJ 3DUIA 4N53C 2QCSB 1AYM3 1AYM1 2VVFA 5FPAA 1XX5A 3IAPA 2XQRA 2XRNA 3AX4A 2WUHA 2HXIA 2VQUA 3PUIA 1K4TA 4CDGA 5I8SA 2ETHA 2LUWA 4CDQB 4AGRA 1CJPA 4XM3A 4RR3C 4FTBA 4GZ9A 1H9TA 2TEPA 2V09A 3O7OA 3BG9A 3WY6A 4JBAA 2EIEA 3ZYGA 4FVVA 4CA0A 3H8XA 3V56A 2IGMA 4KISA 3CC4I 1W39A 4YIRX 2LS6A 2XONA 3F95A 3O14A 4OI4A 3WUCA 4PFPA 4F7ZA 3WTYC 2WSVA 4DJAA 3OYJA 4IEJA 1MMNA 5L7OA 2Y26A 4QPIA 4GFBA 5IAVA 2MC4A 1HBXG 2VBZA 4MGSA 5A7NA 1J3PA 2L9SA 1QZYA 2WZEA 2ADUA 1TW2A 3KP3A 4L5IA 3BTLA 4ZZLA 4IEPA 2ET7A 3V8KA 2VZPA 1OD5A 3M4OJ 3H35A 2O8KA 3C3WA 3OS0A 3HEIA 2ZTNA 3JRIA 1D1BA 4CYCA 1LHUA 4MO7A 3MIBA 5BNQA 5IOZA 2W85A 1LOGA 5CFDC 1Y0NA 1YYNA 1UMHA 3BPVA 2GA2A 5EGOA 2B8MA 1YTYA 4DXTA 3ZVXA 2JDZA 4OMZA 4KYWA 3CJIA 4YM0A 3UGGA 2PAKA 5FO9B 1T2XA 4JDOA 3FHNA 1IRFA 5T3NA 4B29A 4BQOA 4XACA 4A7ZA 4C3JJ 5FUIA 4BHCA 4GAZA 1CIYA 1JMUB 2FDHA 4AYBN 3DXUA 1BI3A 2K9QA 1MR5A 1WJ5A 4IHYA 1GOGA 1V4RA 4RAGA 4NHJA 2HWB2 2ZGQA 2ZGRA 3FLTA 1UYXA 4Y7NJ 2GAUA 1OPMA 1SPPB 1G59A 2DDUA 4Q4Y2 4BU2A 2H0VA 1UY4A 4G8XA 5E1WA 5ILUA 3FM5A 2JVGA 1SACA 1KYZA 2PMUA 2VTXJ 1ND2A 4W65A 3CQOA 4AVSA 3RQ4A 3JRBA 2G9GA 1AR72 3INAA 1NCQC 1R093 1R091 3IC7A 2ZEZA 3KE2A 4PDKA 2E32A 1UKGA 3SEQA 1YFWA 4FOVA 4BXFA 3ZM8A 4FFFA 2R7TA 1HDDC 5HLIA 5JI6A 3J81K 3P9IA 2ZMEB 4XRFA 4W97A 1OCTC 4EN0A 2AS5F 2DTYA 4QXCA 2LTNA 1B09A 4BJ6C 3KS7A 2GZWA 1H8VA 5DG2A 1QJU1 4MEYF 1QJU3 2VOPA 1ASJ1 1ASJ3 4Q29A 1VBE2 2QBXA 4HT1T 4BL0B 3W3CA 1J7KA 1QJX2 4QWQA 4UBGA 2EALA 1EF4A 1KONA 4V1PA 1OF4A 2BUKA 4NAOA 2JG9A 1UMQA 1ETWA 5F1JA 1XNAA 4XCBA 1VQ8I 3E5QA 4Q0SA 1MS8A 2VNRA 3LOBA 1N1TA 1OUSA 1DCSA 3HT1A 3TW7A 4NHXA 1JODA 3PFIA 2FQ3A 3GMEA 4RAYA 5ABJC 1MW7A 4OVEA 5B5EC 1R082 5FXWA 4DW6A 3AP6A 1HRV1 1HRV3 1D0HA 3JUUA 1C28A 2ZEYA 3SISA 3RS6A 3A0HC 4EVIA 4MIMA 3R0JA 3VEPA 1BKZA 3QODA 4M4RA 3WQ7A 4XRSG 4GULA 2X09A 4QPIB 4EQVA 3EQLF 1KXGA 1UQXA 2AREA 2BERA 3VB9A 1GVJA 2P2KA 4BACA 2XG3A 4DEVA 4XW3A 4Q26A 3K4MA 5T50A 1ZR2A 4UB8C 5HS8A 3PIGA 1LHOA 4R9BA 5HI0A 4A44A 4NRPA 4XBLA 3HIFA 5A7PA 4IXLA 4ESFA 1R36A 5AFBA 3HKZN 4EQQA 4Y20A 3PVEA 2FNPA 1CF7B 4NR1A 2VJIA 4JX4A 1CIWA 1M4WA 2CU7A 2CV1A 1YUDA 4QB1A 2IAIA 1IZ3A 3MIHA 2DK8A 3HEFA 3G71I 3GEZA 2IXCA 4UYBA 2WY7Q 5CYVA 4JGYC 2BGCA 1O91A 2GLOA 4Y26A 3F8CA 2GU9A 4U0VA 1VTNC 2G4IA 1QO0D 1UMZA 2XGXA 3EETA 1VLNA 1WMXA 4MGQA 2G0EA 1SHWB 4N9IA 5BNPC 1FMWA 2MG4A 2ZXJA 2EA2A 1FNNA 4BQ5A 1R1UA 3GXUA 1GLNA 1DZQA 3GZTB 2ZAAA 2KP6A 1S9HA 1XNDA 2YPJA 4XFIA 4M6VA 2COMA 2RE9A 1OPOA 3GTGJ 2O14A 4XJAA 2KZVA 5FK8A 1V6MA 4Q47A 5CA6A 2NVQJ 2OPWA 1J1LA 4FI9A 3LF7A 4CRQA 3CMGA 3RGBA 4KBBA 2P5KA 4MQ9F 2GH2A 5DD4A 1LCLA 2JXAA 3CHXA 2VGDA 5F32A 3MZ8A 3WG4A 3JD72 4J19A 3KQ4B 2NVTJ 1W2NA 3JCUC 2FA5A 1YQ5A 4OIRF 1QJU2 1AR92 4MG2A 1YFXA 4QB2A 4QB6A 4YARA 4EN8B 4Y24A 2VUDA 4I30A 2IJLA 3BALA 2E7TA 3SCFA 4HA8A 1VBE3 1VBE1 3OYFA 2F5DA 3CMMA 2GMEA 5LA0A 4S0HB 1OQ1A 1XJAA 2JDMA 2W3JA 4BK4A 2W9XA 3PMEA 5CYYA 3KPHA 4PJJA 1JW6A 2M7BA 2DVBA 4RQPC 5F6LB 4QPWA 3DPLC 1Q8QA 3C2UA 4P96A 4BE3A 4XSZF 2PJRB 3AMNA 4WWCA 5FZ1A 1BC7C 1S2BA 2ZHKA 4BGDA 4M74A 1PIV2 3GO5A 2P7CB 2IC1A 1UB9A 2A5YB 3QYBA 3NRUA 1ZNPA 4GWIA 5FZHA 5I8TA 3HBLA 4L5JA 1IJWC 2E5NA 2L7ZA 3S2DJ 4UUSB 2P5LC 1A6CA 3AZXA 4FPLA 1NH3A 2QE3A 1ZGJA 4LLFA 3Q0UA 3LPGA 4WM7B 2PJPA 1MMGA 4P9LA 3AG4H 3H3VK 5JLWA 1B35C 1RRJA 5FKMA 1VF9A 1KJRA 2HWC1 2HWC3 1MS1A 4DZPA 5FY4A 4COUA 3ZQIA 4E2GA 4BJTA 1UU6A 3F8BA 5EYYA 4A5MA 2DFEA 4ASNA 2Y75A 3ZRGA 1VBD1 1VBD3 1I27A 2A05A 1R64A 5A7OA 2DO7A 4AI3A 2VC9A 1OBNA 1FAYA 3I2HA 2C6SA 4RFT0 1AHDP 5CVRA 4XQFA 1TVGA 1X1CA 1OD3A 1QXJA 1K78A 4NIGA 5ERIA 2LG4A 5I91A 4YGDA 2ID3A 2PHDA 2D44A 2J22A 3G6JB 3LA7A 3K4DA 5GKAC 5IVJA 1GZWA 2MSYA 1HLCA 4XC9A 2GXGA 3KGLA 1DPRA 3PUFA 1C5HA 4H14A 4AVBA 4I99C 3FJSA 1GDTA 3KIOA 3LFMA 2JA8J 3LEKA 1XGNA 2PN5A 1VPHA 3CJIC 5D5VB 4HVQA 3AG1H 4GB33 4GB31 2JENA 5GLZA 5FY8A 4DB5A 5FLMJ 2JT1A 2Z2SB 2HNHA 4FPKA 3DXTA 3ZFEB 3S1MJ 3AYEA 2J42A 1MS0A 2IVJA 3TDUC 4ZZ5A 3JAMZ 6PAXA 3RZZA 3VBFC 2XROA 1OH3A 1AXZA 4F55A 5IJRA 2XJQA 4QX5A 3WLUA 4NROA 3MKYB 4A3KJ 4P9GA 4LB5A 3MO4A 2V1NA 2P8TA 1UPIA 5FBZA 3D6EA 5GLWA 3BQZA 2I8DA 4OFGA 3WDWA 2ZMEA 4E2QA 5I0RA 2ZX4A 4Q4ZF 2FOWA 2DVFA 4I0AA 2OCEA 2RM22 3J9SA 2QA4I 2J5OA 1SFXA 3PSIA 1CWPA 4UFKA 3PO2J 2R5YA 1XPXA 1J3QA 3HR9A 3ITQA 4N0BA 1LGCA 1W9WA 2LRDA 1PO13 1PO11 2WA3A 4E7LA 4KQ7A 2DT5A 3GZEA 3SZPA 5FO5A 1XSDA 1SLIA 4HX4A 3I3QA 1E3OC 2XJPA 3BG6A 1R49A 1MJ9A 2TDXA 1GR3A 1GWKA 4XFFA 2QQBA 2CH0A 3CCQI 3BTYA 2UZKA 3QAHA 3L2VA 2JICA 1P7JA 5BOXA 5FB2A 2VQLA 2P0WA 2HYFA 2DJNA 3F6VA 3OYHA 4XKBA 5FPUA 3ZSJA 4AVZA 2X9DA 1T95A 2J7MA 2LALA 2HOAA 2DCKA 4URTA 3NV4A 2A61A 3RDIA 2C9KA 3O1RA 2X0LA 5H9PA 4DYQA 3B69A 5F0HA 1O5LA 4DZJA 2AZ5A 1SANA 4IEVA 1RUF2 3Q9SA 4BLJA 1Z3XA 1IGOA 3K1MA 2YBKA 1R081 1R083 5KHJA 2JKXA 1IDYA 1VAKA 3ZXJA 1GQHA 1L7RA 2VPRA 1JTZX 5CKNA 3LDRA 4QXHA 2R7QA 2OAZA 2XSDC 4BAYA 3JBG1 3JBG3 3CO2A 4W6WA 1XMXA 5EGOB 2ORZA 5EPAA 1PP7U 4C30A 4XVHA 2GM4A 3KSCA 2FDKA 2DA5A 4CDWA 3AMMA 3WGGA 4XBNA 4H7MA 1RL3A 3KLOA 5H6QA 2IS6A 4XFGA 3EXUA 3K0LA 5C3RA 1GUUA 5JI7A 4XMIA 2XBO2 3SHRA 2CW7A 2HWD2 2ZJ2A 3VHOA 2VZUA 3BUCA 3KVBA 1RB8G 3WU1B 3S6PA 1N3PA 5GPAA 2QZ2A 3BDDA 2IGNA 2MNGA 3SDGA 3WG9A 4OINF 1REDA 3ILNA 5FD6A 3HTSB 4DNCA 1O3SA 2VOXA 2P4WA 4BQ4A 1UHMA 3LQQA 4EN6B 3PUQA 3U9GA 4UVCA 3W21A 1HXDA 1A8MA 5FGMA 3CJTB 2IP2A 2JG9C 4BBRJ 4XICA 5M5WJ 2XGCA 1W8UA 2ZS6B 2R073 2R071 5DYMA 3S30A 2YU3A 1RUH1 1RUH3 1YIPA 2EFPA 3PU8A 4AC0A 5IT9K 1RR7A 3NAUA 4RR3B 5K5RA 2X85A 1IKQA 3WE3A 1U9NA 1YRNA 1DP0A 1HV1A 2ZGUA 3ASOH 4II2A 5K7HA 5CQEA 2PAEA 1XSXA 1QQIA 1H2MA 1ZN2A 4RM2A 1WJEA 5FY1A 4H3WA 4CCNA 1U6GA 2RM23 2RM21 2RS52 1OF3A 4IEWA 2VQHA 1TT0A 2XKOA 4Q48A 4COYA 3AFKA 4UB6C 1BC8C 4KWKA 5KNLA 4ITVA 1IAWA 4X1EA 3OG2A 3DBRB 3HQUA 4HYEA 3WE2A 3OGVA 4WBBA 1FNZA 3KP6A 3OB8A 3TBDA 2QSHX 4CCEA 2LROA 4LG3A 2Z69A 4A4AA 3L7WA 2K0GA 3G7DA 4FXKB 4KWLA 1TG7A 1MGTA 1JOBA 1SBFA 5JWPA 2JA2A 5FRMA 2OD5A 4IETA 4XRSA 1S7OA 2WDBA 3POSA 1X19A 1ACIA 4KNYA 2VUMJ 2VW0A 4MGZE 1GP4A 1ZRRA 2OZJA 3HGGA 3V42A 1FYUA 4IV1C 2PMZN 4BJ5C 2V5DA 4NAMA 3TO6A 1B9NA 3ZQQA 1LENA 3ZMNA 1SLLA 1FATA 1HJFA 5E3NA 2YROA 3X29B 4M6XA 2VODA 4UV8A 3VDDC 2LOOA 4LLNA 3VKFC 1VMHA 1WJDA 1PK6B 5IVVA 1CX1A 1E17A 3POIA 3MDPA 3EYPA 3ZSLA 2V9KA 3CMAI 1DUXC 3CC2I 2GNDA 5DZGA 2PXJA 3J7NA 2HDCA 3F22A 4F8AA 3ETPA 4MGIE 4M3EA 2UWBA 3N7LA 2ZX3A 1TC3C 3NSTA 1NQJA 2EQRA 2R7FA 2PHLA 3U11A 4XOTA 3B6CA 4S2DA 1H6YA 4AYUA 3HD8B 2IGOA 2UWCA 1QVTA 4BUPA 4AVAA 4DYRA 1VZ0A 5JLVA 4G12A 1WD3A 4GWJA 4OULA 1V6OA 1OCRH 2DW4A 3KLSA 1P92A 4BQ1A 2DOEA 3CJRB 3WGIA 3WDXA 4UBHA 1QMJA 4C0HA 5A6XA 2IVIB 3KD4A 2L9LA 2B0LA 1PMIA 3CKHA 5CJ9A 2W24A 3SEZA 1IXRC 2NYXA 2R92J 4PBPA 4BBSJ 4JQFA 3AVRA 5BXXA 2PAMA 3U14A 1ODMA 2IW5A 4ABZA 1Y3TA 1P4AA 4J25A 1D2SA 3NVCA 2WL1A 5CB7A 3A01B 1JKOC 2LR8A 3IIAA 1HOMA 1LECA 3POEA 4L9NA 1AR81 1AR83 1HB1A 5FJKA 4CU7A 4J1XA 2ELJA 4XMAA 4QAWA 3SXYA 2D6LX 5SV5A 2KR2A 3EUHA 2HDWA 3DPTA 3U2RA 3A4CA 3DFGA 2LKXA 3VSLA 3ZR5A 2HZDA 2QKMB 3RYRA 2YC4A 1ST8A 4ZY9A 2ERFA 1JZ3A 1G86A 4Y4YA 3IDBB 1MBJA 3QP6A 2DLLA 2ISYA 2L7KA 2Q2EA 5EG0B 5IP7J 3O1VA 1SZBA 1X1AA 4PHZA 3ZFFB 3ZKYA 1ZTRA 3SKVA 1UCRA 4Q4X2 4XKVA 1RUG3 1RUG1 3OPTA 4Q0PA 1G3WA 3ABZA 1MBHA 2C5DA 1CPNA 1CAUA 1OOPC 3IL2A 3MHZA 2EK5A 3ABMH 2OA2A 4IRGA 1F35A 5IVYA 1K83J 1P8JA 3H1WA 1WW4A 1LODA 1ZYRF 2ARBA 1IO2A 2VR4A 5EEAA 1NLQA 4K40A 1FYMA 3LZZA 2VMGA 4ZYHA 1Q43A 3LSHA 4JDNA 1W7PB 4I09A 3EMRA 4JX0A 2JPBA 1AL21 1AL23 3NRVA 3AZZA 3ONQA 4JKLA 1UCXA 4E70A 2RAEA 1H8TA 4ENNA 2E60A 1PUFB 3RCOA 3ZFGC 1ND2C 2VY0A 1Y9QA 1KQ0A 3GTOJ 2CRGA 4CCLA 4BHBA 3WGHA 4A0YA 4LT5A 4XLNF 5DV5A 1SLAA 2FMYA 1VQLI 2XLAA 5AIQA 2BBAA 3HN3A 1X3UA 2R49A 4AVCA 5C8CB 2DDAA 5I0UA 1XNCA 2A6YA 4LKEA 1PMHX 4O3MA 5FLXZ 1T38A 3VBRA 3LCPA 3NL1A 2DBBA 3H0GJ 2V1XA 1COV3 1COV1 2EFOA 4F83A 4QM8A 5GJ6A 1BJQA 2A7AA 3QYFA 4HPKB 3JRAA 2X5IA 4XLHA 4QPGA 2XJVA 5ILVA 3DGTA 1TWAJ 2WN2A 3OOUA 3DCQA 1U5YA 4LLLA 2Q4SA 2D6KA 5FLHA 4DRVA 3I56I 3RZGA 1WA4A 3VBFA 1TME3 1TME1 2DVAA 2GDFA 3VBSC 4AEKA 1RUJ3 1RUJ1 3QRFF 4MUVA 5FIXA 2XBO1 2XBO3 5LRSA 1O3TA 2NP0A 2I07B 4K3UA 1DHKB 4X0GA 2YBSA 2RS11 2RS13 3C7GA 3WW3A 3KVAA 1FOD2 2OQ7A 5LA2A 3HTUA 2DYCA 3VD4A 1AR73 1AR71 2R0QC 1D0ZA 3RWKX 5IFPA 2VASA 4P9FA 3N7JA 4AZZA 2EJRA 2R16A 3I64A 3ZQLA 1JUHA 1J0RA 3RPUD 4BYYA 4CTEA 3O1UA 4I2OA 2V1UA 3AMQA 1LUJB 3JW4A 2ZZQA 3BROA 5GZDA 4LMFA 4QWNA 3N7KA 3GX4X 2OBPA 1Z7LA 1GV5A 3O1SA 1PJRA 5JOWA 3USUA 4P9UA 2A69F 3S93A 5JSOA 3T4HB 3AK0A 3LAGA 2L7MP 4MYEA 2KT0A 4WM7C 4A3GJ 1IPKA 3BU7A 1D0XA 2MYSA 1C8M2 2X6OA 4IJAA 3C7OA 1HB2A 1W0UA 4BEHB 1JUSA 1GQGA 5IYYA 4IEQA 3UNPA 2DCYA 2O03A 4XAEA 2R5ZB 4L8QA 4NO4A 1BIBA 3AB0A 2OA4A 1HIXA 3L9FA 4FPOB 2VCAA 2XVGA 2H6CA 2IA0A 1WCDJ 4CDXA 1FXZA 1IQDC 5E3LA 1UN1A 3HOBA 1TZLA 4V19K 2DU9A 3QD6A 3IKVA 2VZ3A 2M45A 1XGSA 1DG6A 4I02A 2JDHA 3UV9A 1MZ5A 1VQ5I 3CCLI 5ACA2 5EDNA 5CAZA 3WG2A 1ENRA 1PZ7A 2QQAA 1W5CC 5HV0A 3ZMSA 2BEOA 2XJUA 2Y0SA 3VKMA 2TRTA 1W6PB 1UO9A 4IW3A 2Q1FA 1RUC1 1RUC3 1OISA 4HVOA 3QPTA 3ZYHA 1GOHA 5FAXA 3U78A 3ZMVA 2YHJA 2F4PA 1QA6A 4C2UA 3IZOA 3MKLA 4MXWB 3I2DA 1YQCA 1D7PM 1NG7A 2VXZA 2UU8A 2M3AA 1DZRA 3DXJF 5L3FA 4Q8LA 2VL4A 1FMD2 2BGOA 2BQPA 1O3RA 2UWMA 2RDQA 1VIWB 5FZFA 2ARXA 3W20A 4LHLA 1F2NA 2DN0A 2W94A 1JN2P 3VL9A 4CXYA 2WO1A 3ESWB 5J3UA 3M7GA 4XN0A 2Y60A 4Y33A 3UKTA 1BN5A 5CFDB 4QSHA 3L2WA 1JJ8C 4FQ4A 1WH5A 1VQ9I 1UY3A 5IFTA 5J8FA 1TP4A 4KGQA 4A45A 3N05A 1BVVA 2FMDA 2QQ8A 4GIQA 4QU2A 1A3KA 4RN5A 2G1MA 5C33A 2BXZA 1WCUA 1MZFA 2VUAA 3QWLA 2F5EA 4JYKA 3HWJA 4FO9A 4P9WA 3NAPB 4FPGA 4KMFA 2V1DA 3GWZA 2WAQA 3D4KA 5GTHC 3LQRA 4LULA 4OYUA 4AR2A 5JXGA 5F6KA 5M5YJ 4TSVA 5LY2A 1RGSA 5C44J 2HPMA 3FXMA 3L2CA 4E4HA 3IM0A 4EZHA 2VZTA 3VBOB 1QH7A 3KP7A 4FFGA 5A7QA 1ULYA 4IE5A 1CD3G 3AKRA 5A3WA 2DF7A 2R7EB 1KA8A 3DU5A 3QOPA 1FY7A 5L3EA 3ACGA 1YRZA 2A07F 4P9XA 3TN92 3ECHA 4OIQF 3G4SI 2D40A 5JVGF 2V5YA 1OR7A 4KG0A 5BS6A 2NQYA 1G8WA 1JZ6A 4II3A 2HEOA 3UT0A 5B4XA 4QT6A 4Y1VA 4CCKA 3OSDA 2DUQA 4ZXEA 4BISA 2MH9A 1PO23 1PO21 2XJTA 3QPLA 5E3OA 1PMJX 3TEWA 2L9VA 3DPRC 4KU7A 3O8GA 1K42A 4MHRA 5LGNA 2WAFA 2AXLA 3HNMA 2D3PA 5L19A 1KDMA 5HNFA 2EILH 2G9FA 2OCCH 2BW8A 3NJZA 1T2KA 4XNFA 4BKXA 2JMWA 2D98A 2XAQA 5GLTA 3HXLA 4A6SA 3JRFA 3DYOA 3ZYFA 4AD9A 2MD0A 1OFCX 4FPFA 3JRCA 2VB6A 2L4MA 1TW3A 1QNWA 1NCRA 4ZU7A 4PK4A 4O9EA 1DGRM 3WU2C 1DGRA 3ZFEC 4R8HA 4LK7A 5A2QK 3CBNA 1QWRA 3S2HJ 2Y33A 3MGUA 1YJNI 3C8XA 3U37A 4RQPB 5DQ0A 2MHFA 3VBHC 2VOOA 4QPOA 3WT3A 2E71A 1H1AA 1PVC2 5F0FA 4R9AA 3ZMOA 1OYYA 1H8TC 1ULPA 4M3BA 3E1F1 4KN7X 3IPVA 1OVSA 4I0BA 2CAUA 3RQ0A 1SG3A 4NQWA 4RLFA 3GVAA 2XAHA 5FMCA 5K0UC 4LO4B 2EINH 2XSJC 5I0SA 1NX9A 1V3FA 4Q5OA 1EH6A 1ZZCA 3H3LA 2CG4A 2IUWA 5FZDA 2QQUA 1SVLA 1CPMA 2KM2A 1GICA 3ZMTA 4ZH4F 4QHOA 2M30A 4RB3C 5HDKA 3JQXA 2JE9A 3ZO0B 2AQEA 1B35A 2VQGA 4QDSA 4E8CA 3WUDA 4UAPA 3M3IA 5JHFA 1NKGA 1ITYA 3TAYA 4Q4Y1 4Q4Y3 3RRDA 1JZ7A 3C2BA 4OQ9A 5DAPA 2QBYA 3I2JA 5L9BA 5GLUA 5FO7B 5DCMB 2KFDA 5F0CA 4C3HJ 3L2UA 2NS7A 2VI6A 5CKMA 3MLKA 2HKXA 1C1LA 1LDJA 4WM8A 3MV11 3W5MA 1A6QA 5FZ4A 1JUMA 2NOGA 3E1SA 2K9NA 4AW7A 2GA1A 1GKBA 1ZR4A 3FXRA 4IGOA 4AEJA 3E6MA 1IN7A 1DGRN 2WNUA 4PLNA 4KFCA 2W91A 4K1YA 3JR9A 4D9JA 5T55A 3IH4A 3I4NJ 3FK6A 1C5IA 2DA6A 4X8NA 2ZO4A 4XAAA 2DA7A 3CUQC 3AZYA 4PI2A 4B4RA 2XQXA 1LEAA 3RZMA 1WQ2A 3HOUJ 4Y1YA 2V79A 2WY8Q 3R61A 4QPIC 3HUGB 2YSRA 5D8AC 4YGBA 2GN7A 1HQWA 2Q8CA 5HVQC 3KGZA 1GNZA 4TXWA 1JZ5A 1MNEA 1HW5A 2PEXA 2VT3A 1YIJI 4GALA 4LK0F 4YG3A 1G9CA 3ON7A 3I3EA 3CEWA 1Z78A 3ST7A 4YZ1A 2EV5A 4BA6A 3GGLA 3ILRA 5FK7A 3HNBM 1LOBA 5F3GA 4UVAA 5LK7B 4LO6B 4AFDA 1GT0C 2HOTA 3B94A 4UT5A 5I93A 1HSTA 1W99A 3TO7A 4YEJA 2JG8C 1MH3A 2MD5A 3ABTA 3HSRA 4QGLA 1XNBA 3RNSA 4FE7A 4L0YB 2UY9A 3ILFA 3R0AA 4CHUA 3EYIA 3SXWA 1R23A 5D5XB 1V70A 4XF1A 4RGRA 5FROA 1K5MC 4HW0A 4E7ZA 1T6GC 4LBMA 1JYNA 1JYWA 2WJSA 2VQAA 3I59A 4HPQA 4Y5Z0 1UYPA 4BQQA 3AJYA 2XLGA 4HONA 2Z99A 3THCA 5L7OC 5F3IA 4XQWA 3O0WA 4EJTA 2L02A 2RDNA 2GNBA 4YVWA 2O9LA 4RGGA 4BXUA 2E19A 3NW4A 4NWWA 4UFJA 3H1MA 2ZNZA 1QHDA 5BNNC 3MEXA 4LTAA 4FAGA 4G6DA 1YS6A 3ERED 2A70A 2Y2ZA 3HQRA 3SJMA 4JQRA 3M9AA 2WRAA 3VDXA 3AG3H 2DOAA 5LGTA 2DQRA 3CQZJ 3NQHA 1C4RA 1RIRA 4NB5A 1YCIA 1JYTA 5E18F 3WF2A 1YS7A 4L97A 4LQRA 3AM2A 2O61A 3D3AA 3NNJA 3BQYA 4M3DA 3RZDJ 3K4ZA 1POQA 4HSRA 3MEPA 2QKDA 4Z2YA 1WWXA 3IMMA 5HCBA 1UOGA 4ZYEA 4JVAA 3KZZA 1UG2A 3OYKA 1CAWA 3TL4X 1BW5A 1RUH2 3EUKL 3C7JA 2A3SA 5F3CA 1DBNA 4INDA 1MMAA 5T5OA 5TGTA 3FUOA 3CC7I 3VBHA 5IVEA 3OOPA 1R1VA 2VKVA 2UYAA 1FIAA 4AE2A 2VNOA 3ZFFC 1ETOA 3S0MA 4HF0A 3JRDA 4B1RA 1S0EA 2F48A 3RTRA 2ACJA 2K02A 2VO5A 2E7QA 3T0YA 2QWWA 3HG9A 1FEXA 1LU2A 4FAHA 1V5GA 4DXZA 4IV3C 1B8IB 3F3XA 5HCAA 3ZFGB 1AL0G 1TMF1 1TMF3 5GZFA 4KICA 2QZ3A 3F8FA 4W8JA 4N8MA 1R5GA 4A69C 5A33A 3I2OA 2GSYA 3SCGA 4FPJA 1LU1A 1PNFA 5FZ9A 1VAMA 1UNBA 3N9PA 3DBLB 2WR9A 5GPCA 2JB8A 3I49A 4GCVA 3IB3A 5GALA 4WX9A 3ES4A 1G2HA 2Q8DA 3IKWA 4YGCA 1SQ4A 2ZCWA 2XAJA 5A32A 3UKNA 2JA5J 2B9SA 1ETVA 1JOJA 2B9UA 4XDPA 2QDRA 2VBXA 1IKPA 1MH4A 5JUVA 4MFDA 1UY2A 2ESHA 1H9PA 4N43B 1HB4A 4HLXA 2FBIA 1O6UA 5FZ7A 3WTXC 5C9AA 1B72A 4UF0A 3I3MA 4LO7A 3AMPA 5CVUA 2ZAHA 4FPHA 2ET1A 3U4XA 3VZLA 2JIGA 3F2ZA 3BOPA 2QFEA 3IKTA 2GIZA 1NE4A 3A2KA 1Z7S3 1Z7S1 3ZYRA 5DDGA 4QTRA 5LHHA 3NWKA 4M0NA 5F3EA 2KHMA 1MBGA 1ULEA 1WCKA 1OKQA 3V0BA 4HAMA 5KXEA 2TNFA 5DZEA 3GZ6A 5BNNB 2XHNA 3PL0A 3CCEI 3ECOA 1G9AA 4NBQA 1OKRA 1H88C 1YHQI 2IWGB 2RJKA 1TNFA 4B1LA 1R58A 4RHV2 2DURA 3CIHA 4EROA 2LLKA 2I45A 3UGFA 2B4KA 2CDPA 4RAZA 4YW5A 4PLMA 2LY1A 5HLGA 3HQXA 2QQVA 1ZG3A 4XLCA 4D1QA 1Q8SA 2KXLA 1X7NA 3DYPA 1S0BA 5HNHA 4ASLA 2HS5A 5B1BH 1MQTA 3Q5FA 1SMYF 4L11A 2B45X 4DYCA 3DTKA 1S6LA 2PHRA 2A1XA 4PIXA 3BYWA 1L0OC 2JG8B 5CVIA 4Q8KA 3OBRA 3ACIA 2MEV1 2MEV3 1N25A 1YJ9I 3J7LA 1W6NB 3L2YA 4EJOA 2LK2A 1ZLJA 4HX7A 1ERDA 2P34A 2RR12 1FX5A 1ZA7A 5JAXA 1SFNA 3ASNH 1DQ5A 4XIDA 5JXIA 1XB4A 4HSTA 1XNKA 1D0GA 4NRMA 4A93J 5BNPB 4HN0A 1UZVA 3SMHA 3AFGA 3I7DA 1RZ4A 1JHNA 1OMIA 4IOCF 1H2LA 1A35A 4JTNA 2PHTA 1RVF3 1RVF1 4YVWC 2VD7A 5IK7A 4M3CA 2QENA 1FTZA 4KMQA 3IWFA 3S7EA 3Q8FA 1TWGJ 2PN6A 1IS5A 1FMVA 1MZBA 2W95A 1UY1A 2WS93 2FBKA 2WS91 1VMJA 3O3KA 3HC7A 3OUIA 4UOJA 4MVTA 4QIWN 4XURA 2HEVF 3KV5A 3ECQA 2FDGA 1L7QA 4DBQA 3G1LA 1Z6RA 2RGVA 5BV6A 1WRJA 2ZSHB 5A6QA 2GOMA 4GGGA 2BPA2 1JE8A 1AX1A 1F9KA 3PNVA 2E5ZA 3CUQA 2K40A 2VBBA 2IS2A 5FZOA 2JDUA 3VD5A 2VW2A 1WJFA 1QHGA 3CDIA 2IBDA 2VZ1A 1LULA 5HXVA 4ZZ8A 2KJBA 4I7HA 3PIJA 4ZU5A 3OY9A 2VLAA 4XR6A 1KU2A 4QHZA 4FBFA 1ZHFA 1X3ZB 4RB0A 3OGSA 4GMP3 4GMP1 3Q3SA 4CEYA 1A31A 2CS3A 2J1AA 4NMIA 1ENHA 1WCMJ 3WTVC 4JP0A 3PIOF 4XETA 3MUZ1 5ACA1 5ACA3 1D0YA 1I1EA 2BBYA 1XRUA 5FKOA 3B02A 3HRSA 3S3NA 2ZX0A 4DUWA 3SZTA 3TEZA 1XMKA 2UXNA 4AI2A 4EV0A 3IRQA 3T4VA 5K9YA 4YSFA 2RVAA 5KC6A 1XN7A 2KQRA 2IXIA 4IEYA 1X1BA 5JOYA 3QU6A 2CW0F 3V0AB 3BCWA 3WHTA 3AKSA 1NXD1 5K7PA 1EAH2 1STMA 4N53A 1Z0HA 1NE6A 5J09A 2B39A 5E1RA 2KDOA 3PURA 2F5VA 1UFMA 1RUOA 3FF5A 4Q0QA 5IAXA 4LMYA 2ZABA 2JSPA 1LB2A 4HK8A 1PGL1 2PHFA 2ZACA 4XJ8A 4M72A 2CU5A 2Y64A 3ZYBA 3M8EA 4CDXC 1NA1A 3POWA 2QLZA 4YGEA 3AAFA 4D5CA 3WTTC 3KT4A 2BBVA 1OSGA 2EZLA 1UU5A 2LBFB 3PHMA 1BYHA 5A3UA 2ZBKA 1QNYA 3T8RA 1AUYA 2D3RA 1R4MB 2YZ4A 5A80A 2A6XA 4TLGA 4UV9A 1FOD1 1FOD3 3D5RC 1QRYA 4RM3A 3ZQFA 2AC1A 3M3QA 5HXMA 4WVMB 3RJRA 1H2NA 2K4BA 5KHIA 2PFBA 3GFJA 4JX5A 1QXPA 4BLIA 4MHGA 3WF3A 3P3PA 3SFIA 2H6BA 4LPLA 3G3ZA 1O4XA 1EYBA 3CZ6A 2DCTA 1ND3C 5FZIA 3KCXA 4Z92B 2LDUA 3OY8B 3VDDB 1US3A 5JDBA 2O0YA 1RXFA 2SLIA 2WS92 4XN3A 1G8XA 5D6FA 5BPXA 2R062 5LW9A 3CF2A 1H1MA 2WFF1 2WFF3 1WW6A 3WNKA 1DDLA 2LW8A 3BJAA 4GJYA 4BM8A 1WBFA 3QQAA 4D69A 3IMNA 1V5EA 3CLPA 3RZLA 2K5CA 3N97A 4YELA 2X48A 2YGMA 2TBVA 2H8RA 2JRTA 2VQCA 1LGBA 4CPBA 4BY7J 2BU9A 4M0HA 4B1MA 1MS9A 3H9QA 3BODA 1PO12 2CGNA 3ZYJB 3H8OA 2JQ7A 3BZKA 3VZNA 1XOYA 4C0BA 2BFUS 3AXEA 4CCJA 2Y69H 1HCRA 2K27A 2RV9A 3VZMA 3JZVA 4CP2A 2E1NA 3HBKA 3PJQA 4Y3OA 2BVBA 4A0ZA 2KLOA 2M4KA 5B66C 2HYKA 2W84A 3VBOC 4DINB 2DA2A 2GP5A 2WABA 3OYEA 4YNIA 3BU0A 1ZREA 2L3DA 2OX0A 2FOKA 1YIOA 2IZWA 1W9FA 2VOKA 2B63J 4A3FJ 2IXJA 4RS5B 1VMFA 5FYVA 3BR2A 2VXRA 1VBC3 1VBC1 2Q1MA 2WZR1 2WZR3 4LBLA 2PBIA 3MZYA 1GV2A 2XB6C 3LGRA 2DCZA 5J37A 2KD7A 2HZTA 3IH3A 4CZSA 1Z7UA 1HF0A 2RDRA 2Q8EA 4AFMA 4AEDA 1AA7A 1MIJA 3FXQA 4XRMA 3FXJA 3IDEA 1DQ1A 2EFNA 1F43A 1XBFA 2H1LA 1QPMA 4DXRA 5M3MJ 2ZX2A 4AIJA 4JOMA 2K3PA 4CVUA 1J09A 2ID4A 3B9IA 3MWMA 1DQ0A 4AFCA 2M7AA 4Y22A 2QQIA 5CKTA 1W0PA 4XTPA 1Z3YA 4BDVB 2DFCA 4EZ4A 3PQJA 2H27A 4A3CJ 3WP4A 3R6SA 2ZC2A 2IS1A 4IQJA 4C90A 2RQPA 1ZH5A 1QDOA 1BK0A 2BOIA 1ZKGA 1FIPA 1SLTA 4CEWA 2WYSA 3IAS2 2BHYA 3FUQA 4Y5TA 2XL9A 2E7WA 1N47A 3QH6A 5FUNA 1E5IA 5D1IA 4M3CE 4KT6A 4PDWA 4NIDA 3RZOJ 3HOVJ 1I6HJ 1K5JA 4ZDOA 4BMBA 3W2AA 2PQQA 1E5SA 4MH0E 2ZGTA 4CH7A 1HRI1 1HRI3 2ENRA 4AVVA 4F3QA 4WXHA 4LJHA 3GLLA 4JKMA 4NNJA 1RKWA 4PJLA 4JGZC 4XORA 4MEXF 1W4MA 2WN3A 3FE5A 1U5TA 1M1EB 3PJRA 4I98B 1X1DA 3Q8AA 5J4VA 1KS5A 2WNVC 5LBEA 4CZCA 5HBAA 2KIFA 4FASD 5F37A 4YG0A 4URAA 1AF9A 1AJOA 1FX7A 1YE9A 1YITI 3NAPC