3D0SA

Camp receptor protein from m.tuberculosis, camp-free form
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
224
structure length
224
Chain Sequence
b'MDEILARAGIFQGVEPSAIAALTKQLQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISDSERLARRAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REGULATORY PROTEIN
publication title Crystal structure of cAMP receptor protein from M. tuberculosis in the unliganded form
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
total genus 69
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3d0sA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3d0sA01
2XKOA 3WW1A 3SCHA 3H8UA 1J2XA 1CAXB 2IXKA 2HOEA 3CJNA 1OPCA 1OYYA 4NB5A 3UKVA 2QBYB 3WW3A 1SFUA 2FXAA 3ZMDA 3SZPA 1PP7U 2VONA 5TJJA 3KP5A 1BC8C 4IRGA 4M71A 2I45A 2GC3A 1RGSA 2H27A 3PLQA 2H0VA 2A6HF 4HOBA 2CWEA 1Z9CA 2D40A 4KMUX 1SEFA 3MDPA 2NAZA 5DCMA 5FLIA 3T8TA 3GFLA 2XLGA 1GQHA 3CTAA 1QXRA 5BPDA 5JCTA 1U5TA 2XLFA 3M7GA 2OA4A 2XVCA 3E97A 2LF7A 2Q2EA 4QM8A 3RIRA 1P2FA 5E8IA 1MJAA 2H6BA 1VTNC 4CXFA 3V7RA 1HSTA 2HFHA 4UVAA 1BM9A 2FRHA 5FLHA 3QOPA 3GZ6A 1YFHA 1H0MA 3H7YA 3ZMSA 5I0SA 3LZZA 4IHSA 1Q3EA 2KRFA 1FBSA 1TLHB 1U2WA 3W6KB 2QUFA 4BYYA 2DQLA 1U8RA 2UYBA 3T8RA 4YG2F 4KNYA 1D8JA 1CAUA 4L2NA 1JUHA 1ZRCA 3L2CA 3MEXA 4XFAA 3FM5A 1IRGA 3FFQA 1TNTA 3ZDSA 1YUDA 4LLGF 3GX4X 2PHDA 1BIAA 3WTTC 3NEUA 5ICGA 2VOPA 2W84A 4P9GA 1ZRRA 2IW5A 1WLTA 4EJUA 3GYHX 4XFBA 1LVAA 2BNNA 3OCPA 4G6QA 4EGYA 4F8AA 1RC6A 4HV5A 4BXUA 1TTYA 3BJAA 3CUQA 1ZG3A 1R22A 5DD4A 3VHRA 4YYOA 5A2QK 2GXBA 2D93A 2BV6A 2Z99A 1PP8F 2B5HA 1T2KA 2Z69A 3BB6A 2OQGA 2PMHA 2P5LC 3S0MA 4HBNA 1WA4A 1RZ4A 3FF5A 4U7BA 4UNOA 2JPBA 2KIUA 3BZ6A 3I5UA 3EDPA 2RVCA 4YFXF 2H09A 1PM7A 5E8GA 4P96A 2D45A 5E18F 3MQ0A 2QQAA 2DPDA 3J81Z 2IXHA 3M70A 1R1UA 2IA2A 4ZYEA 5LBQA 1XGMA 2HQNA 1CX4A 5D6FA 4KA4A 1HKSA 3SXWA 1XB4A 2HKXA 3DN7A 1ZGJA 1KQ8A 4I02A 3QU6A 1DUXC 1XGNA 4OMZA 4BQAA 3PNAA 5L3FA 2FF4A 4JBAA 1S3JA 2WFPA 4CHUA 4HW0A 3FWEA 2FBKA 3NRVA 3BPZA 4S05A 4P9FA 3SQNA 2V1UA 4M73A 5KHKA 1RI7A 4XFFA 1GHCA 3LAGA 1H9TA 1Z91A 2ET1A 2MBFA 1OKRA 3SFZA 4CZZA 2FA5A 5CVJA 1IXCA 4GXOA 5LLQA 1DP7P 2D5FA 1DDNA 1SFEA 4HVOA 2QYOA 1W7PA 3USSA 4RAYA 2ISYA 4LLNA 1HXDA 2PA7A 4HAMA 3C7JA 4FX4A 4JQFA 4HZFA 3VODA 3HSRA 1IUYA 1TW3A 1WKMA 4LA3A 4AIJA 1IAWA 1CAXA 2PQ8A 3IDBB 1EH7A 4A0ZA 2QBYA 2K02A 1TNSA 2A3SA 1XSDA 4YNIA 1G4DA 5IT9K 2VE8A 3TKYA 5E1ZB 1FLIA 2Y75A 4IXAA 1Z1DA 4NQWA 2GIVA 2EK5A 1MGTA 2ZKZA 5E1XA 3P9IA 3U11A 2Y0MA 5J6XA 3MWMA 2RNJA 1RNLA 3QAHA 5D5UB 2O61A 3C1DA 5FPZA 3DP7A 4EWAA 3KLOA 4RGSA 1K79A 2KJCA 4S04A 4HV6A 2RDPA 3OTFA 1SFXA 4LUKA 2VXZA 4U0YA 4KU8A 5J7MA 2O8QA 3NJZA 1TQ5A 4KWJA 1VR3A 1BN5A 3FXUA 2CV6A 2ESHA 1G3SA 2W24A 1FP2A 1HSJA 4QLCU 2DI3A 3V4GA 2EVXA 1QWRA 2Q8KA 3LQQA 2RN7A 2C0ZA 1P4AA 3ST7A 4UV8A 3IRQA 3OF1A 5I91A 3RYKA 5ED4A 2C6YA 1I1GA 5ICFA 3V8JA 1HW1A 2QM3A 1SD5A 4M74A 5BPXA 4OLLA 4HLXA 1J3QA 4XFHA 3QPTA 1IN5A 4BIFA 3ELKA 1UIJA 5BOXA 3GLXA 3WODF 1FXZA 2GAUA 3DKWA 4EWEA 1VP6A 3EYIA 1GXPA 2VBYA 1Z7UA 4BHPA 2ESNA 4ZYHA 4LEJA 1YFWA 3J81K 2EAAA 4G7ZF 2ZNZA 4WK8F 2DCTA 2A6EF 3LAJA 2ETHA 4XFGA 2UXNA 3S7IA 4M6YA 1ZVFA 2KXLA 1F5TA 3WTZA 4ZZDA 3JSOA 2F5DA 2XRNA 4MGRA 1YW9A 3O2PE 4RS8A 4AWXB 1MJ9A 3ISPA 2W25A 4XLNF 1UCXA 3HT1A 3DPTA 2XROA 4E70A 1WWXA 2E1NA 4HLYA 1XSXA 2GC1A 4HN0A 2CFXA 2J5OA 5D4RA 1U5TC 2Y0OA 4OU0A 2L01A 5HS7A 3SXYA 5AVPA 2LDUA 1EV7A 2YU3A 4ETSA 2EFOA 3GBFA 4LK0F 3HT2A 2VN2A 3IHUA 2CAUA 4OIQF 1CAVB 3HHGA 1OR7A 5H6RA 5BQTA 4ZU7A 3K1PA 2ZBKA 3FMSA 1U78A 4L11A 5CVUA 5DEQA 1UCRA 5HS8A 5J48A 4HQMA 4XSZF 2RKHA 2O1QA 5JFRA 4HBLA 4YIFA 1AOYA 4JVAA 3JSPA 4HSLA 3FE5A 5HS9A 4I0BA 3H3UA 4GCVA 1U6GA 1UHWA 3WW2A 1ON2A 3UKNA 5I93A 4NHJA 1X7NA 1JHHA 4P55A 2GWRA 1HBXG 4EJVA 4XF1A 1ZZ8A 2KJBA 1CF7A 2ZKLA 1SFNA 2HKOA 2Z5UA 1LRHA 1T6SA 2BGCA 1PMIA 1J1LA 4UVBA 1ZLKA 3HTUA 1IRFA 4J1XA 2VC1A 4U0VA 1EYBA 4A5NA 3E5QA 4D0PA 1YFUA 4A0YA 5K8SA 2PI0A 1S29A 3KP4A 4EWDA 3M3IA 2XL7A 3I64A 1P4WA 2V1XA 1FOKA 2DBBA 2RV8A 1I5ZA 1MKMA 1ZLJA 3EUHA 1W5TA 4G8XA 5A2QZ 1B9NA 3HRSA 3KEQA 2PTMA 1KU7A 3NKTA 5EEGA 3JTGA 2UWMA 2HQRA 2XAJA 1RTVA 3N97A 5JSPA 1J3PA 4Z2YA 5DD8A 1FWZA 2X0LA 1QY4A 1NE4A 5F6FA 4Q48A 4EJWA 3G73A 5ILVA 2HR3A 4META 1FYKA 3F21A 2LNBA 2PFWA 1KYWA 2ZMEB 2QWWA 1S8NA 3WTSC 4XLPF 4PJYA 4L5IA 1CAWA 2OZJA 3ACLA 3S2WA 4LGWA 2VE9A 3C3WA 3K9TA 1OD5A 1BOAA 4XFCA 1HW5A 4HF0A 4CYDA 3LSTA 4DNCA 1Z6RA 2M8EA 1Q43A 4MX3A 2AS5F 5D8LB 3GF2A 3KZYA 2MH9A 3IDCB 3KSCA 2MD5A 3DQVC 4WVZA 3SHRA 4ENNA 4IEWA 4XETA 4YARA 2XL9A 3VOEA 3VEPA 3E5UA 2ETEA 3RZZA 2P4WA 3DF8A 4BAYA 3OV8A 4M6XA 3H50A 2DPUA 3TO6A 4IEPA 4HX8A 4ONUA 2H94A 3ZPLA 4OIOF 2VECA 2P5KA 3EQLF 1OYIA 1FBQA 4DINB 1YW7A 4HX7A 5FD6A 5ICCA 1ZRDA 3SCFA 4O5VA 3E6DA 4Z07A 3FXQA 2LKPA 5D4SA 2E7WA 2PBIA 4GYIA 3S7EA 3IWZA 1LR5A 1BIBA 5J8CA 4H7LA 3R60A 3MZHA 4AVBA 3K2ZA 1ZREA 5JHUA 5DYMA 5LEKA 4PDKA 2BYVE 2O3FA 1LB2A 4AD9A 2DQRA 1MJBA 2QVSB 5EZWA 4A6DA 4E2GA 1X3UA 1RL3A 3J7AO 3F72A 1SQ4A 3F8BA 3AAFA 5BXXA 3LA2A 3F3XA 3KP2A 3FMRA 5IT9Z 4WWCA 4XSXF 3ZMVA 3GUDA 2P6SA 3CF6E 4LG0B 1TBXA 2XUBA 3EQEA 1R36A 2P7CB 4RD7A 3FZVA 4MEYF 4UXNA 3KZZA 3GFIA 1H9GA 2EJRA 5K5OA 4FAGA 3FJSA 3IKTA 2JPCA 3FHZA 2W85A 3BROA 4RAZA 1QBJA 4XBFA 4L9NA 2IXJA 2PFBA 4IHTA 1IN4A 3EO6A 1BBYA 2DW4A 1QO0D 3D0JA 2MLGA 1R58A 2MH2A 4H0EA 3HTSB 1ZRFA 1YS6A 4Q47A 1X82A 4Q5SF 1XE7A 1O3RA 2QJVA 5I0UA 1EH6A 4IVNA 1WI9A 4U7DA 4MH0E 1UPIA 1UFMA 3NSTA 4IJAA 2PAMA 1IN8A 3RJPA 4XEZA 3BOQA 2GC2A 2ZJ2A 4LA2A 1F1ZA 1X8EA 4PIYA 1FP1D 2PJPA 4ESJA 3FM3A 3KCCA 2DFIA 4A5MA 2E1CA 3H1WA 1YFYA 4KICA 3Q9VA 2P5VA 3CEWA 2IJLA 5BMZA 3CLOA 3CUOA 3BDDA 1DZRA 3QRFF 2VT2A 3RKXA 3HSFA 4Y13A 4R1HA 4WXCA 2VBWA 2VBXA 1B1BA 4B8XA 4IRIA 1KA8A 1Q1HA 3M8EA 4LB5A 3OOPA 5HDKA 5L3GA 3GFJA 2B9UA 1FC3A 3BCWA 3I54A 2LF8A 2UY8A 2VBZA 3IWFA 1NHAA 3DFGA 4IRHA 1ON1A 4LLOA 1NXMA 2BNMA 3WGIA 5D5WB 3WTXC 3HOTA 4PIXA 2M45A 1P4XA 4BHBA 3RPQA 1IF1A 1FSHA 2ZFWA 1FYMA 3BP8A 2MC3A 3N4MA 1K78B 4IEXA 1R1TA 2ZO4A 2L4MA 4EROA 3GVAA 1O4TA 4KIBA 3TQNA 4A12A 1W4MA 2HWVA 4UV9A 5FD5A 3J80K 2B0LA 3ABUA 2FBIA 2NRAC 4HQEA 4AVAA 4UBGA 1DGWA 1SMTA 2CAVA 4N0BA 4AVPA 3EJKA 1R5HA 4Y17A 1FX7A 4MGYE 5H20A 1IPJA 1MZBA 1REPC 2K0GA 4L18B 4N9HA 4K8FA 4RGRA 3RKYA 3E3VA 1LNWA 2QLZA 2F2EA 4I98B 2A69F 1KYZA 3PQJA 2IA0A 4G7HF 4HVQA 1B4AA 2GA1A 3KMHA 4WBBA 4KU7A 1JHFA 5JSRA 4LLLA 3VFZA 4FAHA 1E2XA 3IRRA 1YWKA 4ZH4F 1ZARA 4GO1A 3IC7A 2D1HA 1STZA 1S6LA 4KN7X 1ZN2A 3H9AA 1BI3A 1BI2A 3ECHA 3KLNA 4MQVA 4TLFA 3HYIA 4HDVA 2GH2A 2JT1A 5LGTA 2O8XA 4KMFA 2OD5A 4Y15A 1U3EM 4Q0VA 2WWYA 2XKPA 1ZAOA 2EWNA 1Y9QA 1XGOA 4GYGA 4M9XA 3I0TA 3LQRA 3BU7A 1KQ0A 2CO5A 3I58A 4R8HA 4IEOA 1F9NA 4EM0B 1MDMB 3RDIA 2VPVA 1FY7A 1YS7A 1BJAA 5KBFA 2EA4A 4EGZA 2LSOA 2YR2A 1B6AA 4FHTA 1T98A 4ASNA 4G94A 3LA3A 3ROUA 3REOA 1XDSA 4F7ZA 5L3BA 2MHFA 2IVMA 3F8MA 3PFIA 2BEOA 2H6CA 2QCSB 4LB6B 2NS0A 2F5FA 1TQPA 3K0LA 3I59B 2EFPA 2EA7A 4O9EA 2ZNYA 3R6SA 1B59A 2PN6A 1QXJA 3WE3A 2CQKA 1UIKA 4Q0QA 4ZYDA 4XF3A 2WV0A 3MAJA 1ZYRF 1IPKA 1XGSA 1Y0UA 2OA2A 5JSOA 4QM9A 2PLYA 5BS6A 3ZMZA 3HIFA 3BALA 5E20A 2XASA 4EQQA 5KHGA 4MGKE 3RKWA 4RB2C 5LRSA 1G3WA 2JRTA 1SD6A 3TNQA 4MUVA 2KKOA 3O6BB 3IIAA 4XRFA 2AXLA 3EYYA 5IT3A 4HMZA 4EV0A 5CLSA 2P7VB 5HVQC 3KP7A 2ISZA 3TDZC 4BHCA 3BJ6A 1K7AA 2FQ3A 5EEHA 5KVRA 2OYZA 3PQKA 3ES4A 4I3PA 2N7GA 2QNKA 5LHHA 4KN4X 1MD0A 1LQ1A 1BI0A 3CJXA 4L5JA 2QQBA 3P9KA 3E6BA 1ZG1A 1IXRC 2BNOA 1D8KA 3ZMTA 4KWLA 4E2SA 4P9UA 1FBUA 4KFCA 3B02A 1HW2A 2FQPA 2OQRA 4HDUA 3FX3A 4RGUA 1J9IA 1OI6A 4FBFA 1EY2A 2QVOA 4ESFA 4IERA 3KGZA 2RGVA 3JW4A 2QZ8A 4UXAA 3W6JB 5DUIA 1IN6A 1GQGA 4LULA 2WTEA 4Q29A 1CAUB 4A2UA 2QDRA 3D0SA 1DPUA 4QXKA 4ZYGA 3IBMA 1FZPB 3QP6A 4O3MA 4XF4A 5CYVA 2PYTA 4RB1A 4A6EA 5BV6A 3TNPB 1QZYA 1O5LA 4QX5A 3MYXA 4CICA 5D5VB 2EB7A 1IN7A 4O9GA 3ZN1A 2IXLA 2ET7A 3WG9A 4MZUA 3T5XA 5HI0A 3CUQB 2O0YA 4WZCA 3D82A 5AIPA 1ZH5A 2D1VA 2STWA 2D2WA 3T0YA 3F8NA 1J5YA 2HS5A 5FDBA 5CJ9A 3RTRA 3TOAA 1FPQA 1XE8A 3FMQA 1SD4A 4ENMA 3R61A 4Q0UA 2XAHA 4EM2A 3L00A 2JSCA 2FU4A 3V8KA 3B73A 3MFKA 1LKNA 1S7AA 2F5EA 2NNNA 2M87A 4ENKA 5F64A 3L9FA 4LJZF 3WW4A 2JZYA 1ZZCA 2P8TA 3LOIA 2V1DA 1W5SA 3OD0A 4Q0SA 1KGSA 3T1BA 3ZMUA 1C0WA 4M72A 2DLLA 1QNTA 2L02A 4MV2A 1MDMA 2UYAA 3DXJF 2Z2SB 2GA2A 1LDJA 5D8KB 3M8FA 1HKTA 3FXRA 5DUKA 1USTA 3ZN0A 5HOOA 3ML6A 3GYDA 3V8LA 4FT8A 4RB0A 2VT3A 3NQOA 1O57A 2GU9A 1DPRA 4UHTA 2FSWA 2CGPA 2DT5A 2Q0AA 1JGSA 3VB2A 2R3SA 1O7LA 3FHIB 3HRMA 5BY5A 3J80Z 1D3YA 3BJOA 4O6JA 1WGPA 3LA7A 2NNYA 2K27A 4J1WA 2FNPA 5K5RA 1TQIA 5I0TA 5I0RA 2CSOA 1ZZ6A 1ZGAA 4ESBA 3P9CA 5E17F 2V09A 2A07F 3BPXA 3OGJA 4G7OF 2ELHA 3KGLA 2UY9A 5FLXK 3HQXA 1A04A 2IA1A 3CLPA 1FI2A 3WE2A 2X4HA 3R0JA 4L0YB 1DZTA 4ZZLA 4YFKF 1XCBA 2M5WA 2ADUA 2VOOA 1CGPA 4I0AA 3LAPA 1T39A 2YX4A 2L54A 1XRUA 2MA3A 5FFZA 1SD7A 5C6CA 3TDUC 2EFWA 4HA8A 3CO7C 1KQ9A 5HLIA 3GFMA 4HLTA 2MNGA 3R0AA 4IEYA 2UZKA 4PIZA 1UW8A 4AQ6A 3ABTA 2Z3YA 4HSJA 3F8CA 4HF1A 6PAXA 1EPZA 1SAXA 2M1BA 1QGPA 2P6TA 4EVIA 2BBYA 4GGGA 4LK1F 4MHGA 4QMAA 1WRJA 3GXOA 1O5UA 4OMYA 5H6QA 3O14A 5JAXA 1CAVA 1VJ2A 3R4KA 4M9SA 3U0ZA 4L9JA 5I8SA 1UB9A 2XLAA 1IZ1A 1ZNPA 4N9IA 5F1RA 3F22A 4LUMA 5ILUA 1XMKA 3Q9SA 4ORFA 2ZXJA 1O3SA 1BC7C 4YFNF 1R1VA 2FMLA 1R00A 1KU3A 1WQ2A 1HKQA 1XN7A 3IL2A 3TOBA 4LD5A 4ZU5A 4QGLA 3G3ZA 4K2EA 1J59A 2HDCA 2J5PA 3H7JA 1IXSB 3ECOA 4XFIA 1XSVA 3QU3A 4QGNA 2IC1A 4KIGA 3V7CA 5C8WA 4IEUA 2A5YB 1RUNA 4OOIA 2V9VA 5JI6A 3F23A 2M30A 2CG4A 4QWQA 3H1MA 2RQPA 3M9AA 5E16A 3CL1A 4ZU4A 5EFUA 4KWKA 2A61A 4RGXA 4MNUA 2YSRA 3CO6C 3HRUA 3PVBB 1R5GA 5ERIA 2DO7A 3GO5A 3E5XA 3JAMK 2P17A 3H92A 4ON0A 2HJIA 5KK1A 2OZUA 4KL1A 4LFUA 2F5CA 4HYEA 5FO5A 2XAGA 1NE6A 5JVTA 2YX7A 2Q0OA 2HGCA 4UVCA 3KP6A 2ZMEA 3C18A 5HLGA 3WU1B 2GC0A 1P6RA 4IETA 1YFXA 5ILSA 4L9TA 2Q4SA 2XAQA 5L3DA 4WXHA 4D7SA 5FFXA 2JTVA 3TO9A 3JZVA 2MPFA 1OMIA 2XIGA 2FNAA 4D7TA 3TGNA 4PCQA 3ERED 1ZZ7A 4PGGA 2OU2A 2V79A 4Q0PA 5TRDA 4EJOA 1O7FA 5FQ0B 2GQQA 3P7NA 3K1NA 2OPKA 2K7LA 3BPVA 3DV8A 2EV0A 1JXSA 1R23A 1ODDA 4I09A 3SCGA 2E7XA 2EFQA 1GVJA 1V3FA 3WTUC 3QACA 3F6VA 1K6OA 4TV7A 1OYWA 2DK5A 4MQ9F 1SMYF 4JTNA 4YSFA 2VC0A 4WX9A 3GW2A 2ATFA 2PAKA 2OZ6A 5CVIA 1YW8A 2FOKA 2G7HA 2IXIA 2NYXA 1CF7B 4I01A 3RNSA 2Q1ZB 4BH9A 2HYFA 2BE5F 4GULA 3GWZA 5AONA 1L3JA 1PUEE 3QP5A 4BNCA 4MTDA 3EHKA 3I7DA 2K9ZA 5FB2A 3HSEA 2XV4S 3KP3A 4YRDA 2L4AA 1YYVA 5FPXA 2EV6A 4MTEA 1XD7A 1FSEA 2D5HA 4XF0A 1H1IA 1KU2A 2G9WA 3HOSA 2B8MA 4I7HA 4NVPA 4X6QB 3I71A 2FEZA 3H1YA 4LTAA 4HF2A 2CW0F 3HUGA 2O6GE 2CYYA 2KIFA 5LRRA 4PGHA 4JV4A 3ETQA 1R7JA 4R52A 1J58A 1CAWB 5JR3A 2OAZA 4ENJA 3U9GA 3WTYC 1UHMA 4KT5C 4LG0A 2A68F 5D6EA 1F4KA 2L3DA 1L0OC 3FZ3A 3WGHA 4JK1X 4U88A 1LDDA 5HDNA 3WTVC 1O3QA 1PDNC 2Y48A 4CDGA 2FMYA 5DDGA 4OIRF 2EA2A 2G7UA 2HTSA 4M9ZA 3LFKA 4KIFA 2HEOA 1EP0A 1HQCA 1D5VA 1V70A 4KDPA 4EMSA 2DU9A 1Z6TA 1J7KA 1ZG5A 4WXDA 1G3YA 1I1SA 1FT9A 3NVCA 4MGIE 1XCVA 2QQ9A 2IT0A 3CDHA 2YPRA 2PEXA 1USSA 3ZQ7A 4U0WA 1ULYA 4IF4A 3DPLC 5DCFA 2PG4A 2DAOA 3NL1A 4IPAA 4FX0A 1YO5C 3LWFA 2K4JA 2Z33A 4X6RB 2R7FA 2OBPA 2DTRA 1V4RA 1UD1A 3ELNA 3G7DA 4OINF 5LEJA 3RYPA 1E17A 1G3TA 4WF2A 1NZCA 2GXGA 4P5OA 2PQQA 1LDKB 4HX4A 3ULQB 1X8MA 5I8TA 3GEZA 1P92A 2IPQX 2Z9OA 1EH8A 5FLXZ 2XAFA 5BUVA 4HN1A 4YIIA 4Q4ZF 2E9QA 5J3UA 2TDXA 3QPHA 5DCMB 1G6NA 1BI1A 3I53A 3I4PA 2VODA 3RI4A 3ES1A 3RPUA 4IESA 1FYLA 1U5TB 3LWCA 5D5XB 3TO7A 5AIQA 2HTJA 5K5QA 2IP2A 3UKTA 3JTHA 5CVRA 1ZX5A 4AIHA 3COAC 5L3CA 2WC2A 2K86A 4PZJA 1RIOH 2IXCA 2PHLA 2O03A 1IW7F 2FE3A 2XHKA 3IKVA 3WU0A 1K78A 5FQ0A 1S7OA 5L3EA 3H3ZA 3K69A 3MCZA 1OFNA 1W7PD 3KFWX 2V6CA 4KUMA 5E1WA 2RC4A 3EETA 4MEXF 1J3RA 3WTWC 2ZCWA 4AVCA 5E1RA 1LEAA 1I27A 3L2HA 4DQ2A 4R79A 1XDUA 1ZZBA 4CGZA 1T38A 3EBRA 4B09A 3F8FA 2R7DA 2GZWA 4OIPF 4UBHA 3BWGA 3L09A 3SHFA 3BY6A 1QQIA 2XGXA 5J8FA 2KIMA 1YQAA 2EFNA 4AIKA 4UUVA 4HVRA 2ACJA 4A0XA 2PAEA 2EV5A 3KE2A 4Z82A 5T3NA 1T0FA 3MPBA 5DV5A 3ZP5A 1Z05A 4IEVA 1FNNA 3K1MA 1YLFA 2K4BA 2MLKA 3CUQC 1J75A 2W57A 1WSUA 1TQMA 4WCGA 5I8YA 2UXXA 1B9MA 3KETA 1LJ9A 2DK8A 3MZYA 2IRFG 3KEOA 4B29A 4LMYA 2HYGD 5ICEA 5CU1A 1U12A 3CO2A 4L0ZB 2PMUA 2STTA 1NYWA 4EJTA 3JAMZ 1J0RA 4I2OA 4E2QA 5FCCA 3V7SA 3U10A 3U2RA 1GXQA 5KHHA 2QENA 1ONVA 1L3LA 4L9VA 4KYWA 5K1YA 4EM1A 1ZZ9A 1QZZA 1AWCA 1YHFA 1TW2A 3HHHA 4AXOA 3L7WA 5BPIA 5CADA 4RB3C 4CO8A 3DL3A 3U1DA 1JE8A 3RYRA 2FBHA 4MGZE 5CVVA 4QGMA 5KHJA 1YG2A 5LGNA 1I6XA 4XF9A 2HZTA 3F6OA 5FLJA 1LEBA 5LHGA 2VQAA 4IEZA 1RUOA 3C3VA 1DGRA 1KU9A 4G6DA 3DEUA 5HLHA 3E6MA 3GZ5A 1O3TA 4OFGA 3SMHA 3O3KA 5D1IA 3M1EA 5KHIA 5JR7B 1Q5OA 2Q30A 3I59A 3HRTA 2COMA 3WGGA 1YLLA 1W7PB 4IEQA 3NW4A 1Y3TA 5LGUA 5HDGA 5FGMA 3D5LA 1QPMA 3E6CC 1ZHFA 5LHIA 4JTOA 1YTYA 4AQ2A 4G9YA 1YIOA 3SZTA 1XMAA 2F4PA 3Q5FA 1H1MA
chains in the Genus database with same CATH superfamily
2GN3A 5FY0A 2E2IJ 4CA0A 1DGRN 3GZUC 2GBYA 1YXWA 4NB5A 3UKVA 4JOMA 4RA2A 4MFEA 1ZA7A 2VXRA 1SFUA 3WP4A 4NIDA 3KP5A 1BC8C 4IRGA 1UKRA 3PLQA 2VKVA 2IGMA 1X58A 4QPOA 1X2MA 2CWEA 2J1VA 4KMUX 1WMXA 1MIJA 4XKCA 3MDPA 2VOVA 1COV2 3OYMA 1NTCA 2WABA 2JE8A 3GFLA 1GQHA 1MBGA 2YFZA 3VZLA 5E88A 1S0JA 5DDJ1 2OA4A 2VW2A 3N05A 2LF7A 2GNTA 2A6VA 2G4IA 1OF4A 2WB1A 2E71A 2H6BA 4CXFA 5DABA 3JRBA 1W36D 3RQ4A 4II3A 5EXOA 3TMOA 2HFHA 4UVAA 5FLHA 1I5PA 3GZ6A 1YFHA 4QX0A 3O1VA 3FXKA 4Q8LA 4IHSA 1Q3EA 1QDOA 4YG2F 1AR83 1JUHA 1HDDC 1IV8A 2DMUA 3MEXA 1IRGA 3QOEA 4MXVA 4LKFA 3ZDSA 1AR92 2KM2A 3URFA 2VOPA 1CQ9A 3JRFA 1E5RA 4P1WA 2J1EA 2R93J 4FOQA 4LK6A 1C3HA 3N7MA 4HV5A 3VDDA 4FE4A 3CUQA 1ZG3A 3MF9A 1V6KA 1R22A 4HXCA 4YYOA 1PP8F 1ZBA2 2OXBA 5B5EC 4CP1A 3A21A 5CG8A 2DJIA 3OYAA 4R9CA 2OT7A 1IRXA 1BKZA 5FO8B 2Q1MA 4UNOA 4RBOA 9ANTA 2RVCA 1W04A 1KXGA 1QOOA 1UYZA 4AEDB 5IWFA 3OUJA 1DBNA 1T6GC 3M70A 4ZYEA 3WQ7A 1I9RA 5D6FA 2DA7A 3F9KA 2QQIA 2R5ZA 1HKSA 4B47A 3IT8A 1XB4A 3G71I 4PI2A 1YE9A 1KQ8A 3FHNA 2DUPA 2WA3A 1VNDA 5FP7A 5BNQA 3LKJA 5C3SA 4JBAA 3WNNA 1S3JA 1PHMA 2WFPA 2WN3A 1ND3B 2G19A 3FK6A 2ENRA 3FWEA 4DFSA 4KWUA 1JTZX 3GTOJ 3AX4A 4S05A 2EQRA 4P9FA 1MS8A 2VI6A 3WNLA 1GHCA 2V1NA 1H9TA 1LJ7A 2XGEA 2R071 5BNNB 3SFZA 1UAAA 3BOPA 2FA5A 1W9SA 4WM8A 5CA6A 4V2FA 1DP7P 5LLQA 1DDNA 5BNPA 2NZ9A 1W7PA 3WNOA 2BP6A 4RAYA 1U5XA 3OYDA 1HXDA 1XE0A 1VQPI 1UZZA 4A7ZA 1RUG2 2Z79A 5GP9A 3HSRA 4QT6A 1TT5B 2R32A 4NC8A 4A6OA 2NVUB 3A0NA 3VPRA 1EH7A 1IS4A 4OUMA 2FDJA 4NWWA 4Y52J 1TNSA 1XSDA 1ACIA 2F48A 1W8ZA 3OYLA 2D98A 2JICA 1WCUA 5K4LA 3IAQA 1RVF3 1UF2C 2TUNA 1ORKA 3AMQA 2HVQA 3P9IA 2Y0MA 3VBSA 4RQPA 3MICA 3MWMA 4UUSB 3QAHA 1UG2A 4CDQC 2RNGA 4Q8KA 2O61A 1CZVA 1QJX3 2JVGA 5DZFA 4Z2WA 1K79A 4D7YA 1FNYA 2WT0A 2ZHNA 1CJDA 3OTFA 1SFXA 3I4MJ 2VXZA 1K42A 3G1OA 4K8RB 2DA1A 1MVEA 1VR3A 3CJIB 1G3SA 2W24A 1A31A 3ACFA 2VTXA 3OL3A 3FLTA 2L7FP 3CCMI 3KPHA 1VQ4I 3GXUA 3ZKYA 5FZDA 5CEHA 1YQ5A 4YFWA 4PJLA 4UV8A 4HL0A 2ZGSA 5ED4A 1IKPA 2QFEA 5ICFA 4XIDA 1HW1A 2VTXJ 1MW7A 2QM3A 1J3QA 1HOMA 3ZDVA 4XFHA 3ELKA 5M5WJ 1POV1 3N36A 2GAUA 2WAEA 2X5IC 2FJ1A 2PHTA 3U1XA 2IFWA 3SISA 1GXPA 2VBYA 1Z7UA 1L7LA 3KCXA 3ERMA 3OBRA 4A3GJ 4G7ZF 2DCTA 2RM23 1OVSA 1CR7A 1MR5A 3TEXA 4B1MA 2KXLA 1OA4A 3AL0C 4BJTA 3PL0A 2DTYA 4QTRA 4AEDA 4XLNF 4IV3B 4E70A 3S32A 3KWVA 2JX9A 1NY72 3AJYA 1V6OA 2VPLA 2MFZA 2DCKA 2BFUS 1JYXA 4OU0A 4PF1A 3SXYA 1ZBE1 4BJ0A 5FY4A 2VVFA 1RJ7A 4LK0F 1UOJA 3HT2A 5C8CB 1CAVB 3HHGA 2RDRA 5H6RA 5BQTA 3K1PA 1KGYA 4Y22B 2D6MA 1ND3A 1W90A 5HS8A 5JFRA 4D69A 5F08A 4HSLA 3AZZA 4XN3A 3FE5A 2JKXA 4FOVA 2VW0A 1C8NA 2R7ZJ 1ON2A 3UKNA 4MOAA 1BEV1 1VQNI 4XF1A 1ZZ8A 3FLPA 1CF7A 3TEWA 1WJ5A 2KRCA 2OW4A 1W8UA 2ZKLA 5C3RA 1SFNA 2Z5UA 1US3A 3VBRC 4QB2A 1LRHA 4GWNA 3IMMA 2BGCA 1PMIA 1FTTA 3ONQA 4J1XA 1R082 4A3BJ 2Y64A 1GP5A 1YFUA 3VDDC 5K8SA 2XL7A 4V2GA 1IV6A 2A6TA 2V1XA 3LSHA 4FPJA 1MKMA 3PJQA 1ZLJA 3EUHA 1T08B 3ZOIA 3WOGA 3JTGA 2UWMA 3T2TA 3AMNA 4BLIA 1HA8A 2HWC2 3THPA 1FWZA 1MS0A 5F6FA 1FMVA 5FXXA 4CU9A 4IQPA 2HR3A 2LALA 5FJ8J 2VUAA 3AKPA 3SNMA 4PJYA 3ACLA 2VE9A 3AG2H 3K9TA 1FIAA 5A1AA 5J4YA 4CYDA 5BNGA 3FHQA 3MV11 4UUSA 1Q43A 2AS5F 5J1XA 3CF5F 2ZACA 3A4CA 3H42B 1H30A 1X1DA 4GH4A 2MD5A 3DQVC 5JLVA 1FPN1 3ZQFA 5D21A 4Q4W1 2VJJA 1UZCA 2WS91 4Z2AA 4BS9A 2LBFB 2WDBA 1WZ2A 1R1A2 4X8NA 1FIPA 2XL9A 3VOEA 4W6WA 5GZDA 3CJIA 5DS9A 1LOFA 4URAA 3TO6A 4HRIA 3RQ0A 4ONUA 1GU3A 2RS52 4AOCA 3S1RJ 4OIOF 1F9KA 3EQLF 4GWJA 4DINB 4HX7A 5BNPC 1XS9A 4QPIB 5ICCA 3K4MA 4DBRA 2X29A 4BUPA 4LPLA 1ULOA 1JXNA 3FXQA 2E7WA 2OUHA 4GYIA 3S7EA 4BK5A 2CL2A 2AQEA 4CCKA 3R60A 3OMYA 4FISA 3MZHA 3JBG1 3JD73 4LIVA 4UW4A 5DYMA 1MS1A 1D0ZA 1U0AA 1W99A 1LB2A 3G2BA 1WVRA 3QPLA 2ZEZA 5EYXA 5EZWA 5A1LA 3ZLIA 5JXIA 4A3LJ 4XR6A 3F72A 5GAEJ 3OGRA 4I0WB 5FY9A 4QQHA 5BXXA 1LEDA 4N4NB 5FZ4A 1WHUA 5GTHC 4IV3A 3RJRA 1PO22 4LG0B 4XCAA 1RUH1 2V4AA 5F2WA 4MGSA 3SEEA 2VZRA 2VQTA 4YVWB 1IJWC 1H9GA 2XJQA 3I3EA 4MYEA 1IS5A 5JOYA 4A6SA 1RHI2 3TEDA 4FPKA 3FJSA 4TXWA 5FZAA 2JPCA 3FHZA 5C8CA 4RAZA 3SQOA 4BA6A 1AXZA 4V2VA 4IHTA 4CU6A 2G9FA 3OS2A 4G12A 4Y22A 3PUHA 3B5LB 1R58A 1ZRFA 1YS6A 5KWRA 4Q5SF 1XE7A 4EN8B 2V5DA 2HEYF 5I0UA 3LOBA 4HKWA 2IXSA 2VZTA 3DCQA 1MZFA 1D4VB 1RUI1 4XEZA 3KHCA 4A3EJ 4D6RA 1F1ZA 1BR1A 1X8EA 3WNPA 1EKEA 4DPNA 3CZUA 3FM3A 2R0QC 5GAHJ 1VQMI 3QQAA 3KCCA 4CCLA 3S5QA 1A34A 2Y6LA 4M4PA 2YC4A 4P5HA 5IVEA 3UGGA 5IYDJ 4PHZA 3CUOA 1DG6A 4N4OB 3QRFF 2VT2A 1D2SA 5E3OA 1RUF3 4Y13A 3LDKA 2X51A 2VBWA 1COV1 2OV7A 4IRIA 4Q4Y2 1Q1HA 1XJAA 4D6QA 2PLV2 3D4KA 5L3GA 3KX2A 3BC8A 4AEDC 2B9UA 2JMWA 2VQLA 3BCWA 1Z7S3 3VD3A 2UY8A 2A7AA 2L7ZA 1WH5A 4LLOA 1DDLA 5JHFA 4CEYA 3K4KA 4BHBA 1FSHA 1YQCA 3BP8A 2MC3A 5DAPA 4Y5SA 5IVCA 1W0OA 1R1TA 5A3NA 4QKNA 3RI9A 1B09A 5CAZA 3KZIC 1OISA 4HKLA 2A3WA 3TQNA 1EA3A 1ND3C 3FK7A 4V1PA 2HWVA 4AVSA 3J8F2 5FD5A 5M3FJ 3WDWA 4U87A 5LWBA 1RUJ1 1AR91 2CUJA 4AVAA 4UBGA 1DGWA 2JIJA 4AK3A 3HOBA 4XXAA 3NV4A 1AXKA 4NJ4A 2VBBA 1FX7A 4MGYE 5H20A 1AYM1 3Q0UA 4ZKTB 2VCAA 1R4MB 4N9HA 2Y38A 4RGRA 1HIXA 5BNNC 3ZFEB 2V7FA 1RXGA 2JD9A 2F2EA 1UYXA 3T4HB 5FO7B 3CCQI 3K4ZA 1KYZA 1ZBA1 2IA0A 3PIGA 4HVQA 3NNJA 2GA1A 4BISA 4YW7A 1JHFA 4FAHA 3S3MA 4RA0A 4NN0A 1UU6A 2MYSA 2L9LA 1YIPA 3OY9A 5JLWA 1S6LA 2VQ0A 4KN7X 1LE8A 3HDDA 1BI2A 4HDVA 5A7WB 3BN6A 1YOVB 4AM3A 2D43A 2O8XA 3Q8EA 4RAGA 2LW8A 2QQVA 4Y15A 1MNMC 1ULDA 3H0GJ 1Y43B 2AZ5A 3G4SI 4AVZA 4F91B 2ZXHA 1Z21A 4IGOA 4M9XA 3LQRA 1ACCA 2RMU3 3VHPA 3I58A 4EM0B 2CU5A 3RDIA 2VPVA 1FY7A 3ZQGA 3CCSI 4EGZA 5E6HA 5DN2A 2LSOA 4YVWA 3MZ8A 3C2HA 1PX3A 4G94A 1I3AA 3LA3A 2FD5A 1A6CA 4DXRA 4YZ1A 2OTLI 2DMTA 4BBRJ 4F7ZA 2P4EA 2LYCA 1REEA 1JYCA 4UF0B 1N75A 3F8MA 4CCCA 4LB6B 2NS0A 4IQJA 1BJQA 3K0LA 3I59B 2EFPA 2EA7A 3CJIC 4O9EA 3R6SA 1K5MB 1LOFC 2LS6A 2B45X 4XOPA 3C2GA 2D3RA 4AGRA 2CU7A 2HLEA 3EUKL 3X2QH 2WO2A 4XF3A 5CZKA 5JOZA 3MAJA 1AL23 1OA3A 2VKHA 1YQ8A 1IPKA 1W6NB 1XGSA 2HWB1 3ZFGB 1RUG1 3HPGA 3ZIXA 4QM9A 1WGXA 4DZGA 5F3CA 2Y6HA 1MNEA 2PLYA 2YGLA 4XRMA 2M2EA 3HIFA 3BALA 1OQYA 2H8WA 5KHGA 2YUEA 2JG9B 3CC2I 2VQCA 3K48A 3AL5A 4Y20B 1R6RA 4A3ZA 1SVOA 3QYBA 1G3WA 3TNQA 5DPNA 2ZFUA 1V6NA 2KKOA 5T55A 2MG4A 2AXLA 2KT0A 3EYYA 1K4TA 5JLXA 2VUDA 2P7VB 3KF5A 3KP7A 2DN0A 3S30A 2WQZC 3ZPYA 2WZR2 2W4SA 2WAQN 2ZXQA 5KVRA 2OYZA 1T6BX 3UGFA 4ARYA 2ZTNA 1B35B 4I3PA 1G9BA 3KS7A 3KZ4C 4IV3C 1KONA 4H3WA 4L5JA 4Z92B 3P9KA 1ZG1A 4D5CA 4PCRA 1GKBA 2E60A 1V00A 1QJZA 1P8JA 3MIFA 2ZAAA 4FBFA 1EY2A 5M5YJ 2QVOA 3KGZA 2VL4A 2ME6A 5JMCA 1X19A 3SC7X 5C8CC 3HNBM 1GQGA 5CKMA 4Q29A 4L92A 2QDRA 4O3MA 3S93A 5DAVA 5A3WA 5CYVA 2PYTA 3K4NA 4NHXA 4Q4V3 4XQDA 1XOYA 5E3LA 2OQ6A 2CRGA 1O5LA 4QX5A 4CICA 1KJRA 5J4VA 2ZGKA 2J1SA 1UU4A 4C2MJ 1HLCA 4W8JA 2ET7A 3ZFEA 4MZUA 4JKMA 5HI0A 3GCXA 2CUFA 4B48A 1BQPA 1D1BA 3WT3A 3WZ1A 1J5YA 5HNFA 5JXGA 3QH7A 1M06G 1FPQA 4PSWA 3FMQA 1B8IB 3R61A 1OXCA 1OC1A 2XAHA 3L00A 1LGCA 2FU4A 2O8KA 3MPPG 1EUTA 3B73A 3MO4A 3MFKA 2W9XA 3VN4A 1LKNA 1MSEC 4R9AA 4A93J 2NNNA 1VMJA 1NK3P 4GKYA 2NVTJ 3I2GA 4XRSA 2P8TA 2M7BA 4OAZA 1VQKI 4D9JA 1WPKA 1W05A 3OD0A 3A01A 4Q0SA 2DFFA 1KGSA 2ECBA 4M72A 2ZGUA 4S2GA 1QNTA 2L02A 1HKTA 5FWEA 1U5YA 4AHYA 3ZN0A 4XIKA 4B43A 3V8LA 1AR63 1S0IA 4GMP1 3NJYA 2Q8EA 2ARCA 1C5IA 2EH3A 1C8M1 4EZHA 1D4M2 2RS12 1DPRA 3GDBA 4UHTA 5TSWA 2CGPA 3CZJA 5FMOL 4EE2A 3VB2A 1O7LA 3FHIB 4NRMA 1RINA 3X29B 2CSGA 2BVLA 2VOXA 4Q27A 1WGPA 2VE1A 2YB7A 4DXZA 2K27A 1C1LA 5I0TA 4NC7A 1R081 3KV6A 3ZIWA 2CSOA 3ZFGA 3WUCA 4QPIC 2P3KA 3I2HA 2A07F 3BPXA 2ELHA 5FLXK 3CLPA 1SANA 1LOGA 2UV1A 4AUXA 3GGLA 1GOGA 3K3NA 4ZZLA 4YFKF 4FPGA 1HRV2 4ARXA 2ADUA 1QQP3 3WXPA 2IEKA 3FXMA 4Y20A 1WCDJ 5J3LA 3FBNB 5FFZA 3JCUC 3KD4A 1VBD1 4HA8A 4P9XA 1BA5A 1UZYA 4NUBA 1W3VA 4OHXA 4HSJA 4ZS3A 1S55A 1ODMA 5FKLA 5M3MJ 3J4UH 6PAXA 4LE4A 2VG9A 2WBKA 3MW2A 1JZ5A 4JP0A 1B35A 1SAXA 2X09A 1QGPA 2D97A 2DFHA 3HBKA 5J1UA 1JJ6C 3O1MA 1G8WA 3RS6A 1WRJA 5CFCB 2EIEA 2A3YA 3VDBA 1F36A 3M8LA 3GXOA 1POV3 5FP3A 1EF4A 1VJ2A 4YVWC 1DQ0A 2D6KA 4EN9B 2GNMA 1JBCA 4YZ4A 2A71A 2LTPA 3NO8A 4M3CB 1VBC3 4FFFA 1H9PA 3LEIA 5I8SA 1UB9A 4YG3A 1IZ1A 5FOBB 4N9IA 2Y9YA 5FZ1A 3F22A 5ILUA 1XMKA 3UNGC 4AVTA 1BC7C 2DVBA 3IUOA 3WU2C 1HKQA 1XN7A 3ABZA 4PDWB 3OYCA 2RS51 4LD5A 1OUXA 3GHNA 2WNVA 1AX1A 2HDCA 2BPA2 3JREA 1IXSB 1AF9A 2PHXA 4PJJA 3W2AA 4DMIA 2IC1A 4IEUA 2ZZQA 4JX4A 3AZWA 1RUNA 4OOIA 3SEPA 1UXXX 5JI6A 2R7WA 3F23A 2M30A 2CG4A 4QWQA 1TZOA 2RAEA 3M9AA 1MMNA 4XLEA 4RSUA 5L7OB 1D1CA 5L9RA 2EF6A 1V0AA 1V6MA 2JDMA 3LCPA 4PBPA 4CEWB 4IE7A 1B8IA 3O0XA 3E7LA 1QNYA 1K12A 2I10A 4B1RA 3TN93 1PIV3 4CPBA 1NE6A 4A3XA 3ZN4A 4L9TA 4UFHA 5JOWA 1PO21 2XAQA 5GZCA 5FFXA 3UNPA 1NUKA 5ISLA 1UKGA 4D7TA 4R4XA 3AG3H 1TWCJ 2RR12 4WZFA 1QJY3 2OU2A 4Q0PA 1BK1A 5FQ0B 3P7NA 2HYKA 3K1NA 4LBQD 4HK9A 2R6QA 2VASA 1JXSA 4DO0A 1ODDA 4BMBA 5HCHA 3SCGA 4IE0A 1QZEA 4I6ZA 2ZABA 3AKTA 4AGGA 3H3VK 3QACA 1EAH2 4KBZA 1Q1VA 1K6OA 4M4RA 3AMMA 2VAUA 1BR4A 3S16J 4DNYA 4WX9A 1YRZA 2ATFA 2PAKA 2G0EA 4UI9L 1YW8A 2FOKA 3OYKA 2NYXA 1TZLA 5JPMB 3SDGA 1VBA2 2A75A 4SLIA 2TCTA 2H1KA 2HVSA 1L7QA 4LKSA 3IDEA 3GWZA 1LODA 3WHTA 2QQNA 2R49A 1US2A 1OLTA 1CWPA 1PUEE 1KFUL 3ZFEC 3QP5A 4S2HA 5FZLA 3HSEA 1H8TB 1RMU3 1FAYA 3KP3A 1DQ1A 4YRDA 2L4AA 2KZGA 1YYVA 3I3MA 2D6OX 3CMAI 1XD7A 1FSEA 2D5HA 1E5IA 1JZ4A 3H8RA 4BCUA 1D0HA 4CRQA 3JRDA 2WS93 3MKZA 2DYSH 4I7HA 1IRZA 2BW3B 2MABA 3I71A 1S0DA 5FRAA 1TEIA 4Q1RA 2D6LX 3S57A 5DQ0A 3ZSKA 3UJOA 2CW8A 2CYYA 3I4NJ 1IPSA 5LRRA 3F0CA 2JECA 4JV4A 4Z1VA 2DCEA 4OCTA 3B6CA 1W39A 2NVQJ 2X05A 2GM4A 3WGHA 1ENSA 5HDNA 3PO2J 1VBB3 4AWDA 1O3QA 1PDNC 2Y48A 3ABLH 3AC0A 3MW3A 4W1UA 4PJMA 1PGW2 5DZGA 1BCXA 3LSJA 4D5FA 4Q4X3 3LFKA 3JRCA 4KIFA 4DEQA 3WP3A 3HOYJ 3IB3A 2JD4A 5C4XJ 4HNTA 1GWMA 3LDRA 4ISRA 1QH7A 3I2JA 2GIZA 5GLWA 4WXDA 1G3YA 3I2DA 3NVCA 1FT9A 5C3PA 2IT0A 1SFYA 3L2UA 1IZ3A 2YPRA 2OQ7A 2M0CA 5DAXA 3GTQJ 2CH0A 4FFGA 2UWAA 1CVNA 4YW1A 4YRVA 3NL1A 4FX0A 3TBDA 2ID4A 3LWFA 4X6RB 2R7FA 1K5MC 3KT1A 4IO9F 1HCRA 2DTRA 1V4RA 3CHXA 4BEHB 3PJYA 3RFRA 2EXJA 1NZCA 2GXGA 2XJRA 3ZFGC 4P5OA 1TNRA 1LDKB 2R7RA 3ULQB 2DWRA 4AR2A 2DU1A 2VOWA 1X8MA 5I8TA 3GTLJ 1FOXA 1UPSA 5L7OA 4QX7A 2JG9C 5F6LB 5FLXZ 2ID3A 3KEYA 1PUFB 4HN1A 4CUGA 4YIIA 2Y2ZA 1RUD1 2O0OA 5J3UA 2ZS6B 5DCMB 2PHFA 1BR2A 2ZHKA 3D6EA 2VODA 2B63J 3Q9OA 4PLMA 4IESA 2HWD1 1FOD2 2RG4A 3LWCA 1HC8A 2Q2EB 2HTJA 2VZQA 1H9WA 1BBT1 2ADEA 3FBIB 1B35C 1RUI3 4C9YA 3KYDB 4JX0A 2K86A 1LGBA 3OYBA 1RIOH 4BQXA 2W3JA 3FIWA 1QOTA 5M0TA 2BXYA 2PHLA 1IW7F 3FBMA 2FE3A 3WU0A 5FQ0A 1UU5A 3MCZA 4QB6A 3OL4A 4NHYA 3EYPA 3KFWX 2V6CA 4KUMA 2RC4A 5CB7A 3CCRI 3AMPA 3P5BA 4AQSA 4AVCA 1I27A 4EQVA 1NK2P 4DQ2A 4R79A 1H6YA 1ZZBA 2XWBB 3NNLA 5JZGB 4J25A 1YIJI 1COV3 1C4RA 3L09A 1IQAA 2R7EB 2XGXA 2KIMA 3WCRA 1RVF2 1YQAA 3RCOA 1EV11 3OGVA 1CZTA 2IUWA 2EV5A 4Z82A 1T0FA 3MPBA 5DV5A 1RUE2 4IEVA 3TOJA 2K4BA 2MLKA 1UMHA 3TB0A 1XNTA 5I8YA 3D3AA 3LIHA 2W7NA 5GZEA 1JT6A 1DQ6A 4TTGA 3MLKA 4L0ZB 2J1TA 2YU1A 4S2FA 3NAPA 1J0RA 4EN6B 2WZR1 1EUUA 1TME1 1VRBA 4TYSA 5KHHA 4JZRA 4XILA 3OY8B 4L9VA 5CIRA 2CV0A 1H6XA 4QX1A 5FRMA 1CN1A 3T08A 5FZ0A 2YPDA 1TW2A 4UW5A 2EIGA 5CQEA 2GP5A 3DL3A 3U1DA 1DF0A 3H0DA 1ZBA3 3RYRA 3POFA 4MGZE 1OJLA 5F27A 4KISA 4YG6A 2K5CA 3AM2A 4GMP0 1YG2A 5HBAA 1ERDA 1NLQA 1I6XA 1V55H 2HZTA 2QQWA 1LEBA 2VQAA 4IEZA 1N3OA 4JGZB 1XC5A 1DGRA 4G6DA 1LHUA 4M0NA 4CA9A 3HKZN 1B72B 1V5GA 3SMHA 2IVIB 1Q5OA 3BT9A 2Q30A 2COMA 3DYPA 4RLFA 4FP3A 4HFSA 1MQTB 4IL7A 4IEQA 1S2BA 3R4UA 2PELA 1WMFA 3SEZA 4LO5B 1IGOA 4XMYA 3ZXAC 5LHIA 3ALQA 4JTOA 2DT7B 2QDNA 4G9YA 2QF7A 3SZTA 3Q5FA 3VBFB 2XKOA 3ZO0B 2QSFX 4QD2A 3H8UA 1O59A 1CAXB 2IXKA 4ZONA 3WQ1A 1Y4WA 3GJAA 1PGL2 2QBYB 3BODA 4FOWA 2NYYA 2R7XA 1V6IA 4QU1A 1U8BA 4GXLA 4AEKA 3HQUA 4OI4A 2I45A 1OCZH 2GC3A 1PUFA 3OSDA 2H0VA 4C3JJ 2A6HF 2CQXA 2D40A 3QBQA 3VHNA 1SEFA 2NAZA 3PVOA 5DCMA 3T8TA 2YGMA 5C44J 4M3DA 4QX8A 3CTAA 2DTZA 1J83A 2XLFA 4PI0A 1NAEA 1ASJ2 2F5VA 4K3UA 2XVCA 2Q2EA 3GZAA 2V5YA 1P2FA 1MJAA 1RUG3 2O9LA 3O8HA 3V7RA 1HSTA 4QPQA 2FRHA 1HB1A 5CFCC 5DTDA 3H7YA 5FZCA 3ZMSA 2JDNA 2RS11 4XLHA 2QUFA 3WR0A 4RMNA 1SEUA 5FMOS 4OULA 3T8RA 1CAUA 1OPOA 4L2NA 4P9JA 4MO3M 2QKMB 3L2CA 4G4FA 1GNZA 3FM5A 5F0HA 2VCMA 1OCTC 5JZGA 2RREA 1YUDA 2PHDA 1BIAA 3BR3A 2XG3A 3ABKH 2LD5A 3I3DA 2W84A 4P9GA 5FZHA 5EP9A 2BGPA 4PDWC 2E32A 4XFBA 3B6AA 3ZXEA 1YJLA 1JKPC 4G6QA 4EGYA 1RC6A 4OI0A 1TTYA 3BJAA 3ZQLA 1BXHA 4IXLA 2BV6A 2Z99A 2B5HA 3U14A 3BB6A 4ZHNA 3RSJA 5AFEA 1AJKA 4N7UA 2PJRA 1HRV1 2CFOA 3BVCA 3LSRA 2JXAA 5APAA 4HBNA 4FFHA 1RZ4A 4E7JA 3CD6I 3FF5A 3BIWE 4U7BA 3FXOA 1CZSA 1ITYA 2JPBA 3DBRB 3BZ6A 5LA9A 1W8OA 5L7OC 3LSKA 2VZPA 4FXKB 2W95A 2H09A 2VH9A 5E8GA 1TVGA 1CONA 4CEWC 3MQ0A 3OBTA 2DPDA 4JKLA 3VBHA 3NV3A 3J81Z 4AIDA 2IXHA 2DA2A 3ETPA 4IE5A 2VIXA 2FDHA 4P02B 4BXSV 4YM0A 3DN7A 2E2HJ 1JYWA 2DURA 1ZGJA 4JCKA 1XGNA 1N3QA 1DLCA 1IDZA 3ENRA 5L3FA 4NPLA 1JOJA 4CHUA 4HW0A 2P3IA 1NCQB 3ZQQA 2R042 3DXTA 1MS4A 4JGZA 3SQNA 5GAGJ 1UXZA 2WSVA 5IVJA 1RI7A 3WINE 1Z91A 2XC7A 4ZXEA 2GLOA 1S0FA 5KCMA 3UKGA 4GXOA 2D5FA 2DBNA 1SFEA 2WADA 1MQTA 3MN2A 5IJRA 4YGBA 5FBZA 4EATA 2FDKA 2ISYA 2L7KA 4LLNA 3LEMA 4GWIA 4PQQA 4XK4A 3C7JA 5FUIA 2JB8A 4JQFA 2E31A 4EJRA 3VODA 4CP9B 1JKQC 3O1TA 3N9LA 1WKMA 4HPKB 3VBFA 1GV2A 3KQ4B 4BE2A 1IAWA 4QHZA 1CAXA 4LHNA 1AR73 3SITA 5KAFC 1H8TC 3ITQA 2QBYA 2E5ZA 2ECCA 2ELJA 4QDQA 4COZA 5FP4A 4UYBA 4ZZ8A 4L0PA 2HOSA 1FLIA 1Z1DA 2GIVA 3BG9A 3IP4B 4M3EA 1HF0A 1NA1A 2DUOA 3CJQB 3A0HC 4YFZA 1RNLA 1FX5A 5D5UB 1TMF1 5JIAA 5FPZA 3DP7A 3VYRB 4RGSA 3LB9A 2KJCA 4CXYA 3MI8A 4S04A 3FFZA 2CHHA 4BLJA 2RDPA 5B1BH 4YGCA 2AQFA 2E26A 4LUKA 1D0GA 2F4OB 5C71A 2ZEYA 5A7OA 5FJKA 2L5QA 3FXUA 3I3QA 2ESHA 3WDXA 2HWC3 4QLCU 5IAVA 4XLFA 4A7YA 1QWRA 2Q8KA 1I1EA 3LNQA 2RN7A 4LBMA 4NHLA 1Z77A 3IIIA 1PO12 3OPWA 3RYKA 1VBA1 2WAAA 1F8VA 2C6YA 1QDCA 5A3TA 1I1GA 2WNUB 3V8JA 3O1SA 1ETYA 4C1WA 4AF9A 4OLLA 2DV9A 5FXZA 4K9SA 3QPTA 3C2UA 3BG5A 1GNYA 1SACA 1FXZA 1VRH2 1VP6A 1LPQA 1HV1A 3J7ZI 1IG7A 2D6NA 3WEZA 2ESNA 4MGQA 1APNA 3TL4X 1SLCA 2EIKH 4E8DA 2QBXA 4WK8F 2A6EF 1R1A3 3S7IA 4M6YA 1JI6A 4FQ4A 3WTZA 2F5DA 1UX7A 2KR2A 1YW9A 3O2PE 2BRTA 1MJ9A 2W25A 1UCXA 4RGKA 3POJA 1PX4A 3ME2A 2VZ3A 3T2OA 2OS2A 2XB6C 4AEJA 2J5OA 1TL8A 2KPMA 4HSTA 2CDOA 2XGDA 1NXD1 3QWLA 5AC93 3M3OA 3GBFA 1X36A 1K83J 3U78A 4N53B 3KYCB 5JUVA 4ZU7A 1K5JA 3Q3SA 4C30A 3FMSA 1ZR2A 1NCQA 2W92A 1UCRA 4XLAA 5J48A 4XSZF 2RKHA 2LM3A 4HBLA 4YIFA 1AOYA 4I0BA 1G9CA 1Y39A 1SPPB 3DPRA 3WW2A 1AYN2 3ZYGA 5F3IA 4ZC3A 5A3LA 2FOWA 5JZGC 2GWRA 1GZWB 3U37A 3L2VA 2NS8A 4XTPA 1J09A 2KJBA 3WY6A 1YJWI 2GNBA 4UFMA 3PMSA 2R7OA 1ZLKA 3H8OA 3HTUA 4H55A 4A5NA 3E5QA 4D0PA 3DKYA 1UYPA 3O8GA 3S6PA 4A0YA 4QXBA 3M3IA 1PZ9A 1P4WA 1FOKA 2DBBA 1RHI3 1UY4A 4Y1VA 1W5TA 4G8XA 2D6PA 5H9RA 3HRSA 4GA9A 3TEZA 3H5NA 5EEGA 1W8TA 2HQRA 1GSLA 1J3PA 4Z2YA 5DD8A 2X0LA 3ZXSA 3S14J 4Q48A 5EEAA 2LNBA 1CIYA 4E9KA 2A05A 2ZMEB 4OHZA 2QWWA 1MEC2 4XLPF 1CAWA 3C7HA 1OPMA 4ES8A 1DQ2A 1HN1A 1HW5A 3GTMJ 2VJIA 2NLRA 1AL22 1S72I 4MX3A 5D8LB 5JVGF 2YZ4A 5EJCA 1WCQA 3KZYA 3BR2A 3GBGA 2FDGA 1JH5A 1JYIA 3KSCA 2A5WA 3SHRA 4IEWA 4MG2A 1BHGA 4NAOA 1XB9A 3FUOA 2Q8CA 5FROA 2UUZA 2VJ4A 3VEPA 3LDBA 4JGZC 4BAYA 3I2FA 4CCJA 3H50A 2DPUA 5A6QA 4Q4Y3 4J00A 4IEPA 3FHAA 4Y33A 3S3OA 2HOTA 4FTSA 2PLV3 1RVF1 3TW6A 2DA3A 2XPWA 2CUEA 4P9WA 2LY1A 2NM1A 3LGRA 1FBQA 1OT5A 2RJLA 5J1RA 4F83A 1MQTC 1KZHA 2WNUA 1ETKA 4DUVA 1WW6A 1AHDP 2XF6A 1RUE1 1QJX1 3AP9A 2WQ4A 3JQWA 2M34A 4W4ZA 5D4SA 2NMOA 3ZYBA 1HX6A 3NV2A 1GLNA 4H7LA 4AVBA 2D3SA 4YW3A 3K2ZA 3VBFC 3BPSA 3D1NI 2K9NA 1YC61 3I2IA 4AD9A 2C4XA 1G9DA 1MJBA 2QVSB 3J8F3 4RM2A 2VCBA 3Q8CA 1TNFA 4E2GA 1X1CA 1RL3A 3J7AO 1SQ4A 2BQPA 3AAFA 3HUGB 1F43A 3V65A 3FMRA 1PNGA 3K4LA 1T56A 4Q4V2 4F93B 3CF6E 1VBE2 1XSRA 4H7MA 3V56A 2P7CB 4RD7A 3FZVA 4MEYF 1WJDA 2OC6A 3DEEA 2JUGA 2L0KA 2Y33A 2YHJA 5K5OA 2BBVA 3M3QA 4CCOA 3R0RA 3H9JA 4N53A 1ULCA 2R30A 3Q8AA 3ZXDA 2DVDA 2IXJA 2PFBA 3JRIA 3EO6A 2EIMH 3I3BA 4Y1YA 1RXFA 2MLGA 2VW1A 3HTSB 2E35A 2VBPA 2JDZA 2QJVA 2YFUA 4IVNA 1WI9A 3VSKA 2OX0A 1SPPA 1YQ6A 4MH0E 3CQZJ 1FMWA 1SVLA 2PAMA 3BOQA 1WWYA 1WCSA 4PIYA 1WMEA 3OYGA 1VQ8I 5EYYA 1QJFA 2DFIA 4A5MA 1MMSA 2P5VA 3CEWA 4BQOA 3CLOA 5FUNA 5FKKA 4FP2A 1DZRA 2R062 2WBMA 1QHHD 1AR62 3RKXA 2GSYA 2B9SA 5I0DA 2WAOA 2GMMA 3VD9A 3PO3J 2VBXA 5FZ9A 1UMQA 1KA8A 3W9AA 3VBUA 4O61A 1JOPA 5B1AH 3OOPA 4OUEA 1SLIA 1ASJ1 3DFGA 4IRHA 1ON1A 1NXMA 3WGIA 5D5WB 2F17A 4UFLA 5FYHA 1X4OA 3HOTA 1GWKA 1D0YA 4DUWA 3RPQA 2L9VA 1WJAA 3N4MA 5FWJA 2ZGNA 4KI5M 3CC4I 4EROA 4CH7A 4A12A 4UV9A 5A6ZA 1S0CA 3OOUA 3J80K 2B0LA 1P9QC 4A3FJ 2FBIA 4HQEA 2JJ7A 5LD2C 2B4KA 5K7PA 2QQPA 3LMMA 4AVPA 4Y17A 3HWJA 4IV1A 4ES9A 2Y26A 2BZDA 4K8FA 3E3VA 1IKQA 5FZOA 4LORA 5FREA 1KITA 1CX1A 1B4AA 5C4WB 1QGLA 5JSRA 4LLLA 2WO3A 1E2XA 4LR4A 4ZH4F 2ZMLA 4GO1A 5FKNA 1XYNA 1ZN2A 4LG3A 1VBC2 3IPVA 1XX5A 3ECHA 4MQVA 2GH2A 4XKWA 2RDNA 2JT1A 1VQLI 5LGTA 4HK8A 4KMFA 1OA2A 4BGDA 3CDZB 3GTPJ 4Q0VA 1RB8G 2XKPA 1ZAOA 3PIOF 1SG3A 1S0GA 1Y9QA 3BU7A 2CO5A 1UELB 3M3CA 5H9SA 2C9AA 4EYUA 1W6OB 4IEOA 1F9NA 2Y69H 3E0JB 5LA0A 5KBFA 4AL9A 2A6ZA 4KITB 1JOBA 4S0HB 3ROUA 3KT4A 3LSPA 2XBO2 3JD71 4LO7A 1XDSA 4B4QA 5L3BA 2MHFA 3B9IA 2IVMA 1AHSA 2QQOA 3B94A 1NX9A 3MV01 4CDWA 3J7NA 4HONA 4BE1A 1TQPA 2R7UA 4OMCA 1JUPA 3ZSJA 2ZNYA 2PMWB 3H0OA 3J7LA 2PN6A 4NIIA 4XDPA 5E8AA 3GCMA 2Y30A 5CPRB 4LHLA 1UIKA 5IT6A 2WY8Q 4ZYDA 1ZYRF 1SHWB 1DCSA 2WAQA 2W2IA 2OA2A 1FMD3 1OLMA 5JSOA 1Y9MA 1PK6B 3N9PA 3VKNA 2WNUC 3WV6A 1LOCA 3O0VA 4B4CA 4XQWA 1QJY2 5J1YA 3ZGKA 4RB2C 3WF3A 4AFBA 5LRSA 1OQ1A 1URXA 2X6XA 2K9MA 2KL4A 1D4M3 5G04L 2J1RA 2VULA 3O6BB 1GP6A 2HXOA 2H0BA 4HMZA 1GLHA 3H5RA 2K3FA 3LSEA 2YPJA 2ORZA 2ISZA 4UAPA 4NDLA 2ZX3A 3BJ6A 1K7AA 3GTKJ 2X48A 4UY8I 5M5XJ 2AO9A 3KLSA 3ES4A 2HXIA 3F2ZA 5IHRA 5LHHA 2QGUA 4KN4X 1MD0A 1BI0A 5LB6A 2HPMA 2QQBA 4ITCA 3E6BA 3SYTA 3AVSA 3WF1A 1YJKA 2BNOA 1D8KA 4YVSA 3ZMTA 1X1PA 2HOAA 4KWLA 2VMCA 3U4SA 3B02A 2IVJA 2AYHA 4HDUA 4RGUA 2X1EA 3LD8A 1OI6A 2H1LA 2CW7A 4ESFA 3BTCA 2RGVA 2DF7A 3JW4A 1HRV3 4N53C 4UXAA 1IN6A 4LULA 1FV3A 1ETOA 1RUF1 3D0SA 1YX5A 2YDEA 3VKLA 1N1TA 1ETQA 5T5PA 1GDTA 2YY1A 4C91A 1PO11 2NMNA 5HODA 3MGUA 1Z7S1 2IZWA 3MYXA 4BY7J 2VR4A 2JKBA 2WZ8A 2EB7A 1IN7A 2VMDA 3WF2A 3ZN1A 3GNEA 4MIMA 5CKTA 3WG9A 3ZYIB 3CUQB 2VU9A 2LKXA 4WZCA 3GZEA 3VKFC 3EMRA 5GZGA 2CMPA 3T0YA 1VBB2 4GFBA 2ZOEB 1RUC2 3RTRA 4ZTJA 4LE3A 4M01A 1OCOH 4XDOA 1S4CA 4Q0UA 3HGYA 5FXVA 3ZXJA 5F6KA 1S7AA 2F5EA 2D5VA 4ENKA 5F64A 2R1BA 3AKRA 3MIDA 3L9FA 1ZZCA 2ZMEC 1VIWB 4QKBA 2O8OA 3N7KA 1W5SA 3GTJJ 2R5ZB 3ZMUA 5F5AA 1S1AA 4DGWB 2DLLA 1WMDA 3MHZA 2TBVA 3WG7H 3AYCA 3M8FA 1YITI 3VD5A 5F1JA 4WV8A 2QQUA 1USTA 3ML6A 4HEA2 3ASOH 3L1PA 2VVDA 3SKVA 3MIGA 1A8MA 4RB0A 3I2OA 2VT3A 1O57A 2GU9A 4Q5OA 2Q0AA 2RS32 4DZJA 3CJRB 5L36A 1AYN1 5FIXA 3APBA 2LRDA 5BY5A 1D3YA 3J80Z 2W1UA 1BW6A 2L9SA 4WM8B 3LA7A 2Y0SN 2NNYA 1CD3G 3JU9A 2MD0A 2RMU1 3CCLI 1GYKA 2XWJB 2ZJQF 4A3KJ 4UB6C 5F5IA 1O8PA 1ZGAA 5EWSA 1DQ5A 4ESBA 2RR13 2W0XA 3P9CA 3HL2A 2UY9A 1A04A 1FI2A 2X4HA 1DZTA 3HOXJ 4RR3B 2ZJRF 3AK0A 3WQ0A 2RV9A 5A6YA 2D7FA 1SVMA 2YX4A 2L54A 5IVYA 1EAH3 1VF9A 5C6CA 3CO7C 5HCFA 1TWGJ 4HLTA 5F8PA 2VC9A 2WSUA 4IEYA 2YV8A 2KA3A 1UW8A 1P7IA 1H89C 3ABTA 2Z3YA 1Z0XA 3F8CA 3POGA 4RHV2 3VBSB 4RQPB 2Y60A 1AL21 2DYRH 1VBA3 2BBYA 4GGGA 3G6JB 4XZPA 4GQ7A 3PNVA 3WUDA 3ESWB 4MHGA 2VUJA 5FYZA 3IH2A 2C9KA 4PT6A 1O5UA 1WW7A 4OMYA 4II2A 5JAXA 2W82A 3R4KA 4L5EA 4M9SA 4L9JA 4BQQA 2VMEA 4XHBA 4JX5A 3LPGA 2HWE2 1ZNPA 5F1RA 5GZFA 4UUTA 4ORFA 3B3QE 1O3SA 3UESA 4YFNF 2FMLA 4AHZA 2WUHA 2XH6A 5JDBA 1SCRA 3IL2A 1KRIA 4QGLA 1NKGA 5GLUA 3H7JA 5CFDA 3ECOA 5A70A 3LOCA 5T50A 3SEQA 3V7CA 2LREA 5D2AA 2DOEA 1BMV2 1RPWA 3OOXA 1C57A 2C5DA 2O14A 3CL1A 5IVBA 1ONAA 5DZEA 4XORA 4RGXA 2IWGB 2YSRA 3CO6C 3Q8BA 3HRUA 3PVBB 1K6YA 2BY2A 5ERIA 2I5UA 3AKZA 1RETA 2DO7A 3GO5A 3E5XA 1QIQA 4JDNA 2P17A 3H92A 4ON0A 2HJIA 2OZUA 4LFUA 2F5CA 1VB2A 5FO5A 2XAGA 5JVTA 2YX7A 1Y7BA 2HGCA 1F5FA 2DYCA 5HLGA 3MF6A 4XL9A 4JRLA 4Q4V1 1SC7A 4JHZA 3VZMA 3WHCA 4WXHA 1GP4A 2JK3A 3H5AA 4Y26A 2FNAA 4JRAA 4PCQA 4AHWA 3WNKA 2FMDA 2PHUA 4LOSA 4PGGA 4LK7A 3RZKA 1I6HJ 2Z42A 4OI1A 2NVXJ 5HV0A 2GQQA 2W94A 2KIQA 4XCBA 3HNYM 1UZVA 2E7XA 3WF4A 2EFQA 2B39A 1MACA 2FQ4A 4BPZA 5EQUA 4TV7A 1W0NA 3O1PA 2DMPA 2DFCA 4JTNA 1SLTA 1AKHA 2OZ6A 2ZGMA 1W2OA 4DB5A 5C5UA 1FOD3 4NOTA 4RDUA 3NWTA 1CF7B 2JDYA 3RNSA 2XJUA 4BH9A 2HYFA 3PUSA 1IS3A 1XQNA 3BTLA 1WD4A 5AONA 1ENXA 4J19A 1U9NA 5FMBA 4MTDA 3EHKA 2K9ZA 3OGGA 5FB2A 1R093 3FUQA 5C4WC 1AR61 4XF0A 2LR8A 4RR3A 1KU2A 5FO9B 2G9WA 2QQ8A 3HOSA 1VQOI 2E6VA 4UWDA 1DQUA 3H1YA 2JRMA 3FXJA 2CW0F 4ZDPA 2VGDA 3LEGA 5JR3A 3U9GA 3DU6A 3WTYC 1UHMA 4BE0A 4X8PA 4RFT0 3LFMA 1L0OC 4QAWA 4UW3A 3ECQA 2GDFA 3CP8A 4GH4B 1RUE3 3A1YA 4AE2A 2E34A 2G7UA 4OQ9A 3ZQHA 1HQCA 1FNZA 1LFUP 3POBA 3RQIA 1QQP1 3VZKA 1X4PA 3KF3A 3QPSA 1I1SA 2O5RA 2QQ9A 1OKOA 2PEXA 2VNOA 4AW7A 2BOIA 1ULYA 3DPLC 2PG4A 2QKLB 3AYEA 5E89A 3OEBA 3VBOB 4YZ5A 4CUCA 1LHNA 2FDIA 2HEVF 2E7TA 2LTNA 4LHSA 2NS7A 3ELNA 4OINF 3BTIA 5LK5A 2OCEA 4V19K 1E17A 1QJU3 1MBHA 1PK6C 2KHMA 2L9RA 1OLME 4FI9A 1P92A 3F95A 1EH8A 3OWTA 3ZR6A 4BOWA 1A6IA 4CE8A 1VBC1 5FTTC 4XVHA 3NJVA 2LP0A 5IFPA 3QPHA 1BI1A 2H8RA 1SAUA 3RI4A 4QPGB 3POIA 4PJNA 5LZ6A 1U5TB 3BR6A 2WA0A 3HBLA 1ST8A 2WYFA 1HB2A 5AIQA 2QSHX 3A23A 4DQAA 3E1SA 2IP2A 4CCEA 3UKTA 1YNAA 2PMZN 1U5IA 1Q8OA 2ICWG 3MLLA 2GOXB 4OUSA 1TWHJ 4NMIA 4Z6YA 1BOBA 1ND2B 4FE7A 1K78A 5L3EA 4E7HA 3HB9A 3VKOA 3RJ2X 1OCRH 4MEXF 4AEMA 1AR72 2DOAA 4HSRA 2EZIA 2WV1A 3TN91 3I3LA 1PIV1 3EBRA 2XOMA 3F8FA 2R7DA 1KFXL 4OIPF 3BWGA 2OUJA 3SHFA 3BY6A 2XVGA 2OVUA 4AIKA 3PTRB 1XYPA 1ASJ3 1O8SA 2ZGPA 3BZKA 1ETXA 3I49A 2WR9A 4NROA 5ANNA 1YHQI 1HXS2 4A0XA 4Y1ZA 3HOVJ 1QJY1 5T3NA 4OMDA 3VLBB 3ZR8X 5J98B 3PVNA 4QKFA 1GANA 1Z05A 3BGAA 3CUQC 1TQMA 4WCGA 2AUYA 2VJ5A 4FO9A 2R7VA 3KETA 3MZYA 1ULGA 4B29A 5IYYA 2BZTA 3KEOA 3UV9A 1XBFA 2WFF2 4QXHA 4YZ2A 1YI2I 2PMUA 2L2OA 5EF6A 2STTA 1ZRIA 3M2MA 1OQEA 4ZY9A 3HKZA 4I2OA 5FCCA 4DW6A 5EYRA 2O7OA 1ONVA 3RGBA 4Q1PA 1L3LA 1BK0A 4B7KA 1V54H 5B2GB 5DDJ2 3OR2C 5A33A 4J01A 1QZZA 2UU8A 2OJED 4XDQA 4AXOA 3L7WA 2RHPA 2EZLA 4CEYB 4CO8A 3WDUA 3ZX7A 1RMU1 1LULA 1QOSA 3ZPOA 3F6OA 1HJGA 5FLJA 1RUOA 4ITVA 5HLHA 2LKSA 1LOBA 5D1IA 5KHIA 5IK4A 2JWPA 1SFOJ 4LBQA 3HRTA 4DYRA 1YYNA 3WGGA 1YLLA 3W2WA 3OD4A 1Y3TA 3CIHA 1V9U2 5FGMA 1H0BA 2AH2A 3KQRA 3VBOA 3ZN6B 4D1QA 4WM8C 1Z67A 4AQ2A 1UZWA 2JE7A 5F5QA 4CYCA 1H1MA 2BNNA 2FUG2 1VBB1 4ZS2A 1J2XA 2HOEA 4F55A 4AI0A 3PSFA 5AC92 1RUC1 2WLPA 1OPCA 1OYYA 1N77A 1CESA 4Q4X1 4NPMA 2E2JJ 4MHRA 3WW3A 1F4AA 2FXAA 2RJ2A 5K7HA 3ZMOA 1PP7U 2VONA 5L9VA 2P1BA 4HPQA 2R043 1JS9A 4JGYB 4RR3C 1LE8B 2H27A 3CC7I 5T54A 4KMQA 4JX6A 1KS5A 1VMHA 3WG1A 1RKWA 1K61A 3OSGA 2XLGA 4QPGA 4L97A 3D5SC 3QH6A 1R5ID 1QXRA 4KG0A 4YW6A 2WLQA 1U5TA 2E53A 2J7MA 3ZMNA 3E97A 2HDDA 3E1F1 2M8GX 1YCIA 4QM8A 3RIRA 3VBSC 4RQPC 5C5TA 1VTNC 4BE3A 2P0WA 3FBYA 1W6QB 1BM9A 5T5OA 3QOPA 3M3EA 2IAIA 2DA5A 1ND2A 4AFAA 2BTVC 3N9QA 3HEFA 3N9OA 5I0SA 3LZZA 2KRFA 1BL0A 1XPWA 1TLHB 1U2WA 2AC1A 3W6KB 1C5HA 2DQLA 2UWBA 2HEWF 1SCSA 2RS31 5JXHA 4XFAA 2EICA 1REFA 3K70D 4L99A 3FFQA 1RC9A 4IEJA 5J40A 1TNTA 1MH4A 2R072 3C7OA 4BDZA 5ICGA 5HCAA 2HYJA 1ZRRA 2IW5A 1WA6X 1WLTA 4EJUA 2E7QA 3THCA 3IMNA 2OPTA 4AVVA 1I39A 1WD3A 5AFBA 3OCPA 4F8AA 3VZNA 4M6VA 1KS4A 3VHRA 5A2QK 2GXBA 2D93A 3I8TA 3WDVA 2KFDA 1T2KA 2Z69A 2OQGA 2QKDA 4XUTA 2PMHA 2P5LC 3GZNB 1JHJA 4CSWA 2XF5A 1W6MA 1DIWA 2R0FA 4XUOA 3I5UA 5C9AB 3EDPA 4QKDA 3OYEA 2HI3A 1AJOA 3PTYA 4P96A 1UOBA 2D45A 5E18F 2QQAA 2WT1A 2ILMA 3POYA 4QWNA 3ZFFB 3M4FA 1R1UA 1V5FA 2VKDA 4M3BA 2XGCA 1KEXA 3DCFA 5LBQA 1XGMA 4CP2A 4RHV1 1AA7A 1CX4A 1PO13 2LK2A 2EAKA 4KA4A 3A4UA 3OEAA 5DAQA 4C1XA 1X3WB 2HKXA 2DBIA 2FHRA 4I30A 4I02A 1OLQA 3QU6A 1LTEA 1PJRA 1VRH3 2A70A 4BQAA 5IP7J 4AI3A 2FF4A 2ZEXA 2E1MB 4B4PA 2ERFA 1E5HA 2E1OA 5ERLA 1ENQA 4QPYA 4QHBA 3AVRA 1QH6A 5KHKA 2ET1A 2MBFA 4D6SA 1X33A 1OKRA 2B7YA 1QRYA 1IXCA 5EG0B 2VNRA 4HVOA 4UW6A 4XJZA 3USSA 3U1KA 1NCRA 2JIGA 4XAAA 1NT0A 3HEIA 3ZN6A 2PA7A 4HAMA 3S3NA 2EZKA 2BW8A 4LA3A 1G9FA 4AIJA 3S1NJ 4KJZA 2XUEA 2D3PA 4ZPIA 5F3GA 1BVVA 1U5ZA 3JRGA 1ZM1A 2DFBA 5FZ8A 2E51A 3U4XA 2A3SA 2OCCH 3EUHC 4YNIA 1G4DA 4JGYA 2VMGA 4NIGA 3TKYA 5E1ZB 2JUCA 3LIGA 1QVUA 2Y75A 4NQWA 1AYN3 2EK5A 1MGTA 2ZKZA 3U11A 2B7EA 5J6XA 2ZC2A 3OSFA 1R1ZA 3A01B 1WJBA 1ZBE2 4BY1J 4O7XA 3C1DA 4EWAA 3OS1A 2QQLA 4NRPA 2V72A 1TWFJ 2BY1A 1W2AX 4K7JA 4HV6A 2ZJCA 1XG1A 5B4XA 1DYOA 1W6QA 2WN2A 4KU8A 5J7MA 4A3CJ 1ZKGA 3DLLF 4GH4C 1TQ5A 4KWJA 1QHGA 1N47A 5FYBA 3BIEA 5IYCJ 1FYUA 2CV6A 4MHUA 1HSJA 2ZMKA 3FL7A 4BU2A 4LBKA 3RG0A 2EVXA 1APLC 3G6EI 1QJEA 1BJZA 2C0ZA 1MEC3 4FCYA 1W9YA 3K4AA 1MMDA 1JJ8C 3JRAA 3T0AA 4BQ1A 1TC3C 2X9DA 3KV9A 3VBOC 4BIFA 1UIJA 5BOXA 5SV5A 1UYYA 3GLXA 3WODF 3J26N 4AAPA 3DKWA 3VV1A 1POV0 4GKXA 4RGAA 4ZYHA 4LEJA 1YFWA 3Q0VA 4W6XA 2AACA 5FPBA 2EAAA 2DFEA 2ZX1A 2ZNZA 2G9ZA 2TEPA 3LAJA 2Y8KA 4XFGA 2UXNA 5K7ZA 3JSOA 1LHWA 2VMHA 5IOZA 4MGRA 2JA6J 2VXDA 5C9AA 4RS8A 2KQRA 3I55I 3HT1A 3BUCA 3DPTA 2JEMA 3SLIA 2XROA 3VB9A 3ZFFA 4QPGC 1XSXA 4JQRA 4HN0A 5DUVA 5D4RA 1U5TC 5DG2A 4C0HA 1XSQA 2BWAA 3K6GA 3ZM8A 2LDUA 4IHVA 4E7ZA 3FC0A 4Q4W2 1A3KA 2CAUA 4XIOA 4AG4A 2Z16A 4OIQF 4L8QA 2NN8A 1OR7A 3L2YA 2OTJI 2ZBKA 4E4HA 4LQRA 5LK7B 3K4CA 1ND2C 1DGLA 5CVUA 5DEQA 2WL1A 5J47A 4XRSG 2ZA9A 5FZFA 5L9BA 3M4OJ 1JGGA 3CCEI 4HOOA 4JVAA 3JSPA 3S5AA 3TEYA 4GCVA 4PJ0C 5F3EA 1GR3A 1U6GA 4FVVA 1UHWA 4UFJA 4NHJA 1X7NA 1IO2A 1FV2A 4AC0A 1HBXG 4AYBN 4EJVA 2WNVB 4D94A 5EHDA 5EG0A 2HKOA 4XBQA 1PM4A 3N9MA 3PNTA 1VBE3 1J1LA 1IRFA 1W0PA 1OCPA 1EYBA 4MXWB 3KP4A 4FETA 2A73B 1G86A 1W8HA 1X3ZB 2FD8A 3I64A 4E4ZA 3JBG2 4FPEA 2RV8A 2LRPA 2WQ8A 1JZ8A 1W5CC 5A2QZ 1B9NA 3OYWA 1KU7A 3NKTA 1G9AA 3J7AY 2W1OA 2XAJA 4GB33 4EJWA 5ANQA 5ILVA 4META 5T52A 3F21A 3OB8A 4BZ4A 5LBCA 3ZSEA 3WTSC 2OZJA 3S2WA 4BK4A 4LGWA 4BDYA 3C3WA 1NY71 1BOAA 1RUH2 2Y34A 2W1SA 1K4SA 4LBJA 3LSTA 2EIDA 1Z6RA 2M8EA 3GF2A 1FMD2 1JKRC 3DLAA 1N1SA 4Q26A 4YLZA 4WVZA 1VAMA 2JJ6A 4ENNA 1FTZA 1MBKA 1UY3A 5EZHA 1UZ0A 4CEYC 2J42A 4XETA 4HETA 5FK7A 2DDUA 1AR71 4INDA 3MD2A 2R063 3P3NA 4LBLA 1KQRA 1SLAA 3E5UA 2P4WA 4N8MA 3OV8A 4M6XA 1FATA 4U2AA 1JZ7A 4DEVA 3H36A 1GV9A 2VNGA 3TBIA 4HX8A 5A32B 2JE9A 1H88C 4Q2FA 1XMXA 3ZPLA 1PZ7A 2DMQA 4LKEA 2P5KA 2W08A 1OYIA 4PFOA 3P3PA 1YW7A 1S0EA 1MS5A 5FZBA 1ZRDA 2IGKA 3SCFA 1HXS1 4YZ3A 3VUOA 2BOJA 3HN1A 4Z07A 3T1LA 2PBIA 3IWZA 1XC6A 1QU3A 5C3EJ 5D8AB 5KXCA 1ZREA 5LEKA 5IP6A 4XOTA 2WFF1 4PDKA 2BYVE 2O3FA 1S2EA 3OPZA 3UT0A 4LT5A 2J22A 4A6DA 2HWC1 1X3UA 1RYYA 5DM7F 3WNMA 4JGYC 3F8BA 3LA2A 5CKNA 3F3XA 3NWSA 4XSXF 2W87A 3OYJA 2W46A 2VB6A 4NWVA 2XUBA 3O1RA 1W06A 1TT0A 3EQEA 3V42A 1R36A 3T30A 4UXNA 2D44A 2EJRA 2WJSA 2BJSA 5C70A 2K9SA 3VHOA 4FAGA 3IKTA 3BROA 1GQPA 1QBJA 4L9NA 1VPHA 5K7FA 1IN4A 5FYSA 2YC2A 1BBYA 1QO0D 3OUHA 5FZGA 4M0HA 4UT5A 1R1A1 2CS3A 1RUJ2 1E5SA 1SDWA 4ZTFA 3HVDA 3ZRGA 1UL9A 2ZMNA 1H2NA 3VBRA 1EH6A 1AYM2 1VQ5I 4U7DA 2LY9A 1V9U1 2DXIA 2DODA 3RMXA 1IN8A 1N3PA 4DUXA 2ZJ2A 4IOAF 3T4VA 1FP1D 4ESJA 3V0BA 5AC91 2NP0A 1YFYA 4KICA 1NG7A 1NH3A 4MXWA 5FYMA 5LASA 3AL6A 3PM1A 5IAXA 2IJLA 3LL7A 2XBO3 5H9QA 5LFAA 2JA2A 3RWKX 4GWMA 3VD4A 4WXCA 3HG9A 3ACHA 1IG3A 1B1BA 2EBIA 2FX0A 5GPCA 4KG8A 1POGA 5JMOA 3A03A 3M8EA 4XNFA 4M00A 5C9AC 3VDCA 2A5ZA 5HDKA 1LHOA 3GFJA 3QYFA 2Q8DA 2WZPP 3BQZA 4GJYA 1LKXA 5F32A 3ZFFC 1UY1A 3JRHA 3JR9A 1X1BA 1NHAA 5CISA 3TP0A 1PGSA 1NLSA 5GADJ 3SKJE 3WTXC 3NARA 4PIXA 4BQNA 2L9NA 2GMEA 1P4XA 4E4SA 2CGOA 1IF1A 3I97A 1XNKA 2ZFWA 4I99C 1FYMA 2ARXA 4GDFA 1OFCX 4B3XA 3HOZJ 1RHI1 3ZOBA 1PZ8A 3A02A 4ATEA 2ZO4A 4F52A 1OR7C 2E1MC 1O4TA 2WAFA 3S2DJ 3FN9A 3I2KA 5BNOB 3L2RA 3S1MJ 2NRAC 4E4DX 1G59A 4U36A 4DBQA 1SMTA 2CAVA 3VSLA 5CG9A 3G1LA 2IS1A 1OF3A 4E27A 1G2HA 5A32A 4BQ3A 3GLLA 3CJTB 2HWB2 2QLZA 2AENA 2XB5A 2DTWA 2P81A 2VQHA 2C24A 3PQJA 3T09A 4G7HF 2YBSA 2BGOA 3KMHA 5FPUA 4KU7A 3FLRA 4NNJA 3BI3A 3VFZA 2XF7A 3IRRA 3LE0A 1XNCA 1ZARA 1G8XA 4B4RA 1PMJX 5D8AA 1SBEA 3H9AA 2P37A 5J36A 2FCVA 3J7MA 2X6WA 3H9QA 3M7AA 2OD5A 3NAPB 1YI9A 1RR7A 4Q4Y1 2EWNA 2PLV1 5F2SA 1XGOA 2VY0A 2P3YA 1KQ0A 3MKYB 5IPAA 2QTWB 2IFRA 3AP5A 1EJ9A 2WO1A 1BJAA 2EA4A 3DEWA 2B46X 4XACA 4FHTA 4JDMA 1T98A 1JUSA 3REOA 1RUC3 4TN7A 3ZR5A 3VDXA 3PFIA 2BEOA 2QCSB 3HNMA 5DG1A 2FBEA 3J8F1 4MGTA 2F5FA 2YYOA 3BG6A 1H4HA 1XXNA