3D0SA

Camp receptor protein from m.tuberculosis, camp-free form
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
224
structure length
224
Chain Sequence
MDEILARAGIFQGVEPSAIAALTKQLQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISDSERLARRAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REGULATORY PROTEIN
publication title Crystal structure of cAMP receptor protein from M. tuberculosis in the unliganded form
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
total genus 69
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3d0sA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3d0sA01
4RB3C 2DW4A 2KKOA 1YS6A 2W24A 4YYOA 2CO5A 2AXLA 4P55A 2HYGD 3HSFA 1QO0D 4I01A 2QUFA 2XLGA 1YLLA 3SFZA 3JSOA 1U12A 4IHSA 4NHJA 3GBFA 3V8LA 5HS9A 1YFHA 3I0TA 1YQAA 3EDPA 3EJKA 2GAUA 1RZ4A 4O6JA 2YR2A 5CYVA 3O2PE 4RGUA 4U88A 1XD7A 4IRGA 2MD5A 1RGSA 4EJWA 4LFUA 5ILSA 4EVIA 2PFBA 1XCBA 1U5TA 1JHFA 2MC3A 1D8KA 2BGCA 5I0SA 3L2HA 1Y0UA 3FX3A 1RUNA 2XLAA 3BDDA 2YX4A 1LQ1A 1FBQA 4MEYF 1F1ZA 1T6SA 1GXQA 1IUYA 3KETA 2PEXA 2VODA 3ABTA 3MCZA 5KBFA 3NRVA 2PJPA 3HT2A 2HOEA 3GO5A 3HRTA 5CU1A 3ZMDA 4UVCA 1F4KA 4QGMA 3CTAA 1FYKA 3TDUC 2D5HA 2H09A 5I0UA 1KQ0A 1IRFA 4TLFA 4HMZA 1ZARA 2EA2A 3WGHA 5IT3A 4S05A 3D0JA 2VQAA 4EM0B 5CLSA 3Q9VA 4KN7X 4MTDA 1BC8C 2OA4A 2W84A 4LG0A 2DO7A 4MGKE 4Q0UA 4E2SA 3CDHA 4B09A 2H6CA 4OIOF 1ZLKA 4TV7A 3FFQA 3VB2A 3PNAA 1YW9A 5K1YA 3FZ3A 4EJVA 4UXNA 1DPRA 3GW2A 3VODA 2GZWA 5E17F 1FP2A 3HOTA 1TW3A 4XSZF 1IXSB 1JHHA 4X6RB 5LHIA 5E1XA 5CVUA 3H92A 4Z2YA 3WTUC 1ZAOA 4O9EA 3FHZA 1CAWA 1WI9A 4HDVA 2Q30A 3V8KA 2X4HA 2EFPA 4WXDA 2IXCA 4LD5A 1IXRC 1XGMA 5CADA 1K79A 1D5VA 5T3NA 2RKHA 4KU8A 2HDCA 3SZTA 3TO7A 1YHFA 4BIFA 4B29A 2VONA 2P5LC 1ZX5A 2ET1A 3C18A 3HHHA 2HEOA 1YFWA 3KP6A 3UKTA 4HZFA 3NEUA 3COAC 2ZFWA 2A5YB 5HLGA 4PIXA 2DLLA 1YFUA 2MPFA 3GUDA 2XAGA 4Z07A 4HQEA 2BV6A 3CO6C 4HX7A 2ZXJA 4LMYA 1IPJA 5FFZA 3AAFA 2OAZA 2FEZA 1R1VA 4AIHA 2K27A 3KZZA 4M6YA 2ESHA 4P9UA 1S3JA 3CEWA 4I98B 1TNSA 3LZZA 2IVMA 4PCQA 2QQAA 3DFGA 2OQRA 2HZTA 3I5UA 3TO6A 2E1CA 3WTYC 3JAMZ 2EVXA 2ZKLA 2IA2A 1J1LA 5BQTA 4QLCU 1YFXA 4L0YB 5LRSA 4I09A 5DCMB 2BEOA 1FXZA 4A6DA 2IXIA 3CUQA 3N4MA 2EAAA 4EJTA 2ISZA 4RD7A 1QQIA 2JRTA 2W25A 1KU7A 1PUEE 1X3UA 1CF7B 2DQLA 2XLFA 2OPKA 2EV5A 2OQGA 1S7OA 3KP4A 3DXJF 3QACA 2PN6A 3WTSC 2ADUA 2Q2EA 4RGRA 3RKYA 3ML6A 2EV0A 5F6FA 5BV6A 3MYXA 3MPBA 2ZKZA 1OMIA 4A5MA 4L18B 1HXDA 5JR3A 3IRRA 2QVSB 5ICGA 1FBSA 1QNTA 4MTEA 5AONA 4JQFA 5HS7A 4RB0A 2L54A 2O8QA 1YS7A 4IEYA 2OZUA 2A6EF 4KIBA 1BIAA 1H1IA 1ZZ7A 1KGSA 2HQRA 3IL2A 2UYBA 3CLPA 1ZG5A 1USTA 3B02A 2RV8A 2PG4A 4AVCA 4R8HA 5K5OA 2VN2A 4HVOA 2WWYA 1QZYA 1XSVA 2Q1ZB 2E7XA 5H6QA 1L0OC 5D5XB 5DUIA 2YSRA 5E1RA 2PI0A 2RQPA 1PP7U 2KJCA 3T0YA 5KHGA 3WTTC 4OINF 2IRFG 5ILUA 2FNPA 4LJZF 1WA4A 2UWMA 3V7RA 1WQ2A 2L4MA 3ZN1A 2K86A 5D8KB 4B8XA 3GX4X 2GU9A 1IW7F 4LLLA 4PJYA 5JI6A 2R7DA 3RKWA 3ULQB 5JHUA 3VFZA 3LAJA 1Q43A 2GA1A 4YIFA 3H8UA 3HQXA 1OYIA 4UUVA 3M9AA 1SQ4A 2GIVA 3I64A 3KEQA 2EFQA 2PYTA 2CGPA 1FNNA 2XAFA 1OFNA 5FB2A 3NL1A 4D7TA 2C6YA 2ESNA 5KHIA 3REOA 1ZLJA 3JZVA 5FQ0A 3HTUA 3ZMZA 2ELHA 4HN1A 2OA2A 2VBYA 4KU7A 4LA2A 4MGIE 2KRFA 1KQ8A 3H7JA 3WG9A 4BAYA 5E1WA 3L9FA 2M45A 5L3CA 1YW8A 2EK5A 5E18F 4OIPF 1O7LA 2GC0A 4WWCA 5J3UA 3LA3A 2HTSA 1J9IA 1HBXG 2XASA 1XE7A 5D4RA 4LUMA 5F1RA 3ZMVA 4IEVA 3U1DA 2XKPA 3M8FA 1GQGA 1G6NA 5BUVA 3FMRA 4UBHA 1LEBA 4HX4A 2XRNA 3E6CC 1DUXC 1FLIA 1J3QA 1RIOH 1MZBA 2RNJA 5ICFA 1R1UA 2F5DA 3K1PA 4Y15A 1J58A 2NNYA 2QJVA 5K5QA 2EA7A 4MX3A 5FPZA 4D7SA 4ZU4A 4KIGA 1R58A 3ERED 2H0VA 1GXPA 4L5IA 4H0EA 2VC0A 3IDBB 5K8SA 1PDNC 4RAZA 1AOYA 3LQRA 4Q29A 4ZU5A 4EWDA 1ZZBA 4EMSA 4RAYA 4M71A 5AIPA 3P9IA 4YFNF 3HSRA 3IIAA 2DK5A 4R79A 4J1WA 3H1YA 1P2FA 4KN4X 1Q5OA 3WODF 3SHRA 3KP3A 3DF8A 4M72A 1O3RA 1W7PA 3CJXA 2O1QA 1J59A 2V1UA 3EYYA 1OYYA 3EO6A 4FX4A 3ST7A 1XDSA 2HFHA 3D82A 3T8TA 1SFEA 5FD6A 3H1WA 1QBJA 2IXHA 2EA4A 5BY5A 3F8BA 3G3ZA 2E9QA 1BI1A 1R5HA 2M8EA 3PVBB 1J5YA 2UZKA 4PZJA 4EGYA 1RI7A 2P6SA 3ECHA 3EUHA 4AVPA 1UW8A 5L3BA 2KJBA 3GFJA 4OLLA 4KFCA 5TRDA 1Z6TA 1BBYA 2KXLA 4KIFA 4Q48A 3LA2A 4IXAA 2D1VA 2G7HA 3CF6E 4HW0A 4QGNA 1Z1DA 2DFIA 5I8YA 2V09A 5E20A 4I0AA 4ZYGA 2VECA 2FA5A 2OZJA 1WKMA 3TDZC 2V9VA 1ZVFA 2TDXA 4IETA 1WLTA 4UHTA 4IERA 3NW4A 1UFMA 4QXKA 2DTRA 4DNCA 3WU1B 2GC1A 1B9MA 3SCGA 1ZRDA 2IA0A 1FT9A 4HV6A 4JK1X 3SZPA 3H3ZA 5L3GA 1S6LA 2P5KA 3JTHA 4P9GA 3HSEA 2QCSB 1T38A 4MGRA 3I59B 3RJPA 3ETQA 3W6KB 2XHKA 3ACLA 2IP2A 4HLTA 4L9JA 4R52A 2EFWA 4U0YA 3HRSA 1YIOA 2FSWA 3R0AA 2VOPA 1XB4A 4DQ2A 5BMZA 2P5VA 4WXCA 3BWGA 4IRHA 1CAVA 3WTZA 1KYZA 4XF0A 4ENMA 4A0YA 4F7ZA 3F8FA 3ECOA 4LGWA 3L2CA 1U6GA 4KA4A 5E1ZB 5HDNA 3KLNA 2DI3A 3LWCA 3OTFA 1VP6A 2HWVA 4Q0QA 2QQ9A 1YFYA 1Q1HA 2VBXA 2C0ZA 4XF1A 5BPIA 3WU0A 3CO2A 3TKYA 1G3SA 3RNSA 2EV6A 1GHCA 2STTA 1HW2A 1XGOA 3M7GA 2K4JA 1EH7A 1NXMA 1FSEA 4L5JA 3GFIA 3KP5A 1YG2A 4Q47A 4XEZA 2L4AA 3M3IA 3BB6A 1HSTA 4MGZE 4NQWA 1MDMB 1J75A 2J5OA 1XRUA 1FSHA 2NYXA 3ISPA 2UY8A 3VHRA 4XFIA 4QGLA 4AIJA 4Q0SA 1TW2A 3KLOA 2VC1A 2PMHA 4ASNA 1KA8A 1Z91A 3K69A 1K78B 2FBIA 5LGNA 2P6TA 5HDGA 4HSLA 2E1NA 4Q4ZF 2RC4A 4FBFA 3C3VA 3E6BA 3H7YA 1J3PA 1PMIA 4KUMA 3R0JA 2STWA 2MBFA 4WVZA 1B9NA 3BPXA 4XFAA 1HKSA 1ZYRF 3S2WA 3QU3A 1EH6A 3IWZA 3GZ5A 1BIBA 4WXHA 4A12A 4BNCA 1CAUA 2ZJ2A 2ACJA 1HQCA 1ZG1A 3MZYA 2OYZA 2DK8A 2RDPA 3SCHA 1VR3A 4IESA 5HLIA 1XGSA 4O3MA 2Q0AA 1O3TA 3KCCA 1FZPB 2P8TA 4OFGA 2FMLA 4CHUA 1R22A 5I8SA 4GO1A 4HVRA 5H6RA 3ZQ7A 2Z2SB 2V6CA 5LEJA 3N97A 4AXOA 1KYWA 2O8XA 5CVRA 3BJ6A 2EFOA 2Q4SA 3MWMA 3HUGA 3H50A 2G9WA 3FXUA 4RGSA 1FYLA 2M5WA 3ROUA 4ZYDA 3R6SA 4E2GA 2EJRA 4PIYA 4HLXA 1IN5A 3TQNA 2Q8KA 3F8NA 2NRAC 3UKNA 3F21A 4DINB 3F8MA 4IRIA 4I2OA 5L3EA 5J48A 2IW5A 2RVCA 1BI2A 2JPCA 1XSDA 2LDUA 3U9GA 2COMA 2CYYA 2LNBA 2QQBA 5BS6A 3KSCA 1R00A 4HVQA 2GH2A 1RC6A 2VT2A 2EB7A 3NQOA 2ZO4A 3HRMA 5LHGA 1O5UA 2QBYA 4HBNA 4ZYHA 1K6OA 1B1BA 2FRHA 4U0VA 2QNKA 4RB2C 1U5TB 2ZCWA 2D2WA 3F23A 1HKQA 2DBBA 4YNIA 3IHUA 3F72A 2Z69A 3BOQA 3JSPA 5J8CA 1FY7A 1WWXA 4WF2A 1CX4A 1HW5A 3LA7A 3G73A 2UYAA 5LHHA 3IC7A 4IEXA 2D40A 3E5QA 4G6QA 4EGZA 5FO5A 2GC2A 3JAMK 3RZZA 2YPRA 1W4MA 4KWJA 2LKPA 1T98A 4YRDA 3HHGA 4A2UA 3I4PA 1U5TC 1ONVA 3OF1A 1MJAA 3DV8A 4GCVA 2V79A 3EQEA 4XFGA 1VTNC 5C8WA 1BM9A 2XUBA 3KZYA 2OBPA 2L3DA 3MDPA 3U0ZA 2K0GA 3WW1A 1ZNPA 3WW3A 2F5CA 1S7AA 1AWCA 1SAXA 3BJOA 4MZUA 5FLXZ 1LB2A 3E6DA 4LA3A 3K0LA 2GA2A 2DAOA 1QWRA 3BU7A 3HRUA 2NS0A 2OD5A 4A0ZA 2A69F 5HVQC 3RPUA 1EPZA 4LB5A 2IT0A 1IZ1A 4LG0B 4GYIA 4RS8A 1KQ9A 4Y17A 2FNAA 4LLNA 1IRGA 2IPQX 2HTJA 3U2RA 1IN8A 3SQNA 1V70A 2WFPA 1YWKA 2ZBKA 4AQ2A 1B4AA 1BOAA 5JCTA 4HX8A 1H1MA 3GFMA 5FLXK 4NVPA 2OZ6A 3BALA 2NNNA 3FF5A 4XBFA 1IN7A 3I54A 2DU9A 5K5RA 3BPZA 1CAXA 1E17A 2VBWA 3DPLC 1LVAA 3EETA 5BPDA 4XF9A 4OU0A 1CAWB 3GEZA 1I1GA 3FHIB 5DCFA 3DP7A 2FF4A 3GVAA 1DDNA 2GWRA 4GGGA 3OGJA 2VE9A 5E8GA 3L09A 4LK0F 3FJSA 2ETEA 2Z5UA 3HIFA 3I71A 1IN4A 4WCGA 2X0LA 3I58A 4I0BA 4HQMA 4N9HA 4A0XA 1OI6A 3GYHX 3IDCB 5DD4A 4LLGF 3P9CA 1O3SA 2KIMA 2L01A 1W5TA 1T2KA 1I5ZA 4IEQA 5EEGA 3LQQA 2M1BA 3GFLA 3T8RA 4ZZDA 4JV4A 5BOXA 5HOOA 3PQKA 3SCFA 3J7AO 3S0MA 2RN7A 3J80Z 3KP7A 3SMHA 1TLHB 4WK8F 4GYGA 4Q5SF 1UPIA 2FXAA 1HW1A 4J1XA 1YUDA 4KMUX 2QZ8A 2BBYA 2XL7A 2O6GE 4HYEA 1ZRFA 1MJBA 2WV0A 3CUQB 3S7EA 3TO9A 1L3LA 5D6EA 1LRHA 1BN5A 4JTOA 3ES4A 3J80K 1NE4A 3LWFA 1JE8A 1J0RA 3BZ6A 3NVCA 5E16A 3R61A 4G7HF 3RKXA 5D8LB 1G3WA 4IHTA 3ZMTA 2PAEA 5CVIA 1G4DA 4META 3O6BB 1FC3A 2PBIA 3WTWC 4LULA 5CJ9A 2CWEA 3FZVA 1P4AA 4EQQA 3CUQC 4PDKA 3ZDSA 1R7JA 4KWKA 4ETSA 2D45A 4ZYEA 1OR7A 1R36A 4ESBA 1F5TA 5FLIA 4AIKA 2UY9A 5EZWA 1O5LA 3CJNA 2PTMA 3O14A 3HTSB 3DEUA 4XFFA 4XFHA 2ATFA 2XGXA 5LRRA 2WTEA 1ZZ8A 3LAGA 5ERIA 2A6HF 1ZRCA 4BHBA 5TJJA 4RGXA 1B6AA 4G9YA 4KWLA 2JPBA 3GZ6A 3VOEA 1FOKA 2XKOA 2UXNA 4A5NA 3QPTA 1R5GA 2M30A 1P4XA 1MD0A 1ULYA 4M9XA 1V3FA 1DGRA 4EV0A 1XCVA 4P96A 3M1EA 4LLOA 4PGHA 3RIRA 3V7SA 3DKWA 2ZNYA 1ZGJA 5L3DA 2PA7A 2PQ8A 3ELKA 3CL1A 1UIJA 2CAUA 5HI0A 1UHWA 4HF1A 3GWZA 3L7WA 3F6VA 1HSJA 2HGCA 4JTNA 3TNPB 2ET7A 4YIIA 1BI0A 1DGWA 1FPQA 2K02A 2VPVA 1XE8A 4I7HA 2F2EA 1VJ2A 3GLXA 2F5FA 2QM3A 2QWWA 4D0PA 5FQ0B 2H27A 4AVAA 1FX7A 1QY4A 2IXLA 1UIKA 6PAXA 2PAMA 1JUHA 5JFRA 1L3JA 2GXBA 4HAMA 1SFUA 2CG4A 2CW0F 4HDUA 3C1DA 3B73A 1U78A 4Z82A 1EP0A 2CV6A 3KEOA 4FHTA 3BJAA 2JZYA 4IEWA 1FP1D 2HR3A 2CAVA 2IXKA 3WE2A 2HS5A 3H9AA 3JW4A 3RYPA 2PHLA 3F3XA 3ABUA 3CO7C 4GULA 2YX7A 2BE5F 1S8NA 3FM3A 5ICEA 2W85A 1HKTA 1X82A 4EJOA 5I0TA 1IAWA 2A07F 4ENNA 4L2NA 4U7DA 4JBAA 2CQKA 1W5SA 3RDIA 1H0MA 4L9TA 3D5LA 1XMAA 2PQQA 4ENJA 4OIQF 2GQQA 4HF2A 1SMTA 4E70A 3Q9SA 3OV8A 3FE5A 4XFBA 5EFUA 3PQJA 1NYWA 2IA1A 3LFKA 5I8TA 1Z05A 2FBHA 2EFNA 2FBKA 2PFWA 4CICA 4UNOA 2K7LA 4L0ZB 4A6EA 4OMYA 1IN6A 4HV5A 2O3FA 4AVBA 1T39A 4ORFA 3QP5A 5ILVA 4Q0PA 3QU6A 4BHCA 3MQ0A 4IEZA 1W7PB 3SXYA 1TQ5A 5FFXA 5KK1A 4HF0A 4ONUA 1R23A 1PP8F 2MNGA 2MLGA 2PAKA 4IPAA 1ZZ6A 2HYFA 3RYKA 4HOBA 5KHKA 1PM7A 1I1SA 2Y75A 1WSUA 5H20A 3M8EA 3JTGA 5FCCA 2WC2A 3I53A 1BC7C 3FM5A 1RUOA 5HS8A 1ZHFA 4CXFA 1XDUA 1NE6A 3RPQA 3V4GA 4PIZA 1CGPA 2XROA 4XLPF 5FGMA 5DCMA 1SEFA 2CSOA 4M9ZA 4BYYA 4ESJA 4L9VA 2VOOA 1D8JA 5JSRA 3J81Z 1F9NA 5DEQA 3T1BA 1SD5A 4P5OA 2KIFA 2B8MA 1CF7A 5DDGA 3I7DA 3TNQA 1ZREA 1P6RA 4ENKA 2W57A 3G7DA 4HLYA 2DQRA 1E2XA 4PGGA 3P9KA 4IVNA 3KE2A 2P7CB 1LNWA 2QDRA 2ETHA 2DPUA 3J81K 2MH9A 1NHAA 2VXZA 4G6DA 4GXOA 2PLYA 5LLQA 1H9GA 3L00A 1U8RA 3NJZA 1IPKA 1LEAA 1G3TA 4M9SA 4KNYA 4ZH4F 2A68F 4XF3A 2ISYA 4L11A 2MHFA 4CO8A 1MGTA 3MZHA 3IBMA 2LF8A 1JGSA 1TBXA 2KIUA 4LEJA 5JSPA 3FXRA 3ELNA 2K4BA 1XGNA 4IJAA 2O61A 3QOPA 5LGUA 1RL3A 5I93A 2R3SA 2E7WA 2H94A 4QWQA 3BROA 3IKTA 3EYIA 3HOSA 5F64A 1JXSA 1CAVB 2QLZA 4UV8A 2JTVA 1STZA 3E3VA 3ZP5A 3QAHA 2VE8A 1ZN2A 2XAQA 1P4WA 3ES1A 1LR5A 3R4KA 4MGYE 2O0YA 4EM2A 4H7LA 2M87A 1DZTA 2HKXA 2GXGA 2BNMA 3DPTA 3FMSA 3KFWX 3QRFF 3OOPA 2F4PA 2IXJA 3P7NA 2XL9A 3WE3A 5FLHA 1J7KA 5KVRA 1QPMA 1ZRRA 1TQMA 3WW4A 2NAZA 5BPXA 4KICA 1A04A 2MLKA 3WGGA 4BXUA 1FBUA 4LK1F 4ZZLA 1W7PD 2HKOA 2A3SA 1LKNA 2QYOA 1BI3A 2Q0OA 2P4WA 5LBQA 1KU2A 5A2QZ 1RTVA 1J2XA 1WGPA 3D0SA 4KYWA 1BJAA 3CLOA 5D5UB 5DV5A 4CGZA 1UD1A 5D1IA 3C7JA 3ZMUA 3ZPLA 2FOKA 2MH2A 4UXAA 3F22A 2P7VB 4BH9A 2ZNZA 1YTYA 5BXXA 5JAXA 1Z9CA 1LDJA 4AWXB 5A2QK 1GVJA 5FPXA 3WTXC 3MEXA 4I02A 4MQVA 5AIQA 3E97A 3MAJA 3W6JB 4XRFA 5DD8A 3LSTA 4UV9A 4OIRF 4LUKA 1O4TA 4XF4A 4EROA 1GQHA 2O03A 3KMHA 4EWAA 3HYIA 1CAUB 3O3KA 4UBGA 5I91A 1YYVA 2FQPA 3S7IA 2D5FA 1ON1A 2VT3A 1U2WA 2RGVA 1D3YA 2BYVE 4HBLA 4MEXF 4WX9A 2FQ3A 1OD5A 2LSOA 2Z9OA 3FXQA 2MA3A 4IEOA 1X8MA 2JT1A 1O57A 1TNTA 4MHGA 5AVPA 4HA8A 4I3PA 1YW7A 1X7NA 4Y13A 3E5UA 4XLNF 1FI2A 2N7GA 2D93A 3FMQA 4AD9A 4L9NA 3U11A 2PMUA 1SD7A 4O5VA 1I6XA 3EQLF 3OCPA 5L3FA 4G8XA 5HDKA 3KP2A 2XAJA 1UHMA 2UXXA 3HT1A 1X8EA 4M74A 3GXOA 2XV4S 1SMYF 2BNOA 3ZN0A 4JVAA 3UKVA 3WW2A 2V1XA 1FWZA 4IEPA 2Z33A 3PFIA 1IXCA 2OU2A 2L02A 5JR7B 1Z7UA 3QPHA 4ZU7A 5D6FA 4YG2F 1USSA 4XETA 1OPCA 3FWEA 1UB9A 2DCTA 4MV2A 4UVAA 4KL1A 1DPUA 2F5EA 2QBYB 3BCWA 1P92A 4FX0A 4NB5A 1KU9A 3CUOA 1ZZ9A 5DYMA 3TOAA 2J5PA 2XIGA 2V1DA 1DZRA 5J6XA 1ZG3A 5CVVA 2IJLA 4LTAA 4E2QA 4F8AA 1UCXA 5ED4A 2ZMEA 2FU4A 2P17A 4U0WA 1FYMA 1QZZA 4BQAA 2JSCA 1WRJA 5KHJA 1REPC 1ON2A 2B0LA 3DN7A 2DT5A 2H6BA 4IEUA 1XN7A 2QVOA 3SHFA 5FDBA 1TQPA 5J7MA 1ODDA 4WBBA 4QMAA 5CVJA 1LDDA 1Y3TA 1EH8A 2XVCA 4G94A 3MFKA 3KGLA 2Y48A 3I59A 4M6XA 1XSXA 4YARA 1TQIA 4EM1A 4QM8A 2BNNA 3K1NA 5FD5A 4MNUA 3NKTA 2YU3A 4EWEA 5DUKA 4KDPA 4P9FA 1OKRA 2LF7A 1MJ9A 3ZMSA 1UCRA 4HSJA 1V4RA 1RNLA 1T0FA 3GYDA 4OMZA 4K8FA 1I27A 1YLFA 2FE3A 2XAHA 2FMYA 5LEKA 3LAPA 5I0RA 3VEPA 2B5HA 2Y0OA 3V7CA 5ICCA 1J3RA 5E8IA 4OOIA 4X6QB 3IKVA 4QM9A 5LGTA 5FLJA 1ZH5A 2HQNA 1S29A 3KGZA 4IF4A 2A61A 4YFKF 4YFXF 2Z99A 5HLHA 3LOIA 1O7FA 1SD6A 4LB6B 3TOBA 3GF2A 3M70A 3WTVC 4YSFA 1CAXB 3DL3A 3TGNA 5C6CA 2R7FA 3BY6A 1SFXA 1Y9QA 2K9ZA 4R1HA 2EWNA 1IF1A 1ZZCA 4Q0VA 1MKMA 3NSTA 1OYWA 1SD4A 1LJ9A 4CDGA 1QXJA 1G3YA 1YO5C 5EEHA 2CFXA 3QP6A 1B59A 3RTRA 4FAHA 1R1TA 3RI4A 1MDMA 4S04A 3EBRA 4HN0A 3DQVC 3K9TA 1EY2A 4KT5C 2HJIA 3U10A 3E5XA 2QENA 3V8JA 1LDKB 3F8CA 4FAGA 1DP7P 1Q3EA 3H1MA 4KMFA 3E6MA 2Y0MA 1O3QA 4ESFA 1EV7A 5JVTA 4CZZA 5D5WB 3Q5FA 1ZGAA 1K78A 3BP8A 1SFNA 4N0BA 5IT9Z 2DPDA 4UVBA 2IC1A 4FT8A 5JSOA 4N9IA 2VBZA 3SXWA 4M73A 3R60A 2PHDA 4CYDA 2Z3YA 1QGPA 5D5VB 2AS5F 4O9GA 1EYBA 2ZMEB 3IRQA 4G7OF 4U7BA 3K1MA 4G7ZF 2I45A 2D1HA 4MH0E 4WZCA 3F6OA 1KU3A 3EHKA 3C3WA 1C0WA 1Z6RA 5IT9K 2B9UA 4K2EA 4XFCA 5KHHA 4MQ9F 3IWFA 3USSA 2G7UA 4AQ6A 3T5XA 3WGIA 3OD0A 3RYRA 1K7AA 1NZCA 3K2ZA 4ON0A 3PLQA 4EJUA 4BHPA 1XMKA 5J8FA 5D4SA 4MUVA 1U3EM 1QXRA 1TTYA 4XSXF 2GC3A 4QX5A 3BPVA 4RB1A 1H9TA 3H3UA
chains in the Genus database with same CATH superfamily
5IYYA 3PJRA 2KKOA 4R4ZA 2W2IA 1FV3A 4P55A 1Z78A 2HYGD 3HSFA 2A6XA 1UOBA 4P9LA 2D5VA 3AYEA 2DFFA 3MD2A 4AFDA 4IHSA 2QSFX 1QJEA 5GPAA 1GZWA 2XWBB 3TMOA 2W94A 1EAH1 2WNVC 3BTAA 4OUSA 2D6OX 2ZB9A 4S0HB 4FPEA 3RPUD 1F35A 1VQ9I 1MW7A 3B6AA 3OYJA 1VAMA 1XD7A 3W20A 2MD5A 3VWBA 4Y52J 4LFUA 4XQDA 1R1A3 1K5MA 5TGTA 1D8KA 4YW1A 1RIRA 4N53A 1GZCA 3L2HA 4ZXKA 3FX3A 1RUNA 3ZFGB 2XLAA 1VBA3 3AJYA 3M7AA 5A33B 1FBQA 1W2AX 2IUWA 4CCEA 4E7ZA 2AACA 1JODA 1PGL1 2LOOA 2PJPA 5FPAA 3I2GA 3IM0A 3TDUC 1MMNA 2D5HA 2AXTC 2H09A 3T1LA 1W8UA 1KQ0A 1SLIA 4XDQA 1ZARA 2EA2A 3WGHA 4JGZA 2UWAA 2BFUL 2WAAA 3VB9A 1IQDC 4XLAA 4XTMA 1NY72 4WVMA 2DO7A 1AYM2 4ASLA 3RVHA 2JQ7A 4B09A 2H6CA 4OIOF 1ZLKA 4XHXA 3FFQA 5FBZA 1UMQA 2ZHLA 2DN0A 4UXNA 4BDZA 1QF3A 5E17F 1MEC1 3L2UA 3VD5A 2B42B 4XSZF 2XC7A 4OZOA 1AR62 5E1XA 1B8IB 3OEBA 4MGTA 1ZAOA 2E1OA 3NV1A 3O12A 1WI9A 2Q30A 2EFPA 3C7GA 2DMUA 2IXCA 3O8HA 1K79A 2RKHA 3SZTA 1SACA 3U21A 2OCCH 3WDUA 3PIJA 1T6BX 3T1MA 2ET1A 1RUC1 3C18A 1IQAA 3OYWA 2WJSA 3ZYBA 4M3CB 2ZFWA 2A5YB 4UW5A 5F5QA 4EATA 3CO6C 3SLIA 1ULFA 1UO9A 4AL9A 1R1VA 4GJYA 3KZZA 2KA3A 3MBWA 2Y0SA 4P9UA 4LO7A 3CEWA 2CQXA 4Q2FA 5EG0A 3RRDA 4PCQA 1IV6A 2OQRA 1XPXA 1ACCA 2RG4A 3WTYC 5A7PA 4CDXC 2CUFA 2QQOA 4CEYC 4QLCU 1YFXA 2VQGA 4BE3A 4ATFA 3ACHA 4YW2A 2ZA9A 4Z92B 4JHZA 4UW6A 4QKNA 1KU7A 1PUEE 4COVA 4JQRA 4C0HA 4IXLA 1G8XA 2DQLA 1RUF3 1K5MC 2OPKA 3FLTA 2BVMA 2MGQA 2ZSIB 1S7OA 2DVFA 3DXJF 3W21A 3RKYA 4RGRA 4UFLA 2HPMA 5F6FA 3HN1A 3MYXA 3MIFA 4A5MA 2CYFA 3H35A 3DEMA 2EH3A 1KGYA 1OBNA 2BWAA 4OHZA 3FKJA 4HANA 4JQFA 5ABJB 5HS7A 2RS32 4UFJA 5FUNA 2VVEA 2CJJA 1CZTA 5B66C 1QMJA 2RR11 2R7OA 3AZZA 3PFYA 4ITCA 3RFRA 4KIBA 3H36A 1I50J 2XMLA 5JPNB 1ZZ7A 1LESA 3IL2A 1USTA 2NYYA 5JUVA 4AVCA 3J9SA 2AC1A 4R8HA 5FP7A 1AR91 1QZYA 4XCAA 1XSVA 2Q1ZB 4BB3A 5H6QA 1W8NA 4JGZC 3RZLA 2BERA 2YSRA 1PP7U 2KJCA 4A3CJ 1QJU3 2RM21 2EIBA 5KHGA 5IOZA 4OINF 4HOOA 1R6RA 3K3OA 3QBQA 3VUOA 4F52A 1ASJ3 5FKCA 2YFZA 1WQ2A 5D8KB 3GX4X 4B8XA 4L99A 2GU9A 1UZ0A 1IW7F 3HDDA 3OIPA 4LLLA 3QPLA 1WVRA 3INAA 5FYCA 4YIFA 3T30A 1OYIA 2HWB1 1JYWA 3M9AA 5IVBA 1SQ4A 3KEQA 2O0OA 1WJEA 1MMSA 5FB2A 4D7TA 3FBIB 3D1NI 1RUJ2 5C4WA 2I10A 3UGFA 2L7FP 4HN1A 2VBYA 3GHNA 4KU7A 4NC7A 2GN3A 2YU9J 4A7YA 1Y56A 5E1WA 1JTXA 3L9FA 1P8JA 4LPLA 1E57A 3N9NA 1VBC1 1FNZA 1YW8A 1UMIA 2EK5A 4MFDA 4UUSA 1YITI 1W1WE 4LHKA 4XABA 2KRHA 4N43C 5J3UA 2HPIA 2JKBA 1OCPA 5J98B 2HOAA 3F95A 1J9IA 1HBXG 2J1VA 2ZGSA 2L5QA 5D4RA 1XQNA 2Q8DA 5BUVA 1W9FA 3WNNA 2ZOEB 2IXSA 2XRNA 1DUXC 1JZ4A 4CEWB 1RIOH 2FDIA 1MZBA 3MMYB 1EAH2 4YLZA 1JZ6A 3VZKA 4JHTA 5F32A 2VZPA 4GB31 2QJVA 2EA7A 1WMDA 5FPZA 2IEKA 4ZU4A 5M5XJ 3K51A 3S30A 1R58A 2H0VA 1GXPA 4E8CA 2CRGA 2LBFB 1HV1A 2X1DA 4AQSA 5HV0A 5K8SA 4XRSG 1AOYA 3GTGJ 1POV0 1KDKA 3RQ4A 3K2OA 3P6BA 4RGGA 3P9IA 2DK5A 5F3IA 5ISLA 4R79A 4QX7A 5FUPA 4RA0A 2LM3A 1P2FA 4KN4X 5B1BH 4Y20A 5JHFA 4M72A 1TVGA 1HDDC 3AZYA 5A3LA 3ZFEB 1OYYA 1PGL2 5L7OB 4UF0A 2WAFA 3EB7A 1YIFA 2PMWB 3D82A 2VOWA 1UELB 3DGTA 4LBNA 2PJRB 3A23A 4CUBA 2A3YA 1X50A 3UV9A 1LEMA 2E9QA 2ZJCA 1KRIA 4AVTA 4CDWA 2WA0A 3TAYA 2ARBA 2UZKA 5CFDB 2VIXA 4DQAA 1RHI1 5L3BA 3WHBA 1BBYA 2VXRA 4HW0A 2DFIA 3Q3SA 3LSIA 3PSIA 2V09A 3DYMA 4I0AA 2VECA 1X19A 2OZJA 4HXCA 3BPSA 3G6EI 3TDZC 5A7QA 1AF9A 2TDXA 4IETA 1ND3B 2K46A 3GZEA 4IERA 3I2DA 4Q26A 3OYAA 2BW3B 1C8M3 1A34A 4DNCA 3WU1B 1PGSA 2X51A 1RR8C 2IA0A 4Q27A 1FT9A 4HV6A 4JK1X 5EZGA 4NMIA 3H3ZA 1OFCX 4P9GA 2VM9A 1SANA 1CQTA 4ZDLA 1FPN3 3FDYA 4AYUA 3T2QA 3SKVA 3HOUJ 3MKYB 4N4OB 1H2KA 2VOPA 3T2OA 3KCYA 5BMZA 1NUKA 2P5VA 2YGLA 2VW2A 4ATEA 1OLQA 1APLC 3ILRA 4IV3B 5FO8B 1KYZA 4XF0A 4F7ZA 3AZXA 2DA2A 3HPGA 1U6GA 3VBFB 1PNGA 5E1ZB 4RR3B 2DI3A 2J1EA 3K4KA 1HC8A 3H9GA 2HWVA 3ZR6A 1LHVA 1MZ6A 2C1FA 5BNPA 4RHV1 2HBTA 4GJZA 5M0TA 3LSHA 2BGOA 2C0ZA 3VKOA 1T0FC 5BPIA 2Y31A 3CO2A 3M07A 1O6UA 4Q4Y3 1GHCA 2STTA 1HW2A 1MS0A 5GLVA 2GNMA 1NK3P 1FSEA 4L5JA 2DDAA 5LA1A 2JA8J 2KQRA 1XBFA 4CDUC 3M1HA 2VZVA 1ALYA 4NQWA 4Y24A 4LIUA 1IUFA 4GH4C 4M3GA 2VY0A 1BZWA 2XF6A 2HDWA 4DB5A 2ZJPF 4XFIA 1OLMA 4ZKTB 4AYBA 1W6MA 2RR12 2DUOA 2PMHA 2XF5A 2FDGA 1KA8A 5JLXA 1JHNA 4LE4A 3AFGA 1G9DA 3C3VA 3TB0A 5EF6A 1LODA 2C6SA 2WN2A 3H7YA 2PLV3 1PMIA 4CDWC 2LFBA 3ZO0B 4M4RA 1VAVA 1T56A 2ZXHA 2OQ7A 4WVZA 3ZXLA 1HKSA 1ZYRF 3KF3A 2VPRA 3GZ5A 1BOBA 3W5NA 4WXHA 2EIEA 2RM22 2XOMA 1OPMA 4YWAA 4Y1YA 3G71I 2HVRA 1A31A 2R7VA 1PK6B 1HQCA 5JOWA 4FTEA 3UJOA 4YGBA 2RDPA 4E4HA 2EXKA 3A03A 1J84A 1VI0A 5FKOA 1FX5A 1UY1A 5C4JJ 1W03A 4C90A 4A3MJ 1GU3A 2BY1A 1R22A 4XW3A 3LSKA 4HVRA 2Z2SB 1K6YA 1D4VB 3WZ1A 5CVRA 3A22A 3BJ6A 2EFOA 3MWMA 3HUGA 3H50A 2G9WA 2XJSA 3LGRA 4I99C 3ABKH 5DDJ3 1IN5A 3TQNA 3BOWA 4JX0A 2Q8KA 1VBC2 4FPOB 3UKNA 5CZKA 2IAIA 1X9PA 2RVCA 4Y22A 2ID6A 2CYYA 2A75A 3OYCA 2QQ8A 1UOJA 2FZ1A 2GH2A 2HXIA 2KIQA 3I55I 1RC6A 2HH9A 4QPIA 4FE4A 1O5UA 1YXWA 1UMZA 4ZYHA 1K6OA 1KXGA 2FRHA 4BK4A 2QNKA 4NRPA 3MIDA 3CDZB 1HKQA 2DBBA 1GOHA 2JG8A 3IHUA 1VB2A 5D21A 5BNPC 2X5IA 1VBE1 2Z1DA 5J8CA 4WF2A 5IYDJ 3V0BA 5GZDA 2BZDA 3G4SI 2DA4A 3V42A 2Y6GA 4G6QA 1POV1 5F0FA 2VR4A 2BHYA 3RZZA 2YPRA 2LKPA 2AYHA 4D6RA 1GQPA 3SDGA 1BM9A 2WS91 2XUBA 5EV7A 3KZYA 4ZXEA 2L3DA 2UU8A 1DYPA 3NNFA 1IG3A 1PIV3 1ZNPA 2QQIA 4LOTA 3DCFA 2VZQA 5FLXZ 1LB2A 5FTTC 3E6DA 1U8BA 3C7OA 5C4XJ 4LA3A 3K0LA 2LS6A 2MG4A 1QWRA 3HRUA 4A0ZA 1TE1B 1JUMA 1LECA 3ME2A 4CDQB 2IT0A 1H8TB 2Y0SN 4RS8A 4AAPA 2IPQX 2GP3A 1PZ9A 2HTJA 1PM4A 3VDXA 2R073 5FP8A 2WFPA 1UYPA 2QZ2A 3B00A 4F3JA 1BOAA 5JCTA 1H1MA 1IV8A 4NPRA 4LBQA 2NNNA 3CCEI 2YGMA 3W3CA 1IN7A 5K5RA 4INDA 2ADDA 1CAXA 4W65A 2XGDA 2KL4A 3ZOBA 1RHI2 4OU0A 4JX4A 4U36A 1I1GA 4RQPC 1X9TA 5DCFA 1R5ID 3BG9A 5TISC 1DGWY 3S2HJ 3OGJA 2VE9A 2TBVA 5LBEA 3L09A 4LK0F 4YVWB 3WHTA 1JU3A 5FYTA 4J00A 2Z5UA 3HIFA 1K4SA 4JAAA 1UPSA 4QT6A 1OI6A 1H88C 2LKSA 5LASA 2B46X 2HWF1 2RMU3 4DY5A 1PO13 2KIMA 2JDMA 5LD2C 1FEXA 3I2KA 1T2KA 1I5ZA 3VDDC 2X85A 1BK1A 3LQQA 2E31A 3GFLA 4W1UA 3B5LB 4YZ1A 5FY8A 1FJLA 5HOOA 4B7KA 1YI9A 1YQ8A 3UETA 4AGGA 3S0MA 4WV8A 3TEDA 2W5FA 4CRQA 1VMFA 2LTNA 2W9XA 1MVQA 4FQ4A 3PDQA 4BACA 3HPNA 1R9TJ 2FXAA 1HW1A 3BUCA 2O9LA 1WJ5A 1U0JA 4KMUX 2BBYA 2XL7A 3RZGA 1ULCA 2WV0A 3S7EA 3TO9A 2P1BA 5D6EA 5FPBA 1BN5A 4JTOA 3LDRA 3ES4A 4BY1J 1TZLA 1D0XA 4F91B 2ZGKA 4QPIC 1QOSA 2RS11 3Q8FA 1Z3YA 2F6BA 4IHTA 1V6MA 3G1LA 4BQOA 4HKWA 3ZX7A 4LULA 4RHV2 2Q2EB 4HFSA 4EQQA 4AK3A 3CUQC 4KWKA 3Q0WA 2QSGX 1R36A 2W1WA 4ESBA 2WN3A 2F4IA 2XBO3 3O1UA 5E79C 4V2FA 3K10A 3QPSA 2NVTJ 1O5LA 3AZVA 2WTEA 3LAGA 5ERIA 4BHBA 1OOPC 4NOTA 3ATGA 1B6AA 1VLNA 3ZFFB 2JPBA 2R0FA 3GZ6A 3VOEA 1FOKA 2XKOA 1D0GA 2UXNA 4O61A 4BEHB 4LK7A 2WZR1 2COBA 5E3LA 3GM8A 4ZC3A 2VTFA 1P4XA 5DM6F 1UU6A 3LDBA 3S17J 1DGRA 3PUIA 2AQFA 3F0CA 1W6NB 1BCXA 4KG0A 1AU7A 1D0ZA 3J7NA 4DYRA 1SLAA 2QBXA 2VH9A 3ELKA 4JCKA 5C9AC 2F4MB 3CL1A 3ZFGA 2WNUB 3GWZA 3L7WA 1GWLA 2BP6A 5A33A 1MPXA 3TNPB 4B4PA 1B35C 4YIIA 2K02A 2ZEZA 4X6AJ 2OTJI 1XE8A 3LEIA 2OJED 3PUBA 1RB8G 2QM3A 4GD4A 1U5IA 4TYSA 2QWWA 4PF5A 4GMP3 3OR2C 1QY4A 4F92B 2IXLA 2CFOA 1SHWB 5ERLA 3MF6A 4XZUG 5C3PA 3ASIA 3SJMA 4HK9A 3HEIA 4CCDA 1HRI3 3K48A 4FHTA 4PLNA 4IEWA 4PQ9A 2HR3A 2CAVA 3JW4A 3RYPA 3ZQLA 2JDYA 2PHLA 3CO7C 3ABUA 5L73A 4AVSA 4CH7A 2YX7A 2M7BA 3A0BC 4UFMA 2VVDA 4CE8A 4MGQA 1HKTA 4LMFA 4ABZA 4ENNA 1ULDA 2YC0A 1QOOA 1JT0A 1XMAA 2PQQA 2WL1A 2X53S 4ENJA 2WAQA 1NAEA 3OV8A 1QXPA 1JYIA 1GOFA 2DUPA 4AEMA 4NHKA 4R4XA 4EE2A 3LFKA 3WG1A 2FBKA 5FXXA 4CICA 4UNOA 3WG2A 4A6EA 2Y6FA 5F6KA 2DODA 4P08A 1VBE2 5ILVA 3T08A 4P14A 1W7PB 2P3KA 3MFAA 4RM2A 2Y64A 1R23A 2AUYA 2C9AA 3AFHA 1UKGA 2VCCA 2MNGA 4BDVB 4LKSA 1QH6A 1IKQA 1OXCA 2BXZA 4KISA 2A70A 1UZVA 1ZZ6A 3RKQA 2Y75A 3S3MA 5GLTA 1IS3A 1WSUA 5H20A 1ODMA 1HQWA 1NXD1 2WC2A 3I53A 1BC7C 2VUDA 2NVQJ 5M5YJ 1JMUB 3HKZA 1ZHFA 4CXFA 4B4RA 5A32B 4CP9B 1Y8RB 3BOPA 2XROA 2ZXWH 4XLPF 4CA0A 1ST8A 5CPRB 3GJBA 2HWC3 2B8MA 1SG3A 4UB8C 1W6PB 3I7DA 1GP5A 1ZREA 2E6VA 1ITYA 1EPWA 4HLYA 1Z7LA 3I4NJ 4PGGA 2L9LA 2R1BA 3ZFGC 2QDRA 1UG0A 1FOWA 5C3OA 4ZJZA 3SKJE 2MH9A 3FLPA 2MEV1 2VXZA 4G6DA 2PLYA 5ABJA 4RMNA 4UFKA 4Z6YA 4COUA 3NJYA 1YRNB 2OPTA 1CZSA 1DQ5A 1REFA 3ESWB 2G1MA 4ZH4F 2JUCA 4XF3A 4L11A 2MHFA 2R7EB 1R1A1 4CO8A 2BVVA 1JKRC 2CUJA 4B47A 1XS9A 1MGTA 3RWNA 5FRNA 4QSHA 1D1BA 1VBD2 3IMMA 3WX5A 1TBXA 4LEJA 2CHHA 3IZOA 3FXRA 2ZX2A 2K4BA 1VBA1 1JUPA 1IO2A 2X6YA 5A6ZA 4QIWN 4AYBN 3WP6A 2R3SA 5AC92 4FPKA 2W7NA 4QWQA 3B7MA 4BQ3A 3BROA 1UYZA 1JXSA 1CAVB 3POIA 1Q1VA 1JZ7A 2ZACA 1STZA 2CMPA 3E3VA 5GTHC 1X1CA 3BVCA 3APBA 4AGRA 1F4HA 1P4WA 1WFXA 2NVUB 1WBFA 4S2GA 3DPRB 2O0YA 3RCOA 3ZMOA 3CJIC 1NCRB 3C7EA 4GWIA 2WRAA 2E53A 2HKXA 4RGKA 4UFIA 2SBAA 3DPTA 3VBRA 3OOPA 3MICA 2XJQA 2YBSA 1LUJB 3C2GA 2XL9A 3WE3A 5JZGB 3WW4A 2NAZA 1XYOA 1VPHA 2GNTA 4B3NA 2GOXB 2D6LX 2MLKA 5EYXA 1FBUA 2CUEA 2K3FA 2E19A 2WO7A 3S1MJ 4CU9A 1KU2A 3SITA 3HOBA 1BA5A 2I07B 2DYSH 1BJAA 3N35A 3NNJA 3ON7A 5DV5A 4IOAF 4Q4W3 5KAIC 4IHWA 3ZMUA 4DRRA 2FOKA 1YTYA 4BBRJ 1GP4A 5JAXA 3S57A 4CEWA 4P02B 1LDJA 5A3WA 2EPFA 1XNTA 3ZYJB 1RUG2 5T5OA 5HODA 2WZR2 3UESA 3UKGA 1CPMA 2WZ8A 3QD6A 3W6JB 3NV4A 4U87A 1FIAA 2LBFA 5FLMJ 1A78A 4LUKA 1O4TA 4XF4A 4YEJA 2JB8A 3EYPA 1W04A 1CAUB 5F0CA 3S7IA 3VBSB 4HBLA 5J1UA 5A7NA 3ZYGA 2LSOA 3FXQA 3VBOB 1W3VA 2X09A 3AK0A 4TTGA 4MHGA 3T2PA 3N9QA 5HXMA 4I3PA 3M3YJ 4Y26A 3ZFEA 2JD9A 3F9KA 5FP3A 4Y13A 5ABJC 1FI2A 4FPJA 4D6SA 1L7LA 3BLYA 5T5PA 2D93A 3FMQA 4AD9A 5L7OA 3POFA 4L9NA 4IGOA 1ETYA 4DY3A 1I6XA 3EQLF 1S0BA 5L3FA 5CKTA 2E26A 5FMCA 4YELA 4AZZA 3U1KA 2A6TA 2PJRA 1RUF1 5FKLA 4XIOA 1LFPA 1QJY3 4NRQA 4XKBA 1PO21 4AEDC 2NVYJ 3I3QA 4IGQA 5E3MA 3WW2A 4IEPA 2WADA 2Z33A 1YI7A 4XORA 3FC0A 5CFDA 1Z7UA 1Y9MA 4ZU7A 5D6FA 4YG2F 5IYBJ 1USSA 3L9JT 1QZEA 1REEA 1YJLA 4Y33A 5DAXA 1LHNA 1DPUA 2F5EA 2DU0A 4NB5A 1KU9A 1ZZ9A 1F5FA 1LHOA 4OVEA 2XIGA 3DTEA 5J6XA 1ZG3A 5CVVA 4E2QA 5ED4A 1R091 2IS6A 4IV1B 5A3OA 1ND3A 1WJBA 1MR5A 4U0WA 2Q1MA 2VBBA 1FYMA 1IS4A 3FBMA 1QZZA 2E2HJ 3DCQA 2R5ZB 2XGEA 2VQTA 2JSCA 3A2KA 1WRJA 2Y6JA 4FPLA 2YG0A 3SH5A 5KHJA 1REPC 3DN7A 3QYFA 3VBRC 4EEFG 5FDBA 3FL7A 5J7MA 2OT7A 4QMAA 1Y3TA 1QJU1 2KR2A 3IAQA 4M6XA 3H5RA 2K9MA 1XSXA 4YARA 4YPJA 3K1NA 3OUHA 3F2ZA 3H8OA 2JA5J 3WQ0A 2LF7A 1YC61 1FMD3 1MJ9A 3ZMSA 3BC8A 1OURA 4D94A 1EF4A 3J4UH 3GYDA 3KF5A 3KHCA 1OQ1A 4K8FA 1SLTA 1YLFA 1K5JA 2XAHA 4IV3A 2B5HA 5KHDA 3PUQA 5ICCA 5E8IA 4XRMA 1QJX3 4X6QB 3VBFA 5C8CB 3IKVA 4QM9A 5FLJA 1ZH5A 4RR3A 1S29A 4PJJA 3BGAA 1OA4A 2BXYA 4XOTA 4YFKF 3LOIA 4AM3A 3N3HA 4LB6B 1QGLA 4Y1ZA 1OLTA 1CZVA 3PJQA 4W4ZA 3OL4A 2ZXIA 5HNFA 5C6CA 3EMRA 3BI3A 3BY6A 1MNDA 1S7EA 4JDMA 2RJLA 2VZUA 1LGCA 4XDPA 1QXJA 3AL6A 5EEHA 1R49A 3QP6A 3RTRA 5FZOB 1RVF3 1SLBA 3NRUA 2D3SA 3WVJA 4S04A 3EBRA 4E4ZA 1SDWA 1V5EA 3ACIA 1EY2A 4KT5C 1FOD3 4QPGB 2MEV2 1DCSA 3V8JA 1W0TA 1S1AA 3VBHC 4FAGA 5GZFA 1ZYBA 3JRIA 3ZFEC 4E8DA 3GTKJ 2Y0MA 1TNRA 4PT6A 3VD4A 5D5WB 3Q5FA 1ZGAA 4P1WA 4IOCF 4B7EA 1WWYA 3UL2A 2QQVA 5IK8A 4FT8A 4FPGA 2L7KA 3I3DA 2L7MP 4ZS2A 3R60A 1G2HA 3WNXA 2Z3YA 2GNDA 2MFZA 3E0JB 5D5VB 1VQNI 1LENA 3OIQA 1RUH1 4LT5A 4U7BA 1IJWC 1DGRN 2NS7A 1H6XA 3V64A 2ZS6B 3C3WA 1A36A 1Z6RA 5BNOC 5IT9K 1PK6A 4IQ4A 1Z7S1 2W39A 4MQ9F 3IWFA 3USSA 1Q8QA 4M3DA 3T5XA 3GNEA 2JWTA 3RYRA 2VCMA 1P7IA 2MW8A 3K2ZA 3HN3A 1JZ8A 1D7PM 2JEMA 4TZDA 1ND3C 4MUVA 5DN2A 1TWHJ 1U3EM 3H5NA 3LEGA 4COWA 4FASD 2G0EA 2DA5A 4RB1A 1OMIA 2DA7A 2ZMKA 3JQXA 2WNVB 4RB3C 3WLUA 4CXYA 2DW4A 3ZSMA 3ZXDA 1HX6A 4YYOA 2CO5A 4OHWA 1IGOA 2LP0A 2XJTA 4DO0A 3ZYHA 2YUEA 4Y4RA 4XRSA 2XLGA 2WAOA 2DURA 3M8LA 3SFZA 1U12A 1ULEA 3PMEA 1G59A 3OWTA 1WLDA 1UZCA 3V8LA 4XICA 3I0TA 4UB6C 1YQAA 1B72B 1H2LA 1JZ2A 2GAUA 3U4SA 4DBRA 1XJAA 1BBT3 2YR2A 5CYVA 3GXUA 2R7WA 1S0JA 1W05A 2W3JA 5ILSA 4YZ4A 3VBFC 2JDNA 1DU3D 2RV9A 3I2OA 4LBQD 5IJRA 4RR3C 1JHFA 2MC3A 1VBB1 1GOGA 1Y0UA 1U0AA 5FMBA 3BDDA 2YX4A 5IK7A 4CUCA 2MD0A 1FPN1 5T5JA 2WAQN 3N7MA 1F1ZA 2BDRA 1T6SA 4KGGA 4A45A 2PEXA 5EJ3A 1QHDA 3MCZA 3NRVA 1V6KA 2HOEA 4OAYA 3S5AA 5CU1A 3ZMDA 5LA0A 1OLME 1F4KA 1HXS1 1FYKA 2E2IJ 1F15A 2VTXJ 4CCMA 4BQXA 5I0UA 2A5ZA 1LKXA 4HMZA 3VHOA 5KCMA 1RUE3 5IT3A 4S05A 2VQAA 2AR6A 4KN7X 4CDQA 1AL0G 1EUUA 1H8TA 1V9U1 5A3TA 3GTPJ 4Q4Y1 3CDHA 4EN8B 2VMGA 3T2TA 2DXIA 2F17A 1QHGA 1DGRM 1YW9A 2QKDA 1PO22 3HKZN 2JN6A 2JDZA 5KR7A 3KM5A 3V56A 4QX3A 4CXXA 3AP6A 1W2NA 5F3GA 4YM3A 5CVUA 3H92A 1RUI2 3VDAA 1GV9A 4Z2AA 2VOKA 3Q8AA 3BG7A 4O9EA 4QPWA 4HDVA 3L2RA 3V8KA 4ZZ5A 5DTDA 1IXRC 1D5VA 2L0KA 3VZOA 4Y1UA 1PK6C 2VUAA 4BIFA 1US2A 4YVWA 4B29A 3OYGA 2RNGA 4DNYA 4LHSA 2P5BA 4K3UA 2HEOA 1R092 4IO9F 3KP6A 3THDA 5B2GB 2M4GA 5HLGA 4PIXA 5GAGJ 3GUDA 4HQEA 2DJIA 1F31A 2BV6A 1WCKA 4CDXB 4CEYB 2ORXA 2FEZA 2VNVA 4OI0A 1ZBA3 3TEXA 2X8KA 4WZFA 2ESHA 2VC9A 4URAA 4XKVA 1QJU2 4TXWA 3K4AA 5IAVA 4I98B 1TNSA 3ILFA 1NH3A 1BK0A 3PHMA 3U14A 2M0CA 2VUMJ 2E1CA 4DYQA 1MSEC 1FAYA 1MBEA 4BZ4A 4IEJA 2CW7A 2YUSA 4L0YB 2JE8A 4GMP0 4LO6B 4I09A 1FXZA 4A6DA 1JUSA 2IXIA 1J83A 3N4MA 2XHNA 1GNZA 4K8RB 1JKPC 1H0BA 4XMYA 4XK4A 5DAPA 5F5CA 2E34A 1LE8B 5E8AA 2R32A 1N78A 2OQGA 1HB3A 3SEPA 3QACA 2Q2EA 2EV0A 3MPBA 4L18B 3IRRA 1C5IA 4MXVA 2CS3A 4CU8A 2LK2A 2H1LA 2J1SA 4AEKA 2XSDC 3ZXKA 4M6VA 3FXLA 2A6EF 2V73A 1BIAA 1H1IA 4GAZA 2R0HA 2HQRA 2UYBA 5EJZB 2VB6A 1JTYA 4RA2A 3CLPA 3ZFFA 3OSGA 3K4NA 5EYRA 5GLZA 3GTJJ 2VN2A 3BR6A 2E7XA 2LH9A 5D5XB 3VD3A 4AOCA 2RQPA 1VB4A 2JIJA 1H8TC 3JRDA 4F83A 1W6NA 2DTWA 3WTTC 4E4SA 4CZSA 4BJ5C 2JSPA 1WA4A 2UWMA 3NAPB 4MG2A 3LSMA 4QX2A 3O1SA 1UL9A 3QH7A 5JI6A 1PMJX 1HRV3 1MZ5A 2GA1A 3OYWB 3KLSA 3H8UA 3HQXA 1F8VA 2VQHA 1RUH2 4XN3A 2GIVA 3SH4A 3I64A 2EFQA 5G05L 4YW3A 4TN7A 4N43B 2C6YA 3LB9A 1Z7S2 1RXFA 3HTUA 1GLNA 2ELHA 2OA2A 2QUOA 2KRFA 3H7JA 1H89C 5FY9A 4J19A 5E88A 1SC7A 5L3CA 4BLIA 2M8GX 3GCXA 3AL5A 4DUXA 1W0NA 3DU5A 1IC8A 3WF2A 1OH3A 3IAM2 1OCZH 2QTWB 2HTSA 4NJ4A 4B3AA 2FCUA 1MBHA 2ENRA 5F1RA 4K21A 4IEVA 5FZGA 1VRH2 2XKPA 3M8FA 4UBHA 5C3RA 4HX4A 5FZ0A 1MH4A 2JJ7A 2ZGTA 3N9PA 5C5UA 1AR72 5FXVA 5EIYB 1WJFA 5ICFA 1R1UA 3NNGA 2ZZJA 3TEWA 1F43A 3SQOA 5K5QA 5C70A 4KIGA 1VQ7I 4RGAA 1PO11 4L5IA 4H0EA 4LO4B 1FTTA 3IDBB 4XJWA 3VBUC 2RVAA 2Y69H 1JBCA 4BUPA 2M0MA 1RESA 3LQRA 4Q29A 1VBB2 2B4KA 2VOVA 4ZU5A 4EWDA 3J7ZI 3IMNA 1R64A 4EMSA 5J1RA 4M71A 4YFNF 3LMMA 4A7ZA 1YX5A 3SHRA 4MFEA 3T4VA 4BLJA 3DBHB 5FZ9A 1O3RA 1W7PA 3CJQB 4CCOA 2O1QA 1COV1 3NJXA 2Y30A 1TL8A 1DG6A 3NJVA 3N9MA 4XDOA 1LCLA 2PHXA 1IHMA 3C7HA 3T8TA 4GWMA 1KZHA 2K9NA 5FD6A 3H1WA 1HXS2 3KB5A 3W5MA 5BY5A 3G3ZA 1XC6A 2HLEA 2XWJB 5A32A 5FRAA 3ZFFC 1U5XA 4CP9A 4LG3A 1BI1A 3CCSI 2HEYF 1UAAA 1J5YA 4CSWA 1CIWA 2F4LA 1RI7A 2PHRA 1TT0A 2P6SA 2IGNA 3ECHA 1ZR2A 5KXEA 3AG2H 1UW8A 1V9U2 4BDYA 1Z6TA 1NX9A 2KXLA 4Q48A 4IXAA 3CF6E 2XBO1 3DYPA 1Z1DA 1WH7A 1AR83 3LIGA 1JZ3A 4ZYGA 1OC1A 4P9WA 2I5UA 1UQXA 3JUUA 2RAEA 3ZSLA 3D3AA 3WDVA 1WKMA 1UYYA 3SH3A 2NZ9A 4UHTA 2P3IA 1VIWB 2RJKA 5IVVA 5FWEA 4QXKA 2DTRA 2VMFA 3HQRA 3SCGA 1ZRDA 1YRNA 1ULOA 4PLOA 1MNEA 2P6HA 2HU9A 1EV13 1F36A 2P5KA 3JTHA 5FREA 3HQUA 4LHNA 1T38A 1I3QJ 4YW7A 1OH4A 3RJPA 3LPFA 3BQYA 2DCEA 2XHKA 1UZYA 2BFUS 3SEZA 4FCAA 4HLTA 1I3AA 4L9JA 3PM1A 3H5AA 4U0YA 1X58A 4RLFA 1A8MA 3R0AA 1R081 1RMU3 4A69C 1XB4A 1UXXX 2WNOA 1WJCA 2QCOA 3BWGA 4ISQA 1CAVA 3WTZA 4A0YA 3WD5A 2AZ5A 3ECOA 3AXDA 3L2CA 2WYFA 4OHVA 1GBGA 2W91A 5HDNA 4QQ2A 4GMP1 3LWCA 5CKMA 5F1JA 3DPRA 2YS9A 2ELKA 3NWSA 2QQ9A 4CDUB 2ZXQA 2EINH 1Q1HA 1OSGA 1NCRA 3X2QH 3PVNA 1JOJA 3BCAA 3DLLF 1SCSA 4GH4B 2WWSA 5EP9A 2VW0A 1G3SA 3RNSA 1XGOA 2YPDA 1ND2B 4QX8A 2IVIB 3RZDJ 5JZGA 1ETVA 2NLRA 4BMBA 2E51A 1XNCA 3KQ4B 2L4AA 3BB6A 2BZTA 5A70A 1HSTA 4MGZE 1MDMB 1ACIA 2ARAA 5CQEA 1XRUA 4MLOA 4EJRA 1FSHA 5F9TA 4HRIA 4NN0A 1IPSA 3VGIA 1W3XA 4Q0SA 2DYRH 2WUHA 5H9SA 4ASNA 1Z91A 3K69A 2FBIA 5LGNA 5HDGA 4BQQA 4HSLA 2V4VA 3MN2A 4Q4ZF 2R5YB 4EN7B 5DG2A 4FBFA 2ZAHA 4A3GJ 1J3PA 2M9HA 1BJQA 2J42A 1L7QA 4QHOA 2B9SA 2W87A 3R0JA 2R16A 2D97A 3O1RA 4C2TA 1B9NA 2JVHA 1VMHA 3IWZA 4CA9A 4L97A 4A12A 3WF4A 1AJOA 3LL7A 4BNCA 1CAUA 2SLIA 4LITA 2ACJA 2V5DA 3MZ8A 3MZYA 5A3PA 2XQRA 2OYZA 2V4AA 1JYXA 3VBOA 4G4FA 3KCCA 4PUSA 3ZXEA 5I8SA 2EZKA 4GO1A 5H6RA 2R061 2JECA 5JXJA 5LEJA 3N97A 4AXOA 4XILA 1SVLA 3WDXA 1KYWA 1VRBA 2Z5WA 3EUKL 2VZRA 3QYEA 1LVKA 3FXUA 2HWC1 2M5WA 1QU0A 3MLLA 5DZGA 3MV01 5A1AA 3F8NA 2NRAC 3AMMA 4S2DA 1OVSA 4IRIA 1RPWA 4A3FJ 4QQHA 3OYBA 3ZLIA 5BNNB 3VYRB 3CMEI 5DUXA 5BNPB 4V19K 3IH2A 2COMA 3K70C 2Z79A 3KSCA 3K46A 3JB8A 4F93B 3ZKUA 3I4MJ 1PMHX 2VT2A 4YG6A 1LULA 4DYCA 4XKCA 4U0VA 4B3XA 4RB2C 3CZUA 3CNAA 5EGOB 2D2WA 4NHLA 3F23A 1HJFA 2W52A 4YNIA 4IV1A 5DG1A 3F72A 2L2OA 4NE9A 2Z69A 3JSPA 1WWXA 1C1LA 1NCRC 3JBG1 1CX4A 2R5ZA 1AYM3 3G73A 3TOJA 3ZVXA 1PO12 5DMYA 3MKLA 4EGZA 5FO5A 1JI6A 4C0BA 1W4MA 4KWJA 3ACGA 4YRDA 2BHZA 2WO1A 1U5TC 1DGLA 3O1VA 3U07A 3TYJA 2QQUA 1AR63 2OBPA 1SLCA 3MDPA 2K0GA 3WW1A 2P81A 2JDAA 4W6XA 3WQ7A 2XF7A 3OR1C 4I0WB 2WLPA 1S7AA 1CIYA 1W0OA 3B94A 5FYZA 4RFT0 1TMF2 4QDSA 4M3FA 4NAMA 3O7OA 2GA2A 4FTHA 3BU7A 2NS0A 3HEFA 2YZ4A 4AR2A 2CV0A 1COV2 4DXSA 3RMXA 3R4SA 1IZ1A 2O8KA 4LG0B 5CBLA 4GYIA 1CX1A 2OC6A 4XUOA 4LLNA 1NG6A 5C8CA 1S0DA 4RQPB 1Z0HA 1YJ9I 2ZBKA 1RR7A 4HEA2 4AQ2A 4QHZA 4Q4X2 3BR0A 3GFMA 5FLXK 2R042 2QQMA 4OUEA 3BALA 2HOSA 2VZ1A 3BPZA 1GFF2 2WQ4A 2YFUA 3UK9A 5IT6A 3A0NA 4Z1VA 2CNAA 2DA6A 2LRPA 2VBWA 3OS1A 3EETA 2OKXA 2XVLA 1CAWB 4OI1A 3O0VA 2XPVA 3DKYA 3S3OA 3O8GA 1IDYA 3DP7A 2FF4A 4LNVA 5L9VA 1DDNA 2DU1A 2ZGRA 3VDDB 5JWPA 1UF2C 3TWIA 4Q4W1 5FZOA 2ETEA 3CU7A 1IN4A 4RLQA 4YFWA 3S1QJ 4WCGA 1W2UA 2X0LA 3VBOC 3I58A 4HQMA 3WDWA 3GYHX 1HIXA 3P5BA 4P5YA 4QPGA 3IDCB 4PJNA 1ODNA 3P9CA 1O3SA 1E5RA 3OY8B 1W5TA 4IEQA 2XGCA 2VL4A 2M1BA 2YPJA 4XBNA 3P3PA 3PQKA 3SCFA 3J7AO 1BR1A 3QODA 2RN7A 1MQTB 4YGCA 3KX2A 2LTPA 1TLHB 2VJJA 4WK8F 1SCRA 4FTSA 3S14J 4Q5SF 1UPIA 1N3PA 4J1XA 5F5AA 1S2EA 2RS33 1YUDA 2D3PA 4HL0A 2QZ8A 1OA2A 1R082 2L9SA 2O6GE 1ZRFA 1MJBA 3CUQB 2R6QA 1L3LA 1V0AA 3I49A 1LRHA 2G9FA 3V0BB 1N47A 2ZHMA 2ZABA 4UAPA 2FHRA 3OBTA 4AFMA 3R4UA 1J0RA 3BZ6A 5C3EJ 5E16A 3PL8A 3KYLA 5KXDA 1UZZA 3RKXA 4G7HF 1G3WA 4XPVA 4DS0A 3OYEA 2PBIA 4N7UA 1QJY1 3WQBA 4CP0A 3PJYA 4MIMA 1P4AA 1K42A 4PDKA 1OOPB 5J3LA 5IP9J 2WNVA 5FKKA 3L2YA 4R9CA 1T33A 3ASOH 1OQEA 4HETA 5DZFA 3POGA 4QTRA 4D69A 4HONA 4Z8BA 3S1NJ 4XR6A 4XFFA 5K7HA 4XFHA 3WT3A 2ATFA 1ZZ8A 2JJ6A 3H42B 2HWD2 4RGXA 2CGOA 4QPYA 1B72A 3S1RJ 5C9AB 4U2AA 4NAOA 4C2MJ 4LBQB 1RUJ3 3QPTA 4OWRB 4JZRA 4C8DA 4BIOA 3VV1A 1R5GA 4A3KJ 1MD0A 1B35B 2D6PA 1V3FA 4P96A 4ANJA 4LLOA 2LREA 1WCDJ 4PGHA 3RIRA 5C7GA 5C8CC 3RQIA 5L3DA 5FROA 1WD3A 2NMNA 5DABA 2PQ8A 1KEXA 4DIQA 2K40A 1UIJA 1UJ8A 1YQ5A 2HXOA 3K2AA 1JW6A 2BY0A 2GDFA 5FZDA 3PURA 4H2AA 3UT0A 1FPQA 4AQTA 5FOJB 1ENQA 2VPVA 2F2EA 3MIGA 4AFBA 2V5YA 3P3NA 4MXWB 5FQ0B 2IGKA 4R9AA 4AVAA 4A3BJ 1EAH3 1FX7A 4PJ0C 1I6HJ 2E5NA 1UIKA 6PAXA 3U4XA 1JUHA 1GLHA 1HB1A 1YHQI 1F4AA 2VOTA 3CQZJ 3DEEA 2CG4A 4HDUA 1OFSA 3C1DA 5GALA 1JOBA 3WINE 2HWE3 1PX3A 2CV6A 2R062 5FY1A 3KEOA 3JRGA 1FP1D 3SZGA 3WE2A 2HS5A 2A3XA 4MO7A 2Z16A 4BQYA 3HC7A 5JOZA 5C3QA 4EYUA 3F3XA 2CDOA 2HWC2 3I2FA 3J8F2 1S8NA 3FM3A 1LAJA 5IOYA 3GDBA 5IUQA 4XBLA 1OHFA 4XKWA 4HKOA 4XMAA 1O59A 5DQ0A 1W5SA 3J7YJ 5TSWA 3ZR5A 3AJZA 3PUFA 4IW3A 5ANNA 3P1IA 3ZM8A 2NN8A 5LK5A 3UJQA 3FE5A 5EFUA 1PJRA 2WBMA 2Y26A 4X8PA 1C3HA 3OYIA 1QU3A 2K7LA 2R7XA 4D1QA 1S9HA 4XC9A 4OMYA 3HOYJ 2DCZA 1JZ5A 2W1UA 3JBG2 3Q8EA 1WW7A 3HPHA 4CDXA 1IG0A 3QU6A 3MQ0A 4CEYA 1NKGA 4Q8KA 2FOWA 2LY1A 4HF0A 1PP8F 1N1TA 2PAKA 4IPAA 3OUJA 1PVC2 3AVSA 5KHKA 1U5ZA 3I2IA 3M8EA 1UY4A 3RJ2X 4HNTA 1PVXA 5FCCA 4XACA 1BKZA 3FM5A 5HS8A 4OZXA 2ERFA 3LFIA 1NE6A 1NCQC 2VO5A 3SNMA 2E2JJ 2BV4A 4PIZA 2LRDA 4M9ZA 4BYYA 2VOOA 2QQJA 1D8JA 4E7IA 1F9NA 1V6JA 1SD5A 2MYSA 1MIJA 2KIFA 3FFZA 5DDGA 4C30A 1LE8A 4ENKA 2W57A 3G7DA 2W1QA 2DQRA 2NP0A 3LEKA 4IVNA 1GICA 4PBOA 2DPUA 5GP9A 3EUHC 2HYXA 2DCJA 3DKXA 1NHAA 2I74A 2OS2A 3CD6I 3L00A 3VZJA 1XG1A 1H4GA 4HPQA 1G3TA 4M9SA 1VQOI 4AEJA 2FDJA 2ZMNA 2BVBA 4XXPA 1UX7A 4RL7A 3DWLE 4Q4W2 1UMHA 3ZIWA 1BVVA 3W6VA 3MZHA 4M3BA 3SYTA 4FQZA 3JRFA 2LF8A 1JGSA 4A7KA 2KIUA 1RINA 1OJLA 4PDWC 3ELNA 4IJAA 2O61A 1QQP1 2Y2ZA 1WJDA 3CJIB 3TP0A 2LG4A 1YQCA 1RL3A 3CIHA 4V2WA 5I93A 3ZXFA 5J1YA 1PUFB 3IKTA 3EYIA 3TEZA 5F64A 3WXPA 1GV2A 1CVNA 5CFCC 2JTVA 3NAPA 5FYMA 3K75B 4YW5A 3T0AA 1CD3G 3CCQI 2VE8A 4XE9A 2XAQA 5FZ3A 3AKZA 5FO7B 4DXRA 1GZTA 1OD3A 4V2GA 3T0BA 4MGYE 4EM2A 2JA6J 4DEVA 2RR13 5KNLA 3GZTB 2VTXA 4QPOA 1UG2A 1RUE1 3JD72 2BNMA 4N43A 2X29A 4LKFA 1MNMC 3FMSA 1QJFA 1Z77A 5ACA1 2CGNA 2F4PA 3FBYA 3LKJA 2E5ZA 3NO8A 2XPWA 3ZR8X 1H30A 3CJRB 5BPXA 2PX9A 4ASMB 1A04A 3POJA 3WGGA 5GM0A 4LBOA 3OJBA 1W7PD 2RM23 2QYOA 1BI3A 5L36A 4FFFA 5LBQA 2W95A 4IE0A 3HGGA 1RTVA 2MC4A 5B5EC 1US3A 1J2XA 1NG0A 2K9QA 3D0SA 2VKDA 2ZEWA 1CR7A 3BZCA 3FUOA 3KVBA 5D5UB 1YOVB 4RM3A 1UD1A 5D1IA 4Y5SA 3C7JA 3ZPLA 1GR3A 4AU7A 1SFYA 1A8DA 3F22A 3ILNA 2ZNZA 1RJ8A 2DFHA 4YVSC 3WY6A 3JCIA 3J7MA 1TWAJ 1GVJA 1KS4A 4P9JA 2JKXA 3LPGA 5AIQA 4BMEA 2YMZA 3E97A 4L5EA 4XUTA 3LSTA 4LKEA 2DFEA 3RS6A 1NQDA 4EROA 1GQHA 3QOEA 1HQNA 1VBC3 1YYVA 2LVSA 3J7LA 1H1AA 1U2WA 1AL21 1WJAA 2L9NA 3R4DB 3CP2A 2P2KA 4MEXF 2LY9A 1S4CA 1O8SA 2RS52 2MA3A 2D6KA 1X8MA 2VXJA 3Q0VA 2BTVC 3BG3A 5JIAA 4AEDB 2CV2A 1PZ7A 3MI8A 1MMDA 3CDIA 4XLNF 2Y0IA 3THPA 3U11A 4MSVA 2LKXA 1FV2A 4G8XA 4PI0A 3EUAA 1UHMA 3HT1A 1X8EA 1DP0A 4LQRA 4YM1A 3DU6A 3GXOA 1XNDA 2G9ZA 2XV4S 1PVEA 1VQ5I 2LYCA 1FWZA 2WR9A 4DUVA 5A1LA 2R7QA 2X05A 3PFIA 1Y6IA 3M2MA 2L02A 1PX4A 5T50A 1ETXA 4XETA 1OPCA 3FWEA 1D4M2 2EILH 2W68A 4UVAA 3N9LA 3VBRB 4XURA 1MS1A 1LFUP 2QBYB 3NAPC 4FX0A 2X6XA 4C1WA 1I1EA 3N9OA 1A6QA 5IK4A 2IJLA 1UCXA 2ZMEA 1FMWA 1RETA 3AL0B 4AIDA 4W6YA 3VYTB 2QEXI 3CCUI 3ZQHA 1OLRA 2KISA 2MSYA 1XN7A 4IEUA 3SHFA 1AJKA 3NKGA 2HI3A 4WBBA 2X9DA 1SVMA 1EH8A 2XVCA 4G94A 2WLQA 4DZJA 3KGLA 3DBLB 2Y48A 2WSUA 2JA7J 4X0GA 1TQIA 4LORA 4EM1A 2BNNA 3NWKA 4EWEA 1RHI3 4JRAA 4P9FA 3TN91 3I3MA 2ZHNA 1HJGA 3MO4A 2VBDA 2M3AA 3WP4A 1T0FA 5C44J 2QZ3A 1OF4A 4QX0A 3VD7A 3VEPA 3V7CA 3ECQA 4OOIA 2R92J 5LGTA 5FZLA 2IFRA 2HQNA 3S5QA 3KGZA 2A61A 2VLAA 1SD6A 4CDUA 4XHBA 3GF2A 1UY3A 3M70A 4HKLA 2E7AA 4BK5A 4GH4A 3ABMH 2DMPA 4BISA 5FJKA 3U78A 1ND2A 3VBHB 4R1HA 1ZZCA 4L92A 4Q0VA 1OYWA 1SD4A 3OSDA 1LJ9A 5H9RA 4FAHA 2QQKA 3WNPA 4YGEA 2KM2A 3RI4A 1YJNI 1MDMA 1STMA 2QGUA 1MS5A 3DQVC 4F55A 2C26A 2XJPA 2HJIA 4K40A 1LDKB 3PIGA 4QKDA 3T3YA 4QU2A 4PHZA 3K4CA 1E3OC 5FZ8A 4EN6B 5JVTA 1LPQA 5CNAA 4B8EA 4RHV3 5BNOB 4N0BA 3IH4A 1UXZA 2R5YA 4UVBA 2IC1A 4JKMA 1C5HA 1O4ZA 5CA6A 2VJXA 3SXWA 5JLVA 1MEC2 2PHDA 4M0HA 4CYDA 4KNCA 3K4JA 1QQP2 2IBDA 4NIAA 3WCRA 4G7OF 2I45A 1OCOH 2WY7Q 3LD8A 1KU3A 2WFF3 5FXZA 4AQ6A 3AMQA 2QQPA 4HG6B 3WGIA 3OD0A 1K7AA 3BR1A 4ON0A 1YIPA 2R7ZJ 5LBCA 1WPKA 2CU5A 1RUC2 3PL0A 2ZMEC 3IUOA 2BU9A 1TTYA 2JX9A 4GZ9A 4QX5A 4Q4V1 1UY2A 3FXKA 5C71A 3H3UA 4A3DJ 1W9TA 3MIHA 4KH9A 2W24A 5ACA2 4QHBA 5FZFA 2AENA 2AXLA 1TME1 5J96B 5F37A 1PZ8A 4I01A 2QUFA 1YLLA 4TSVA 3WF1A 5LCWL 3VDBA 1AR81 3OGSA 4RDUA 3JSOA 3CDLA 4OAZA 5HS9A 1QDCA 3L1PA 1YO8A 1OR7C 4QB2A 5BNNA 4DGWB 3EDPA 2RQQA 4XUPA 3CLQA 4PF1A 4U88A 2ICWG 4IHXA 4BQ4A 5CYYA 1I3HA 4P5HA 4X1EA 1VE0A 2PFBA 3MLKA 1SDDB 5EGOA 2BGCA 3HWJA 3HOWJ 2ELJA 2HZDA 4AVZA 1LHUA 3I3EA 5FZ6A 1E3HA 3M1CA 3QYBA 3OS2A 4PFPA 3G1MA 3KCXA 1LQ1A 5LA9A 1RYYA 3VD9A 4RS5B 3NWTA 3HJRA 4QX1A 3MV11 4QKBA 2DOEA 5E3NA 1HQLA 4WM7C 1FOYA 4PK4A 1ND2C 1RMU1 4CU7A 5KBFA 4BPZA 3HT2A 2GBYA 4LR4A 1O4XA 1AL22 3GO5A 4LOSA 4UVCA 2ZGLA 4QGMA 3CTAA 3GZAA 1XTAA 3LDKA 5LWBA 3AKTA 1IRFA 4MOAA 4C2UA 2TNFA 4CXWA 1TNFA 2VVFA 4NHMA 2RHPA 5K0UC 1AR92 1X3ZB 5CLSA 3Q9VA 1V6NA 4IDZA 4LG0A 3W59A 1TWFJ 4XOPA 3QQAA 3CP8A 4MGKE 4Q0UA 4TV7A 4RQPA 3VB2A 3PNAA 1VBE3 1WHUA 5K1YA 1DPRA 2GZWA 4DZPA 3KT4A 3HOTA 5IVJA 2MABA 3ZN4A 1TW3A 4XJ8A 3SDBA 1IXSB 2V6EA 1WW6A 1JHHA 2VI6A 4X6RB 4BL0B 2ZZQA 5F7UA 5LHIA 2V72A 3GZNB 3WTUC 1DU0A 4BXFA 1CAWA 4KT6A 2XJRA 5B4NA 2HWB2 3LE0A 2X4HA 4WXDA 4LD5A 1G86A 3ERMA 5CADA 5T3NA 3HM5A 2HDCA 3VDDA 2GLOA 3B9IA 2D43A 1V6LA 2VONA 3KYCB 1XOYA 1RITA 3OOUA 1E5SA 3CMYA 1OUXA 3UKTA 3OGRA 3COAC 2VMIA 1YFUA 2ME6A 2MPFA 4QKFA 3HD8B 2XAGA 4Z07A 4Y7NJ 1NLSA 2DVGA 2CH0A 3O1OA 3BTJA 2ZXJA 2BUKA 3OY8A 5FFZA 3AAFA 3GGLA 2OAZA 4AIHA 2ZGOA 1ETKA 3A4CA 2WZEA 2NVXJ 1MQTA 2TEPA 2E1MC 1OQYA 2IVMA 2QQAA 3DFGA 2F6CA 3VL8A 2EVXA 3TP3A 2JDKA 2DWRA 4NIGA 1J1LA 3TN92 5BQTA 1QVTA 2B63J 2M34A 5FR3A 5BNNC 5D8AC 5LRSA 2BEOA 2TCTA 3CUQA 1S0GA 4GB32 4RD7A 1QQIA 2JRTA 3NV2A 2X10A 2JG9A 2Y33A 4FCYA 1CF7B 3V0AB 2ZX1A 2DYCA 1JKQC 2XLFA 4K7JA 1IDZA 2GH8A 4AC0A 5GADJ 2EV5A 1VBD3 5A3MA 3A0KA 3KP4A 4AGVA 1R71A 2ADUA 3ML6A 5BV6A 1BR2A 1UZWA 5EPAA 5AC93 4K9SA 1OOPA 5JR3A 5FYHA 3ZXGA 1FBSA 1WKYA 4SBVA 1DYKA 1NA1B 5AONA 1X36A 1GSLA 1H2NA 2ARCA 3FMGA 4XONA 2FMDA 1DGWX 2ARXA 2WB1A 2O8QA 1YS7A 4NIDA 3BYWA 3H3VK 1RUD3 4IEYA 2OZUA 1SEUA 3WNMA 1OF3A 4HPKB 3CCYA 4CUAA 1ZG5A 2RV8A 3DPUA 2ZTNA 5C9AA 3WNLA 2PG4A 1E5IA 3ABLH 5K5OA 4HVOA 2XVGA 4J01A 5DUIA 1NY71 1AYM1 1B35A 1LOGA 3HJEA 2E7TA 5JOXA 3MGUA 2IRFG 5ILUA 3MLJA 2O14A 3AKPA 3ZN1A 2K86A 4OI4A 4JYKA 3ULQB 1JOPA 3VFZA 5FZAA 3AYDA 1WMFA 4LBMA 4D0QA 2FZ2A 4K1ZA 3AYCA 2PYTA 1FNNA 2XAFA 1ULGA 4ASKA 2A7AA 5KHIA 3RZMA 3DEWA 3REOA 1ZLJA 3JZVA 4MXWA 5FQ0A 5J4YA 4BE1A 5EDNA 1WUVA 2BOJA 1KFUL 4MGIE 2XB6C 3EXUA 3I56I 3WG9A 1RUG3 3OPTA 1ZELA 3AVRA 2HYKA 4OUMA 1D2QA 1K3IA 2GIZA 4JDOA 4OIPF 4ARYA 1O7LA 1QA6A 5FKBA 4Q4V2 3LA3A 3WDYA 3FXMA 4IQPA 5JLWA 2XASA 4BE0A 1XE7A 3T09A 1YEWA 1TME2 5LBBA 3IN9A 3I3LA 3U1DA 5IW0A 1MQTC 2JDHA 1G6NA 1W9WA 5LK7B 4RFRB 5SV8A 3OL3A 4MYEA 3VBUB 2KZGA 5CG9A 3EPZA 3E6CC 1FLIA 4WVVA 1J3QA 1BEV1 2YBPA 2RNJA 2YY1A 2F5DA 4Y15A 1J58A 3GCMA 4NC8A 4UY8I 2BW8A 2Y9YA 2P3YA 5L9RA 4MX3A 4D7SA 2VZTA 5J47A 4B44A 2VAUA 4KBBA 2JG9C 5FYUA 4S2FA 2A6ZA 1PDNC 4RAZA 4AF9A 4KQ7A 4NBQA 3QCWA 1ZZBA 4RAYA 1DZQA 3HSRA 4YRVA 3IIAA 3JXSA 1H9WA 3H1YA 3BT9A 3PUAA 5FZKA 3DF8A 2RS31 3CJXA 3L2WA 1J59A 1A6IA 2V1UA 3EO6A 4FX4A 4UFHA 1KQRA 5JXIA 3ZN6B 1G9FA 1K83J 2FCVA 2WT1A 3UYJA 3L2QA 1MBGA 3AFKA 1XDSA 3K77A 4IQJA 2HFHA 3K4DA 4FP3A 1QBJA 2IXHA 2EA4A 2A6WA 2VPLA 3OYLA 1G9AA 1HF0A 2DJNA 4A6SA 1G7YA 3PTYA 2D44A 4N7IA 2PHWA 2FDHA 1JI8A 5FJ8J 4YW6A 1AYN1 1D1AA 4AVPA 3TRSB 1H2MA 3GFJA 3M4OJ 4KFCA 4KIFA 5K4LA 1VZ0A 2G7HA 2O5RA 4QGNA 1K45A 4WM8B 4UW4A 4M3EA 3LSGA 2Q5TA 4WVWA 5IWFA 3OYNA 1ZVFA 3WP3A 1WLTA 4A3XA 2Q8CA 4COZA 2R1DA 2CQQA 3VYUB 3DXTA 3ACFA 1RJ7A 2XUMA 1NG7A 5E89A 2GC1A 2JK3A 1ZGWA 3IDEA 3PU3A 5FP4A 3SZPA 1IS5A 4KGQA 2VE1A 1XYPA 3HSEA 2QCSB 4QQOA 3SEQA 2C4XA 4MGRA 2RE9A 5HCBA 4EZHA 3CQOA 3ETQA 2A73B 2BJSA 5F2SA 3THCA 4DJAA 2IP2A 3ACLA 4ZYAA 4EZ4A 3PU8A 4R52A 4BXXJ 5CG8A 1XPWA 1YIOA 4JGYC 3CJIA 4G12A 2EXIA 1PUFA 4NWVA 1XMXA 1FYUA 4WXCA 2IGOA 1GUUA 2XB0X 2DT7B 2DTZA 3F8FA 4FPHA 2DMQA 4IE4A 4LGWA 2JVGA 1XU2A 3KLNA 3OTFA 2VZ3A 2J1UA 2MEV3 2BGPA 1VP6A 1SBEA 1QPIA 3LSDA 4Q0QA 1YFYA 2VBXA 1GMMA 4Q1RA 4XF1A 3WU0A 2HWE1 4H7MA 3TKYA 2EV6A 2P34A 2VU9A 2VJIA 1ZBE3 5F8PA 3GFIA 2NPIA 3KV5A 2AREA 3KP5A 1CPNA 1YG2A 2R0QC 4Q47A 4XEZA 3VKNA 2OTLI 3M3IA 4FETA 4CCJA 5J37A 2VXDA 2WS92 3IAS2 2A05A 4N90A 1DU6A 3PMSA 1J75A 3VL9A 3D6EA 1W6OB 2NYXA 3ISPA 1POGA 3GF6A 5LY2A 4K20A 3ZYFA 1AX1A 3H0GJ 2IVJA 4ZDPA 3T4HB 1S0FA 5FK8A 2P6TA 2E1NA 5T54A 3T0DA 4B1LA 2YROA 5LFAA 3WG3A 2KT0A 1SBDA 2PMZA 1SVOA 3P5JA 3VHNA 4KUMA 3TW7A 2STWA 2MBFA 3BPXA 3S2WA 1EH6A 1BIBA 2LY2A 1SPPB 2PXJA 3JB4C 4SLIA 5CB7A 2DVAA 2ZJ2A 3JR9A 1N1SA 1WCSA 1AX2A 4NHXA 5CQGA 1SAUA 1VF9A 3SCHA 2V26A 4IESA 5F6LB 5HLIA 1XGSA 2EIGA 2Q0AA 2FDFA 1O3TA 2QE3A 2B39A 4Q5OA 4OFGA 2P8TA 2VUJA 2FMLA 4CHUA 5BNQA 4AEDA 5E3OA 2QKLB 3ZQ7A 2HWF2 1E5HA 2Q4SA 5GJ6A 3FLRA 3POSA 3G6JB 2LROA 1X33A 1QEXA 4RGSA 2UWBA 3ROUA 4ZYDA 1CWPA 4F3QA 2EJRA 1YIJI 2FD5A 4E7LA 2VUCA 3F8MA 2DMNA 4I2OA 5L3EA 5J48A 2IW5A 1Y1WJ 2BWCA 3PTRB 3U9GA 4YG0A 2QQBA 5K7PA 3NARA 4HVQA 4V1PA 1GT0C 2KMUA 4BU2A 1G8WA 2EB7A 3NQOA 2ZO4A 1O91A 1JJ8C 4N4NB 2QBYA 4HBNA 1LFBA 1B1BA 2Y6LA 4QB6A 4LLFA 3DTIA 1U5TB 2RS12 1MBKA 1BEV2 2HNHA 2EXJA 4NC6A 3BU0A 3BOQA 3U1XA 2VQLA 1HW5A 1ULPA 2WT0A 3LA7A 4HG2A 4NROA 2UYAA 5LHHA 3IC7A 3BR5A 1XYNA 5IY5H 4A42A 3JAMK 3OEAA 3W2AA 4AAXA 4E9KA 1PO23 4Q8LA 1PYVA 3I4PA 4A41A 1OCCH 3OF1A 1MJAA 2AEZA 4GCVA 2V79A 4N53C 3RMYA 1VTNC 5C8WA 3Q0UA 4Y5TA 2A3WA 2OUHA 4GWJA 5IAXA 1UOGA 3WSOA 1RUI3 1TG7A 3CESA 3I3BA 3OOXA 5FWJA 4UT5A 2B7YA 3WW3A 4M3CF 3NNLA 2WY8Q 1KD7A 3BJOA 3MHZA 3B9CA 1T6GC