3D0ZA

Structural charcaterization of an engineered allosteric protein
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
214
structure length
214
Chain Sequence
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGHEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase class-mu 26 kDa isozyme
publication title Using affinity chromatography to engineer and characterize pH-dependent protein switches.
pubmed doi rcsb
source organism Schistosoma japonicum
molecule tags Transferase
total genus 68
structure length 214
sequence length 214
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2008-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3d0zA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3d0zA01
2GZZA 1SYXA 3FZ4A 4ML6A 1X0RA 3CTFA 2CVKA 1S3DA 1W4VA 4ZB9A 3F4TA 2YZHA 3F8UA 4TOPA 2DJ2A 2PUKC 2E0QA 3LGCA 5ECRB 2V2GA 1XOAA 2L59A 2DJ3A 2IPAA 2MBSA 4K0NA 3I69A 4RQRA 1SYRA 3ME7A 2JZRA 1SKWB 2N5FA 5DALA 4XRAA 4CW9A 1JZOA 3F63A 4BVXB 5AISA 1N2AA 5KEJA 2VCWA 3O6TA 4AF2A 4PQIA 1M0UA 2RM6A 2FWHA 2I81A 5DJLA 5DBQA 1WPIA 2RLIA 4GWRA 2WZ9A 2AV4A 1PL2A 3GFKA 1A24A 1KEBA 2C0DA 1EZKA 2B6MA 3W8JA 2XC2A 2H0HA 1BYEA 3WGEA 2O7KA 3FY7A 4OWYA 1A8LA 4WBRD 3UIWA 3D6IA 3WT1A 1A2MA 1FB0A 4XIHA 3CMIA 4LL1B 3GN3A 2FGXA 3VWWA 3GKXA 4JBBA 1WMJA 11GSA 2K6VA 3H4KA 4OCFA 5LNKe 1TW9A 1YQ1A 4OD7A 5ECLB 3M9JA 4DSSA 3UEMA 1BQ7A 2HI7A 3GRXA 4MMMA 1TRWA 4ILFA 4P3YB 2V41A 1X5EA 3GL3A 5ID2B 4EO3A 4EDYA 12GSA 3CBUA 2EIQA 3QFBC 4GSSA 3TKSA 3DD3A 3RHBA 1U87A 6GSYA 1Z7PA 1EV4A 1TI3A 4NV2A 5ECIB 2L57A 1X5DA 3H8QA 3GYKA 2OKAA 3BOAA 1XWBA 3IRAA 2TIRA 1YF0A 2A2RA 3GX8A 2C0EA 1ERVA 3LG6A 4HUAA 4D73B 4KDXA 2H0IA 4EL1A 4IVFA 1GTBA 3EYTA 1PMTA 1GSUA 4NHWA 3ZMLA 5DAKB 4G19A 2ON7A 3LXZA 3FZ9A 4ZB6A 3V1WA 2YWMA 2LRCA 4PNFA 4RUVA 3KXOA 4DVCA 2L5LA 1V2AA 2GZYA 3IR4A 4G0IA 1HNAA 3VURA 2L5OA 1ZMAA 2MMNA 2NPBA 2I3YA 1GTUA 4RI6A 1T3BA 3C7MA 4MZWA 1E2YA 1OKTA 3HD5A 2LQQA 1SL0B 4KCEA 4KDYA 2CT6A 3VFIA 1OVNA 2C4JA 4HZ4A 1UN2A 3HJPA 2K18A 4MF5A 2WJUA 1SKSB 1ABAA 5F0GA 4IJ3A 4GLTA 1BG5A 1M2DA 1WOUA 1MDKA 3M0FA 4LMVA 4KA0A 5ECMB 4PUAA 3TJKA 3CSHA 3IAM2 1TRVA 3ED3A 1XIYA 1K3OA 1V58A 4XS4B 1JZRA 2DMMA 4XRDA 3DGQA 5G30A 1F6MC 1MDJA 1WIKA 4TXOB 4QL7A 2UZ8A 1W89A 3RBTA 1FW1A 1O81A 1SK1A 4MCUA 5IIZA 3IK7A 1GNEA 4G9HA 3GA4A 3C71A 1X5CA 3ZIJA 1AW9A 3CSJA 3EURA 2VL2A 4WR5A 3LXTA 4JEDA 3ZRDA 1G6WA 1FOVA 4MZBA 2K9FA 3CRTA 1B9YC 4EC0A 2V6OA 3LJRA 5ELAA 2F3MA 4LA1A 1B48A 2AHEA 3IBHA 2CVDA 1OC9B 3Q6OA 1ON4A 3L9UA 4Q5RA 1J0FA 4NV5A 5AIXA 3QR6A 4IBPA 2VCTA 5EY6A 1EGOA 3HY2A 3ZITA 2HT9A 1PKWA 3BJ5A 1LBKA 3FHKA 1TDIA 5CP1A 4PTSA 4JE1A 2BTOT 1F2EA 5ECOB 2HNLA 3FZ5A 2N5BA 3D0ZA 3KH7A 3M3MA 5DQYA 2H1BA 3DWVA 3TRQA 4PXOA 3VWUA 2M46A 4RI7A 2DJKA 3C8EA 1OKDA 3S9FA 5HFIA 1GTAA 4OFMA 1EV9A 2X8HA 2HZFA 4WETA 2WFCA 1XPVA 2HSMA 2VAFA 2C8UA 4IW9A 3ZFBA 1AXDA 1TRUA 1GSSA 2HRKB 1PX6A 3L4NA 2R6KA 2GSSA 1YEXA 5D93A 2LTKA 3LFLA 1YKCA 1B9XC 5L71A 1AQVA 4J56E 3KP8A 2WS2A 1O7UA 6GSWA 2LJKA 3IV4A 5CRDA 5F07A 5F8BA 1TJDA 3MAKA 4I6XA 4TN8A 3TOUA 1JZDA 3LSZA 4PX1A 2VL3A 5D9VA 4ECBA 5IMCA 2C3QA 4L0UA 3IAS2 2H66A 1Z9HA 3C1RA 5DQSA 4I2UA 3U5RE 3KMNA 5IMFA 1VF3A 2V1MA 5ECNB 5ECSA 2ZNMA 4Q5NA 2I1UA 5J3RA 4OO5A 3UMAA 3I6AA 1GL8A 1MDIA 3KD0A 3LORA 2QSIA 1U6TA 1XCCA 1JZWA 1XZOA 2GDRA 4F9ZA 1PSQA 1SKRB 1ZOFA 3IXRA 1TXXA 4QQ7A 4WR4A 3WGXA 1JFUA 3ZIVA 3KJYA 5DCHA 5DVBA 1PKZA 4TR1A 2LQOA 1Z6MA 4MH3A 2GT5A 2GQLA 2QGVA 1X9MB 4MJCA 4KAEA 3FW2A 1ZL9A 2KP2A 2KHPA 3ME8A 3GUSA 2RIIA 2YOIA 3DXBA 2H19A 1K0BA 3Q74A 2LRNA 4HZ2A 1GUHA 3P90A 4G0KA 2YWOA 1MD4A 2G2QA 13GSA 2LV3A 4K1FA 4KUNA 3F3QA 1ST9A 3BBYA 4YAPA 3H93A 4GSNA 3CSIA 1BEDA 3FR9A 2DLXA 1MD3A 1GSEA 3IA1A 1TU7A 2GSQA 3D4TA 4NHZA 4TR3A 4FIWA 1ACVA 4MPGA 4IP6A 2GLRA 5LD0A 4KF9A 2C80A 1S3CA 4KNDA 2VM1A 3BCIA 1AAZA 4O7HA 2PPTA 2ZUPA 4GQCA 4JR4A 1O8WA 3TUEA 4X1UA 1K0DA 2M80A 4K6XA 5GAND 1IYIA 1DSBA 1U3AA 2AB6A 3UVHA 2NVLA 2C0FA 1U3IA 3A2XA 5GSTA 1QGVA 4F82A 3TRPA 1HD2A 2JZSA 1J08A 3GH6A 3MDKA 4N0VA 7GSSA 2JSYA 1XW5A 1XWAA 1TK0B 4BL7A 1QUWA 2HZEB 2CAQA 3ERWA 3SWLA 1X9SB 2H76A 3F6FA 1G0TA 2NDOA 1E6BA 4IN0A 3UOMA 2CV4A 1V98A 4GXZA 3D21A 5D9WA 1GSDA 1OE7A 3FRCA 4DSRA 4ECCA 4PURA 4ZXGA 3HJMA 4ZB8A 1I5GA 2IFQA 1BAYA 4PGTA 1UVZA 5IMVA 2H0GA 5J9BA 2TRCP 2L4QA 4BVYA 4KW6A 1PRXA 4EXJA 4K0GA 5CRWA 1EWXA 4WKWA 3UARA 2RUFA 3NIVA 4POKA 2CZ3A 3C73A 4NPBA 3QAGA 3JCML 5HFKA 1G7EA 4G10A 1GLPA 4KSMA 3KTLA 20GSA 17GSA 4L8EA 4KDUA 1URMA 3EWLA 3PH9A 4IP1A 3WGDA 1M2AA 1ML6A 1HNBA 3KZQA 4MJAA 3ISOA 1WWJA 1F3AA 2GGTA 2DMLA 2IN3A 4DSQA 4N11A 2P0GA 4GSTA 3NOFA 4OFNA 4N10A 2OA7A 4POLA 3F3RA 2YN1A 2DJ0A 1GUMA 4K7IA 3GNJA 3KCMA 3PR8A 3MSZA 3ZYWA 1DBYA 2KOKA 4TVEA 3QAVA 3W6GA 4WF4A 2FWEA 1SK0A 5HQPA 3GIXA 3FR3A 2JSZA 3GTUB 2H74A 4K7NA 4FYCA 1Z3EA 3TJBA 2CVBA 1KTEA 2XBQA 2E7PA 5G5EA 3CTGA 2HSNB 5G2ZA 2IMFA 5IMAA 5IMZA 2AAWA 3EE2A 2VLTA 1TRSA 1MTCA 5J4UA 2PVQA 5A5KA 3L78A 1QK8A 1F3BA 1ERWA 2LNSA 4MJEA 4FQUA 1B4PA 2H73A 3ZZXA 1AQWA 18GSA 2O87A 1PX7A 4J2FA 3ZMKA 2H1GA 5HFGA 5KN3A 4HI7A 2H01A 1V9WA 4EF0A 1ILOA 5CAXA 3GSTA 2AUVA 5B6NA 1K0NA 3WD6A 3QMXA 4I8BA 2C3NA 2H6ZA 4WF5A 2YWIA 2R4VA 1HQOA 5LCZA 4L5LA 5CO3A 3GKMA 4F0CA 1AIUA 3KP9A 2LKUA 4V2MA 2HYXA 3HA9A 4XCSA 2XPDA 2MMAA 4AJ7A 4I97A 4Z7XA 1EOHA 2G0FA 3GMFA 3A2VA 3DVWA 22GSA 4MJBA 1T8EB 2GZPA 2GSRA 1V57A 4O32A 1USBA 2H8LA 4TR0A 2LS5A 5HR2A 5KN1A 1SU9A 2XHFA 3FYGA 4USSA 3BCKA 4GTUA 4O5RA 2QKEA 1GSYA 4ZL7A 2DIZA 2PERA 3O3TA 3ZLPA 1YKAA 4EDZA 3LWAA 2Z9SA 5JCUA 2OE1A 2P5QA 4IS0A 3D22A 2VD1A 4LLRA 3VI7A 4AJ6A 2I4AA 2VIMA 3ERGA 4I2TA 2FD3A 3F9UA 1K0CA 3EVIA 1N8JA 2JU5A 4BVXA 5E4WA 4PUFC 1ZYQB 4YAVA 5ECHB 1A2LA 3DKSA 3QCPA 1SJ6A 3RHCA 2RUEA 2L6CA 1SL1B 2H70A 3APQA 4KGIA 3TKRA 2MMZA 4EE0A 1S3AA 2C1YA 3IHQA 3TCOA 9GSSA 3DMLA 4X43A 1H75A 5C00A 3VWXA 1TTZA 3WYWA 4K2DA 5DALB 1A23A 1GH2A 2HSYA 4HS1A 3DEXA 3HZ8A 3KH9A 5KN2A 2LJRA 3I9V2 3MWHA 4V2LA 3DVXA 1C72A 1SD9A 2K8SA 5J9CA 3HXSA 5IPGA 2NBSA 2ON5A 1SD8A 2QC7A 2KP1A 2HLSA 3DYRA 1NSWA 2DC5A 4MF7A 1TK5B 4YH2A 5IM9A 5IQYA 3KGKA 4IGJA 2B3SA 2FUG2 3TGZA 5ID2A 3VPQA 3TKSE 1Q4JA 3GL5A 3HDCA 4BPYA 2YNXA 4F03A 2H30A 3PPUA 2FA4A 3HJOA 1VGLA 1WJKA 3GX0A 1GULA 5HR3A 2FNOA 4BWQA 2GQKA 4BA7A 3HYPA 5ECKB 4PNGA 4BWSA 5G31A 4MP4A 4DSSB 1I9DA 2KUCA 4MH2A 5FT3A 3EINA 1K0OA 1XVQA 1NM3A 1FVKA 2YV9A 3APOA 3TDGA 1ERUA 5D8IA 1EOGA 1R7HA 5BMUA 2PVOC 3HVSA 4FYUA 2L4CA 1T00A 1K3LA 5G1LA 4JR6A 4QL9A 4D73A 3HHVA 2YANA 2H1AA 1M99A 4MF6A 3TOTA 5B7CA 2B5XA 2IL3A 5FWGA 2PN8A 2N5AA 3W8SA 5AIVA 2JADA 5DAKA 2E2MA 1PD21 4MDCA 2F51A 1SK2A 3IC4A 4ZIJA 2YJHA 3TKPA 1QXHA 3RAZA 1Z5YE 5DJMA 4AGSA 2VL9A 3E3EA 2CZ2A 1NW2A 2ZCTA 10GSA 2EIOA 1NHOA 1XWGA 2X8CA 5D9XA 4KH7A 3J7Yb 3R2QA 2P5RA 3M1GA 1PQNA 4ECIA 4J57E 2LUSA 4ZBAA 3WT2A 1M2BA 2PWJA 3GSSA 1G7OA 1YEPA 4ULXA 3VK9A 4ID0A 1RK4A 1ZZYA 4H86A 2GSTA 3U6VA 2ES7A 1GSQA 2B7JA 1F37A 1OE8A 2VCXA 1T4ZA 1Y25A 3MNGA 4ACSA 2H75A 4KSOA 2F8AA 3N5OA 1A0RP 4XS4A 1BJXA 4V1Ag 3CRUA 4K8MA 2E2GA 1GRXA 3L0HA 4XTSA 1JHBA 1TP9A 2LRTA 4TXOA 4ISDA 5HR0A 3QD9A 3RPNA 2H71A 3D5JA 4NAXA 4EVMA 1RQMA 2VUPA 2PU9C 3G7IA 1RW1A 4ZBBA 5KN0A 2AYTA 1A0FA 4TW5A 3F0IA 5F06A 3KMOA 1WP0A 1THXA 1T4YA 2A4VA 2FA8A 1XVWA 3A5WA 3VI5A 2AJQB 3IE3A 5ECQB 1BX9A 2O8VB 4FH8A 6GSVA 4WEYA 1K3YA 4GQFA 4XHMA 3D4MA 3GV1A 3I43A 2XBIA 3M9KA 5DDLA 5D9TA 8GSSA 1OC9A 2OJLA 5EL8A 1PN9A 4YQVA 3HVVA 1O73A 3GHAA 4IJIA 4LL4B 3F6DA 5FHIA 1Y6EA 2FWFA 2YWNA 4DEJA 5ENUA 2WB9A 3VLNA 1ZCPA 2X99A 1TU8A 4MABA 3KEBA 2IMIA 1XOBA 1ZGNA 1R26A 2O89A 2H72A 1WRYA 2RM5A 5EPFA 3APSA 6GSXA 1JLWA 2A2SA 5IO0A 3UJ1A 2B1LA 3ZREA 4MLYA 5F05A 3QAWA 2EC4A 5ECPB 2WRTA 1UC7A 19GSA 3GURA 3PGTA 1YY7A 5B6MA 1EP7A 4TRXA 2GTUA 1B4QA 2HRKA 3TKSC 4NWYA 3F4SA 2VCQA 4L0WA 1EGRA 2CAIA 1SJZA 4HJMA 3BD2A 2IWTA 1VF1A 1ZYEA 1O85A 4KCAA 2DSAA 3VWVA 4EUYA 5IMDA 2GQMA 3ZFLA 5E59A 2VO4A 4HOJA 2PGTA 4POBA 2HSMB 2WGRA 4PQ1A 1TKDB 4LMWA 5IO2A 3US3A 2YCDA 4HEA2 4ZILA 2R5GA 3UAPA 3P8WA 1F9MA 1GP1A 3C1SA 3FZAA 3E0UA 4X0XA 2V6KA 2FLSA 5H5RA 5J41A 5CYYA 2VCZA 4OCEA 2MZCA 4EKZA 5B8BA 4F2IA 1Z7RA 4E8HA 2OE3A 4GCIA 1XBSA 1A8YA 2O85A 5CRGA 3LEFA 2REMA 4HU9A 3TRXA 4ECJA 2B5YA 5D96A 5A4UA 2HQTA 2JACA 3Q19A 2BJXA 3G7YA 4XS6A 2D2ZA 3DRNA 3ZVJA 2LEGA 5DCGA 1XWCA 1WE0A 3DIEA 5JCGA 1R5AA 4JU5A 5HR1A 1O8XA 2EIRA 5CREA 2ALBA 4N0ZA 4K9ZA 2B1KA 4KB3A 1FO5A 1OAZA 1EEJA 2J23A 3A2WA 3IDVA 1M9AA 3Q18A 3HKRA 2VOCA 1NHYA 4MK3A 1FVJA 1DE1A 4OMVA 5GZZB 2R2JA 3EU3A 3O76A 4GF0A 3ZL5A 1VF4A 2HXKA 4TR1B 2MMOA 3GH9A 3R3EA 1LJRA 2VLVA 3HZ4A 5B8AA 5H5SA 1PA3A 1AUCA 3LYKA 1SJIA 4IQ1A 1CQHA 2CA8A 4NMUA 3L9SA 3IPZA 2DIYA 1GSFA 4WXTA 1TI1A 3G9BA 2YP6A 1GNWA 3IK9A 4IELA 2VL2C 4FYBA 3RPPA 4TR4A 2R37A 4JZQA 2I9HA 5A4WA 1J9BA 3EC3A 1TK8B 2C0GA 1CQGA 1FB6A 2TRXA 2OBKA 3UL3A 4HU7A 2CX3A 1XFLA 4KX4A 3IOSA 2DBCA 2K8VA 4MPFA 5JCWA 3QOUA 2HE3A 4ZBDA 3SBCA 3EMPA 6GSUA 3EU4A 4XS1A 2YJ7A 1K0AA 1YJ6A 3KM6A 4IHUA 3UBKA 5AGYA 2HZEA 4CHSA 3FKFA 2IMDA 4NXIA 2OBIA 2LNTA 2VLUA 4YQUA 3IC8A 3FK8A 3H79A 1XW9A 2HSHA 3VPTA 1TOFA 4GRFA 2HRNA 5CNWA 3N9JA 2X8GA 2JZTA 4K7OA 2B7KA 3QPMA 1LU4A 1XXUA 3G7JA 2MYGA 2C3TA 3P7XA 1Q98A 2GVPA 4POMA 1AC1A 1V40A 1SL2B 2VCVA 3K8NA 3UBLA 1DUGA 5H5QA 5J5NA 4BL7B 2YV7A 4L5OA 1HYUA 2WDUA 5COHA 1KNGA 1HNCA 3GKKA 1PGTA 4HDEA 2IFQB 2IMKA 3EMXA 1QMVA 5ELGA 2F9SA 6GSSA 2H1DA 2B5EA 1B8XA 2CQ9A 3M8NA 2H6YA 2GT6A 2HRAA 1GTIA 1SENA 4BVYB 6GSTA 4KE3A 2DJJA 3A3TA 4AJ8A 5IOWA 2FHEA 3QDNA 1R4WA 4JRRA 1A2JA 2M72A 3CXGA 4HQZA 5GAPD 5JWRB 1QFNA 4WBJA 3J7Yk 5JWQB 4IKHA 5IPHA 1THOA 5C04A 3RDWA 3FR6A 1GLQA 1FAAA 2IJYA 1ERTA 1R5PA 2GS3A 4ZL8A 5AN1A 2HRFA 1OC3A 2J9HA 2OACA 4PQHA 4IQAA 3KIJA 2F8FA 2YPMA 3GTUA 2MBTA 4RQXA 4Q5FA 1VRSD 1YDKA 2OE0A 3TJFA 1XW6A 2NTOA 3H1NA 2IIYA 2H6XA 2FY6A 5GSSA 1EEMA 1K0MA 5D73A 4E8EA 2PMTA 2VD0A 3HCZA 2LJAA 1X9WB 4MA9A 4O92A 1QQ2A 2BMXA 1PL1A 2XPEA 1H4OA 2PBJA 4V1Ap 4ML1A 2WCIA 2KLXA 3E9JB 4F0BA 3LYPA 1JLVA 1OYJA 2HFDA 2DJ1A 5ABRA 1Z6NA 3CYNA 5INYA 2WULA 2JL4A 3FEUA 1G6YA 5A4VA 2X64A 3LQ7A 3TKQA 3ERFA 4HQSA 2IMEA 4ZL9A 1GUKA 2FWGA 1U88A 3UVTA 3L9VA 14GSA 4FO5A 1GWCA 2FCHA 1T1VA 3TJJA 4TKYA 16GSA 4HJ2A 4G0LA 1EP8A 1M9BA 1FHEA 1T7PB 2CX4A 4Q5QA 5JWOB 3HVXA 3ZVJD 5G1KA 3KTBA 2YZUA 4MZCA 1AQXA 3GKNA 1XWKA 2P31A 3TJGA 3QFAC 1M7TA 1VF2A 3ZTLA 5IOXA 4OFTA 4OO4A 2LSTA 4YQMA 3AY8A 1YZXA 1MEKA 1O6JA 4TXVA 3PINA 4V2NA 1DE2A 4N30A 3NZNA 3OR5A 3F4RA 5EVOA 1IYHA 5CRHA 2R3XA 3P2AA 4I5QA 2V32A 1OC8A 3TB2A 2OADA 1KBNA 1FG4A 1YF1A 1UA5A 2VM2A 2L6DA 5G5FA 4CDOA 4G2EA
chains in the Genus database with same CATH superfamily
2GZZA 1SYXA 3FZ4A 4A5PA 4ML6A 1X0RA 3CTFA 2CVKA 1S3DA 1W4VA 4ZB9A 3F4TA 2YZHA 3F8UA 4TOPA 2DJ2A 2PUKC 2E0QA 3LGCA 5ECRB 2V2GA 4PHZC 1XOAA 2L59A 2R0CA 2DJ3A 2IPAA 2MBSA 4K0NA 3I69A 4RQRA 1SYRA 3ME7A 2JZRA 1SKWB 2N5FA 2O3EA 5DALA 4XRAA 4CW9A 1JZOA 3F63A 4BVXB 1I1IP 5AISA 1N2AA 5KEJA 2VCWA 3O6TA 4AF2A 4PQIA 1M0UA 2RM6A 2FWHA 2I81A 5DJLA 5DBQA 4AKGA 1WPIA 2RLIA 4AI6A 4GWRA 1YVLA 2WZ9A 2AV4A 1PL2A 3GFKA 1A24A 1KEBA 2C0DA 1EZKA 2B6MA 3W8JA 2R0GA 2XC2A 2H0HA 1BYEA 3WGEA 2O7KA 3FY7A 4OWYA 1A8LA 4WBRD 3UIWA 3D6IA 3WT1A 1A2MA 1FB0A 4XIHA 3CMIA 4LL1B 3GN3A 2FGXA 3VWWA 3GKXA 4JBBA 1WMJA 11GSA 2K6VA 3H4KA 4OCFA 5LNKe 1TW9A 1YQ1A 4OD7A 5ECLB 3M9JA 4DSSA 3UEMA 1BQ7A 2HI7A 3GRXA 4MMMA 1TRWA 4ILFA 4P3YB 2V41A 1X5EA 3GL3A 5ID2B 4EO3A 4EDYA 12GSA 3CBUA 2EIQA 3QFBC 4GSSA 2H1LA 3TKSA 3DD3A 3RHBA 1U87A 6GSYA 1Z7PA 1EV4A 1TI3A 4NV2A 5ECIB 2L57A 1X5DA 3H8QA 3GYKA 2OKAA 3BOAA 1XWBA 3IRAA 2TIRA 1YF0A 2A2RA 3GX8A 2C0EA 5BMUB 1ERVA 3LG6A 4HUAA 2A4HA 4D73B 4KDXA 2H0IA 4EL1A 4IVFA 2WVXA 1GTBA 3EYTA 1PMTA 1GSUA 4NHWA 3ZMLA 5DAKB 4G19A 2ON7A 3LXZA 3FZ9A 4ZB6A 3V1WA 2YWMA 2LRCA 4PNFA 4RUVA 2DKHA 3KXOA 4DVCA 2L5LA 1Y1UA 1V2AA 2GZYA 3IR4A 4G0IA 1HNAA 3VURA 2L5OA 4CY8A 1ZMAA 2MMNA 2NPBA 2I3YA 1GTUA 4RI6A 1T3BA 3C7MA 4MZWA 1E2YA 1OKTA 3HD5A 2LQQA 1SL0B 4KCEA 4KDYA 2CT6A 3VFIA 1OVNA 2C4JA 4HZ4A 1UN2A 3HJPA 2K18A 4MF5A 2WJUA 1M3IA 1SKSB 1ABAA 5F0GA 4IJ3A 4GLTA 1BG5A 1M2DA 1WOUA 1MDKA 3M0FA 4LMVA 4KA0A 5ECMB 4PUAA 3TJKA 3CSHA 3IAM2 1TRVA 3ED3A 2A2PA 1XIYA 3MYDA 1K3OA 1V58A 4XS4B 1JZRA 2DMMA 4XRDA 3DGQA 5G30A 1F6MC 1MDJA 4PI0C 1WIKA 4TXOB 4ZB7A 4QL7A 2UZ8A 1W89A 3RBTA 1FW1A 1O81A 1SK1A 4AKIA 4MCUA 5IIZA 3IK7A 1GNEA 4G9HA 3GA4A 3C71A 1X5CA 3ZIJA 1AW9A 3CSJA 3EURA 5A1NB 5KOWA 2VL2A 4WR5A 3LXTA 1ZYNA 4JEDA 3ZRDA 1G6WA 1FOVA 4MZBA 2K9FA 3CRTA 1B9YC 4EC0A 2V6OA 3LJRA 5ELAA 2F3MA 4LA1A 1B48A 2AHEA 3IBHA 2CVDA 1OC9B 3Q6OA 1ON4A 4K5SA 3L9UA 5BRTA 4Q5RA 1J0FA 4HSCX 4NV5A 5AIXA 3QR6A 4IBPA 2VCTA 5EY6A 1EGOA 3HY2A 3ZITA 2HT9A 1S3RA 1PKWA 3BJ5A 1LBKA 2OT3A 3FHKA 1TDIA 5CP1A 4PTSA 4JE1A 4N3ZA 2BTOT 1F2EA 5ECOB 2VKZG 2HNLA 2DKIA 3FZ5A 2N5BA 3D0ZA 3KH7A 3M3MA 5DQYA 2H1BA 3DWVA 3TRQA 4PXOA 3VWUA 2M46A 4RI7A 2DJKA 3C8EA 1OKDA 3S9FA 5HFIA 1GTAA 4OFMA 1EV9A 2X8HA 2HZFA 4WETA 2WFCA 1XPVA 2HSMA 2VAFA 2C8UA 4IW9A 3ZFBA 1AXDA 1TRUA 1GSSA 2HRKB 1PX6A 3L4NA 3CQFA 2R6KA 2GSSA 1YEXA 5D93A 2LTKA 3LFLA 1YKCA 1B9XC 5L71A 1AQVA 4J56E 3KP8A 4Z2UA 2WS2A 1O7UA 6GSWA 2LJKA 3IV4A 5CRDA 5F07A 5F8BA 1TJDA 3MAKA 4I6XA 4TN8A 3TOUA 1JZDA 3LSZA 4PX1A 2VL3A 5D9VA 4ECBA 5IMCA 2C3QA 4L0UA 3IAS2 2H66A 1Z9HA 3C1RA 5DQSA 4I2UA 3U5RE 3KMNA 5IMFA 1VF3A 2V1MA 5ECNB 5ECSA 2ZNMA 4Q5NA 2I1UA 5J3RA 4OO5A 3UMAA 3I6AA 1GL8A 1MDIA 3KD0A 3LORA 2QSIA 1U6TA 1XCCA 1JZWA 1XZOA 2GDRA 4F9ZA 1PSQA 1SKRB 1ZOFA 3IXRA 1TXXA 4QQ7A 4WR4A 3WGXA 1JFUA 3ZIVA 3EPTA 3KJYA 5DCHA 5DVBA 1PKZA 4TR1A 2LQOA 1Z6MA 4MH3A 2GT5A 2GQLA 2QGVA 1X9MB 4MJCA 4KAEA 3FW2A 1ZL9A 2KP2A 2KHPA 3ME8A 3GUSA 2RIIA 1TXUA 2YOIA 3DXBA 2X4AA 2H19A 1K0BA 3Q74A 2LRNA 5A5HB 4HZ2A 1GUHA 3P90A 4G0KA 2YWOA 1MD4A 2G2QA 13GSA 2LV3A 4K1FA 4KUNA 3F3QA 1ST9A 3BBYA 4YAPA 3H93A 4GSNA 3CSIA 1BEDA 3FR9A 2DLXA 1MD3A 1GSEA 3IA1A 1TU7A 2GSQA 3D4TA 4NHZA 4TR3A 4FIWA 2UV8G 1ACVA 4MPGA 4IP6A 2GLRA 5LD0A 4KF9A 2C80A 1S3CA 4KNDA 2VM1A 3BCIA 1AAZA 4O7HA 2PPTA 2ZUPA 4GQCA 4JR4A 1O8WA 1SVLA 3TUEA 5KOXA 4X1UA 1K0DA 2M80A 4K6XA 5GAND 1IYIA 1DSBA 1U3AA 2AB6A 3UVHA 2NVLA 2C0FA 1U3IA 3A2XA 5GSTA 1QGVA 2EFEA 4F82A 3TRPA 1HD2A 2JZSA 1J08A 3GH6A 3MDKA 4N0VA 7GSSA 2JSYA 1XW5A 1XWAA 1TK0B 4BL7A 1QUWA 2HZEB 2CAQA 3ERWA 3SWLA 1X9SB 2H76A 3F6FA 1G0TA 2NDOA 1E6BA 4IN0A 3UOMA 2CV4A 1V98A 4GXZA 3D21A 5D9WA 1GSDA 1OE7A 3FRCA 4DSRA 4ECCA 4PURA 4ZXGA 3HJMA 4ZB8A 1I5GA 2IFQA 1BAYA 4PGTA 1UVZA 5A34A 5IMVA 2H0GA 5J9BA 4YKGA 2TRCP 2L4QA 4BVYA 4KW6A 1PRXA 3FMWA 4EXJA 4K0GA 5CRWA 1EWXA 4WKWA 1YEWC 3UARA 2RUFA 3NIVA 4POKA 2CZ3A 3C73A 4NPBA 3QAGA 3JCML 5HFKA 1G7EA 4G10A 1GLPA 4EIPA 4KSMA 3KTLA 20GSA 17GSA 4L8EA 4KDUA 1FOHA 1URMA 3EWLA 3PH9A 4IP1A 3WGDA 1M2AA 1ML6A 1HNBA 3KZQA 4MJAA 3ISOA 1WWJA 1F3AA 2GGTA 2DMLA 2IN3A 4DSQA 4N11A 2P0GA 4GSTA 3NOFA 4OFNA 2QA1A 4N10A 2OA7A 4POLA 3F3RA 2YN1A 2DJ0A 1GUMA 4K7IA 3GNJA 3KCMA 3PR8A 3MSZA 3ZYWA 1DBYA 2KOKA 4TVEA 3QAVA 3W6GA 4WF4A 2FWEA 1SK0A 5HQPA 3GIXA 3FR3A 2JSZA 3HVNA 3GTUB 2H74A 4K7NA 4FYCA 1Z3EA 3TJBA 2CVBA 1KTEA 2XBQA 2E7PA 5G5EA 3CTGA 2HSNB 5G2ZA 3MIXA 2IMFA 5IMAA 5IMZA 2AAWA 3EE2A 2VLTA 1TRSA 1MTCA 5J4UA 2PVQA 5A5KA 3L78A 1QK8A 1F3BA 1ERWA 2WVYA 2LNSA 4MJEA 4FQUA 1B4PA 2H73A 3ZZXA 1AQWA 18GSA 2O87A 1PX7A 3CHXC 4J2FA 3ZMKA 2H1GA 5HFGA 5KN3A 4HI7A 2H01A 1V9WA 4EF0A 1BG1A 1ILOA 5CAXA 3GSTA 2AUVA 5B6NA 1K0NA 3WD6A 3QMXA 4I8BA 2C3NA 2H6ZA 4WF5A 2YWIA 2R4VA 1HQOA 5LCZA 4L5LA 5CO3A 3GKMA 4F0CA 1AIUA 3KP9A 2LKUA 4V2MA 2HYXA 3HA9A 4XCSA 2XPDA 2MMAA 4AJ7A 4I97A 4Z7XA 1EOHA 2G0FA 3GMFA 3A2VA 3DVWA 22GSA 4MJBA 1T8EB 2GZPA 2GSRA 1V57A 4O32A 1USBA 2H8LA 4TR0A 2LS5A 5HR2A 5KN1A 1SU9A 2XHFA 3FYGA 4USSA 3BCKA 4GTUA 4O5RA 2QKEA 1GSYA 4ZL7A 2DIZA 2PERA 3O3TA 3ZLPA 1YKAA 4EDZA 3LWAA 4QMKA 2Z9SA 1BF5A 5JCUA 2OE1A 2P5QA 4IS0A 3D22A 2EFHA 2VD1A 4LLRA 3VI7A 4Z2TA 5J4YA 4AJ6A 2I4AA 4BIKA 2VIMA 3ERGA 4I2TA 4E68A 2FD3A 3F9UA 1K0CA 3EVIA 1N8JA 2JU5A 4BVXA 5E4WA 4PUFC 1ZYQB 4GDFA 4YAVA 5ECHB 1A2LA 3DKSA 3QCPA 1SJ6A 3RHCA 2RUEA 2L6CA 1SL1B 2H70A 3RGBC 3APQA 3IHGA 4KGIA 3TKRA 1N25A 2MMZA 4EE0A 1S3AA 2C1YA 3IHQA 3TCOA 9GSSA 3DMLA 4X43A 1H75A 5C00A 3VWXA 1TTZA 3WYWA 4K2DA 5DALB 1A23A 1GH2A 2HSYA 4HS1A 3DEXA 3HZ8A 3KH9A 5KN2A 2LJRA 3I9V2 3MWHA 4V2LA 3DVXA 1C72A 1SD9A 2K8SA 5J9CA 3HXSA 5IPGA 2NBSA 2ON5A 1SD8A 2QC7A 2KP1A 2HLSA 3DYRA 1NSWA 2DC5A 4MF7A 1TK5B 3A5IA 4K2XA 4YH2A 5IM9A 5IQYA 3KGKA 4IGJA 2B3SA 2FUG2 3TGZA 5ID2A 3VPQA 3TKSE 1Q4JA 3GL5A 3HDCA 4BPYA 2YNXA 4F03A 2H30A 3PPUA 2FA4A 3HJOA 1VGLA 1WJKA 3GX0A 1GULA 5HR3A 2FNOA 4BWQA 2GQKA 4BA7A 3HYPA 5ECKB 4PNGA 4BWSA 4ICYA 5G31A 4MP4A 4DSSB 1I9DA 2KUCA 4MH2A 5FT3A 3HMJG 3EINA 1K0OA 1XVQA 1NM3A 1FVKA 2YV9A 3APOA 3TDGA 1ERUA 5D8IA 1EOGA 1R7HA 4EIQA 4O5UA 5BMUA 2PVOC 3HVSA 4FYUA 2L4CA 1T00A 1K3LA 5G1LA 4JR6A 4QL9A 4D73A 3HHVA 2WW1A 2YANA 2H1AA 1M99A 4MF6A 3TOTA 5B7CA 2B5XA 2IL3A 5FWGA 2PN8A 2N5AA 3W8SA 5AIVA 2JADA 5DAKA 2E2MA 1PD21 4MDCA 2F51A 1SK2A 3IC4A 4ZIJA 2YJHA 3TKPA 1QXHA 3RAZA 1Z5YE 5DJMA 4AGSA 2VL9A 3E3EA 2CZ2A 1NW2A 2ZCTA 10GSA 2EIOA 1NHOA 1XWGA 2X8CA 5D9XA 4KH7A 3J7Yb 3R2QA 2P5RA 3M1GA 2WVXB 1PQNA 4ECIA 4J57E 2LUSA 4ZBAA 3WT2A 1M2BA 2PWJA 3GSSA 1G7OA 1YEPA 4ULXA 3VK9A 4ID0A 1RK4A 1ZZYA 4H86A 2GSTA 3U6VA 2ES7A 1GSQA 2B7JA 1F37A 1OE8A 2VCXA 1T4ZA 1Y25A 3MNGA 4ACSA 2H75A 4KSOA 2F8AA 3N5OA 1A0RP 4XS4A 1BJXA 4V1Ag 3CRUA 4K8MA 2E2GA 1GRXA 3L0HA 4XTSA 1JHBA 1TP9A 2LRTA 4TXOA 4ISDA 5HR0A 3QD9A 3RPNA 2H71A 3D5JA 4NAXA 4EVMA 1RQMA 2VUPA 2PU9C 3G7IA 1RW1A 4ZBBA 5KN0A 2AYTA 1A0FA 4TW5A 3F0IA 5F06A 3KMOA 1WP0A 1THXA 1T4YA 2A4VA 2FA8A 5A1NA 1XVWA 3A5WA 3VI5A 2AJQB 4W66A 3IE3A 5ECQB 1BX9A 4X4JA 2O8VB 4FH8A 6GSVA 4WEYA 1K3YA 4GQFA 4XHMA 3D4MA 3GV1A 3I43A 2XBIA 3M9KA 5DDLA 5D9TA 8GSSA 1OC9A 2OJLA 5EL8A 1PN9A 4YQVA 3HVVA 1O73A 2R0PA 3GHAA 4IJIA 4LL4B 3F6DA 2WW2A 5FHIA 1Y6EA 2FWFA 2YWNA 4DEJA 5ENUA 2WB9A 3VLNA 1ZCPA 2X99A 1TU8A 2QA2A 2O5VA 4MABA 3KEBA 2IMIA 1XOBA 1ZGNA 1PN0A 1R26A 2O89A 2H72A 1WRYA 2RM5A 4PI2C 5EPFA 3APSA 6GSXA 1JLWA 2A2SA 5IO0A 3UJ1A 2B1LA 3ZREA 4MLYA 5F05A 3QAWA 2EC4A 5ECPB 2WRTA 1UC7A 19GSA 5J40A 3GURA 3PGTA 1YY7A 2WW3A 5B6MA 1EP7A 4TRXA 2GTUA 1B4QA 2HRKA 3TKSC 4NWYA 3F4SA 2VCQA 4L0WA 1EGRA 2CAIA 1SJZA 4HJMA 3BD2A 2IWTA 1VF1A 1ZYEA 1O85A 4KCAA 2DSAA 3VWVA 4EUYA 5IMDA 2GQMA 3ZFLA 5E59A 2VO4A 4HOJA 2PGTA 4POBA 2HSMB 2WGRA 4PQ1A 1TKDB 4LMWA 5IO2A 3US3A 2YCDA 4HEA2 4ZILA 2R5GA 3UAPA 3P8WA 1F9MA 1GP1A 3C1SA 3FZAA 3E0UA 4X0XA 2V6KA 2FLSA 5H5RA 5J41A 5CYYA 2VCZA 4OCEA 2MZCA 4EKZA 5B8BA 4F2IA 1Z7RA 4E8HA 2OE3A 4GCIA 1XBSA 1A8YA 2O85A 5CRGA 3LEFA 2REMA 4HU9A 3TRXA 4ECJA 2B5YA 5D96A 5A4UA 2HQTA 2JACA 3Q19A 4YKFA 2BJXA 3G7YA 4XS6A 2D2ZA 4O5QA 3DRNA 3ZVJA 2LEGA 5DCGA 1XWCA 1WE0A 3DIEA 5JCGA 1R5AA 4JU5A 5HR1A 1O8XA 2EIRA 5CREA 5A5HA 2ALBA 4N0ZA 4K9ZA 2B1KA 2O36A 4KB3A 1FO5A 1OAZA 1EEJA 1XG8A 2J23A 3A2WA 3IDVA 2EFCA 1M9AA 3HKRA 3Q18A 2VOCA 1NHYA 4MK3A 1FVJA 1DE1A 4OMVA 5GZZB 2R2JA 3EU3A 3O76A 4GF0A 3ZL5A 1VF4A 2HXKA 4TR1B 2MMOA 3GH9A 2X49A 3R3EA 4MNNA 1LJRA 2VLVA 3HZ4A 5B8AA 5H5SA 4K5RA 1PA3A 1AUCA 3LYKA 1SJIA 4IQ1A 1CQHA 2CA8A 4NMUA 3L9SA 3IPZA 2DIYA 1GSFA 4WXTA 1TI1A 3G9BA 2YP6A 1GNWA 3IK9A 4IELA 2VL2C 4FYBA 3RPPA 4TR4A 2R37A 4JZQA 2I9HA 5A4WA 1J9BA 3EC3A 1TK8B 2C0GA 1CQGA 1FB6A 2TRXA 2OBKA 3UL3A 4HU7A 1PFOA 2CX3A 1XFLA 4KX4A 3IOSA 2DBCA 2K8VA 4MPFA 5JCWA 3QOUA 2HE3A 4ZBDA 3SBCA 3EMPA 6GSUA 3EU4A 4XS1A 2YJ7A 1K0AA 1YJ6A 3KM6A 4IHUA 3UBKA 5AGYA 2HZEA 4CHSA 3FKFA 2IMDA 4NXIA 2OBIA 2LNTA 2VLUA 4YQUA 3IC8A 3FK8A 3H79A 1XW9A 2HSHA 3VPTA 2WW0A 1TOFA 4GRFA 2HRNA 5CNWA 3N9JA 2X8GA 2JZTA 4K7OA 2B7KA 3QPMA 1LU4A 1XXUA 3G7JA 2MYGA 2C3TA 3P7XA 1Q98A 2GVPA 4POMA 2EFDA 1AC1A 1V40A 1SL2B 2VCVA 3K8NA 3LW9A 3UBLA 4CY6A 1DUGA 5H5QA 5J5NA 4BL7B 2YV7A 4G01A 4L5OA 1HYUA 2WDUA 5COHA 1S4BP 1KNGA 1HNCA 3GKKA 1PGTA 4HDEA 2IFQB 2IMKA 3EMXA 1SVOA 1QMVA 5A34B 5ELGA 2F9SA 6GSSA 2H1DA 2B5EA 1B8XA 2CQ9A 3M8NA 2H6YA 2GT6A 2HRAA 1GTIA 1SENA 4BVYB 6GSTA 4KE3A 2DJJA 3A3TA 4AJ8A 5IOWA 2FHEA 5J47A 3QDNA 1R4WA 4JRRA 1A2JA 1ZYPA 2M72A 3CXGA 4HQZA 5GAPD 5JWRB 1QFNA 4WBJA 1SVMA 3J7Yk 5JWQB 4IKHA 5IPHA 1THOA 5C04A 3RDWA 3FR6A 1GLQA 1FAAA 2IJYA 1ERTA 1R5PA 2GS3A 4ZL8A 4Z2RA 5AN1A 2HRFA 1OC3A 2J9HA 2OACA 4PQHA 4IQAA 3KIJA 2F8FA 2YPMA 3GTUA 2MBTA 4RQXA 4Q5FA 1VRSD 1YDKA 2OE0A 3TJFA 1XW6A 2NTOA 3H1NA 2IIYA 2H6XA 2FY6A 5GSSA 1EEMA 1K0MA 5D73A 4E8EA 2PMTA 2VD0A 3HCZA 2LJAA 1X9WB 4MA9A 4O92A 1QQ2A 2BMXA 1PL1A 2HSNA 3RFRC 2XPEA 4AKHA 1H4OA 2PBJA 4V1Ap 4ML1A 2WCIA 2KLXA 3E9JB 4F0BA 3LYPA 1JLVA 1OYJA 2HFDA 2DJ1A 5ABRA 1Z6NA 3CYNA 5INYA 2WULA 2JL4A 3FEUA 1G6YA 5A4VA 2X64A 3LQ7A 3TKQA 3ERFA 4HQSA 2IMEA 4ZL9A 1GUKA 2FWGA 1U88A 3UVTA 3L9VA 14GSA 4FO5A 1GWCA 2FCHA 1T1VA 3TJJA 4TKYA 16GSA 4HJ2A 4G0LA 1EP8A 1M9BA 1FHEA 1T7PB 2CX4A 4Q5QA 5JWOB 3HVXA 3ZVJD 5G1KA 3KTBA 2YZUA 3TU3B 4MZCA 5J4VA 1AQXA 3CWGA 3GKNA 1XWKA 2P31A 3TJGA 3QFAC 1M7TA 1VF2A 3ZTLA 5IOXA 4OFTA 4OO4A 2LSTA 4YQMA 3AY8A 1YZXA 1MEKA 1O6JA 2WZSA 4TXVA 4AKXB 3PINA 4V2NA 1DE2A 2WVZA 4N30A 3NZNA 3OR5A 3F4RA 5EVOA 1IYHA 5CRHA 2R3XA 3P2AA 4I5QA 2V32A 1OC8A 3TB2A 2OADA 1KBNA 1FG4A 4FXYP 1UA5A 1M3JA 1YF1A 2VM2A 2L6DA 5G5FA 4CDOA 4G2EA
chains in the Genus database with same CATH topology
2GZZA 1SYXA 3FZ4A 4A5PA 4ML6A 1X0RA 3CTFA 2CVKA 1S3DA 1W4VA 4ZB9A 3F4TA 2YZHA 3F8UA 4TOPA 2DJ2A 2PUKC 2E0QA 3LGCA 5ECRB 2V2GA 1XOAA 2L59A 2R0CA 2DJ3A 2IPAA 2MBSA 4K0NA 3I69A 4RQRA 1SYRA 3ME7A 2JZRA 1SKWB 2N5FA 5DALA 4XRAA 4CW9A 1JZOA 3F63A 4BVXB 5AISA 1N2AA 5KEJA 2VCWA 3O6TA 4AF2A 4PQIA 1M0UA 2RM6A 2FWHA 2I81A 5DJLA 5DBQA 4AKGA 1WPIA 2RLIA 4AI6A 4GWRA 1YVLA 2WZ9A 2AV4A 1PL2A 3GFKA 1A24A 1KEBA 2C0DA 1EZKA 2B6MA 3W8JA 2R0GA 2XC2A 2H0HA 1BYEA 3WGEA 2O7KA 3FY7A 4OWYA 1A8LA 4WBRD 3UIWA 3D6IA 3WT1A 1A2MA 1FB0A 4XIHA 3CMIA 4LL1B 3GN3A 2FGXA 3VWWA 3GKXA 4JBBA 1WMJA 11GSA 2K6VA 3H4KA 4OCFA 5LNKe 1TW9A 1YQ1A 4OD7A 5ECLB 3M9JA 4DSSA 3UEMA 1BQ7A 2HI7A 3GRXA 4MMMA 1TRWA 4ILFA 4P3YB 2V41A 1X5EA 3GL3A 5ID2B 4EO3A 4EDYA 12GSA 3CBUA 2EIQA 3QFBC 4GSSA 2H1LA 3TKSA 3DD3A 3RHBA 1U87A 6GSYA 1Z7PA 1EV4A 1TI3A 4NV2A 5ECIB 2L57A 1X5DA 3H8QA 3GYKA 2OKAA 3BOAA 1XWBA 3IRAA 2TIRA 1YF0A 2A2RA 3GX8A 2C0EA 5BMUB 1ERVA 3LG6A 4HUAA 2A4HA 4D73B 4KDXA 2H0IA 4EL1A 4IVFA 1GTBA 3EYTA 1PMTA 1GSUA 4NHWA 3ZMLA 5DAKB 4G19A 2ON7A 3LXZA 3FZ9A 4ZB6A 3V1WA 2YWMA 2LRCA 4PNFA 4RUVA 2DKHA 3KXOA 4DVCA 2L5LA 1Y1UA 1V2AA 2GZYA 3IR4A 4G0IA 1HNAA 3VURA 2L5OA 4CY8A 1ZMAA 2MMNA 2NPBA 2I3YA 1GTUA 4RI6A 1T3BA 3C7MA 4MZWA 1E2YA 1OKTA 3HD5A 2LQQA 1SL0B 4KCEA 4KDYA 2CT6A 3VFIA 1OVNA 2C4JA 4HZ4A 1UN2A 3HJPA 2K18A 4MF5A 2WJUA 1SKSB 1ABAA 5F0GA 4IJ3A 4GLTA 1BG5A 1M2DA 1WOUA 1MDKA 3M0FA 4LMVA 4KA0A 5ECMB 4PUAA 3TJKA 3CSHA 3IAM2 1TRVA 3ED3A 2A2PA 1XIYA 3MYDA 1K3OA 1V58A 4XS4B 1JZRA 2DMMA 4XRDA 3DGQA 5G30A 1F6MC 1MDJA 1WIKA 4TXOB 4ZB7A 4QL7A 2UZ8A 1W89A 3RBTA 1FW1A 1O81A 1SK1A 4AKIA 4MCUA 5IIZA 3IK7A 1GNEA 4G9HA 3GA4A 3C71A 1X5CA 3ZIJA 1AW9A 3CSJA 3EURA 5A1NB 5KOWA 2VL2A 4WR5A 3LXTA 1ZYNA 4JEDA 3ZRDA 1G6WA 1FOVA 4MZBA 2K9FA 3CRTA 1B9YC 4EC0A 2V6OA 3LJRA 5ELAA 2F3MA 4LA1A 1B48A 2AHEA 3IBHA 2CVDA 1OC9B 3Q6OA 1ON4A 4K5SA 3L9UA 5BRTA 4Q5RA 1J0FA 4NV5A 5AIXA 3QR6A 4IBPA 2VCTA 5EY6A 1EGOA 3HY2A 3ZITA 2HT9A 1PKWA 3BJ5A 1LBKA 2OT3A 3FHKA 1TDIA 5CP1A 4PTSA 4JE1A 4N3ZA 2BTOT 1F2EA 5ECOB 2VKZG 2HNLA 2DKIA 3FZ5A 2N5BA 3D0ZA 3KH7A 3M3MA 5DQYA 2H1BA 3DWVA 3TRQA 4PXOA 3VWUA 2M46A 4RI7A 2DJKA 3C8EA 1OKDA 3S9FA 5HFIA 1GTAA 4OFMA 1EV9A 2X8HA 2HZFA 4WETA 2WFCA 1XPVA 2HSMA 2VAFA 2C8UA 4IW9A 3ZFBA 1AXDA 1TRUA 1GSSA 2HRKB 1PX6A 3L4NA 2R6KA 2GSSA 1YEXA 5D93A 2LTKA 3LFLA 1YKCA 1B9XC 5L71A 1AQVA 4J56E 3KP8A 4Z2UA 2WS2A 1O7UA 6GSWA 2LJKA 3IV4A 5CRDA 5F07A 5F8BA 1TJDA 3MAKA 4I6XA 4TN8A 3TOUA 1JZDA 3LSZA 4PX1A 2VL3A 5D9VA 4ECBA 5IMCA 2C3QA 4L0UA 3IAS2 2H66A 1Z9HA 3C1RA 5DQSA 4I2UA 3U5RE 3KMNA 5IMFA 1VF3A 2V1MA 5ECNB 5ECSA 2ZNMA 4Q5NA 2I1UA 5J3RA 4OO5A 3UMAA 3I6AA 1GL8A 1MDIA 3KD0A 3LORA 2QSIA 1U6TA 1XCCA 1JZWA 1XZOA 2GDRA 4F9ZA 1PSQA 1SKRB 1ZOFA 3IXRA 1TXXA 4QQ7A 4WR4A 3WGXA 1JFUA 3ZIVA 3EPTA 3KJYA 5DCHA 5DVBA 1PKZA 4TR1A 2LQOA 1Z6MA 4MH3A 2GT5A 2GQLA 2QGVA 1X9MB 4MJCA 4KAEA 3FW2A 1ZL9A 2KP2A 2KHPA 3ME8A 3GUSA 2RIIA 1TXUA 2YOIA 3DXBA 2X4AA 2H19A 1K0BA 3Q74A 2LRNA 5A5HB 4HZ2A 1GUHA 3P90A 4G0KA 2YWOA 1MD4A 2G2QA 13GSA 2LV3A 4K1FA 4KUNA 3F3QA 1ST9A 3BBYA 4YAPA 3H93A 4GSNA 3CSIA 1BEDA 3FR9A 2DLXA 1MD3A 1GSEA 3IA1A 1TU7A 2GSQA 3D4TA 4NHZA 4TR3A 4FIWA 2UV8G 1ACVA 4MPGA 4IP6A 2GLRA 5LD0A 4KF9A 2C80A 1S3CA 4KNDA 2VM1A 3BCIA 1AAZA 4O7HA 2PPTA 2ZUPA 4GQCA 4JR4A 1O8WA 1SVLA 3TUEA 5KOXA 4X1UA 1K0DA 2M80A 4K6XA 5GAND 1IYIA 1DSBA 1U3AA 2AB6A 3UVHA 2NVLA 2C0FA 1U3IA 3A2XA 5GSTA 1QGVA 2EFEA 4F82A 3TRPA 1HD2A 2JZSA 1J08A 3GH6A 3MDKA 4N0VA 7GSSA 2JSYA 1XW5A 1XWAA 1TK0B 4BL7A 1QUWA 2HZEB 2CAQA 3ERWA 3SWLA 1X9SB 2H76A 3F6FA 1G0TA 2NDOA 1E6BA 4IN0A 3UOMA 2CV4A 1V98A 4GXZA 3D21A 5D9WA 1GSDA 1OE7A 3FRCA 4DSRA 4ECCA 4PURA 4ZXGA 3HJMA 4ZB8A 1I5GA 2IFQA 1BAYA 4PGTA 1UVZA 5A34A 5IMVA 2H0GA 5J9BA 4YKGA 2TRCP 2L4QA 4BVYA 4KW6A 1PRXA 3FMWA 4EXJA 4K0GA 5CRWA 1EWXA 4WKWA 3UARA 2RUFA 3NIVA 4POKA 2CZ3A 3C73A 4NPBA 3QAGA 3JCML 5HFKA 1G7EA 4G10A 1GLPA 4EIPA 4KSMA 3KTLA 20GSA 17GSA 4L8EA 4KDUA 1FOHA 1URMA 3EWLA 3PH9A 4IP1A 3WGDA 1M2AA 1ML6A 1HNBA 3KZQA 4MJAA 3ISOA 1WWJA 1F3AA 2GGTA 2DMLA 2IN3A 4DSQA 4N11A 2P0GA 4GSTA 3NOFA 4OFNA 2QA1A 4N10A 2OA7A 4POLA 3F3RA 2YN1A 2DJ0A 1GUMA 4K7IA 3GNJA 3KCMA 3PR8A 3MSZA 3ZYWA 1DBYA 2KOKA 4TVEA 3QAVA 3W6GA 4WF4A 2FWEA 1SK0A 5HQPA 3GIXA 3FR3A 2JSZA 3GTUB 2H74A 4K7NA 4FYCA 1Z3EA 3TJBA 2CVBA 1KTEA 2XBQA 2E7PA 5G5EA 3CTGA 2HSNB 5G2ZA 3MIXA 2IMFA 5IMAA 5IMZA 2AAWA 3EE2A 2VLTA 1TRSA 1MTCA 5J4UA 2PVQA 5A5KA 3L78A 1QK8A 1F3BA 1ERWA 2LNSA 4MJEA 4FQUA 1B4PA 2H73A 3ZZXA 1AQWA 18GSA 2O87A 1PX7A 4J2FA 3ZMKA 2H1GA 5HFGA 5KN3A 4HI7A 2H01A 1V9WA 4EF0A 1BG1A 1ILOA 5CAXA 3GSTA 2AUVA 5B6NA 1K0NA 3WD6A 3QMXA 4I8BA 2C3NA 2H6ZA 4WF5A 2YWIA 2R4VA 1HQOA 5LCZA 4L5LA 5CO3A 3GKMA 4F0CA 1AIUA 3KP9A 2LKUA 4V2MA 2HYXA 3HA9A 4XCSA 2XPDA 2MMAA 4AJ7A 4I97A 4Z7XA 1EOHA 2G0FA 3GMFA 3A2VA 3DVWA 22GSA 4MJBA 1T8EB 2GZPA 2GSRA 1V57A 4O32A 1USBA 2H8LA 4TR0A 2LS5A 5HR2A 5KN1A 1SU9A 2XHFA 3FYGA 4USSA 3BCKA 4GTUA 4O5RA 2QKEA 1GSYA 4ZL7A 2DIZA 2PERA 3O3TA 3ZLPA 1YKAA 4EDZA 3LWAA 4QMKA 2Z9SA 1BF5A 5JCUA 2OE1A 2P5QA 4IS0A 3D22A 2EFHA 2VD1A 4LLRA 3VI7A 4Z2TA 5J4YA 4AJ6A 2I4AA 2VIMA 3ERGA 4I2TA 4E68A 2FD3A 3F9UA 1K0CA 3EVIA 1N8JA 2JU5A 4BVXA 5E4WA 4PUFC 1ZYQB 4GDFA 4YAVA 5ECHB 1A2LA 3DKSA 3QCPA 1SJ6A 3RHCA 2RUEA 2L6CA 1SL1B 2H70A 3APQA 3IHGA 4KGIA 3TKRA 1N25A 2MMZA 4EE0A 1S3AA 2C1YA 3IHQA 3TCOA 9GSSA 3DMLA 4X43A 1H75A 5C00A 3VWXA 1TTZA 3WYWA 4K2DA 5DALB 1A23A 1GH2A 2HSYA 4HS1A 3DEXA 3HZ8A 3KH9A 5KN2A 2LJRA 3I9V2 3MWHA 4V2LA 3DVXA 1C72A 1SD9A 2K8SA 5J9CA 3HXSA 5IPGA 2NBSA 2ON5A 1SD8A 2QC7A 2KP1A 2HLSA 3DYRA 1NSWA 2DC5A 4MF7A 1TK5B 3A5IA 4K2XA 4YH2A 5IM9A 5IQYA 3KGKA 4IGJA 2B3SA 2FUG2 3TGZA 5ID2A 3VPQA 3TKSE 1Q4JA 3GL5A 3HDCA 4BPYA 2YNXA 4F03A 2H30A 3PPUA 2FA4A 3HJOA 1VGLA 1WJKA 3GX0A 1GULA 5HR3A 2FNOA 4BWQA 2GQKA 4BA7A 3HYPA 5ECKB 4PNGA 4BWSA 4ICYA 5G31A 4MP4A 4DSSB 1I9DA 2KUCA 4MH2A 5FT3A 3HMJG 3EINA 1K0OA 1XVQA 1NM3A 1FVKA 2YV9A 3APOA 3TDGA 1ERUA 5D8IA 1EOGA 1R7HA 4EIQA 4O5UA 5BMUA 2PVOC 3HVSA 4FYUA 2L4CA 1T00A 1K3LA 5G1LA 4JR6A 4QL9A 4D73A 3HHVA 2YANA 2H1AA 1M99A 4MF6A 3TOTA 5B7CA 2B5XA 2IL3A 5FWGA 2PN8A 2N5AA 3W8SA 5AIVA 2JADA 5DAKA 2E2MA 1PD21 4MDCA 2F51A 1SK2A 3IC4A 4ZIJA 2YJHA 3TKPA 1QXHA 3RAZA 1Z5YE 5DJMA 4AGSA 2VL9A 3E3EA 2CZ2A 1NW2A 2ZCTA 10GSA 2EIOA 1NHOA 1XWGA 2X8CA 5D9XA 4KH7A 3J7Yb 3R2QA 2P5RA 3M1GA 1PQNA 4ECIA 4J57E 2LUSA 4ZBAA 3WT2A 1M2BA 2PWJA 3GSSA 1G7OA 1YEPA 4ULXA 3VK9A 4ID0A 1RK4A 1ZZYA 4H86A 2GSTA 3U6VA 2ES7A 1GSQA 2B7JA 1F37A 1OE8A 2VCXA 1T4ZA 1Y25A 3MNGA 4ACSA 2H75A 4KSOA 2F8AA 3N5OA 1A0RP 4XS4A 1BJXA 4V1Ag 3CRUA 4K8MA 2E2GA 1GRXA 3L0HA 4XTSA 1JHBA 1TP9A 2LRTA 4TXOA 4ISDA 5HR0A 3QD9A 3RPNA 2H71A 3D5JA 4NAXA 4EVMA 1RQMA 2VUPA 2PU9C 3G7IA 1RW1A 4ZBBA 5KN0A 2AYTA 1A0FA 4TW5A 3F0IA 5F06A 3KMOA 1WP0A 1THXA 1T4YA 2A4VA 2FA8A 5A1NA 1XVWA 3A5WA 3VI5A 2AJQB 4W66A 3IE3A 5ECQB 1BX9A 4X4JA 2O8VB 4FH8A 6GSVA 4WEYA 1K3YA 4GQFA 4XHMA 3D4MA 3GV1A 3I43A 2XBIA 3M9KA 5DDLA 5D9TA 8GSSA 1OC9A 2OJLA 5EL8A 1PN9A 4YQVA 3HVVA 1O73A 2R0PA 3GHAA 4IJIA 4LL4B 3F6DA 5FHIA 1Y6EA 2FWFA 2YWNA 4DEJA 5ENUA 2WB9A 3VLNA 1ZCPA 2X99A 1TU8A 2QA2A 2O5VA 4MABA 3KEBA 2IMIA 1XOBA 1ZGNA 1PN0A 1R26A 2O89A 2H72A 1WRYA 2RM5A 5EPFA 3APSA 6GSXA 1JLWA 2A2SA 5IO0A 3UJ1A 2B1LA 3ZREA 4MLYA 5F05A 3QAWA 2EC4A 5ECPB 2WRTA 1UC7A 19GSA 5J40A 3GURA 3PGTA 1YY7A 5B6MA 1EP7A 4TRXA 2GTUA 1B4QA 2HRKA 3TKSC 4NWYA 3F4SA 2VCQA 4L0WA 1EGRA 2CAIA 1SJZA 4HJMA 3BD2A 2IWTA 1VF1A 1ZYEA 1O85A 4KCAA 2DSAA 3VWVA 4EUYA 5IMDA 2GQMA 3ZFLA 5E59A 2VO4A 4HOJA 2PGTA 4POBA 2HSMB 2WGRA 4PQ1A 1TKDB 4LMWA 5IO2A 3US3A 2YCDA 4HEA2 4ZILA 2R5GA 3UAPA 3P8WA 1F9MA 1GP1A 3C1SA 3FZAA 3E0UA 4X0XA 2V6KA 2FLSA 5H5RA 5J41A 5CYYA 2VCZA 4OCEA 2MZCA 4EKZA 5B8BA 4F2IA 1Z7RA 4E8HA 2OE3A 4GCIA 1XBSA 1A8YA 2O85A 5CRGA 3LEFA 2REMA 4HU9A 3TRXA 4ECJA 2B5YA 5D96A 5A4UA 2HQTA 2JACA 3Q19A 4YKFA 2BJXA 3G7YA 4XS6A 2D2ZA 4O5QA 3DRNA 3ZVJA 2LEGA 5DCGA 1XWCA 1WE0A 3DIEA 5JCGA 1R5AA 4JU5A 5HR1A 1O8XA 2EIRA 5CREA 5A5HA 2ALBA 4N0ZA 4K9ZA 2B1KA 4KB3A 1FO5A 1OAZA 1EEJA 2J23A 3A2WA 3IDVA 2EFCA 1M9AA 3HKRA 3Q18A 2VOCA 1NHYA 4MK3A 1FVJA 1DE1A 4OMVA 5GZZB 2R2JA 3EU3A 3O76A 4GF0A 3ZL5A 1VF4A 2HXKA 4TR1B 2MMOA 3GH9A 2X49A 3R3EA 4MNNA 1LJRA 2VLVA 3HZ4A 5B8AA 5H5SA 4K5RA 1PA3A 1AUCA 3LYKA 1SJIA 4IQ1A 1CQHA 2CA8A 4NMUA 3L9SA 3IPZA 2DIYA 1GSFA 4WXTA 1TI1A 3G9BA 2YP6A 1GNWA 3IK9A 4IELA 2VL2C 4FYBA 3RPPA 4TR4A 2R37A 4JZQA 2I9HA 5A4WA 1J9BA 3EC3A 1TK8B 2C0GA 1CQGA 1FB6A 2TRXA 2OBKA 3UL3A 4HU7A 2CX3A 1XFLA 4KX4A 3IOSA 2DBCA 2K8VA 4MPFA 5JCWA 3QOUA 2HE3A 4ZBDA 3SBCA 3EMPA 6GSUA 3EU4A 4XS1A 2YJ7A 1K0AA 1YJ6A 3KM6A 4IHUA 3UBKA 5AGYA 2HZEA 4CHSA 3FKFA 2IMDA 4NXIA 2OBIA 2LNTA 2VLUA 4YQUA 3IC8A 3FK8A 3H79A 1XW9A 2HSHA 3VPTA 1TOFA 4GRFA 2HRNA 5CNWA 3N9JA 2X8GA 2JZTA 4K7OA 2B7KA 3QPMA 1LU4A 1XXUA 3G7JA 2MYGA 2C3TA 3P7XA 1Q98A 2GVPA 4POMA 2EFDA 1AC1A 1V40A 1SL2B 2VCVA 3K8NA 3LW9A 3UBLA 4CY6A 1DUGA 5H5QA 5J5NA 4BL7B 2YV7A 4G01A 4L5OA 1HYUA 2WDUA 5COHA 1KNGA 1HNCA 3GKKA 1PGTA 4HDEA 2IFQB 2IMKA 3EMXA 1SVOA 1QMVA 5A34B 5ELGA 2F9SA 6GSSA 2H1DA 2B5EA 1B8XA 2CQ9A 3M8NA 2H6YA 2GT6A 2HRAA 1GTIA 1SENA 4BVYB 6GSTA 4KE3A 2DJJA 3A3TA 4AJ8A 5IOWA 2FHEA 5J47A 3QDNA 1R4WA 4JRRA 1A2JA 1ZYPA 2M72A 3CXGA 4HQZA 5GAPD 5JWRB 1QFNA 4WBJA 1SVMA 3J7Yk 5JWQB 4IKHA 5IPHA 1THOA 5C04A 3RDWA 3FR6A 1GLQA 1FAAA 2IJYA 1ERTA 1R5PA 2GS3A 4ZL8A 4Z2RA 5AN1A 2HRFA 1OC3A 2J9HA 2OACA 4PQHA 4IQAA 3KIJA 2F8FA 2YPMA 3GTUA 2MBTA 4RQXA 4Q5FA 1VRSD 1YDKA 2OE0A 3TJFA 1XW6A 2NTOA 3H1NA 2IIYA 2H6XA 2FY6A 5GSSA 1EEMA 1K0MA 5D73A 4E8EA 2PMTA 2VD0A 3HCZA 2LJAA 1X9WB 4MA9A 4O92A 1QQ2A 2BMXA 1PL1A 2HSNA 2XPEA 4AKHA 1H4OA 2PBJA 4V1Ap 4ML1A 2WCIA 2KLXA 3E9JB 4F0BA 3LYPA 1JLVA 1OYJA 2HFDA 2DJ1A 5ABRA 1Z6NA 3CYNA 5INYA 2WULA 2JL4A 3FEUA 1G6YA 5A4VA 2X64A 3LQ7A 3TKQA 3ERFA 4HQSA 2IMEA 4ZL9A 1GUKA 2FWGA 1U88A 3UVTA 3L9VA 14GSA 4FO5A 1GWCA 2FCHA 1T1VA 3TJJA 4TKYA 16GSA 4HJ2A 4G0LA 1EP8A 1M9BA 1FHEA 1T7PB 2CX4A 4Q5QA 5JWOB 3HVXA 3ZVJD 5G1KA 3KTBA 2YZUA 3TU3B 4MZCA 5J4VA 1AQXA 3CWGA 3GKNA 1XWKA 2P31A 3TJGA 3QFAC 1M7TA 1VF2A 3ZTLA 5IOXA 4OFTA 4OO4A 2LSTA 4YQMA 3AY8A 1YZXA 1MEKA 1O6JA 4TXVA 4AKXB 3PINA 4V2NA 1DE2A 4N30A 3NZNA 3OR5A 3F4RA 5EVOA 1IYHA 5CRHA 2R3XA 3P2AA 4I5QA 2V32A 1OC8A 3TB2A 2OADA 1KBNA 1FG4A 1YF1A 1UA5A 2VM2A 2L6DA 5G5FA 4CDOA 4G2EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GZZ A;  1SYX A;  3FZ4 A;  4ML6 A;  1X0R A;  3CTF A;  2CVK A;  1S3D A;  1W4V A;  4ZB9 A;  3F4T A;  2YZH A;  3F8U A;  4TOP A;  2DJ2 A;  2PUK C;  2E0Q A;  3LGC A;  5ECR B;  2V2G A;  1XOA A;  2L59 A;  2DJ3 A;  2IPA A;  2MBS A;  4K0N A;  3I69 A;  4RQR A;  1SYR A;  3ME7 A;  2JZR A;  1SKW B;  2N5F A;  5DAL A;  4XRA A;  4CW9 A;  1JZO A;  3F63 A;  4BVX B;  5AIS A;  1N2A A;  5KEJ A;  2VCW A;  3O6T A;  4AF2 A;  4PQI A;  1M0U A;  2RM6 A;  2FWH A;  2I81 A;  5DJL A;  5DBQ A;  1WPI A;  2RLI A;  4GWR A;  2WZ9 A;  2AV4 A;  1PL2 A;  3GFK A;  1A24 A;  1KEB A;  2C0D A;  1EZK A;  2B6M A;  3W8J A;  2XC2 A;  2H0H A;  1BYE A;  3WGE A;  2O7K A;  3FY7 A;  4OWY A;  1A8L A;  4WBR D;  3UIW A;  3D6I A;  3WT1 A;  1A2M A;  1FB0 A;  4XIH A;  3CMI A;  4LL1 B;  3GN3 A;  2FGX A;  3VWW A;  3GKX A;  4JBB A;  1WMJ A;  11GS A;  2K6V A;  3H4K A;  4OCF A;  5LNK e;  1TW9 A;  1YQ1 A;  4OD7 A;  5ECL B;  3M9J A;  4DSS A;  3UEM A;  1BQ7 A;  2HI7 A;  3GRX A;  4MMM A;  1TRW A;  4ILF A;  4P3Y B;  2V41 A;  1X5E A;  3GL3 A;  5ID2 B;  4EO3 A;  4EDY A;  12GS A;  3CBU A;  2EIQ A;  3QFB C;  4GSS A;  3TKS A;  3DD3 A;  3RHB A;  1U87 A;  6GSY A;  1Z7P A;  1EV4 A;  1TI3 A;  4NV2 A;  5ECI B;  2L57 A;  1X5D A;  3H8Q A;  3GYK A;  2OKA A;  3BOA A;  1XWB A;  3IRA A;  2TIR A;  1YF0 A;  2A2R A;  3GX8 A;  2C0E A;  1ERV A;  3LG6 A;  4HUA A;  4D73 B;  4KDX A;  2H0I A;  4EL1 A;  4IVF A;  1GTB A;  3EYT A;  1PMT A;  1GSU A;  4NHW A;  3ZML A;  5DAK B;  4G19 A;  2ON7 A;  3LXZ A;  3FZ9 A;  4ZB6 A;  3V1W A;  2YWM A;  2LRC A;  4PNF A;  4RUV A;  3KXO A;  4DVC A;  2L5L A;  1V2A A;  2GZY A;  3IR4 A;  4G0I A;  1HNA A;  3VUR A;  2L5O A;  1ZMA A;  2MMN A;  2NPB A;  2I3Y A;  1GTU A;  4RI6 A;  1T3B A;  3C7M A;  4MZW A;  1E2Y A;  1OKT A;  3HD5 A;  2LQQ A;  1SL0 B;  4KCE A;  4KDY A;  2CT6 A;  3VFI A;  1OVN A;  2C4J A;  4HZ4 A;  1UN2 A;  3HJP A;  2K18 A;  4MF5 A;  2WJU A;  1SKS B;  1ABA A;  5F0G A;  4IJ3 A;  4GLT A;  1BG5 A;  1M2D A;  1WOU A;  1MDK A;  3M0F A;  4LMV A;  4KA0 A;  5ECM B;  4PUA A;  3TJK A;  3CSH A;  3IAM 2;  1TRV A;  3ED3 A;  1XIY A;  1K3O A;  1V58 A;  4XS4 B;  1JZR A;  2DMM A;  4XRD A;  3DGQ A;  5G30 A;  1F6M C;  1MDJ A;  1WIK A;  4TXO B;  4QL7 A;  2UZ8 A;  1W89 A;  3RBT A;  1FW1 A;  1O81 A;  1SK1 A;  4MCU A;  5IIZ A;  3IK7 A;  1GNE A;  4G9H A;  3GA4 A;  3C71 A;  1X5C A;  3ZIJ A;  1AW9 A;  3CSJ A;  3EUR A;  2VL2 A;  4WR5 A;  3LXT A;  4JED A;  3ZRD A;  1G6W A;  1FOV A;  4MZB A;  2K9F A;  3CRT A;  1B9Y C;  4EC0 A;  2V6O A;  3LJR A;  5ELA A;  2F3M A;  4LA1 A;  1B48 A;  2AHE A;  3IBH A;  2CVD A;  1OC9 B;  3Q6O A;  1ON4 A;  3L9U A;  4Q5R A;  1J0F A;  4NV5 A;  5AIX A;  3QR6 A;  4IBP A;  2VCT A;  5EY6 A;  1EGO A;  3HY2 A;  3ZIT A;  2HT9 A;  1PKW A;  3BJ5 A;  1LBK A;  3FHK A;  1TDI A;  5CP1 A;  4PTS A;  4JE1 A;  2BTO T;  1F2E A;  5ECO B;  2HNL A;  3FZ5 A;  2N5B A;  3D0Z A;  3KH7 A;  3M3M A;  5DQY A;  2H1B A;  3DWV A;  3TRQ A;  4PXO A;  3VWU A;  2M46 A;  4RI7 A;  2DJK A;  3C8E A;  1OKD A;  3S9F A;  5HFI A;  1GTA A;  4OFM A;  1EV9 A;  2X8H A;  2HZF A;  4WET A;  2WFC A;  1XPV A;  2HSM A;  2VAF A;  2C8U A;  4IW9 A;  3ZFB A;  1AXD A;  1TRU A;  1GSS A;  2HRK B;  1PX6 A;  3L4N A;  2R6K A;  2GSS A;  1YEX A;  5D93 A;  2LTK A;  3LFL A;  1YKC A;  1B9X C;  5L71 A;  1AQV A;  4J56 E;  3KP8 A;  2WS2 A;  1O7U A;  6GSW A;  2LJK A;  3IV4 A;  5CRD A;  5F07 A;  5F8B A;  1TJD A;  3MAK A;  4I6X A;  4TN8 A;  3TOU A;  1JZD A;  3LSZ A;  4PX1 A;  2VL3 A;  5D9V A;  4ECB A;  5IMC A;  2C3Q A;  4L0U A;  3IAS 2;  2H66 A;  1Z9H A;  3C1R A;  5DQS A;  4I2U A;  3U5R E;  3KMN A;  5IMF A;  1VF3 A;  2V1M A;  5ECN B;  5ECS A;  2ZNM A;  4Q5N A;  2I1U A;  5J3R A;  4OO5 A;  3UMA A;  3I6A A;  1GL8 A;  1MDI A;  3KD0 A;  3LOR A;  2QSI A;  1U6T A;  1XCC A;  1JZW A;  1XZO A;  2GDR A;  4F9Z A;  1PSQ A;  1SKR B;  1ZOF A;  3IXR A;  1TXX A;  4QQ7 A;  4WR4 A;  3WGX A;  1JFU A;  3ZIV A;  3KJY A;  5DCH A;  5DVB A;  1PKZ A;  4TR1 A;  2LQO A;  1Z6M A;  4MH3 A;  2GT5 A;  2GQL A;  2QGV A;  1X9M B;  4MJC A;  4KAE A;  3FW2 A;  1ZL9 A;  2KP2 A;  2KHP A;  3ME8 A;  3GUS A;  2RII A;  2YOI A;  3DXB A;  2H19 A;  1K0B A;  3Q74 A;  2LRN A;  4HZ2 A;  1GUH A;  3P90 A;  4G0K A;  2YWO A;  1MD4 A;  2G2Q A;  13GS A;  2LV3 A;  4K1F A;  4KUN A;  3F3Q A;  1ST9 A;  3BBY A;  4YAP A;  3H93 A;  4GSN A;  3CSI A;  1BED A;  3FR9 A;  2DLX A;  1MD3 A;  1GSE A;  3IA1 A;  1TU7 A;  2GSQ A;  3D4T A;  4NHZ A;  4TR3 A;  4FIW A;  1ACV A;  4MPG A;  4IP6 A;  2GLR A;  5LD0 A;  4KF9 A;  2C80 A;  1S3C A;  4KND A;  2VM1 A;  3BCI A;  1AAZ A;  4O7H A;  2PPT A;  2ZUP A;  4GQC A;  4JR4 A;  1O8W A;  3TUE A;  4X1U A;  1K0D A;  2M80 A;  4K6X A;  5GAN D;  1IYI A;  1DSB A;  1U3A A;  2AB6 A;  3UVH A;  2NVL A;  2C0F A;  1U3I A;  3A2X A;  5GST A;  1QGV A;  4F82 A;  3TRP A;  1HD2 A;  2JZS A;  1J08 A;  3GH6 A;  3MDK A;  4N0V A;  7GSS A;  2JSY A;  1XW5 A;  1XWA A;  1TK0 B;  4BL7 A;  1QUW A;  2HZE B;  2CAQ A;  3ERW A;  3SWL A;  1X9S B;  2H76 A;  3F6F A;  1G0T A;  2NDO A;  1E6B A;  4IN0 A;  3UOM A;  2CV4 A;  1V98 A;  4GXZ A;  3D21 A;  5D9W A;  1GSD A;  1OE7 A;  3FRC A;  4DSR A;  4ECC A;  4PUR A;  4ZXG A;  3HJM A;  4ZB8 A;  1I5G A;  2IFQ A;  1BAY A;  4PGT A;  1UVZ A;  5IMV A;  2H0G A;  5J9B A;  2TRC P;  2L4Q A;  4BVY A;  4KW6 A;  1PRX A;  4EXJ A;  4K0G A;  5CRW A;  1EWX A;  4WKW A;  3UAR A;  2RUF A;  3NIV A;  4POK A;  2CZ3 A;  3C73 A;  4NPB A;  3QAG A;  3JCM L;  5HFK A;  1G7E A;  4G10 A;  1GLP A;  4KSM A;  3KTL A;  20GS A;  17GS A;  4L8E A;  4KDU A;  1URM A;  3EWL A;  3PH9 A;  4IP1 A;  3WGD A;  1M2A A;  1ML6 A;  1HNB A;  3KZQ A;  4MJA A;  3ISO A;  1WWJ A;  1F3A A;  2GGT A;  2DML A;  2IN3 A;  4DSQ A;  4N11 A;  2P0G A;  4GST A;  3NOF A;  4OFN A;  4N10 A;  2OA7 A;  4POL A;  3F3R A;  2YN1 A;  2DJ0 A;  1GUM A;  4K7I A;  3GNJ A;  3KCM A;  3PR8 A;  3MSZ A;  3ZYW A;  1DBY A;  2KOK A;  4TVE A;  3QAV A;  3W6G A;  4WF4 A;  2FWE A;  1SK0 A;  5HQP A;  3GIX A;  3FR3 A;  2JSZ A;  3GTU B;  2H74 A;  4K7N A;  4FYC A;  1Z3E A;  3TJB A;  2CVB A;  1KTE A;  2XBQ A;  2E7P A;  5G5E A;  3CTG A;  2HSN B;  5G2Z A;  2IMF A;  5IMA A;  5IMZ A;  2AAW A;  3EE2 A;  2VLT A;  1TRS A;  1MTC A;  5J4U A;  2PVQ A;  5A5K A;  3L78 A;  1QK8 A;  1F3B A;  1ERW A;  2LNS A;  4MJE A;  4FQU A;  1B4P A;  2H73 A;  3ZZX A;  1AQW A;  18GS A;  2O87 A;  1PX7 A;  4J2F A;  3ZMK A;  2H1G A;  5HFG A;  5KN3 A;  4HI7 A;  2H01 A;  1V9W A;  4EF0 A;  1ILO A;  5CAX A;  3GST A;  2AUV A;  5B6N A;  1K0N A;  3WD6 A;  3QMX A;  4I8B A;  2C3N A;  2H6Z A;  4WF5 A;  2YWI A;  2R4V A;  1HQO A;  5LCZ A;  4L5L A;  5CO3 A;  3GKM A;  4F0C A;  1AIU A;  3KP9 A;  2LKU A;  4V2M A;  2HYX A;  3HA9 A;  4XCS A;  2XPD A;  2MMA A;  4AJ7 A;  4I97 A;  4Z7X A;  1EOH A;  2G0F A;  3GMF A;  3A2V A;  3DVW A;  22GS A;  4MJB A;  1T8E B;  2GZP A;  2GSR A;  1V57 A;  4O32 A;  1USB A;  2H8L A;  4TR0 A;  2LS5 A;  5HR2 A;  5KN1 A;  1SU9 A;  2XHF A;  3FYG A;  4USS A;  3BCK A;  4GTU A;  4O5R A;  2QKE A;  1GSY A;  4ZL7 A;  2DIZ A;  2PER A;  3O3T A;  3ZLP A;  1YKA A;  4EDZ A;  3LWA A;  2Z9S A;  5JCU A;  2OE1 A;  2P5Q A;  4IS0 A;  3D22 A;  2VD1 A;  4LLR A;  3VI7 A;  4AJ6 A;  2I4A A;  2VIM A;  3ERG A;  4I2T A;  2FD3 A;  3F9U A;  1K0C A;  3EVI A;  1N8J A;  2JU5 A;  4BVX A;  5E4W A;  4PUF C;  1ZYQ B;  4YAV A;  5ECH B;  1A2L A;  3DKS A;  3QCP A;  1SJ6 A;  3RHC A;  2RUE A;  2L6C A;  1SL1 B;  2H70 A;  3APQ A;  4KGI A;  3TKR A;  2MMZ A;  4EE0 A;  1S3A A;  2C1Y A;  3IHQ A;  3TCO A;  9GSS A;  3DML A;  4X43 A;  1H75 A;  5C00 A;  3VWX A;  1TTZ A;  3WYW A;  4K2D A;  5DAL B;  1A23 A;  1GH2 A;  2HSY A;  4HS1 A;  3DEX A;  3HZ8 A;  3KH9 A;  5KN2 A;  2LJR A;  3I9V 2;  3MWH A;  4V2L A;  3DVX A;  1C72 A;  1SD9 A;  2K8S A;  5J9C A;  3HXS A;  5IPG A;  2NBS A;  2ON5 A;  1SD8 A;  2QC7 A;  2KP1 A;  2HLS A;  3DYR A;  1NSW A;  2DC5 A;  4MF7 A;  1TK5 B;  4YH2 A;  5IM9 A;  5IQY A;  3KGK A;  4IGJ A;  2B3S A;  2FUG 2;  3TGZ A;  5ID2 A;  3VPQ A;  3TKS E;  1Q4J A;  3GL5 A;  3HDC A;  4BPY A;  2YNX A;  4F03 A;  2H30 A;  3PPU A;  2FA4 A;  3HJO A;  1VGL A;  1WJK A;  3GX0 A;  1GUL A;  5HR3 A;  2FNO A;  4BWQ A;  2GQK A;  4BA7 A;  3HYP A;  5ECK B;  4PNG A;  4BWS A;  5G31 A;  4MP4 A;  4DSS B;  1I9D A;  2KUC A;  4MH2 A;  5FT3 A;  3EIN A;  1K0O A;  1XVQ A;  1NM3 A;  1FVK A;  2YV9 A;  3APO A;  3TDG A;  1ERU A;  5D8I A;  1EOG A;  1R7H A;  5BMU A;  2PVO C;  3HVS A;  4FYU A;  2L4C A;  1T00 A;  1K3L A;  5G1L A;  4JR6 A;  4QL9 A;  4D73 A;  3HHV A;  2YAN A;  2H1A A;  1M99 A;  4MF6 A;  3TOT A;  5B7C A;  2B5X A;  2IL3 A;  5FWG A;  2PN8 A;  2N5A A;  3W8S A;  5AIV A;  2JAD A;  5DAK A;  2E2M A;  1PD2 1;  4MDC A;  2F51 A;  1SK2 A;  3IC4 A;  4ZIJ A;  2YJH A;  3TKP A;  1QXH A;  3RAZ A;  1Z5Y E;  5DJM A;  4AGS A;  2VL9 A;  3E3E A;  2CZ2 A;  1NW2 A;  2ZCT A;  10GS A;  2EIO A;  1NHO A;  1XWG A;  2X8C A;  5D9X A;  4KH7 A;  3J7Y b;  3R2Q A;  2P5R A;  3M1G A;  1PQN A;  4ECI A;  4J57 E;  2LUS A;  4ZBA A;  3WT2 A;  1M2B A;  2PWJ A;  3GSS A;  1G7O A;  1YEP A;  4ULX A;  3VK9 A;  4ID0 A;  1RK4 A;  1ZZY A;  4H86 A;  2GST A;  3U6V A;  2ES7 A;  1GSQ A;  2B7J A;  1F37 A;  1OE8 A;  2VCX A;  1T4Z A;  1Y25 A;  3MNG A;  4ACS A;  2H75 A;  4KSO A;  2F8A A;  3N5O A;  1A0R P;  4XS4 A;  1BJX A;  4V1A g;  3CRU A;  4K8M A;  2E2G A;  1GRX A;  3L0H A;  4XTS A;  1JHB A;  1TP9 A;  2LRT A;  4TXO A;  4ISD A;  5HR0 A;  3QD9 A;  3RPN A;  2H71 A;  3D5J A;  4NAX A;  4EVM A;  1RQM A;  2VUP A;  2PU9 C;  3G7I A;  1RW1 A;  4ZBB A;  5KN0 A;  2AYT A;  1A0F A;  4TW5 A;  3F0I A;  5F06 A;  3KMO A;  1WP0 A;  1THX A;  1T4Y A;  2A4V A;  2FA8 A;  1XVW A;  3A5W A;  3VI5 A;  2AJQ B;  3IE3 A;  5ECQ B;  1BX9 A;  2O8V B;  4FH8 A;  6GSV A;  4WEY A;  1K3Y A;  4GQF A;  4XHM A;  3D4M A;  3GV1 A;  3I43 A;  2XBI A;  3M9K A;  5DDL A;  5D9T A;  8GSS A;  1OC9 A;  2OJL A;  5EL8 A;  1PN9 A;  4YQV A;  3HVV A;  1O73 A;  3GHA A;  4IJI A;  4LL4 B;  3F6D A;  5FHI A;  1Y6E A;  2FWF A;  2YWN A;  4DEJ A;  5ENU A;  2WB9 A;  3VLN A;  1ZCP A;  2X99 A;  1TU8 A;  4MAB A;  3KEB A;  2IMI A;  1XOB A;  1ZGN A;  1R26 A;  2O89 A;  2H72 A;  1WRY A;  2RM5 A;  5EPF A;  3APS A;  6GSX A;  1JLW A;  2A2S A;  5IO0 A;  3UJ1 A;  2B1L A;  3ZRE A;  4MLY A;  5F05 A;  3QAW A;  2EC4 A;  5ECP B;  2WRT A;  1UC7 A;  19GS A;  3GUR A;  3PGT A;  1YY7 A;  5B6M A;  1EP7 A;  4TRX A;  2GTU A;  1B4Q A;  2HRK A;  3TKS C;  4NWY A;  3F4S A;  2VCQ A;  4L0W A;  1EGR A;  2CAI A;  1SJZ A;  4HJM A;  3BD2 A;  2IWT A;  1VF1 A;  1ZYE A;  1O85 A;  4KCA A;  2DSA A;  3VWV A;  4EUY A;  5IMD A;  2GQM A;  3ZFL A;  5E59 A;  2VO4 A;  4HOJ A;  2PGT A;  4POB A;  2HSM B;  2WGR A;  4PQ1 A;  1TKD B;  4LMW A;  5IO2 A;  3US3 A;  2YCD A;  4HEA 2;  4ZIL A;  2R5G A;  3UAP A;  3P8W A;  1F9M A;  1GP1 A;  3C1S A;  3FZA A;  3E0U A;  4X0X A;  2V6K A;  2FLS A;  5H5R A;  5J41 A;  5CYY A;  2VCZ A;  4OCE A;  2MZC A;  4EKZ A;  5B8B A;  4F2I A;  1Z7R A;  4E8H A;  2OE3 A;  4GCI A;  1XBS A;  1A8Y A;  2O85 A;  5CRG A;  3LEF A;  2REM A;  4HU9 A;  3TRX A;  4ECJ A;  2B5Y A;  5D96 A;  5A4U A;  2HQT A;  2JAC A;  3Q19 A;  2BJX A;  3G7Y A;  4XS6 A;  2D2Z A;  3DRN A;  3ZVJ A;  2LEG A;  5DCG A;  1XWC A;  1WE0 A;  3DIE A;  5JCG A;  1R5A A;  4JU5 A;  5HR1 A;  1O8X A;  2EIR A;  5CRE A;  2ALB A;  4N0Z A;  4K9Z A;  2B1K A;  4KB3 A;  1FO5 A;  1OAZ A;  1EEJ A;  2J23 A;  3A2W A;  3IDV A;  1M9A A;  3Q18 A;  3HKR A;  2VOC A;  1NHY A;  4MK3 A;  1FVJ A;  1DE1 A;  4OMV A;  5GZZ B;  2R2J A;  3EU3 A;  3O76 A;  4GF0 A;  3ZL5 A;  1VF4 A;  2HXK A;  4TR1 B;  2MMO A;  3GH9 A;  3R3E A;  1LJR A;  2VLV A;  3HZ4 A;  5B8A A;  5H5S A;  1PA3 A;  1AUC A;  3LYK A;  1SJI A;  4IQ1 A;  1CQH A;  2CA8 A;  4NMU A;  3L9S A;  3IPZ A;  2DIY A;  1GSF A;  4WXT A;  1TI1 A;  3G9B A;  2YP6 A;  1GNW A;  3IK9 A;  4IEL A;  2VL2 C;  4FYB A;  3RPP A;  4TR4 A;  2R37 A;  4JZQ A;  2I9H A;  5A4W A;  1J9B A;  3EC3 A;  1TK8 B;  2C0G A;  1CQG A;  1FB6 A;  2TRX A;  2OBK A;  3UL3 A;  4HU7 A;  2CX3 A;  1XFL A;  4KX4 A;  3IOS A;  2DBC A;  2K8V A;  4MPF A;  5JCW A;  3QOU A;  2HE3 A;  4ZBD A;  3SBC A;  3EMP A;  6GSU A;  3EU4 A;  4XS1 A;  2YJ7 A;  1K0A A;  1YJ6 A;  3KM6 A;  4IHU A;  3UBK A;  5AGY A;  2HZE A;  4CHS A;  3FKF A;  2IMD A;  4NXI A;  2OBI A;  2LNT A;  2VLU A;  4YQU A;  3IC8 A;  3FK8 A;  3H79 A;  1XW9 A;  2HSH A;  3VPT A;  1TOF A;  4GRF A;  2HRN A;  5CNW A;  3N9J A;  2X8G A;  2JZT A;  4K7O A;  2B7K A;  3QPM A;  1LU4 A;  1XXU A;  3G7J A;  2MYG A;  2C3T A;  3P7X A;  1Q98 A;  2GVP A;  4POM A;  1AC1 A;  1V40 A;  1SL2 B;  2VCV A;  3K8N A;  3UBL A;  1DUG A;  5H5Q A;  5J5N A;  4BL7 B;  2YV7 A;  4L5O A;  1HYU A;  2WDU A;  5COH A;  1KNG A;  1HNC A;  3GKK A;  1PGT A;  4HDE A;  2IFQ B;  2IMK A;  3EMX A;  1QMV A;  5ELG A;  2F9S A;  6GSS A;  2H1D A;  2B5E A;  1B8X A;  2CQ9 A;  3M8N A;  2H6Y A;  2GT6 A;  2HRA A;  1GTI A;  1SEN A;  4BVY B;  6GST A;  4KE3 A;  2DJJ A;  3A3T A;  4AJ8 A;  5IOW A;  2FHE A;  3QDN A;  1R4W A;  4JRR A;  1A2J A;  2M72 A;  3CXG A;  4HQZ A;  5GAP D;  5JWR B;  1QFN A;  4WBJ A;  3J7Y k;  5JWQ B;  4IKH A;  5IPH A;  1THO A;  5C04 A;  3RDW A;  3FR6 A;  1GLQ A;  1FAA A;  2IJY A;  1ERT A;  1R5P A;  2GS3 A;  4ZL8 A;  5AN1 A;  2HRF A;  1OC3 A;  2J9H A;  2OAC A;  4PQH A;  4IQA A;  3KIJ A;  2F8F A;  2YPM A;  3GTU A;  2MBT A;  4RQX A;  4Q5F A;  1VRS D;  1YDK A;  2OE0 A;  3TJF A;  1XW6 A;  2NTO A;  3H1N A;  2IIY A;  2H6X A;  2FY6 A;  5GSS A;  1EEM A;  1K0M A;  5D73 A;  4E8E A;  2PMT A;  2VD0 A;  3HCZ A;  2LJA A;  1X9W B;  4MA9 A;  4O92 A;  1QQ2 A;  2BMX A;  1PL1 A;  2XPE A;  1H4O A;  2PBJ A;  4V1A p;  4ML1 A;  2WCI A;  2KLX A;  3E9J B;  4F0B A;  3LYP A;  1JLV A;  1OYJ A;  2HFD A;  2DJ1 A;  5ABR A;  1Z6N A;  3CYN A;  5INY A;  2WUL A;  2JL4 A;  3FEU A;  1G6Y A;  5A4V A;  2X64 A;  3LQ7 A;  3TKQ A;  3ERF A;  4HQS A;  2IME A;  4ZL9 A;  1GUK A;  2FWG A;  1U88 A;  3UVT A;  3L9V A;  14GS A;  4FO5 A;  1GWC A;  2FCH A;  1T1V A;  3TJJ A;  4TKY A;  16GS A;  4HJ2 A;  4G0L A;  1EP8 A;  1M9B A;  1FHE A;  1T7P B;  2CX4 A;  4Q5Q A;  5JWO B;  3HVX A;  3ZVJ D;  5G1K A;  3KTB A;  2YZU A;  4MZC A;  1AQX A;  3GKN A;  1XWK A;  2P31 A;  3TJG A;  3QFA C;  1M7T A;  1VF2 A;  3ZTL A;  5IOX A;  4OFT A;  4OO4 A;  2LST A;  4YQM A;  3AY8 A;  1YZX A;  1MEK A;  1O6J A;  4TXV A;  3PIN A;  4V2N A;  1DE2 A;  4N30 A;  3NZN A;  3OR5 A;  3F4R A;  5EVO A;  1IYH A;  5CRH A;  2R3X A;  3P2A A;  4I5Q A;  2V32 A;  1OC8 A;  3TB2 A;  2OAD A;  1KBN A;  1FG4 A;  1YF1 A;  1UA5 A;  2VM2 A;  2L6D A;  5G5F A;  4CDO A;  4G2E A; 
#chains in the Genus database with same CATH topology
 2GZZ A;  1SYX A;  3FZ4 A;  4A5P A;  4ML6 A;  1X0R A;  3CTF A;  2CVK A;  1S3D A;  1W4V A;  4ZB9 A;  3F4T A;  2YZH A;  3F8U A;  4TOP A;  2DJ2 A;  2PUK C;  2E0Q A;  3LGC A;  5ECR B;  2V2G A;  4PHZ C;  1XOA A;  2L59 A;  2R0C A;  2DJ3 A;  2IPA A;  2MBS A;  4K0N A;  3I69 A;  4RQR A;  1SYR A;  3ME7 A;  2JZR A;  1SKW B;  2N5F A;  2O3E A;  5DAL A;  4XRA A;  4CW9 A;  1JZO A;  3F63 A;  4BVX B;  1I1I P;  5AIS A;  1N2A A;  5KEJ A;  2VCW A;  3O6T A;  4AF2 A;  4PQI A;  1M0U A;  2RM6 A;  2FWH A;  2I81 A;  5DJL A;  5DBQ A;  4AKG A;  1WPI A;  2RLI A;  4AI6 A;  4GWR A;  1YVL A;  2WZ9 A;  2AV4 A;  1PL2 A;  3GFK A;  1A24 A;  1KEB A;  2C0D A;  1EZK A;  2B6M A;  3W8J A;  2R0G A;  2XC2 A;  2H0H A;  1BYE A;  3WGE A;  2O7K A;  3FY7 A;  4OWY A;  1A8L A;  4WBR D;  3UIW A;  3D6I A;  3WT1 A;  1A2M A;  1FB0 A;  4XIH A;  3CMI A;  4LL1 B;  3GN3 A;  2FGX A;  3VWW A;  3GKX A;  4JBB A;  1WMJ A;  11GS A;  2K6V A;  3H4K A;  4OCF A;  5LNK e;  1TW9 A;  1YQ1 A;  4OD7 A;  5ECL B;  3M9J A;  4DSS A;  3UEM A;  1BQ7 A;  2HI7 A;  3GRX A;  4MMM A;  1TRW A;  4ILF A;  4P3Y B;  2V41 A;  1X5E A;  3GL3 A;  5ID2 B;  4EO3 A;  4EDY A;  12GS A;  3CBU A;  2EIQ A;  3QFB C;  4GSS A;  2H1L A;  3TKS A;  3DD3 A;  3RHB A;  1U87 A;  6GSY A;  1Z7P A;  1EV4 A;  1TI3 A;  4NV2 A;  5ECI B;  2L57 A;  1X5D A;  3H8Q A;  3GYK A;  2OKA A;  3BOA A;  1XWB A;  3IRA A;  2TIR A;  1YF0 A;  2A2R A;  3GX8 A;  2C0E A;  5BMU B;  1ERV A;  3LG6 A;  4HUA A;  2A4H A;  4D73 B;  4KDX A;  2H0I A;  4EL1 A;  4IVF A;  2WVX A;  1GTB A;  3EYT A;  1PMT A;  1GSU A;  4NHW A;  3ZML A;  5DAK B;  4G19 A;  2ON7 A;  3LXZ A;  3FZ9 A;  4ZB6 A;  3V1W A;  2YWM A;  2LRC A;  4PNF A;  4RUV A;  2DKH A;  3KXO A;  4DVC A;  2L5L A;  1Y1U A;  1V2A A;  2GZY A;  3IR4 A;  4G0I A;  1HNA A;  3VUR A;  2L5O A;  4CY8 A;  1ZMA A;  2MMN A;  2NPB A;  2I3Y A;  1GTU A;  4RI6 A;  1T3B A;  3C7M A;  4MZW A;  1E2Y A;  1OKT A;  3HD5 A;  2LQQ A;  1SL0 B;  4KCE A;  4KDY A;  2CT6 A;  3VFI A;  1OVN A;  2C4J A;  4HZ4 A;  1UN2 A;  3HJP A;  2K18 A;  4MF5 A;  2WJU A;  1M3I A;  1SKS B;  1ABA A;  5F0G A;  4IJ3 A;  4GLT A;  1BG5 A;  1M2D A;  1WOU A;  1MDK A;  3M0F A;  4LMV A;  4KA0 A;  5ECM B;  4PUA A;  3TJK A;  3CSH A;  3IAM 2;  1TRV A;  3ED3 A;  2A2P A;  1XIY A;  3MYD A;  1K3O A;  1V58 A;  4XS4 B;  1JZR A;  2DMM A;  4XRD A;  3DGQ A;  5G30 A;  1F6M C;  1MDJ A;  4PI0 C;  1WIK A;  4TXO B;  4ZB7 A;  4QL7 A;  2UZ8 A;  1W89 A;  3RBT A;  1FW1 A;  1O81 A;  1SK1 A;  4AKI A;  4MCU A;  5IIZ A;  3IK7 A;  1GNE A;  4G9H A;  3GA4 A;  3C71 A;  1X5C A;  3ZIJ A;  1AW9 A;  3CSJ A;  3EUR A;  5A1N B;  5KOW A;  2VL2 A;  4WR5 A;  3LXT A;  1ZYN A;  4JED A;  3ZRD A;  1G6W A;  1FOV A;  4MZB A;  2K9F A;  3CRT A;  1B9Y C;  4EC0 A;  2V6O A;  3LJR A;  5ELA A;  2F3M A;  4LA1 A;  1B48 A;  2AHE A;  3IBH A;  2CVD A;  1OC9 B;  3Q6O A;  1ON4 A;  4K5S A;  3L9U A;  5BRT A;  4Q5R A;  1J0F A;  4HSC X;  4NV5 A;  5AIX A;  3QR6 A;  4IBP A;  2VCT A;  5EY6 A;  1EGO A;  3HY2 A;  3ZIT A;  2HT9 A;  1S3R A;  1PKW A;  3BJ5 A;  1LBK A;  2OT3 A;  3FHK A;  1TDI A;  5CP1 A;  4PTS A;  4JE1 A;  4N3Z A;  2BTO T;  1F2E A;  5ECO B;  2VKZ G;  2HNL A;  2DKI A;  3FZ5 A;  2N5B A;  3D0Z A;  3KH7 A;  3M3M A;  5DQY A;  2H1B A;  3DWV A;  3TRQ A;  4PXO A;  3VWU A;  2M46 A;  4RI7 A;  2DJK A;  3C8E A;  1OKD A;  3S9F A;  5HFI A;  1GTA A;  4OFM A;  1EV9 A;  2X8H A;  2HZF A;  4WET A;  2WFC A;  1XPV A;  2HSM A;  2VAF A;  2C8U A;  4IW9 A;  3ZFB A;  1AXD A;  1TRU A;  1GSS A;  2HRK B;  1PX6 A;  3L4N A;  3CQF A;  2R6K A;  2GSS A;  1YEX A;  5D93 A;  2LTK A;  3LFL A;  1YKC A;  1B9X C;  5L71 A;  1AQV A;  4J56 E;  3KP8 A;  4Z2U A;  2WS2 A;  1O7U A;  6GSW A;  2LJK A;  3IV4 A;  5CRD A;  5F07 A;  5F8B A;  1TJD A;  3MAK A;  4I6X A;  4TN8 A;  3TOU A;  1JZD A;  3LSZ A;  4PX1 A;  2VL3 A;  5D9V A;  4ECB A;  5IMC A;  2C3Q A;  4L0U A;  3IAS 2;  2H66 A;  1Z9H A;  3C1R A;  5DQS A;  4I2U A;  3U5R E;  3KMN A;  5IMF A;  1VF3 A;  2V1M A;  5ECN B;  5ECS A;  2ZNM A;  4Q5N A;  2I1U A;  5J3R A;  4OO5 A;  3UMA A;  3I6A A;  1GL8 A;  1MDI A;  3KD0 A;  3LOR A;  2QSI A;  1U6T A;  1XCC A;  1JZW A;  1XZO A;  2GDR A;  4F9Z A;  1PSQ A;  1SKR B;  1ZOF A;  3IXR A;  1TXX A;  4QQ7 A;  4WR4 A;  3WGX A;  1JFU A;  3ZIV A;  3EPT A;  3KJY A;  5DCH A;  5DVB A;  1PKZ A;  4TR1 A;  2LQO A;  1Z6M A;  4MH3 A;  2GT5 A;  2GQL A;  2QGV A;  1X9M B;  4MJC A;  4KAE A;  3FW2 A;  1ZL9 A;  2KP2 A;  2KHP A;  3ME8 A;  3GUS A;  2RII A;  1TXU A;  2YOI A;  3DXB A;  2X4A A;  2H19 A;  1K0B A;  3Q74 A;  2LRN A;  5A5H B;  4HZ2 A;  1GUH A;  3P90 A;  4G0K A;  2YWO A;  1MD4 A;  2G2Q A;  13GS A;  2LV3 A;  4K1F A;  4KUN A;  3F3Q A;  1ST9 A;  3BBY A;  4YAP A;  3H93 A;  4GSN A;  3CSI A;  1BED A;  3FR9 A;  2DLX A;  1MD3 A;  1GSE A;  3IA1 A;  1TU7 A;  2GSQ A;  3D4T A;  4NHZ A;  4TR3 A;  4FIW A;  2UV8 G;  1ACV A;  4MPG A;  4IP6 A;  2GLR A;  5LD0 A;  4KF9 A;  2C80 A;  1S3C A;  4KND A;  2VM1 A;  3BCI A;  1AAZ A;  4O7H A;  2PPT A;  2ZUP A;  4GQC A;  4JR4 A;  1O8W A;  1SVL A;  3TUE A;  5KOX A;  4X1U A;  1K0D A;  2M80 A;  4K6X A;  5GAN D;  1IYI A;  1DSB A;  1U3A A;  2AB6 A;  3UVH A;  2NVL A;  2C0F A;  1U3I A;  3A2X A;  5GST A;  1QGV A;  2EFE A;  4F82 A;  3TRP A;  1HD2 A;  2JZS A;  1J08 A;  3GH6 A;  3MDK A;  4N0V A;  7GSS A;  2JSY A;  1XW5 A;  1XWA A;  1TK0 B;  4BL7 A;  1QUW A;  2HZE B;  2CAQ A;  3ERW A;  3SWL A;  1X9S B;  2H76 A;  3F6F A;  1G0T A;  2NDO A;  1E6B A;  4IN0 A;  3UOM A;  2CV4 A;  1V98 A;  4GXZ A;  3D21 A;  5D9W A;  1GSD A;  1OE7 A;  3FRC A;  4DSR A;  4ECC A;  4PUR A;  4ZXG A;  3HJM A;  4ZB8 A;  1I5G A;  2IFQ A;  1BAY A;  4PGT A;  1UVZ A;  5A34 A;  5IMV A;  2H0G A;  5J9B A;  4YKG A;  2TRC P;  2L4Q A;  4BVY A;  4KW6 A;  1PRX A;  3FMW A;  4EXJ A;  4K0G A;  5CRW A;  1EWX A;  4WKW A;  1YEW C;  3UAR A;  2RUF A;  3NIV A;  4POK A;  2CZ3 A;  3C73 A;  4NPB A;  3QAG A;  3JCM L;  5HFK A;  1G7E A;  4G10 A;  1GLP A;  4EIP A;  4KSM A;  3KTL A;  20GS A;  17GS A;  4L8E A;  4KDU A;  1FOH A;  1URM A;  3EWL A;  3PH9 A;  4IP1 A;  3WGD A;  1M2A A;  1ML6 A;  1HNB A;  3KZQ A;  4MJA A;  3ISO A;  1WWJ A;  1F3A A;  2GGT A;  2DML A;  2IN3 A;  4DSQ A;  4N11 A;  2P0G A;  4GST A;  3NOF A;  4OFN A;  2QA1 A;  4N10 A;  2OA7 A;  4POL A;  3F3R A;  2YN1 A;  2DJ0 A;  1GUM A;  4K7I A;  3GNJ A;  3KCM A;  3PR8 A;  3MSZ A;  3ZYW A;  1DBY A;  2KOK A;  4TVE A;  3QAV A;  3W6G A;  4WF4 A;  2FWE A;  1SK0 A;  5HQP A;  3GIX A;  3FR3 A;  2JSZ A;  3HVN A;  3GTU B;  2H74 A;  4K7N A;  4FYC A;  1Z3E A;  3TJB A;  2CVB A;  1KTE A;  2XBQ A;  2E7P A;  5G5E A;  3CTG A;  2HSN B;  5G2Z A;  3MIX A;  2IMF A;  5IMA A;  5IMZ A;  2AAW A;  3EE2 A;  2VLT A;  1TRS A;  1MTC A;  5J4U A;  2PVQ A;  5A5K A;  3L78 A;  1QK8 A;  1F3B A;  1ERW A;  2WVY A;  2LNS A;  4MJE A;  4FQU A;  1B4P A;  2H73 A;  3ZZX A;  1AQW A;  18GS A;  2O87 A;  1PX7 A;  3CHX C;  4J2F A;  3ZMK A;  2H1G A;  5HFG A;  5KN3 A;  4HI7 A;  2H01 A;  1V9W A;  4EF0 A;  1BG1 A;  1ILO A;  5CAX A;  3GST A;  2AUV A;  5B6N A;  1K0N A;  3WD6 A;  3QMX A;  4I8B A;  2C3N A;  2H6Z A;  4WF5 A;  2YWI A;  2R4V A;  1HQO A;  5LCZ A;  4L5L A;  5CO3 A;  3GKM A;  4F0C A;  1AIU A;  3KP9 A;  2LKU A;  4V2M A;  2HYX A;  3HA9 A;  4XCS A;  2XPD A;  2MMA A;  4AJ7 A;  4I97 A;  4Z7X A;  1EOH A;  2G0F A;  3GMF A;  3A2V A;  3DVW A;  22GS A;  4MJB A;  1T8E B;  2GZP A;  2GSR A;  1V57 A;  4O32 A;  1USB A;  2H8L A;  4TR0 A;  2LS5 A;  5HR2 A;  5KN1 A;  1SU9 A;  2XHF A;  3FYG A;  4USS A;  3BCK A;  4GTU A;  4O5R A;  2QKE A;  1GSY A;  4ZL7 A;  2DIZ A;  2PER A;  3O3T A;  3ZLP A;  1YKA A;  4EDZ A;  3LWA A;  4QMK A;  2Z9S A;  1BF5 A;  5JCU A;  2OE1 A;  2P5Q A;  4IS0 A;  3D22 A;  2EFH A;  2VD1 A;  4LLR A;  3VI7 A;  4Z2T A;  5J4Y A;  4AJ6 A;  2I4A A;  4BIK A;  2VIM A;  3ERG A;  4I2T A;  4E68 A;  2FD3 A;  3F9U A;  1K0C A;  3EVI A;  1N8J A;  2JU5 A;  4BVX A;  5E4W A;  4PUF C;  1ZYQ B;  4GDF A;  4YAV A;  5ECH B;  1A2L A;  3DKS A;  3QCP A;  1SJ6 A;  3RHC A;  2RUE A;  2L6C A;  1SL1 B;  2H70 A;  3RGB C;  3APQ A;  3IHG A;  4KGI A;  3TKR A;  1N25 A;  2MMZ A;  4EE0 A;  1S3A A;  2C1Y A;  3IHQ A;  3TCO A;  9GSS A;  3DML A;  4X43 A;  1H75 A;  5C00 A;  3VWX A;  1TTZ A;  3WYW A;  4K2D A;  5DAL B;  1A23 A;  1GH2 A;  2HSY A;  4HS1 A;  3DEX A;  3HZ8 A;  3KH9 A;  5KN2 A;  2LJR A;  3I9V 2;  3MWH A;  4V2L A;  3DVX A;  1C72 A;  1SD9 A;  2K8S A;  5J9C A;  3HXS A;  5IPG A;  2NBS A;  2ON5 A;  1SD8 A;  2QC7 A;  2KP1 A;  2HLS A;  3DYR A;  1NSW A;  2DC5 A;  4MF7 A;  1TK5 B;  3A5I A;  4K2X A;  4YH2 A;  5IM9 A;  5IQY A;  3KGK A;  4IGJ A;  2B3S A;  2FUG 2;  3TGZ A;  5ID2 A;  3VPQ A;  3TKS E;  1Q4J A;  3GL5 A;  3HDC A;  4BPY A;  2YNX A;  4F03 A;  2H30 A;  3PPU A;  2FA4 A;  3HJO A;  1VGL A;  1WJK A;  3GX0 A;  1GUL A;  5HR3 A;  2FNO A;  4BWQ A;  2GQK A;  4BA7 A;  3HYP A;  5ECK B;  4PNG A;  4BWS A;  4ICY A;  5G31 A;  4MP4 A;  4DSS B;  1I9D A;  2KUC A;  4MH2 A;  5FT3 A;  3HMJ G;  3EIN A;  1K0O A;  1XVQ A;  1NM3 A;  1FVK A;  2YV9 A;  3APO A;  3TDG A;  1ERU A;  5D8I A;  1EOG A;  1R7H A;  4EIQ A;  4O5U A;  5BMU A;  2PVO C;  3HVS A;  4FYU A;  2L4C A;  1T00 A;  1K3L A;  5G1L A;  4JR6 A;  4QL9 A;  4D73 A;  3HHV A;  2WW1 A;  2YAN A;  2H1A A;  1M99 A;  4MF6 A;  3TOT A;  5B7C A;  2B5X A;  2IL3 A;  5FWG A;  2PN8 A;  2N5A A;  3W8S A;  5AIV A;  2JAD A;  5DAK A;  2E2M A;  1PD2 1;  4MDC A;  2F51 A;  1SK2 A;  3IC4 A;  4ZIJ A;  2YJH A;  3TKP A;  1QXH A;  3RAZ A;  1Z5Y E;  5DJM A;  4AGS A;  2VL9 A;  3E3E A;  2CZ2 A;  1NW2 A;  2ZCT A;  10GS A;  2EIO A;  1NHO A;  1XWG A;  2X8C A;  5D9X A;  4KH7 A;  3J7Y b;  3R2Q A;  2P5R A;  3M1G A;  2WVX B;  1PQN A;  4ECI A;  4J57 E;  2LUS A;  4ZBA A;  3WT2 A;  1M2B A;  2PWJ A;  3GSS A;  1G7O A;  1YEP A;  4ULX A;  3VK9 A;  4ID0 A;  1RK4 A;  1ZZY A;  4H86 A;  2GST A;  3U6V A;  2ES7 A;  1GSQ A;  2B7J A;  1F37 A;  1OE8 A;  2VCX A;  1T4Z A;  1Y25 A;  3MNG A;  4ACS A;  2H75 A;  4KSO A;  2F8A A;  3N5O A;  1A0R P;  4XS4 A;  1BJX A;  4V1A g;  3CRU A;  4K8M A;  2E2G A;  1GRX A;  3L0H A;  4XTS A;  1JHB A;  1TP9 A;  2LRT A;  4TXO A;  4ISD A;  5HR0 A;  3QD9 A;  3RPN A;  2H71 A;  3D5J A;  4NAX A;  4EVM A;  1RQM A;  2VUP A;  2PU9 C;  3G7I A;  1RW1 A;  4ZBB A;  5KN0 A;  2AYT A;  1A0F A;  4TW5 A;  3F0I A;  5F06 A;  3KMO A;  1WP0 A;  1THX A;  1T4Y A;  2A4V A;  2FA8 A;  5A1N A;  1XVW A;  3A5W A;  3VI5 A;  2AJQ B;  4W66 A;  3IE3 A;  5ECQ B;  1BX9 A;  4X4J A;  2O8V B;  4FH8 A;  6GSV A;  4WEY A;  1K3Y A;  4GQF A;  4XHM A;  3D4M A;  3GV1 A;  3I43 A;  2XBI A;  3M9K A;  5DDL A;  5D9T A;  8GSS A;  1OC9 A;  2OJL A;  5EL8 A;  1PN9 A;  4YQV A;  3HVV A;  1O73 A;  2R0P A;  3GHA A;  4IJI A;  4LL4 B;  3F6D A;  2WW2 A;  5FHI A;  1Y6E A;  2FWF A;  2YWN A;  4DEJ A;  5ENU A;  2WB9 A;  3VLN A;  1ZCP A;  2X99 A;  1TU8 A;  2QA2 A;  2O5V A;  4MAB A;  3KEB A;  2IMI A;  1XOB A;  1ZGN A;  1PN0 A;  1R26 A;  2O89 A;  2H72 A;  1WRY A;  2RM5 A;  4PI2 C;  5EPF A;  3APS A;  6GSX A;  1JLW A;  2A2S A;  5IO0 A;  3UJ1 A;  2B1L A;  3ZRE A;  4MLY A;  5F05 A;  3QAW A;  2EC4 A;  5ECP B;  2WRT A;  1UC7 A;  19GS A;  5J40 A;  3GUR A;  3PGT A;  1YY7 A;  2WW3 A;  5B6M A;  1EP7 A;  4TRX A;  2GTU A;  1B4Q A;  2HRK A;  3TKS C;  4NWY A;  3F4S A;  2VCQ A;  4L0W A;  1EGR A;  2CAI A;  1SJZ A;  4HJM A;  3BD2 A;  2IWT A;  1VF1 A;  1ZYE A;  1O85 A;  4KCA A;  2DSA A;  3VWV A;  4EUY A;  5IMD A;  2GQM A;  3ZFL A;  5E59 A;  2VO4 A;  4HOJ A;  2PGT A;  4POB A;  2HSM B;  2WGR A;  4PQ1 A;  1TKD B;  4LMW A;  5IO2 A;  3US3 A;  2YCD A;  4HEA 2;  4ZIL A;  2R5G A;  3UAP A;  3P8W A;  1F9M A;  1GP1 A;  3C1S A;  3FZA A;  3E0U A;  4X0X A;  2V6K A;  2FLS A;  5H5R A;  5J41 A;  5CYY A;  2VCZ A;  4OCE A;  2MZC A;  4EKZ A;  5B8B A;  4F2I A;  1Z7R A;  4E8H A;  2OE3 A;  4GCI A;  1XBS A;  1A8Y A;  2O85 A;  5CRG A;  3LEF A;  2REM A;  4HU9 A;  3TRX A;  4ECJ A;  2B5Y A;  5D96 A;  5A4U A;  2HQT A;  2JAC A;  3Q19 A;  4YKF A;  2BJX A;  3G7Y A;  4XS6 A;  2D2Z A;  4O5Q A;  3DRN A;  3ZVJ A;  2LEG A;  5DCG A;  1XWC A;  1WE0 A;  3DIE A;  5JCG A;  1R5A A;  4JU5 A;  5HR1 A;  1O8X A;  2EIR A;  5CRE A;  5A5H A;  2ALB A;  4N0Z A;  4K9Z A;  2B1K A;  2O36 A;  4KB3 A;  1FO5 A;  1OAZ A;  1EEJ A;  1XG8 A;  2J23 A;  3A2W A;  3IDV A;  2EFC A;  1M9A A;  3HKR A;  3Q18 A;  2VOC A;  1NHY A;  4MK3 A;  1FVJ A;  1DE1 A;  4OMV A;  5GZZ B;  2R2J A;  3EU3 A;  3O76 A;  4GF0 A;  3ZL5 A;  1VF4 A;  2HXK A;  4TR1 B;  2MMO A;  3GH9 A;  2X49 A;  3R3E A;  4MNN A;  1LJR A;  2VLV A;  3HZ4 A;  5B8A A;  5H5S A;  4K5R A;  1PA3 A;  1AUC A;  3LYK A;  1SJI A;  4IQ1 A;  1CQH A;  2CA8 A;  4NMU A;  3L9S A;  3IPZ A;  2DIY A;  1GSF A;  4WXT A;  1TI1 A;  3G9B A;  2YP6 A;  1GNW A;  3IK9 A;  4IEL A;  2VL2 C;  4FYB A;  3RPP A;  4TR4 A;  2R37 A;  4JZQ A;  2I9H A;  5A4W A;  1J9B A;  3EC3 A;  1TK8 B;  2C0G A;  1CQG A;  1FB6 A;  2TRX A;  2OBK A;  3UL3 A;  4HU7 A;  1PFO A;  2CX3 A;  1XFL A;  4KX4 A;  3IOS A;  2DBC A;  2K8V A;  4MPF A;  5JCW A;  3QOU A;  2HE3 A;  4ZBD A;  3SBC A;  3EMP A;  6GSU A;  3EU4 A;  4XS1 A;  2YJ7 A;  1K0A A;  1YJ6 A;  3KM6 A;  4IHU A;  3UBK A;  5AGY A;  2HZE A;  4CHS A;  3FKF A;  2IMD A;  4NXI A;  2OBI A;  2LNT A;  2VLU A;  4YQU A;  3IC8 A;  3FK8 A;  3H79 A;  1XW9 A;  2HSH A;  3VPT A;  2WW0 A;  1TOF A;  4GRF A;  2HRN A;  5CNW A;  3N9J A;  2X8G A;  2JZT A;  4K7O A;  2B7K A;  3QPM A;  1LU4 A;  1XXU A;  3G7J A;  2MYG A;  2C3T A;  3P7X A;  1Q98 A;  2GVP A;  4POM A;  2EFD A;  1AC1 A;  1V40 A;  1SL2 B;  2VCV A;  3K8N A;  3LW9 A;  3UBL A;  4CY6 A;  1DUG A;  5H5Q A;  5J5N A;  4BL7 B;  2YV7 A;  4G01 A;  4L5O A;  1HYU A;  2WDU A;  5COH A;  1S4B P;  1KNG A;  1HNC A;  3GKK A;  1PGT A;  4HDE A;  2IFQ B;  2IMK A;  3EMX A;  1SVO A;  1QMV A;  5A34 B;  5ELG A;  2F9S A;  6GSS A;  2H1D A;  2B5E A;  1B8X A;  2CQ9 A;  3M8N A;  2H6Y A;  2GT6 A;  2HRA A;  1GTI A;  1SEN A;  4BVY B;  6GST A;  4KE3 A;  2DJJ A;  3A3T A;  4AJ8 A;  5IOW A;  2FHE A;  5J47 A;  3QDN A;  1R4W A;  4JRR A;  1A2J A;  1ZYP A;  2M72 A;  3CXG A;  4HQZ A;  5GAP D;  5JWR B;  1QFN A;  4WBJ A;  1SVM A;  3J7Y k;  5JWQ B;  4IKH A;  5IPH A;  1THO A;  5C04 A;  3RDW A;  3FR6 A;  1GLQ A;  1FAA A;  2IJY A;  1ERT A;  1R5P A;  2GS3 A;  4ZL8 A;  4Z2R A;  5AN1 A;  2HRF A;  1OC3 A;  2J9H A;  2OAC A;  4PQH A;  4IQA A;  3KIJ A;  2F8F A;  2YPM A;  3GTU A;  2MBT A;  4RQX A;  4Q5F A;  1VRS D;  1YDK A;  2OE0 A;  3TJF A;  1XW6 A;  2NTO A;  3H1N A;  2IIY A;  2H6X A;  2FY6 A;  5GSS A;  1EEM A;  1K0M A;  5D73 A;  4E8E A;  2PMT A;  2VD0 A;  3HCZ A;  2LJA A;  1X9W B;  4MA9 A;  4O92 A;  1QQ2 A;  2BMX A;  1PL1 A;  2HSN A;  3RFR C;  2XPE A;  4AKH A;  1H4O A;  2PBJ A;  4V1A p;  4ML1 A;  2WCI A;  2KLX A;  3E9J B;  4F0B A;  3LYP A;  1JLV A;  1OYJ A;  2HFD A;  2DJ1 A;  5ABR A;  1Z6N A;  3CYN A;  5INY A;  2WUL A;  2JL4 A;  3FEU A;  1G6Y A;  5A4V A;  2X64 A;  3LQ7 A;  3TKQ A;  3ERF A;  4HQS A;  2IME A;  4ZL9 A;  1GUK A;  2FWG A;  1U88 A;  3UVT A;  3L9V A;  14GS A;  4FO5 A;  1GWC A;  2FCH A;  1T1V A;  3TJJ A;  4TKY A;  16GS A;  4HJ2 A;  4G0L A;  1EP8 A;  1M9B A;  1FHE A;  1T7P B;  2CX4 A;  4Q5Q A;  5JWO B;  3HVX A;  3ZVJ D;  5G1K A;  3KTB A;  2YZU A;  3TU3 B;  4MZC A;  5J4V A;  1AQX A;  3CWG A;  3GKN A;  1XWK A;  2P31 A;  3TJG A;  3QFA C;  1M7T A;  1VF2 A;  3ZTL A;  5IOX A;  4OFT A;  4OO4 A;  2LST A;  4YQM A;  3AY8 A;  1YZX A;  1MEK A;  1O6J A;  2WZS A;  4TXV A;  4AKX B;  3PIN A;  4V2N A;  1DE2 A;  2WVZ A;  4N30 A;  3NZN A;  3OR5 A;  3F4R A;  5EVO A;  1IYH A;  5CRH A;  2R3X A;  3P2A A;  4I5Q A;  2V32 A;  1OC8 A;  3TB2 A;  2OAD A;  1KBN A;  1FG4 A;  4FXY P;  1UA5 A;  1M3J A;  1YF1 A;  2VM2 A;  2L6D A;  5G5F A;  4CDO A;  4G2E A; 
#chains in the Genus database with same CATH homology
 2GZZ A;  1SYX A;  3FZ4 A;  4A5P A;  4ML6 A;  1X0R A;  3CTF A;  2CVK A;  1S3D A;  1W4V A;  4ZB9 A;  3F4T A;  2YZH A;  3F8U A;  4TOP A;  2DJ2 A;  2PUK C;  2E0Q A;  3LGC A;  5ECR B;  2V2G A;  1XOA A;  2L59 A;  2R0C A;  2DJ3 A;  2IPA A;  2MBS A;  4K0N A;  3I69 A;  4RQR A;  1SYR A;  3ME7 A;  2JZR A;  1SKW B;  2N5F A;  5DAL A;  4XRA A;  4CW9 A;  1JZO A;  3F63 A;  4BVX B;  5AIS A;  1N2A A;  5KEJ A;  2VCW A;  3O6T A;  4AF2 A;  4PQI A;  1M0U A;  2RM6 A;  2FWH A;  2I81 A;  5DJL A;  5DBQ A;  4AKG A;  1WPI A;  2RLI A;  4AI6 A;  4GWR A;  1YVL A;  2WZ9 A;  2AV4 A;  1PL2 A;  3GFK A;  1A24 A;  1KEB A;  2C0D A;  1EZK A;  2B6M A;  3W8J A;  2R0G A;  2XC2 A;  2H0H A;  1BYE A;  3WGE A;  2O7K A;  3FY7 A;  4OWY A;  1A8L A;  4WBR D;  3UIW A;  3D6I A;  3WT1 A;  1A2M A;  1FB0 A;  4XIH A;  3CMI A;  4LL1 B;  3GN3 A;  2FGX A;  3VWW A;  3GKX A;  4JBB A;  1WMJ A;  11GS A;  2K6V A;  3H4K A;  4OCF A;  5LNK e;  1TW9 A;  1YQ1 A;  4OD7 A;  5ECL B;  3M9J A;  4DSS A;  3UEM A;  1BQ7 A;  2HI7 A;  3GRX A;  4MMM A;  1TRW A;  4ILF A;  4P3Y B;  2V41 A;  1X5E A;  3GL3 A;  5ID2 B;  4EO3 A;  4EDY A;  12GS A;  3CBU A;  2EIQ A;  3QFB C;  4GSS A;  2H1L A;  3TKS A;  3DD3 A;  3RHB A;  1U87 A;  6GSY A;  1Z7P A;  1EV4 A;  1TI3 A;  4NV2 A;  5ECI B;  2L57 A;  1X5D A;  3H8Q A;  3GYK A;  2OKA A;  3BOA A;  1XWB A;  3IRA A;  2TIR A;  1YF0 A;  2A2R A;  3GX8 A;  2C0E A;  5BMU B;  1ERV A;  3LG6 A;  4HUA A;  2A4H A;  4D73 B;  4KDX A;  2H0I A;  4EL1 A;  4IVF A;  1GTB A;  3EYT A;  1PMT A;  1GSU A;  4NHW A;  3ZML A;  5DAK B;  4G19 A;  2ON7 A;  3LXZ A;  3FZ9 A;  4ZB6 A;  3V1W A;  2YWM A;  2LRC A;  4PNF A;  4RUV A;  2DKH A;  3KXO A;  4DVC A;  2L5L A;  1Y1U A;  1V2A A;  2GZY A;  3IR4 A;  4G0I A;  1HNA A;  3VUR A;  2L5O A;  4CY8 A;  1ZMA A;  2MMN A;  2NPB A;  2I3Y A;  1GTU A;  4RI6 A;  1T3B A;  3C7M A;  4MZW A;  1E2Y A;  1OKT A;  3HD5 A;  2LQQ A;  1SL0 B;  4KCE A;  4KDY A;  2CT6 A;  3VFI A;  1OVN A;  2C4J A;  4HZ4 A;  1UN2 A;  3HJP A;  2K18 A;  4MF5 A;  2WJU A;  1SKS B;  1ABA A;  5F0G A;  4IJ3 A;  4GLT A;  1BG5 A;  1M2D A;  1WOU A;  1MDK A;  3M0F A;  4LMV A;  4KA0 A;  5ECM B;  4PUA A;  3TJK A;  3CSH A;  3IAM 2;  1TRV A;  3ED3 A;  2A2P A;  1XIY A;  3MYD A;  1K3O A;  1V58 A;  4XS4 B;  1JZR A;  2DMM A;  4XRD A;  3DGQ A;  5G30 A;  1F6M C;  1MDJ A;  1WIK A;  4TXO B;  4ZB7 A;  4QL7 A;  2UZ8 A;  1W89 A;  3RBT A;  1FW1 A;  1O81 A;  1SK1 A;  4AKI A;  4MCU A;  5IIZ A;  3IK7 A;  1GNE A;  4G9H A;  3GA4 A;  3C71 A;  1X5C A;  3ZIJ A;  1AW9 A;  3CSJ A;  3EUR A;  5A1N B;  5KOW A;  2VL2 A;  4WR5 A;  3LXT A;  1ZYN A;  4JED A;  3ZRD A;  1G6W A;  1FOV A;  4MZB A;  2K9F A;  3CRT A;  1B9Y C;  4EC0 A;  2V6O A;  3LJR A;  5ELA A;  2F3M A;  4LA1 A;  1B48 A;  2AHE A;  3IBH A;  2CVD A;  1OC9 B;  3Q6O A;  1ON4 A;  4K5S A;  3L9U A;  5BRT A;  4Q5R A;  1J0F A;  4NV5 A;  5AIX A;  3QR6 A;  4IBP A;  2VCT A;  5EY6 A;  1EGO A;  3HY2 A;  3ZIT A;  2HT9 A;  1PKW A;  3BJ5 A;  1LBK A;  2OT3 A;  3FHK A;  1TDI A;  5CP1 A;  4PTS A;  4JE1 A;  4N3Z A;  2BTO T;  1F2E A;  5ECO B;  2VKZ G;  2HNL A;  2DKI A;  3FZ5 A;  2N5B A;  3D0Z A;  3KH7 A;  3M3M A;  5DQY A;  2H1B A;  3DWV A;  3TRQ A;  4PXO A;  3VWU A;  2M46 A;  4RI7 A;  2DJK A;  3C8E A;  1OKD A;  3S9F A;  5HFI A;  1GTA A;  4OFM A;  1EV9 A;  2X8H A;  2HZF A;  4WET A;  2WFC A;  1XPV A;  2HSM A;  2VAF A;  2C8U A;  4IW9 A;  3ZFB A;  1AXD A;  1TRU A;  1GSS A;  2HRK B;  1PX6 A;  3L4N A;  2R6K A;  2GSS A;  1YEX A;  5D93 A;  2LTK A;  3LFL A;  1YKC A;  1B9X C;  5L71 A;  1AQV A;  4J56 E;  3KP8 A;  4Z2U A;  2WS2 A;  1O7U A;  6GSW A;  2LJK A;  3IV4 A;  5CRD A;  5F07 A;  5F8B A;  1TJD A;  3MAK A;  4I6X A;  4TN8 A;  3TOU A;  1JZD A;  3LSZ A;  4PX1 A;  2VL3 A;  5D9V A;  4ECB A;  5IMC A;  2C3Q A;  4L0U A;  3IAS 2;  2H66 A;  1Z9H A;  3C1R A;  5DQS A;  4I2U A;  3U5R E;  3KMN A;  5IMF A;  1VF3 A;  2V1M A;  5ECN B;  5ECS A;  2ZNM A;  4Q5N A;  2I1U A;  5J3R A;  4OO5 A;  3UMA A;  3I6A A;  1GL8 A;  1MDI A;  3KD0 A;  3LOR A;  2QSI A;  1U6T A;  1XCC A;  1JZW A;  1XZO A;  2GDR A;  4F9Z A;  1PSQ A;  1SKR B;  1ZOF A;  3IXR A;  1TXX A;  4QQ7 A;  4WR4 A;  3WGX A;  1JFU A;  3ZIV A;  3EPT A;  3KJY A;  5DCH A;  5DVB A;  1PKZ A;  4TR1 A;  2LQO A;  1Z6M A;  4MH3 A;  2GT5 A;  2GQL A;  2QGV A;  1X9M B;  4MJC A;  4KAE A;  3FW2 A;  1ZL9 A;  2KP2 A;  2KHP A;  3ME8 A;  3GUS A;  2RII A;  1TXU A;  2YOI A;  3DXB A;  2X4A A;  2H19 A;  1K0B A;  3Q74 A;  2LRN A;  5A5H B;  4HZ2 A;  1GUH A;  3P90 A;  4G0K A;  2YWO A;  1MD4 A;  2G2Q A;  13GS A;  2LV3 A;  4K1F A;  4KUN A;  3F3Q A;  1ST9 A;  3BBY A;  4YAP A;  3H93 A;  4GSN A;  3CSI A;  1BED A;  3FR9 A;  2DLX A;  1MD3 A;  1GSE A;  3IA1 A;  1TU7 A;  2GSQ A;  3D4T A;  4NHZ A;  4TR3 A;  4FIW A;  2UV8 G;  1ACV A;  4MPG A;  4IP6 A;  2GLR A;  5LD0 A;  4KF9 A;  2C80 A;  1S3C A;  4KND A;  2VM1 A;  3BCI A;  1AAZ A;  4O7H A;  2PPT A;  2ZUP A;  4GQC A;  4JR4 A;  1O8W A;  1SVL A;  3TUE A;  5KOX A;  4X1U A;  1K0D A;  2M80 A;  4K6X A;  5GAN D;  1IYI A;  1DSB A;  1U3A A;  2AB6 A;  3UVH A;  2NVL A;  2C0F A;  1U3I A;  3A2X A;  5GST A;  1QGV A;  2EFE A;  4F82 A;  3TRP A;  1HD2 A;  2JZS A;  1J08 A;  3GH6 A;  3MDK A;  4N0V A;  7GSS A;  2JSY A;  1XW5 A;  1XWA A;  1TK0 B;  4BL7 A;  1QUW A;  2HZE B;  2CAQ A;  3ERW A;  3SWL A;  1X9S B;  2H76 A;  3F6F A;  1G0T A;  2NDO A;  1E6B A;  4IN0 A;  3UOM A;  2CV4 A;  1V98 A;  4GXZ A;  3D21 A;  5D9W A;  1GSD A;  1OE7 A;  3FRC A;  4DSR A;  4ECC A;  4PUR A;  4ZXG A;  3HJM A;  4ZB8 A;  1I5G A;  2IFQ A;  1BAY A;  4PGT A;  1UVZ A;  5A34 A;  5IMV A;  2H0G A;  5J9B A;  4YKG A;  2TRC P;  2L4Q A;  4BVY A;  4KW6 A;  1PRX A;  3FMW A;  4EXJ A;  4K0G A;  5CRW A;  1EWX A;  4WKW A;  3UAR A;  2RUF A;  3NIV A;  4POK A;  2CZ3 A;  3C73 A;  4NPB A;  3QAG A;  3JCM L;  5HFK A;  1G7E A;  4G10 A;  1GLP A;  4EIP A;  4KSM A;  3KTL A;  20GS A;  17GS A;  4L8E A;  4KDU A;  1FOH A;  1URM A;  3EWL A;  3PH9 A;  4IP1 A;  3WGD A;  1M2A A;  1ML6 A;  1HNB A;  3KZQ A;  4MJA A;  3ISO A;  1WWJ A;  1F3A A;  2GGT A;  2DML A;  2IN3 A;  4DSQ A;  4N11 A;  2P0G A;  4GST A;  3NOF A;  4OFN A;  2QA1 A;  4N10 A;  2OA7 A;  4POL A;  3F3R A;  2YN1 A;  2DJ0 A;  1GUM A;  4K7I A;  3GNJ A;  3KCM A;  3PR8 A;  3MSZ A;  3ZYW A;  1DBY A;  2KOK A;  4TVE A;  3QAV A;  3W6G A;  4WF4 A;  2FWE A;  1SK0 A;  5HQP A;  3GIX A;  3FR3 A;  2JSZ A;  3GTU B;  2H74 A;  4K7N A;  4FYC A;  1Z3E A;  3TJB A;  2CVB A;  1KTE A;  2XBQ A;  2E7P A;  5G5E A;  3CTG A;  2HSN B;  5G2Z A;  3MIX A;  2IMF A;  5IMA A;  5IMZ A;  2AAW A;  3EE2 A;  2VLT A;  1TRS A;  1MTC A;  5J4U A;  2PVQ A;  5A5K A;  3L78 A;  1QK8 A;  1F3B A;  1ERW A;  2LNS A;  4MJE A;  4FQU A;  1B4P A;  2H73 A;  3ZZX A;  1AQW A;  18GS A;  2O87 A;  1PX7 A;  4J2F A;  3ZMK A;  2H1G A;  5HFG A;  5KN3 A;  4HI7 A;  2H01 A;  1V9W A;  4EF0 A;  1BG1 A;  1ILO A;  5CAX A;  3GST A;  2AUV A;  5B6N A;  1K0N A;  3WD6 A;  3QMX A;  4I8B A;  2C3N A;  2H6Z A;  4WF5 A;  2YWI A;  2R4V A;  1HQO A;  5LCZ A;  4L5L A;  5CO3 A;  3GKM A;  4F0C A;  1AIU A;  3KP9 A;  2LKU A;  4V2M A;  2HYX A;  3HA9 A;  4XCS A;  2XPD A;  2MMA A;  4AJ7 A;  4I97 A;  4Z7X A;  1EOH A;  2G0F A;  3GMF A;  3A2V A;  3DVW A;  22GS A;  4MJB A;  1T8E B;  2GZP A;  2GSR A;  1V57 A;  4O32 A;  1USB A;  2H8L A;  4TR0 A;  2LS5 A;  5HR2 A;  5KN1 A;  1SU9 A;  2XHF A;  3FYG A;  4USS A;  3BCK A;  4GTU A;  4O5R A;  2QKE A;  1GSY A;  4ZL7 A;  2DIZ A;  2PER A;  3O3T A;  3ZLP A;  1YKA A;  4EDZ A;  3LWA A;  4QMK A;  2Z9S A;  1BF5 A;  5JCU A;  2OE1 A;  2P5Q A;  4IS0 A;  3D22 A;  2EFH A;  2VD1 A;  4LLR A;  3VI7 A;  4Z2T A;  5J4Y A;  4AJ6 A;  2I4A A;  2VIM A;  3ERG A;  4I2T A;  4E68 A;  2FD3 A;  3F9U A;  1K0C A;  3EVI A;  1N8J A;  2JU5 A;  4BVX A;  5E4W A;  4PUF C;  1ZYQ B;  4GDF A;  4YAV A;  5ECH B;  1A2L A;  3DKS A;  3QCP A;  1SJ6 A;  3RHC A;  2RUE A;  2L6C A;  1SL1 B;  2H70 A;  3APQ A;  3IHG A;  4KGI A;  3TKR A;  1N25 A;  2MMZ A;  4EE0 A;  1S3A A;  2C1Y A;  3IHQ A;  3TCO A;  9GSS A;  3DML A;  4X43 A;  1H75 A;  5C00 A;  3VWX A;  1TTZ A;  3WYW A;  4K2D A;  5DAL B;  1A23 A;  1GH2 A;  2HSY A;  4HS1 A;  3DEX A;  3HZ8 A;  3KH9 A;  5KN2 A;  2LJR A;  3I9V 2;  3MWH A;  4V2L A;  3DVX A;  1C72 A;  1SD9 A;  2K8S A;  5J9C A;  3HXS A;  5IPG A;  2NBS A;  2ON5 A;  1SD8 A;  2QC7 A;  2KP1 A;  2HLS A;  3DYR A;  1NSW A;  2DC5 A;  4MF7 A;  1TK5 B;  3A5I A;  4K2X A;  4YH2 A;  5IM9 A;  5IQY A;  3KGK A;  4IGJ A;  2B3S A;  2FUG 2;  3TGZ A;  5ID2 A;  3VPQ A;  3TKS E;  1Q4J A;  3GL5 A;  3HDC A;  4BPY A;  2YNX A;  4F03 A;  2H30 A;  3PPU A;  2FA4 A;  3HJO A;  1VGL A;  1WJK A;  3GX0 A;  1GUL A;  5HR3 A;  2FNO A;  4BWQ A;  2GQK A;  4BA7 A;  3HYP A;  5ECK B;  4PNG A;  4BWS A;  4ICY A;  5G31 A;  4MP4 A;  4DSS B;  1I9D A;  2KUC A;  4MH2 A;  5FT3 A;  3HMJ G;  3EIN A;  1K0O A;  1XVQ A;  1NM3 A;  1FVK A;  2YV9 A;  3APO A;  3TDG A;  1ERU A;  5D8I A;  1EOG A;  1R7H A;  4EIQ A;  4O5U A;  5BMU A;  2PVO C;  3HVS A;  4FYU A;  2L4C A;  1T00 A;  1K3L A;  5G1L A;  4JR6 A;  4QL9 A;  4D73 A;  3HHV A;  2YAN A;  2H1A A;  1M99 A;  4MF6 A;  3TOT A;  5B7C A;  2B5X A;  2IL3 A;  5FWG A;  2PN8 A;  2N5A A;  3W8S A;  5AIV A;  2JAD A;  5DAK A;  2E2M A;  1PD2 1;  4MDC A;  2F51 A;  1SK2 A;  3IC4 A;  4ZIJ A;  2YJH A;  3TKP A;  1QXH A;  3RAZ A;  1Z5Y E;  5DJM A;  4AGS A;  2VL9 A;  3E3E A;  2CZ2 A;  1NW2 A;  2ZCT A;  10GS A;  2EIO A;  1NHO A;  1XWG A;  2X8C A;  5D9X A;  4KH7 A;  3J7Y b;  3R2Q A;  2P5R A;  3M1G A;  1PQN A;  4ECI A;  4J57 E;  2LUS A;  4ZBA A;  3WT2 A;  1M2B A;  2PWJ A;  3GSS A;  1G7O A;  1YEP A;  4ULX A;  3VK9 A;  4ID0 A;  1RK4 A;  1ZZY A;  4H86 A;  2GST A;  3U6V A;  2ES7 A;  1GSQ A;  2B7J A;  1F37 A;  1OE8 A;  2VCX A;  1T4Z A;  1Y25 A;  3MNG A;  4ACS A;  2H75 A;  4KSO A;  2F8A A;  3N5O A;  1A0R P;  4XS4 A;  1BJX A;  4V1A g;  3CRU A;  4K8M A;  2E2G A;  1GRX A;  3L0H A;  4XTS A;  1JHB A;  1TP9 A;  2LRT A;  4TXO A;  4ISD A;  5HR0 A;  3QD9 A;  3RPN A;  2H71 A;  3D5J A;  4NAX A;  4EVM A;  1RQM A;  2VUP A;  2PU9 C;  3G7I A;  1RW1 A;  4ZBB A;  5KN0 A;  2AYT A;  1A0F A;  4TW5 A;  3F0I A;  5F06 A;  3KMO A;  1WP0 A;  1THX A;  1T4Y A;  2A4V A;  2FA8 A;  5A1N A;  1XVW A;  3A5W A;  3VI5 A;  2AJQ B;  4W66 A;  3IE3 A;  5ECQ B;  1BX9 A;  4X4J A;  2O8V B;  4FH8 A;  6GSV A;  4WEY A;  1K3Y A;  4GQF A;  4XHM A;  3D4M A;  3GV1 A;  3I43 A;  2XBI A;  3M9K A;  5DDL A;  5D9T A;  8GSS A;  1OC9 A;  2OJL A;  5EL8 A;  1PN9 A;  4YQV A;  3HVV A;  1O73 A;  2R0P A;  3GHA A;  4IJI A;  4LL4 B;  3F6D A;  5FHI A;  1Y6E A;  2FWF A;  2YWN A;  4DEJ A;  5ENU A;  2WB9 A;  3VLN A;  1ZCP A;  2X99 A;  1TU8 A;  2QA2 A;  2O5V A;  4MAB A;  3KEB A;  2IMI A;  1XOB A;  1ZGN A;  1PN0 A;  1R26 A;  2O89 A;  2H72 A;  1WRY A;  2RM5 A;  5EPF A;  3APS A;  6GSX A;  1JLW A;  2A2S A;  5IO0 A;  3UJ1 A;  2B1L A;  3ZRE A;  4MLY A;  5F05 A;  3QAW A;  2EC4 A;  5ECP B;  2WRT A;  1UC7 A;  19GS A;  5J40 A;  3GUR A;  3PGT A;  1YY7 A;  5B6M A;  1EP7 A;  4TRX A;  2GTU A;  1B4Q A;  2HRK A;  3TKS C;  4NWY A;  3F4S A;  2VCQ A;  4L0W A;  1EGR A;  2CAI A;  1SJZ A;  4HJM A;  3BD2 A;  2IWT A;  1VF1 A;  1ZYE A;  1O85 A;  4KCA A;  2DSA A;  3VWV A;  4EUY A;  5IMD A;  2GQM A;  3ZFL A;  5E59 A;  2VO4 A;  4HOJ A;  2PGT A;  4POB A;  2HSM B;  2WGR A;  4PQ1 A;  1TKD B;  4LMW A;  5IO2 A;  3US3 A;  2YCD A;  4HEA 2;  4ZIL A;  2R5G A;  3UAP A;  3P8W A;  1F9M A;  1GP1 A;  3C1S A;  3FZA A;  3E0U A;  4X0X A;  2V6K A;  2FLS A;  5H5R A;  5J41 A;  5CYY A;  2VCZ A;  4OCE A;  2MZC A;  4EKZ A;  5B8B A;  4F2I A;  1Z7R A;  4E8H A;  2OE3 A;  4GCI A;  1XBS A;  1A8Y A;  2O85 A;  5CRG A;  3LEF A;  2REM A;  4HU9 A;  3TRX A;  4ECJ A;  2B5Y A;  5D96 A;  5A4U A;  2HQT A;  2JAC A;  3Q19 A;  4YKF A;  2BJX A;  3G7Y A;  4XS6 A;  2D2Z A;  4O5Q A;  3DRN A;  3ZVJ A;  2LEG A;  5DCG A;  1XWC A;  1WE0 A;  3DIE A;  5JCG A;  1R5A A;  4JU5 A;  5HR1 A;  1O8X A;  2EIR A;  5CRE A;  5A5H A;  2ALB A;  4N0Z A;  4K9Z A;  2B1K A;  4KB3 A;  1FO5 A;  1OAZ A;  1EEJ A;  2J23 A;  3A2W A;  3IDV A;  2EFC A;  1M9A A;  3HKR A;  3Q18 A;  2VOC A;  1NHY A;  4MK3 A;  1FVJ A;  1DE1 A;  4OMV A;  5GZZ B;  2R2J A;  3EU3 A;  3O76 A;  4GF0 A;  3ZL5 A;  1VF4 A;  2HXK A;  4TR1 B;  2MMO A;  3GH9 A;  2X49 A;  3R3E A;  4MNN A;  1LJR A;  2VLV A;  3HZ4 A;  5B8A A;  5H5S A;  4K5R A;  1PA3 A;  1AUC A;  3LYK A;  1SJI A;  4IQ1 A;  1CQH A;  2CA8 A;  4NMU A;  3L9S A;  3IPZ A;  2DIY A;  1GSF A;  4WXT A;  1TI1 A;  3G9B A;  2YP6 A;  1GNW A;  3IK9 A;  4IEL A;  2VL2 C;  4FYB A;  3RPP A;  4TR4 A;  2R37 A;  4JZQ A;  2I9H A;  5A4W A;  1J9B A;  3EC3 A;  1TK8 B;  2C0G A;  1CQG A;  1FB6 A;  2TRX A;  2OBK A;  3UL3 A;  4HU7 A;  2CX3 A;  1XFL A;  4KX4 A;  3IOS A;  2DBC A;  2K8V A;  4MPF A;  5JCW A;  3QOU A;  2HE3 A;  4ZBD A;  3SBC A;  3EMP A;  6GSU A;  3EU4 A;  4XS1 A;  2YJ7 A;  1K0A A;  1YJ6 A;  3KM6 A;  4IHU A;  3UBK A;  5AGY A;  2HZE A;  4CHS A;  3FKF A;  2IMD A;  4NXI A;  2OBI A;  2LNT A;  2VLU A;  4YQU A;  3IC8 A;  3FK8 A;  3H79 A;  1XW9 A;  2HSH A;  3VPT A;  1TOF A;  4GRF A;  2HRN A;  5CNW A;  3N9J A;  2X8G A;  2JZT A;  4K7O A;  2B7K A;  3QPM A;  1LU4 A;  1XXU A;  3G7J A;  2MYG A;  2C3T A;  3P7X A;  1Q98 A;  2GVP A;  4POM A;  2EFD A;  1AC1 A;  1V40 A;  1SL2 B;  2VCV A;  3K8N A;  3LW9 A;  3UBL A;  4CY6 A;  1DUG A;  5H5Q A;  5J5N A;  4BL7 B;  2YV7 A;  4G01 A;  4L5O A;  1HYU A;  2WDU A;  5COH A;  1KNG A;  1HNC A;  3GKK A;  1PGT A;  4HDE A;  2IFQ B;  2IMK A;  3EMX A;  1SVO A;  1QMV A;  5A34 B;  5ELG A;  2F9S A;  6GSS A;  2H1D A;  2B5E A;  1B8X A;  2CQ9 A;  3M8N A;  2H6Y A;  2GT6 A;  2HRA A;  1GTI A;  1SEN A;  4BVY B;  6GST A;  4KE3 A;  2DJJ A;  3A3T A;  4AJ8 A;  5IOW A;  2FHE A;  5J47 A;  3QDN A;  1R4W A;  4JRR A;  1A2J A;  1ZYP A;  2M72 A;  3CXG A;  4HQZ A;  5GAP D;  5JWR B;  1QFN A;  4WBJ A;  1SVM A;  3J7Y k;  5JWQ B;  4IKH A;  5IPH A;  1THO A;  5C04 A;  3RDW A;  3FR6 A;  1GLQ A;  1FAA A;  2IJY A;  1ERT A;  1R5P A;  2GS3 A;  4ZL8 A;  4Z2R A;  5AN1 A;  2HRF A;  1OC3 A;  2J9H A;  2OAC A;  4PQH A;  4IQA A;  3KIJ A;  2F8F A;  2YPM A;  3GTU A;  2MBT A;  4RQX A;  4Q5F A;  1VRS D;  1YDK A;  2OE0 A;  3TJF A;  1XW6 A;  2NTO A;  3H1N A;  2IIY A;  2H6X A;  2FY6 A;  5GSS A;  1EEM A;  1K0M A;  5D73 A;  4E8E A;  2PMT A;  2VD0 A;  3HCZ A;  2LJA A;  1X9W B;  4MA9 A;  4O92 A;  1QQ2 A;  2BMX A;  1PL1 A;  2HSN A;  2XPE A;  4AKH A;  1H4O A;  2PBJ A;  4V1A p;  4ML1 A;  2WCI A;  2KLX A;  3E9J B;  4F0B A;  3LYP A;  1JLV A;  1OYJ A;  2HFD A;  2DJ1 A;  5ABR A;  1Z6N A;  3CYN A;  5INY A;  2WUL A;  2JL4 A;  3FEU A;  1G6Y A;  5A4V A;  2X64 A;  3LQ7 A;  3TKQ A;  3ERF A;  4HQS A;  2IME A;  4ZL9 A;  1GUK A;  2FWG A;  1U88 A;  3UVT A;  3L9V A;  14GS A;  4FO5 A;  1GWC A;  2FCH A;  1T1V A;  3TJJ A;  4TKY A;  16GS A;  4HJ2 A;  4G0L A;  1EP8 A;  1M9B A;  1FHE A;  1T7P B;  2CX4 A;  4Q5Q A;  5JWO B;  3HVX A;  3ZVJ D;  5G1K A;  3KTB A;  2YZU A;  3TU3 B;  4MZC A;  5J4V A;  1AQX A;  3CWG A;  3GKN A;  1XWK A;  2P31 A;  3TJG A;  3QFA C;  1M7T A;  1VF2 A;  3ZTL A;  5IOX A;  4OFT A;  4OO4 A;  2LST A;  4YQM A;  3AY8 A;  1YZX A;  1MEK A;  1O6J A;  4TXV A;  4AKX B;  3PIN A;  4V2N A;  1DE2 A;  4N30 A;  3NZN A;  3OR5 A;  3F4R A;  5EVO A;  1IYH A;  5CRH A;  2R3X A;  3P2A A;  4I5Q A;  2V32 A;  1OC8 A;  3TB2 A;  2OAD A;  1KBN A;  1FG4 A;  1YF1 A;  1UA5 A;  2VM2 A;  2L6D A;  5G5F A;  4CDO A;  4G2E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...