3D1JA

Crystal structure of e.coli gs mutant dmgs(c7s;c408s)
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
475
structure length
475
Chain Sequence
MQVLHVSSEMFPLLKTGGLADVIGALPAAQIADGVDARVLLPAFPDIRRGVTDAQVVSRRDTFAGHITLLFGHYNGVGIYLIDAPHLYDRPGSPYHDTNLFAYTDNVLRFALLGWVGAEMASGLDPFWRPDVVHAHDWHAGLAPAYLAARGRPAKSVFTVHNLAYQGMFYAHHMNDIQLPWSFFNIHGLEFNGQISFLKAGLYYADHITAVSPTYAREITEPQFAYGMEGLLQQRHREGRLSGVLNGVDEKIWSPETDLLLASRYTRDTLEDKAENKRQLQIAMGLKVDDKVPLFAVVSRLTSQKGLDLVLEALPGLLEQGGQLALLGAGDPVLQEGFLAAAAEYPGQVGVQIGYHEAFSHRIMGGADVILVPSRFEPCGLTQLYGLKYGTLPLVRRTGGLADTVSDSSLENLADGVASGFVFEDSNAWSLLRAIRRAFVLWSRPSLWRFVQRQAMAMDFSWQVAAKSYRELYYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Crystal Structures of the Open and Catalytically Competent Closed Conformation of Escherichia coli Glycogen Synthase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Glycogen synthase
total genus 158
structure length 475
sequence length 475
ec nomenclature ec 2.4.1.21: Starch synthase.
pdb deposition date 2008-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00534 Glycos_transf_1 Glycosyl transferases group 1
A PF08323 Glyco_transf_5 Starch synthase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3d1jA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3d1jA02
4MICA 3COPA 1Z6QA 2QRMA 3ZCUA 3MTAA 2VCEA 2KS6A 4GZ5A 2HY7A 4GYWA 2C9ZA 3HBNA 4YI3A 3QHPA 4X6LA 4L22A 1GPYA 2GEJA 2XMPA 2SKCA 3UYKA 2GJ4A 4CTNA 2SKDA 3NB0A 1JIXA 4NEQA 2VSNA 3EBOA 4W6QA 3MT9A 4GYYA 3WAGA 4BFCA 3BD6A 4NESA 3ZCRA 4AY5A 2XGOA 1M5RA 2PYIA 3OKCA 1NZFA 3CUYA 4RIEA 5IKPA 3OTIA 2X0EA 3BDAA 2WTXA 2QLLA 3G2KA 2Q6VA 4N3AA 3S27A 1C3JA 3E3NA 4HWGA 1KTIA 1IXYA 1C8LA 1L5RA 3VUEA 3WADA 2XA9A 1FA9A 2G9RA 2IW1A 4LDPA 3S28A 3T3GA 4N9WA 4KQ2A 3E3OA 4AMGA 4EJ2A 2F3UA 3T3EA 5BNWA 1WV0A 1XV5A 4N3CA 1L5SA 2G9UA 3OTGA 4XIFA 4N3BA 1ABBA 3CUTA 3H4TA 9GPBA 3CX4A 3ZCSA 2O6LA 2QN8A 4MI6A 1P2GA 2ECPA 4F97A 1Y8ZA 2AW3A 3Q3EA 2FETA 1Z6PA 4NC9A 4GZ6A 3D0RA 2PYDA 2AV6A 3MT8A 1FU8A 2YJNA 3G2NA 3MS2A 4GPBA 4BQEA 1FTQA 2PQ6A 2XA1A 3RSCA 3MQFA 2AZDA 1LWOA 2QRQA 1WUYA 2ACVA 3ZCVA 1VGVA 3CEJA 1SXPA 1WV1A 1NOJA 2R66A 4WADA 1GGNA 2ASVA 2QN1A 3PE4A 1PYGA 2IYFA 3OY7A 1E4OA 2F9FA 4M83A 3L7CA 5ENZA 3RT1A 3TSAA 4XI9A 4QLBA 2XA2A 1Z8DA 3G2IA 2BISA 1C50A 2GPAA 4G2TA 4CDRA 2ZB2A 1AXRA 3MBOA 2X6RA 3T3HA 1GPAA 1BX3A 1XOIA 4KQMA 2XCUA 2SKEA 3S0JA 1P29A 1EM6A 2FFRA 3MRTA 2BGUA 3GPBA 3T7DA 3BCSA 5IKOA 3DDWA 3WC4A 2BGTA 2QNBA 2GPBA 1IIRA 4GZ3A 4RELA 1NZDA 1K06A 4WHMA 4AN4A 5C1DA 1FS4A 1PN3A 1L5WA 2BFWA 3UYLA 3SYRA 2IV7A 2QN9A 3BEOA 3PE3A 4PQGA 2VCHA 2F3PA 2H1HA 3L7DA 4WACA 4YUAA 3DDSA 4CTOA 2QN2A 4X7PA 1F0KA 4MRAA 1E1YA 1UZUA 1FTYA 3C4QA 3L79A 5GPBA 5JTUA 3NP7A 5TMEA 1XC7A 3NC4A 3O3CA 3EBPA 1LWNA 1P4GA 4X7RA 2QLMA 3TAXA 4HLNA 1PNVA 3OKPA 2IEGA 2R60A 3FROA 1WW3A 3G2JA 1RRVA 5DXFA 1JIVA 4Z5XA 3C4VA 4M60A 3NP9A 2AMVA 2JLBA 4RENA 4YI5A 3QKWA 1QKJA 5TMDA 1L5VA 3OY2A 3CUVA 2XGMA 3S2UA 3L7AA 3RHZA 1YGPA 3BCRA 5JTTA 1NLMA 3T3IA 4X7MA 1RZUA 2R4TA 3T3DA 1FU4A 4LEIA 1AHPA 2G9QA 2ATIA 3CEHA 3NCHA 2X0DA 1WUTA 4EL0A 1JG6A 3E3LA 3VDNB 1A8IA 2IUYA 1NOKA 4KQ1A 1WW2A 1GZ5A 8GPBA 1J39A 1Z62A 4CTMA 4RIIA 4AMBA 2XCIA 1L5QA 3DD1A 1NOIA 4BQIA 3HBFA 3DZCA 2GEKA 3H4IA 3S29A 2OFFA 2IEIA 2IYAA 3OKAA 1NVKA 1L7XA 4F9FA 4FZRA 4RIHA 1JIUA 2VG8A 2X6QA 3IAAA 1Y6GA 2GM9A 3MS7A 3GUHA 4EL5A 3G2LA 2IV3A 1C8KA 1H5UA 3OT5A 3G2HA 3MTBA 4EKYA 3CUWA 3BCUA 3ZCTA 4MI3A 2P6PA 2R68A 4FKZA 3BD7A 3CEMA 5LQDA 1F6DA 2QRHA 1V4VA 3L01A 2PRIA 2QN3A 4EKEA 2JZCA 2GPNA 3C48A 3VUFA 5DLDA 3AMVA 4RIFA 1QM5A 2XGSA 1B4DA 1RZVA 5D01A 4REMA 3D0QA 4MHSA 3RSZA 1UQUA 1XKXA 1L6IA 5TMBA 3D1JA 7GPBA 4BQFA 3MTDA 3Q3IA 1EXVA 5D00A 2G9VA 1GPBA 2QZSA 2QRGA 3MS4A 2PRJA 2VSYA 3MSCA 2R4UA 3ZCQA 1SXQA 1O6CA 3MRXA 1Y6FA 1K08A 1YA6A 1P2BA 2JJMA 3MT7A 1PSWA 2QRPA 2H1FA 4M7PA 3MRVA 5DU2A 3L7BA 1HLFA 2ACWA 3SYMA 1XL0A 3CV3A 2X0FA 1GG8A 4RIGA 4N39A 4MHOA 1FC0A 6GPBA 2F3QA 3OTHA 2QLNA 1XL1A 1JEJA 1GFZA 3ZCPA 3HBJA 3TOVA 3T5TA 2C1XA 3VDMA 4F96A 1JG7A 2C1ZA 2FF5A 5TVGA 3Q3HA 3NPAA 1UQTA 2C4MA 1FTWA 2GT1A 3HBMA 4MI9A 2F3SA 2QN7A 5HXAA 3BD8A 1FU7A 3NAZA 1P4JA 5I45A 4AY6A 3IA7A 3CUUA 4RBNA 1P4HA 1P2DA
chains in the Genus database with same CATH superfamily
5JBNA 4C4SA 1LK0A 3K32A 4R1OA 4RA9A 2E1RA 3TOZA 1SK8A 3TQQA 1NYQA 3HYRA 4V0SA 2I6QA 1AUPA 1KZGB 4HFNA 4CI0B 1QIJA 4G1BA 1HDGO 4CG1A 4X97A 4YUZA 2VCEA 3G0HA 3V1NA 2Z9BA 1QH8A 1T4CB 1ECLA 5CVCA 3Q0TA 1JVSA 1S7GA 1UP7A 1Z18A 4JOQA 5DOVA 2UAGA 3HDGA 4V1CI 2ZSDA 3NUZA 4JVSB 1I3OA 4DJJA 4YUWA 5HGXA 2C9DA 3CPJB 4KO4S 2OD7A 5CR9A 3T3OA 1R4NA 3AEXA 4HC4A 2WAOA 2H8KA 3HXKA 1XMSA 2HJHA 3ESYA 1KY2A 2ZRFA 1GM5A 3QY9A 5AW7A 4HDCA 4RYLA 2UZIR 4EP1A 4F5YA 3PC3A 1N5RA 4RQTA 1VE5A 4W6QA 4LA4A 5AH0A 2MTBA 3KTFA 2J9ZB 2WU0A 1Z56C 5DGXA 1E9EA 2VJAA 5CB4F 4D80A 2W00A 3ZC3A 4F84A 4G97A 2ZVQX 1OKKD 2AEJA 1NW8A 1N33B 4NZYA 1Q92A 4UOQA 4EBBA 1T3HA 2FG5A 1AGYA 3VTKA 5ELMA 4W9NA 2QY6A 3W78A 4RJIA 2ERCA 3FNHA 4M9QA 4MV1A 2JFFA 3D7MA 5GIPE 3JWHA 2PGXA 3CCBA 4LX8A 1RVDA 1N32B 4YP7A 3OH8A 4H77A 4ITRC 3V80A 2BMJA 3AL2A 3RTCA 4CMIB 2MYTA 5LIPA 4X1YB 2G6TA 3G2QA 3G2KA 3SKYA 2RBKA 4Q48A 4DC1A 3QVWA 4IQFA 3JYQA 2C2OA 5SICE 1JHDA 1PJCA 1HG0A 2ZYGA 3KOYA 3VPGA 1ZX1A 5CDHA 4B3GA 3WGKA 5COAA 5IXYA 4LDPA 5JRZA 4U7TB 4PRLA 3DC7A 4FOOA 4AO6A 2OV1A 3SEZA 3DAHA 5CFZA 5ICSA 1N5MA 2IQ5A 1KO5A 3MUOA 4HGOA 4X20B 3OESA 3WG9A 3VI4B 4F1JA 5THQA 4UD6A 4BU1A 3R1IA 5A9RA 1PEKE 4O3FA 3LSYA 5A4DA 1MTOA 4QGFA 3GC6A 3H9UA 3OF5A 3R5TA 2HREA 1RM5A 1Y3CE 2W2XA 2P2YA 1IVNA 4V02A 3OCJA 4YK7A 3V2UA 2Y1XA 2NTEA 4MWZA 1XPRA 5ESDA 1GZSA 1W34A 4Z4CA 4GAEA 3QFFA 2JLRA 2QUZA 1CULC 1SKYE 2D59A 2PH5A 3KKZA 3N6RA 3KHKA 3ZR4B 2BOVA 5J59A 3V9AA 2A4MA 2X2FA 2FSVC 3ZIDA 4XE5A 1NONA 1P7PA 1SBHA 4DV2B 3LY9A 2ZTMA 1ESDA 4JGIA 2O8EB 4FZ5A 3WXMA 1I0ZA 3IGFA 1FPQA 4Z8YA 2WHYA 4BATA 5BQ3A 1AQIA 4YWHA 3VU0A 2EG5A 5AD1A 1Q17A 4RZ2A 4OB6A 5B58C 5CDFE 5AOVA 2YN4A 4UCXA 2AFHA 1I94B 4OK5A 4KXXA 4EI9A 2J08A 1E2LA 2FETA 3J80A 2ZR8A 5D8DA 3UJ3X 4PPFA 3C3PA 4M6WA 4WK0B 3PB3A 3P20A 2WWHA 1EDZA 4OLBA 1Q0PA 4EB8A 4QNNA 1Y4UA 4LJ8A 2ZYHA 3P27A 4PXSA 4X8HA 1VA4A 4C05A 2YJNA 5BWCA 3TZBA 2Q3BA 3A3YA 3CYFA 1RRFA 2AFIA 2OHXA 4H7HA 1HFJA 3BGVA 3FF1A 3FOBA 2XB4A 3F3SA 3NTLA 4KSCA 4Z8XA 1Z16A 4HF7A 2OLKA 2P2CA 4U9UA 3RWMB 3RYHA 4A5OA 3NHFA 1P91A 1C30A 2B30A 2J0UA 2NZ8A 4EI2A 4RUKA 3T1HB 3IDZA 2OHJA 4CI9A 5TARA 1TF2A 4GRAA 5L51A 4ILEA 1NNI1 3CEJA 2NSDA 2P4QA 2VDUE 5EE5B 1LF0A 2WUWE 4K8RB 5L3RA 5JFGA 3EEFA 1WV1A 3M4JA 2FOXA 5DNYB 4I9FA 1WY7A 2VO1A 2A5LA 3IERA 4CLEA 2TECE 3WOHA 5KOHB 2MWMA 4A4DA 1TYZA 1Y5LA 3B7GA 2GUWA 4BKQA 2XTMA 2FUG6 2ZROA 3MF4A 4NBSA 4BC1A 4M83A 4Q93A 3PL5A 1BSVA 5AW0A 2HXSA 2PUTA 2Q5JA 3WL5A 4ER0A 2HMUA 1CX9B 3OD5A 3KQNA 3BXPA 4LI3X 4Z0HO 3ZY5A 4BTLA 1GGJA 2RONA 1MHTA 3TMKA 2BGNA 2C82A 2IXEA 1TVKA 2YWCA 2Y1OA 3CBGA 3VI3B 1SG9A 5MFZA 4QEZA 1C9MA 1WXIA 2K2QB 1MO5A 5DHFA 3LUBA 2RHLA 3Q1LA 4G41A 2AZMA 2ZB2A 4HQNA 2XTNA 1T2FA 2GRUA 3AHCA 3EODA 1XGKA 2YX1A 1DBIA 3LE8A 2J7PD 3DXZA 5B2FA 5LD2C 3GJ6A 1BX3A 4KQMA 3D02A 2YWDA 1ACMA 2IOFK 3C87A 5DI3A 1KYVA 4YRMA 3JVVA 4MIEA 4RPGA 2W4IA 3EQ6A 3HXPA 2W0MA 1XVLA 5GGYA 2QDXA 5D3MB 1P2TA 4I1OA 3WIEA 3T7DA 4EVQA 1OXUA 4Q21A 2Z6AA 2VF5X 5BSWA 4POOA 1RKXA 1X7ZB 2E5WA 1Y4SA 3A6KA 2X1VA 4DR1B 3FDJA 1C3VA 2GXUA 2IEYA 1K6EA 2HV9A 1Q6ZA 4F4CA 1QGED 1UDBA 1V8FA 4N12A 3GWGA 2C4KA 3OIWA 4AG6A 4IDHA 4FB4A 2OP0A 3OM8A 4MKHA 4HEQA 2NP7A 1K06A 1OIWA 1DQRA 2ZQ5A 4Q66C 5KHAA 3U31A 4WFIA 1FS4A 1RYDA 4ZC1A 1PX2A 5I7HA 2G3YA 1D2CA 1GKYA 5AVQA 1M66A 4FGKA 1T6NA 1V41E 1WB6A 3D3QA 1A8UA 1ZL0A 3M6WA 1MP0A 3PFGA 3KZCA 2I4MA 2IHTA 1CERA 3NDBB 1PV1A 2DWQA 1Z4OA 2FWMX 4JNCA 3P9CA 3AG5A 1MVOA 4M2LA 2ZJ7A 1Z2AA 1W88B 1JKMA 2I66A 3O2SB 4B3IA 4ZDWA 1G0NA 3EEYA 3SJUA 5IVIA 4EFKA 5C81A 5I3ZA 5LZ4A 2DOKA 1S2NA 1QWOA 2H2AA 1KS9A 2JPDA 1YE3A 3COSA 1XYYA 2RGCA 3WIBA 1XDGA 4O4IA 3GPLA 4DCSA 2GZAA 2EWWA 4A0HA 3HE3A 4G8DA 4LGCA 2WAAA 5B64A 5I9NA 3P4UA 3PHIA 3NC4A 4I4CA 4XWGA 3P2YA 3ON5A 4JITA 5AK0A 1SR8A 2IIBA 4RGYA 1E4VA 5D1NA 1EVEA 2FA9A 4YRGA 3LXRA 1E8DA 3JWGA 4N5NA 5EIAA 3L6OO 2R1VB 4M37A 1ICIA 3GLQA 4DWOA 1TJ4A 2HSDA 4ZAZA 3MEQA 2OENG 1OLSB 1T1RA 1WMDA 3PGVA 1E6EA 4B3DA 1W5BA 4YRTA 4DEXA 3DMGA 4WUTA 4C29A 2QXUA 3GGCA 4GSKA 3EZ6A 4I4LA 5EWMB 1DEOA 2HBYA 5FUYA 3HNOA 4MR8A 1N5DA 1XTTA 1W7AA 1FVXA 4YI5A 1C4XA 2JHGA 1EUZA 3UA4A 1J1UA 1I9CA 2PX3A 1XI2A 2D8AA 4RMHA 1DUVG 1HMPA 2BT4A 4GC5A 4N5DA 1T1EA 1A5TA 3D4NA 3DWFA 4WXMA 1PFVA 4EMUA 3S81A 2B4YA 2EW2A 1MB0A 3NFRA 2P2LA 3W6PA 1S8FA 3D7SA 4ZO7A 3ENQA 2WT8A 3CBQA 1ZW1A 1DDGA 4CM4A 2G04A 4AXBA 3I5YA 4MAMA 2QBYB 2CNDA 2W4QA 4GHWA 5A2GA 3FBWA 1YA8A 4LJRA 3VBCA 2YWJA 4H1VA 3ZNNA 3GVPA 3FNFA 1GCOA 3WLOA 3WISA 5CNJA 1CC1S 4QVKA 5IJ0B 5U9CA 1QFYA 2QTLA 4PGGA 2I1WA 3WJ2A 2JI9A 2UV8A 3UCXA 3U6KA 4IVPA 4KWIA 4J6EA 1O6ZA 3IE0A 1C4OA 1GZ5A 4AMVA 3BAZA 3L1VA 4JLUA 4U9HS 2VDMB 4WY8A 4ARCA 1J20A 1EJ6A 4UDOA 4AJ9A 4B76A 1B41A 2ZRIA 1Y1QA 3D8RA 4ZK2A 2B37A 3CF4A 3UUFA 1JMVA 2D4AA 4MW4A 3ESXA 2YMLA 2H16A 1N3BA 1NOIA 4RFVA 4B84A 3K1TA 4ETWA 1NVTA 1YKGA 4IH4A 1K1EA 4JT2A 5HS6A 1ADBA 3AM1A 2O8VA 3ISJA 3ZLJA 1O3YA 1YU9A 2Z4TA 3UAVA 5DFAA 4QHTA 4UPEA 3RVQA 1KEWA 1RLTA 2FSHA 1CR2A 2X23A 2Y3IA 1ACJA 3DEFA 2X1HA 3QQPA 3X2FA 2ODTX 3AWDA 3D5TA 3IQHX 3QXHA 5AI8A 1Z4PX 4GECA 1R4AA 2IEIA 4YRSA 1FYDA 2WT4A 3GCZA 2VAWA 1R6TA 5KC9A 4X9XA 4NJMA 3BXEA 3RS4A 1L4YA 1JDSA 3DBRA 4F9FA 1GAQA 5KNDD 4DCGA 1PLKA 2ZBFA 1GGEA 1C1HA 1VG0B 3LUAA 4HWSA 3EOZA 3IUBA 4GO1A 2H3EA 3ZDBA 9LDTA 5IAGA 4FXOA 4UNSA 2BEJA 2JJ1D 5K51A 1QU3A 3RC1A 4BZZA 1UP6A 4X6UA 4MS4B 2H7CA 3KYCA 1DJNA 4KHZA 4JASB 2W2LD 4HKTA 4ZREA 1CF4A 5DE3A 3IAS6 2ZS8A 1G38A 4HK4A 4KXYA 4BHTA 1AO3A 1AKMA 3E9DA 2Z57A 4UHEA 5CEFA 1CETA 4V0ME 2UXDB 1KJ8A 3TE6A 3GHYA 1SUCA 3QJ5A 1WEHA 4WMLA 1L3IA 1GNSA 1LPPA 1OX6A 2IHZA 2J46A 2XYRA 1WXEA 4ZVPA 3ZQKA 5H9WA 3Q5EA 3FYHA 1BVHA 4RVDA 2I80A 2XZPA 3U4CA 3EFBA 3BD7A 3FNQA 3QF4A 5DTMA 2IUSA 4A8PA 5JD3A 1A76A 1NNSA 2AMFA 3ZZ1A 4CG2A 1TC1A 1W46A 3MGGA 1I33A 2QRHA 1V4VA 1Z13A 3AB3A 2NU9B 2UDPA 4YMGA 4U2EA 2UYOA 2ZWAA 3TPCA 4G1UC 5LZ7A 5HYVA 1JTFA 5KYWA 3MD0A 1GT6A 3HMQA 4RIFA 2W2KA 1OX5A 4BEVA 4C3OB 4DLRA 4XGIA 1R66A 1NXOA 2O19A 4RV5A 4GGMX 4TS3A 5GTDA 1A7UA 1KGDA 4BRZA 4PCVA 1UMBA 4C7VA 4MMYB 4KO1S 3K0FB 1KWKA 1F7UA 1D03A 1VIVA 2BMWA 1M3SA 4WJZA 4X84A 4GKAA 2RK4A 3ZYZA 4P80A 3KQUA 2Z4RA 5DHQA 4Q4HA 3WWPA 4MPPA 4C7OB 4KR3A 4WGFA 5EE9A 1EXVA 1GPKA 1XA0A 3OZVA 4CQNA 2ES4A 2IHNA 3C0KA 4ALLA 2VSYA 4DV0B 1W8IA 3KR1A 3VNUA 1KFKB 4QAJA 2EZ4A 2V6IA 4DANA 2E3JA 1KI9A 3PSAA 1NATA 2ZYSA 3M89A 1L4UA 3NYQA 4KX3A 3AP2A 1U9ZA 2CF6A 3KUUA 4QQKA 4WK2B 4KWHA 3IMCA 1ATZA 2JGLA 2HMVA 2OBMA 3L1JA 4CF7A 3SC2B 2LE0A 5GVRA 1B2LA 3JS5A 1EQUA 4FHZA 2AR0A 4FM9A 2R9VA 2GKGA 1KVTA 3BMQB 4G5RA 3LBFA 3VR6A 2WDPA 3RWOA 2C7QA 5BNFA 1TC2A 2AE2A 4OQLA 4OHZA 1FC0A 2YS6A 3RTGA 2LCQA 1XZQA 2FMUA 5J5CA 7AT1A 4Q02A 4M0EA 2P27A 2LIPA 3OX1A 3S99A 5THKA 4CM6A 2DFNA 1AKWA 5KX5B 5LZ8A 5TLSA 4EB0A 2ZJYA 1T6YA 4GC9A 4J0DA 4PNEA 5IANA 5L40A 1UBLS 1NX6A 2FW0A 3KKKA 5FBQB 1EB9A 4RNCA 5CW1A 1R0KA 4F2GA 1U0SY 4MWSA 1C3LA 2C3OA 4D6YA 2PA0A 1EB8A 3M0EA 4XDHA 2HSWA 2GZRA 1T91A 1UFRA 3MCTA 3ABSB 3HA2A 3ISVA 1D3AA 1R0ZA 2AT1A 2C96A 1O9HA 1S3GA 2ZB4A 3P2OA 5EUCA 3RC8A 3I1FA 4L9WA 3U80A 1E8NA 2IUFA 5LOVA 5IVDA 2OGZA 4GBGA 2IE8A 2NVUA 4ITVA 3WMXA 2FRXA 4FHEA 5IAAA 1WCWA 2DB3A 3DOCA 721PA 1UEXC 3WSTA 2P3OA 2ONYA 2X4IA 4ZYZA 3U81A 2QD2A 5JXWA 3JD1A 3NU1A 1T2EA 2ZP1A 4OQPA 2QMEA 3CINA 1F5NA 4DZRA 2CHEA 4AY2A 1C8BA 1E9CA 2ECFA 2WJJA 6REQB 3RD5A 3TCXB 2IUUA 4KPYA 2N0SA 1DMSA 2G17A 4C0WA 4MQLA 3RU3A 2R25B 2I6TA 3NETA 5DWQA 3TTUA 3UFXA 3LSTA 1P2VA 1MPXA 4LDJA 1KBOA 3AERB 1E9VA 1P4HA 1U1CA 2CN1A 2A88A 2NO1A 4CQLB 4CIXA 2YVQA 1X3SA 2ZPUA 5JZBA 3RB8A 4KRGA 3GT3A 3DJFA 1VJCA 1NAIA 4CM5A 3H5NA 2XKJE 1QE5A 1KIMA 4RORA 3I39X 3WGVA 2EX0A 2RI6A 1YJXA 2GILA 2ZYAA 2NUBA 3H1BA 3I72A 4HAZA 4MQUA 2GMWA 3R0JA 2I34A 1W48A 4QXMA 3HCOA 1XK7A 5D5PA 2X9LA 2G70A 3ZXIA 4DR7B 3HBLA 1QHHA 2JIZA 1Z38A 1MB2A 1XDBA 2PXAA 2ZYDA 4WBNF 5FPTA 2HW8A 2FFAA 4X93A 3Q87B 1UANA 1VP3A 1IJEA 1PL0A 3MFQA 3BJEA 4EQ6A 3L7OA 16PKA 1MIOA 2PZFA 5FOWA 3UA3A 5IJ0A 3V8MA 1P3Y1 1WDMA 3HJGA 3NB0A 1VI6A 2PY6A 3DFIA 2QGNA 3ZJTA 2WJPA 4PU0A 3MT9A 3BXFA 1WD7A 2SBTA 4ZVSA 3ANSA 3TL6A 3G9ZA 4HDNB 5A5VA 2FE4A 1EK0A 1P1JA 3LZ6A 1ZDMA 4TMZA 1L7VC 1TRKA 1V5EA 3MJEA 4XQEA 1QGOA 1V96A 3ZDXB 4W8GA 3V97A 3EVEA 3S70A 1I36A 2OV6A 5J2TB 1TKCA 5GGXA 2G07A 1XTPA 1CJBA 2H9YA 4O33A 5AOAA 3TKYA 5CLJA 2PMEA 2BE7A 1BVUA 1HBJA 1QGUB 2B1QA 3I9V1 3L6UA 4LJ5A 4A7PA 1FTSA 2CXNA 2YXNA 3WBFA 5C2JB 2MMCA 4F2DA 3AB7A 4LC0A 4LV5B 4YX9A 1A8QA 2JEOA 1IN1A 2CVOA 2P9TA 2EQ5A 3FX2A 3ZY4A 3NTXA 3QSGA 2P5UA 2VATA 3IP5A 3KLMX 4K2HA 4B7AA 3TECE 3SE7A 1XFDA 3QWIA 1C0PA 1FP1D 1XD2B 3OZAA 4JJ4A 1EQ2A 4QPJC 1K6JA 5AP9A 5JPDA 2PYZA 2J45A 1TQ6A 4C78A 5K8LA 2I1VB 1UBOS 2CCJA 4WESA 3TD6A 5LMUB 3IT0A 2A9OA 5B36A 4J4HA 3GU3A 3IJEB 3BDVA 1KOJA 5EIFA 4HNVA 5KYXB 3M3HA 3ODPA 4G9BA 1YC2A 4AKHA 2JA2A 3MWFA 2FX5A 3FOAA 1BO6A 2A2ZA 2I4OA 1GWNA 2HMTA 3T95A 3R5JA 1T1IA 3LUDA 4WZBE 2P4UA 1QO7A 3EY4A 3I8OA 4ID3A 5EE0A 5I9MA 2O7VA 2X8BA 3JATB 4OMFG 3U4AA 3K5PA 2Y1WA 1VXOA 4LVUA 3P1JA 4A1OA 1I6KA 1DAPA 3SP1A 2AK3A 2P2ZA 4XIFA 1SCJA 3CRQA 1C9EA 3E9ZA 1KPIA 1YCGA 4QVGA 5BN3B 3IAFA 3KE9A 1ZA2A 5KOIA 2A33A 5JCOC 3AF4A 2ST1A 3K4QA 1ZOIA 2XSZD 2X42A 1YB7A 4BPRA 1QF9A 1Z2OX 1KJJA 2QF7A 2QMOA 5C53B 4D25A 1KNQA 3D7KA 4Y2XA 4MR8B 4Z4FA 4O2AF 3M4XA 2HUPA 4MWBA 3TKAA 3VOAA 1LF5A 4MJ3A 3THWB 5KNLA 1W8DA 1ILWA 2IT1A 4L5CA 1GLNA 1QIMA 4HDRA 4B3FX 5JHHB 1M5TA 5DT9A 1N2CA 2A6PA 4K1LA 4BUJA 2PU7A 4HO1X 1N1EA 4B79A 2FLWA 4OPMA 2HU8A 1OFHA 3G6KA 1ZGZA 5ALRA 2W58A 1OWNA 2Z95A 2ZI5A 3TJMA 2OXFA 2NAPA 2IYQA 1GU1A 2W8BA 2RG1A 2D5LA 2QR5A 3FD8A 1Z5GA 2PYDA 3PYXA 4LHXA 3AVQA 4ND2A 2VP4A 3TTXA 4FQ8A 1OGYA 2HQ1A 2J67A 5F5LA 2G67A 4YXWA 4U4AA 3LL7A 5EKDA 2JATA 4NYIQ 1ZC3A 3AJ9A 4RA6B 3SF8B 3RIEA 3WLKX 5KWIA 4Z86A 4W6ZA 4L74A 5GQSA 1ZOLA 1Y9EA 4DDMA 1KJ9A 4I8DA 2I62A 3EEIA 1DIGA 4NE2A 5FLXA 4G8BA 1KFJB 1RWNA 2I3BA 3LBNA 3LWBA 4MCAA 3OE7D 4AP5A 3B78A 2QUJA 1QV9A 4MARA 4WADA 1G6HA 1TAUA 1OFUX 1AD2A 4XCVA 2INGX 2QT1A 5WRFA 4Y1FA 5HK8A 5CIYA 1OGJA 5ECGC 5L8VA 3KOOA 2CV0A 2BHTA 3C16C 1G64A 2P7IA 4CEHA 1XTRA 3IQWA 1N6OA 1XWFA 1N0HA 1CHNA 1PRYA 2R751 3R5FA 1ZH6A 1FX0A 2W4MA 3KB1A 1LUAA 3G2IA 3I05A 4L75A 1C50A 1IY0A 1DWPA 1R0YA 3OLWA 4EKGA 3Q7IA 4IGAA 1LSJA 4MDHA 4X24A 3WNVA 3L6RA 1NTRA 4IJKA 3GGPA 2L18A 3AB8A 1NBAA 4BNLA 4DSNA 1JFVA 1FYFA 1XTBA 1X1EA 3LC0A 4R1TA 3N2KA 1JKIA 4R54A 2QLBA 4FEYA 3V8VA 4RK5A 1E66A 3NYIA 3K15A 3V4FA 2HR1A 1JAXA 2PSHA 3PD1A 5LQSA 3VH2A 1UPBA 3RKRA 2FY8A 4HNQA 4QAQA 4QLAA 4KO3S 4G0YA 2BH9A 1CY2A 3F96A 3WJ1A 2AI1A 1QF7A 2LD4A 2RGUA 3HGMA 1ST2A 2DQ4A 3NDPA 5C5CA 3I12A 1VRWA 4N1AA 4NX2A 5BVHB 1RACA 5F78A 1IIRA 3MK31 2JI4A 3AY7A 3SY8A 4QECA 2HZBA 3EZ7A 2BFDA 2I78A 2J59A 2JJ1A 1ISPA 3DEYX 3O8QA 4JS0A 4YHBA 5IC6A 3ZD6A 1RJFA 3FPSA 4GYKA 2R6GA 5AXAA 1Z37A 3GVCA 2EATA 2BFEB 5CHYA 2RGGA 1QQ7A 5BXYA 5SYAA 5TGZA 2IYEA 3PNYA 1PK9A 1NM5C 1UKVY 4E7PA 1OGIA 3WB2A 3T7TA 3UWDA 2OUKA 2FCRA 4KIUA 4GOKA 5EYPA 1V1JA 4FKBA 4OQMA 3L4EA 5DEIA 1FP2A 4OL0A 5KTMA 2GBPA 2J09A 3AI1A 4KQKA 2J0SA 4BKOA 4UVIA 4IJ5A 1W4CA 1LTHR 3ZDAA 3GUVA 1S9DA 3W77A 2F43A 2ZJ6A 5IW8A 3LKVA 5ALFA 3K35A 3R74A 1LLDA 3PENA 1OC2A 2HA2A 1RCUA 4DBLE 4GDFA 3WAKA 2NW6A 5AM3A 1ZVVA 4JB8A 3OIDA 1W88A 2VRWA 4QEKA 5EVCA 1DLJA 1EXWA 5C1BA 2RH8A 1YQEA 2FFHA 4LHYA 2B2NA 5LU8A 3ZGVA 2FJUA 2BE9A 3MCVA 3OKPA 3W2GA 4BC0A 4N7MA 4TLCA 1F0PA 1VRCA 1MIHA 4JN6B 3N70A 4BECA 4HL6A 5FNZA 1XVAA 1YL6A 1E5XA 1ORRA 2ZIGA 3AT1A 3IX7A 4B3MB 5JATA 3ED5A 1PG5A 5DXFA 1GGKA 3H2ZA 3V4VB 1U98A 4FX5A 3NTQA 1XZGA 4IIXA 2W2VA 1R0CA 1V47A 3ZV5A 2ODWA 5LC1A 2UZ0A 1XU4A 1Y7TA 2W98A 3LCVB 3CUVA 3DL2A 3PC4A 4G8CA 5AO9A 4D7AA 1HT2E 3D8HA 3S2UA 3WLQA 5LXTB 3L4JA 1IVSA 2H52A 2OD9A 3IQDB 4B17A 3D3WB 1IPEA 1JYFA 2W22A 4GG1A 3CX3A 2BF7A 4B4KA 2Q4EA 3TKLA 1SKUA 4HNSA 5CFLA 2D1QA 2GETA 3DS8A 4JCOA 1O95A 2W6JA 2IF0A 3OF2A 4MKFA 1CRQA 1ACLA 3CEHA 5F64A 3E15A 3LO5A 3VTFA 4WCFB 1Y8CA 5I7FA 3C8MA 3PSHA 1QCZA 1S2DA 1VJTA 3X44A 1OZGA 4WKCA 1C2YA 4MLPA 5JRJA 1AUVA 1U28C 3ZJYA 1T8SA 2CUZA 2GD1O 4TYPA 1Q91A 1FTNA 4TS9A 4A6PA 5BNTA 1W1UA 2H2IA 1KVSA 4QOEA 5JD4A 1X42A 4XCXA 5LQAA 2DKNA 1W85A 1BHO1 3LPAA 3PFNA 4XQGA 4FN4A 1PW7A 3KQQA 2XR1A 3U1TA 5L6LB 2RH4A 3C5CA 1C7RA 3GI1A 4M1TA 4NECA 6AT1A 2PJRA 4PRYA 3CWCA 3SDBA 1R8QA 3KK0A 3OJEA 4MUFA 3BL8A 1XA4A 4RQAA 3D6MA 4UUQA 1GPLA 3ZGOA 2ZUTA 4E94A 4CM3A 1N9GA 2H8GA 4WWHA 1MKYA 1W1IA 3T1QA 1LSOA 4MO9A 4MVJF 5K20A 5F12A 1DJQA 3DMTC 4KW7A 3U3DA 1CU1A 2BIFA 3DLCA 5FNVF 4ERXA 4CIYA 3VHQA 1TM7E 2JFPA 1FFDA 3LPDA 4TUYA 3U3RA 4RETA 3VO8A 3WIUA 3CF2A 4MKRA 2CVHA 2R44A 4CKEA 4PAOA 2PO7A 2I54A 5A62A 1MV5A 1S5PA 4JGBA 3V7UA 3PYMA 1JIUA 1TCUA 1VYUA 2A0WA 1CQIA 1ZZGA 2PZBA 2NV0A 1BD4A 4PTZA 4BWVA 2CBZA 2BFBA 3B7WA 5HFNA 5KQMA 1B6GA 1VGRA 3AONB 3B82A 3JWIA 4Y2YA 3BWMA 1TZJA 1HV8A 3F1KA 3RK1A 1QB7A 3WGNA 2UVPA 1DU4A 4KIGA 3SQMA 4C7OA 1VI5A 4N82A 5BN4A 3QVXA 4L8FA 2IV3A 5GV7A 4Q1VA 2Y67A 4C9BA 1GL7A 2X19A 3I73A 3TBFA 1GDDA 4B6FA 5B4UA 2JASA 1YVEI 3SC6A 1CIVA 1ECJA 3LRXA 1OXBB 3MUEA 4GOLD 4KOAA 1GUAA 1FFBA 1U0TA 2DR0A 4MS4A 2HRRA 4U7GA 4O5OA 2RGEA 4TV8B 4OBEA 1IAQA 5CB8A 4H4EA 2RC6A 4DDHA 2ZZMA 3RG2A 4D5GA 3LTEA 3DZDA 2WSSA 4EG7A 4L28A 2YYZA 3B5IA 4AFNA 3DE0X 3DXYA 3HM2A 1X7DA 2QSJA 4NHOA 4XR9A 4EDFA 5DWDA 3RWBA 1M2NA 2GK4A 2DHQA 2JEZA 4OQXA 8LDHA 2CEKA 3ESDA 1H85A 1SVLA 1AIPA 3TXAA 9ABPA 4JU9A 5HUHA 3WY9A 2AOUA 3N8DA 5HDBB 2YY6A 3KV3O 4CEIB 3JQFC 4LVOA 3B9RA 1FCJA 1YS2X 2WU3A 4JLOA 1J09A 4LF5B 3EGDA 4K9LA 4TPKA 3M4YA 3QE4A 4CIAA 3THSA 4NY1A 2W83A 2Q6LA 4PPGA 5FL7A 3T3PB 3OFKA 4PX3A 2HV8A 1GKUB 2Q6TA 3SC3A 1B0PA 1ONBA 1IVYA 1GNQA 5IVHA 3JAKB 3CSUA 2I4TA 2JHPA 5J4HA 1EP3B 2MINB 4R41A 1P9LA 3VR4D 5AKEA 2DBZA 4FNOA 1VLVA 1THMA 1RHUA 4DLWA 1FLAA 3W5AA 1NVVR 3TCNA 2FHSA 1OFTA 1QVAA 2IDZA 3AHFA 3G0GA 1C4WA 1YQQA 3TSOA 2IODA 4L8YA 3RE1A 4Q7QA 1UJMA 3U16A 1PW5A 3COZA 5CLIA 1XKQA 4UC0A 4M7WA 3WHIA 1EDDA 2O3SA 3A32A 1QH9A 3MIZA 3SYMA 4JI0B 3ZDQA 3CXRA 3I45A 4FHFA 4HTFA 4MQBA 5CVDA 2Y76A 3W2EA 1OX4B 1CUEA 1QOPB 4EF4A 2NQ8A 3NIBA 4NCBA 1KEPA 1CCWA 3DE4X 1SZDA 4CM4B 1GZ4A 4KE6A 3JAMA 2QTRA 3K0CC 3QQ5A 1D5WA 3UHAA 2F3TA 2IIPA 4CKCB 3RYIA 1K4KA 1KFEB 3I6ZA 1KH2A 2CEAA 1ZD9A 2ATXA 3FFXA 3HBJA 3O7WA 4NJEA 3T5TA 2XKKA 1RXUA 4MW1A 4E11A 3H75A 4DJEC 3CF6R 1BMFD 2CNWD 2G5GX 5HWSA 3N8NA 3Q7EA 4OKSA 1UQTA 1HNXB 2P69A 4I1IA 2B8WA 2IHKA 4QOGA 3U39A 1UODA 4AJEA 2AC2A 1Z6GA 1QZ3A 4JL6A 1T10A 1Z7BA 1FTWA 3DHWC 5JSZB 3TNFA 1OWMA 1K8QA 3W34A 2WM9B 1DQSA 2BGJA 2EQAA 2GT1A 2GN4A 4HTAA 4NYMQ 3JQGA 1EFCA 5A9TA 1HA3A 3DMFA 4DA7A 3LDAA 1YZQA 2QMHA 3JQAB 3MJCA 2QZJA 3KLBA 1Q50A 3TRJA 1NJ5A 4RA9B 5CEJA 2GFIA 2XDWA 2JLXA 4M7OA 3AETB 4ESVA 5LA6A 4XEHA 3IHLA 4B34A 2ZIUB 3KJIA 1Y3HA 3EPKA 4EJSC 1DV1A 4OQQA 1ZJ4A 3DOUA 3FLAA 4PYQA 1AN0A 4XSHA 5ALSA 1X0XA 4RTSA 3GJZA 4GD3Q 1GJRA 1YS6A 4G4JA 4KB5A 4B81A 1D4ZA 3UH0A 1O0CA 1LPMA 1XTSA 4I6EA 1VG9B 4JL8A 5DIZA 4ZAGA 4FXPA 1M67A 1XQ6A 4N7RA 4CUKA 2P30A 2VTBB 3UBMA 5B37A 2IY9A 1YBAA 1RJDA 4PCAA 1J5EB 3DPIA 1XK6A 2C8VA 3AW9A 5CH3A 2V3CC 4NPAA 1Z6XA 3L02A 3K8YA 1Q77A 1VCOA 2E18A 2SCUB 2IH5A 1MJNA 2UYQA 1HTBA 2O4UX 3R23A 4DCTA 4OM8A 4EJSB 1TCBA 1R50A 1U28A 3TOCA 2PSFA 5G4KA 4BLUA 1JT9A 2DF8A 2QUKA 4GZ5A 3L4KA 1ZESA 1HORA 1QX4A 2JFXA 3WSWA 1JYEA 5JYCA 5KYYB 3A1VA 3HZZA 3FLBA 1GAJA 2IHYA 4TLMB 1SA0B 1ZOOA 1TW3A 2NOAA 2OTCA 3AM4A 3EXHB 4M9UA 5GONB 1XWWA 4Z51A 2HQSA 4FGUA 4COOA 4DQXA 4MYUA 1L8XA 5F76A 1U4SA 4L22A 1GPYA 1YZFA 4XVCA 1HNNA 5F7XA 2NM0A 4KACA 4XVRA 5TPZD 4QYMA 1NBIA 5JCXA 3SXUB 3KEMA 5GAJA 4XFDA 4R6WA 4TQ9A 4Z7OB 1LPSA 2H31A 1JLLA 1IC6A 1J7JA 2ATVA 1GRQA 4JYCA 4O0MA 4BB0A 5L4SA 1NBOA 3U9LA 1CRLA 3U44B 2M9MA 3NBAA 2I1LA 2WSLA 2B5WA 4WBNA 4MGIR 5T41A 1VCIA 1W2HA 2SHKA 3EG9A 4J03A 5JH7B 4O2BA 1M0SA 2GXQA 3KC2A 4JBGA 4MCIA 5ESXA 1IZYA 3T34A 1TQ4A 3GJ8A 4UCWA 5D1HA 4BV3A 1T5DX 4H4DA 2R6DA 1EZ1A 2J0UB 3E05A 4FSHA 1MJFA 1DI0A 4FX2A 2YZKA 3HC7A 4RIEA 1DRWA 4Q4JA 4CETA 5HKKD 3KELA 2CF5A 1JSCA 3CS3A 3ANXA 3DO5A 5U4QA 3HDHA 5IH7A 1E6WA 5K1ZA 7ABPA 3RVSA 1K8YB 2PUWA 1X8JA 2PWYA 5KZMB 4FC7A 2PZKA 4TKVB 4WE3A 1OI7A 2QRLA 1ENOA 3QMPA 5JCJA 1N92A 3MAGA 1LRKA 2RH5A 3NAGA 5FWNA 4QREA 5JEEA 1A69A 2YXBA 1P0IA 3E22B 4P98A 5BW4A 3R3VA 5HCUA 3TTTA 1E5VA 5ECDA 5KPDA 4AI6A 3NO4A 2PJZA 3GJ5A 1IJBA 4JXJA 2FFBA 3DONA 4BP8A 5JVDA 2BGMA 3U0BA 2PUEA 4MYTA 1DGQA 2GGSA 2HJWA 2R1UA 2VJPA 3A4LA 3L0CA 4FI3F 5DI3B 4GX1A 3D6VA 5ERXA 3TE7A 5BQ5A 3THYA 3W2HA 2EW1A 4Y2RA 2CXTA 1QCYA 2ONJA 3K70D 2NO4A 3RS8A 5JPCA 2J07A 1XTQA 5ALTA 3FTFA 2JW5A 1VPLA 4X1YA 2KLBA 5BW6B 1X1TA 4FLEA 1GEGA 2CJWA 4GWLA 4AZ0B 4RW0A 3QBDA 3ZXSA 4EUEA 3VYSB 1KEZA 3NHAA 4QUBA 1ZK0A 1BDJA 1TJPB 5SYNA 3IVGA 4OMUA 4M6WB 1YFLA 4G4IA 1ZAYA 3NJ8A 4ASUA 3R3ZA 4FFNA 3ML1A 3QMVA 4PZPA 4QDOA 1ABBA 2PSJA 5LL6P 1TGVA 2C5BA 1NX9A 5B3KA 3DWEX 1VA5A 5KUTA 2DETA 4MVJD 2AI2A 4ZVNA 4PSUA 3M2PA 3DTVD 1X0VA 3F6RA 3OLYA 5BSUA 1VKHA 2DPYA 2VBGA 4IGKA 3E18A 1XF1A 3N2EA 4MI6A 5C9ZA 1T5BA 3EW7A 1FFXA 3R9XB 2NMVA 2AZ4A 4IDQA 2J7PA 4R1QA 5K8IA 1JZQA 1AUOA 1RMQA 2ZATA 2GZ2A 3MWKA 4YAFA 3GX1A 3EZ9A 1GNVA 4HXFB 1GA1A 5ALJA 2VSXA 5CCBA 2VRBA 1PTKA 1DARA 2FEOA 2FXIA 4RZSA 4NOMA 1AT1A 1PUIA 3HY4A 4BNHA 2HL6A 5MGNA 1U02A 3UM9A 2JH9A 2AV6A 3OZBA 4UARA 2J0VA 4C0XA 4BQEA 4DG5A 4LF9B 4JKOA 2YINC 3KQTA 5A5EA 3WIVA 1VSUA 4LWOA 3RHSA 1LI5A 3AEQA 5FL7D 4P92A 4M9CA 3FDZB 4JVNA 2BEVA 1XRMA 3LC7O 1YE5A 1G9SA 3OZIA 2GCOA 5IFLA 2QYTA 2Z58A 4ZTBA 5JJLA 4OAPA 3CLSD 1AKUA 1LGYA 3B5JA 1XHFA 3LQYA 1A7KA 1X19A 2OHIA 4BO1A 4UM7A 4DA9A 1SIOA 3E7PA 3F9RA 1JVBA 1R8SA 3CEPB 4DV4B 3V42A 2HHAA 3LNTA 1G63A 2VA9A 5GM2A 2F8SA 2ZPTX 1A72A 3NC0C 4BNDA 1I3MA 1K5DA 5L3SB 3STTA 3UEOA 1L4BA 2XQIA 4RD1A 4CV2A 3P71T 3FUTA 3KYJB 2JHFA 2VTVA 1SPBS 2JK0A 2CXHA 4I14A 4B4OA 1ULSA 2ZK7A 4B6PA 5H68A 2PZEA 3HYTA 1GDHA 4IX9A 4JYPA 3HU5A 3LQKA 1DKQA 3PK0A 1KY5A 4XGRA 2HNAA 1T0UA 1KZ1A 1JXQA 4UNQA 2C20A 4YASA 1QIDA 4M46A 3WYGA 1AXRA 1DMRA 2AIRA 2JIBA 3UB4A 4E5KA 3ID6C 1A3CA 5ED0A 4BBZA 1AS2A 3AJRA 4X63A 2AN1A 4M99A 4C6TB 2FWJA 3GFGA 4TTVA 3RASA 3VNQA 1PVDA 3U26A 3CRZA 1XKTA 3HN6A 3QVOA 2IY7A 3H3FA 4QRDA 4NZNA 4IINA 4EA7A 2NNLD 1NMQA 3HR8A 4XUGB 1YI0A 3WC4A 1RKQA 4D9MA 4EVSA 2YOGA 2GJ9A 3IV6A 3M1YA 3DTVA 1NVGA 4UMEA 5CX4A 1TEVA 3ZK9A 4WLVA 5E6UB 4JUIA 5EMNA 1NR5A 1DSSG 1HNZB 5LYYA 1V2GA 4TKMA 5DLEA 1Z5VA 1Z73A 1IZZA 3DAPA 2I22A 4QPDA 3QE3A 3IHTA 3EQ2A 4CTKA 1PFQA 3CR7A 3TLGB 2XRFA 1IEWA 5BSTA 4J7XA 3ZEAA 1JNXX 2MYPA 1I2ZA 1S8AA 1YL5A 5ARDA 1G8YA 3RJ5A 3PJDA 3UJPA 3W5UA 3NYRA 4HMPA 4AD8A 4CQLA 4F9TA 1XCPA 3TZKA 2O3UA 3OD1A 1UBHS 3V8PA 2XX3A 1RQRA 4P58A 1RKBA 1T9BA 1XCBA 1JPJA 2FLVA 1WY5A 2FWIA 5CVJA 3UCEA 4Q01A 1M6VB 2VHTA 1ZJJA 3U3XA 3FMVA 4YJ2B 3L4SO 2WD7B 1UZUA 2ORIA 2OMEA 2R7AA 4JOBA 3UHFA 1KMHA 4WDQA 2OLJA 5CXQA 2MT9A 3V4RA 3RADC 4B6SA 1D2GA 1DG9A 1E32A 1EDOA 1BROA 2NV2B 2Y1KA 3FFBA 1S7CA 3HB1A 4O8CA 2OQVA 2RHRA 5AESA 1MTZA 3CRW1 3ETCA 5A3QA 3BFPA 4BJ5A 1Q95A 1K3UB 1V3VA 1XZJA 2JC3A 2YMPA 3OPYA 2CXQA 1UXJA 3S5UA 3N86A 3L6CA 4UFPA 4Z53A 1Q44A 3O1IC 1J7KA 4UAVA 3AFMA 3FWNA 1T13A 4TL8A 1YGYA 2CUNA 1BX1A 2DE0X 2GEBA 3L84A 3ZZUA 1RKUA 2GUGA 4L2IA 2XTAA 4BYGA 5NLLA 3FROA 2EJBA 2OM2A 4CIWA 3FHJA 1F7VA 1N6NA 3QX3A 1RJ9B 1ULTA 2BZ0A 3EG9B 5SZJA 2F8LA 4BCBA 4DEVA 3EQ7A 4Y2GA 4DMCA 1SD5A 2I3ZA 4KJXA 1NFRA 2G28A 4QU0A 1K9VF 3AOEC 1WNTA 2JNWA 4M60A 4QQFA 5G0UA 821PA 2WIJA 3N0RA 4RD3A 1A95A 1E2NA 4Q3CA 4OB8A 1N2ZA 4JJZA 4ESHA 2XGMA 1G3UA 1JWAB 4M1QA 3L7AA 2P2GA 1CEYA 3NEYA 4KZPA 3BCRA 5HQ3B 4B40A 5ECWA 4RTRA 2H29A 1TLFA 4ZIRA 2FTKE 1NF9A 3WXBA 5HM6A 3A36A 1YB5A 3PT9A 5H0IA 1Z35A 2BI8A 10MHA 3WQHA 1NE7A 2VJKA 4IVNA 1UM8A 3ZDZB 4PYRA 3L5KA 4JI7B 4QPNA 1YFZA 2GXAA 1N5LA 3P7MA 2G9QA 5GVSA 1KEEA 3DDOA 5IHXA 4YAUA 4RTQA 1CZLA 1C7QA 2WUEA 3O83A 1IY2A 2NADA 1IWBB 4BMYA 4WASA 5JZVA 1ISIA 3I6MA 4G4SP 3LLSA 2PX4A 1UWCA 5CNIA 5HBGA 4Z6KA 1K97A 1NOKA 4NMHA 2GI4A 2I7XA 1LB1B 2P0AA 3KUCA 2ALJA 5H1YA 3DE5X 3IV9A 2CZCA 2QU8A 4CLHA 1HFKA 4P3OA 1G2PA 2CDCA 3ND6A 2AJBA 2C8JA 5JQGA 5ELXA 1QV6A 4KVZA 1ZK4A 1BJKA 3VC1A 4ZOEA 5K3SA 4BS9A 3JAWA 2X0KA 4NICA 1D7OA 1E1CB 4IIUA 3T38A 3K1ZA 5D6OA 5AT1A 4GZLA 3LM8A 4JT4A 3LY8A 4BBPA 5EJ5A 1EXDA 3S29A 5PNTA 3A9VA 2QVGA 4YP1A 1T3ZA 4N0DA 1RHMA 2AJDA 3DV0A 4UATA 4CF4A 2A0FA 1QANA 4DLZA 1KYTA 1R2QA 1DOHA 4GXQA 4ECEA 4KN9S 1WBJB 1II8A 1QV7A 2VI5A 5CX1B 5ITVA 3ZY3A 4EW2A 3U7HB 1ODCA 4J91A 3RH0A 1DBWA 1PGJA 3GZJA 4P3XA 5FF9A 1LLQA 1E9SA 4R5MA 4MTLA 3PX7A 4NNJA 1RAEA 1UBTS 2WR8A 3RARA 1JZTA 2YNMC 2BGKA 4YV1A 3IAEA 4FEGA 4Q1FA 1AB5A 1GL9B 4IDPA 1E3IA 3MBIA 1V5GA 2NZ2A 3IAAA 1BE8A 3VPXA 5KWEA 1MCZA 2BTQA 1DC8A 4QBFA 3F78A 3GT7A 1T5TA 4H3VA 4D6PA 2Q5LA 3RIGA 4N7BA 1OILA 2PFSA 5GONA 3UOWA 4B35A 2VZEA 3E3AA 1A8SA 2EBWA 2UZAA 4EENA 4QJBA 3GP8A 4OLFA 1C3EA 3V4OA 1D4OA 2YHIA 3PRJA 3M9WA 3S1LA 5F21A 2FSFA 3PHBE 1HYHA 3HP1A 4PAMA 4H27A 1LS1A 5CJJA 2F4VB 1L9KA 5FA8A 2HD4A 2PBFA 4PONA 2QRJA 3CEMA 3CKLA 4W1QA 4ZT3A 5BMOA 2XMZA 2P9FA 4WXRA 1FDUA 1X7WA 4D9EA 2GD6A 5ICFA 2X58A 3DKRA 5EKUA 5K3AA 3JX9A 3RIMA 3YASA 1SVMA 2V5AA 4R7TA 4XOIA 4ICIA 2YJGA 3D6AA 3EXG1 3MMXA 4GPEA 4KC0A 5A1TA 4D3DA 2K2WA 3PXXA 5JANA 1W581 1KDRA 2BHNA 4S05A 4YCNA 1SK9A 1T2VA 2DWPA 3U4QB 1EPUA 1B4DA 1ZJ6A 2CLHB 2E6KA 2FSSA 2XYVA 3AEKA 5MN6A 1FMLA 4PNHA 3V8BA 5U1PA 4AECA 4URVR 1U7HA 3PITA 1BRTA 1E18A 1XAHA 3RODA 3A4IA 2GHIA 2P9QA 4L73A 4TWRA 2YJ3A 4Y6OA 4BQFA 4DLNA 5JNSA 1NP3A 4RHTA 4YHHB 1VDMA 1E2KA 2AK2A 1HC7A 4HLDA 1WU8A 1YJAA 4BLRA 5EJ2A 5HIKA 4D0LB 4MUJA 2BEUA 1ZM7A 4FSDA 3RVDA 1YDWA 2PA3A 4G0ZA 1ZIXA 3L43A 4NLLA 1YT5A 4RK1A 5D51S 5TX7A 5AMXA 4DCCA 3G5UA 2J3IA 3FM9A 3NOVA 5DRYA 3TZLA 1KDZA 3RFFA 2G7ZA 4E13A 4KTTE 5AVTA 5BVGB 2OK7A 1SOMA 3IEMA 2BH2A 2G8LA 3AHIA 3T5PA 3PR1A 4L72A 2BTQB 3PXEA 2V9ZA 3F6CA 4XYEA 1OUMA 1JL3A 1D0VA 4PS0A 4AJLA 1A5ZA 4DIDA 1DWQA 5BYKA 3NANA 2OCIA 2QVYX 1JVNA 4DL9A 3UMMA 3EVAA 3C1TA 1RLMA 3BTOA 1JEJA 2P5SA 4J9VA 2PR2A 4O63O 1N7GA 3TGWA 1ADJA 3M1AA 1CNFA 2AR9A 3ROGA 3TOVA 4EUFA 1SHUX 3DTNA 4D9FA 1JG7A 1VIDA 2C1ZA 2R11A 2PANA 3TZCA 5IKEA 4LF6B 3WQSB 3WMFA 3A2NA 4IUYA 2YWXA 3WLPA 1U7PA 4DAEA 2C4MA 2WNHA 4H7IA 1OBCA 2VAXA 1ZVQA 5BR7A 3E7WA 1YZUA 2Q2QA 3DBHB 1SULA 4ZXFA 4JROA 4YP0A 2ZUUA 1ZIDA 1HEUA 1Q1NA 4AJNA 3TCKA 4EMSA 4RA6A 2A3RA 3B3GA 1V7CA 4GF5A 1UFKA 2EZUA 3CTMA 4RD0A 5BSMA 2DBVO 3X2SA 3ZKAA 1J06A 1XT6A 3OCXA 1P2SA 4H6PA 4R71A 4F8JA 5B7NA 4P82A 1AY0A 3DHYA 4IJMA 4KZKA 5HF5A 5KYGA 3VYVA 4URXR 4ENPA 3Q7PA 5TQ0A 3H04A 1RQPA 3ZWAA 3GEHA 4ERNA 1E89A 1JG2A 3SZLA 3OCVA 4YGXB 4AG5A 4LYHA 4JEIA 5KCMA 1RD4A 5DNUA 4CVNA 4L2IB 1AURA 4UBNA 1G5HA 1G5IA 3DT6A 4AY6A 2Q45A 5AHWA 2H2WA 3IA7A 4GP7A 1RMYA 3KOWA 1VYTA 3N2IA 1J2TA 3H0EA 4TXLA 4J75A 1G8FA 3N2GB 4MMXB 3VH3A 5ALVA 1X1AA 1OJLA 4K9SA 3ZD7A 1YZYA 3ZIAD 5BR1A 1G41A 1U99A 3CH6A 4WY5A 4NMXB 2VJLA 4R68A 3X1YA 1SWVA 2CVPA 1GYQA 1PL6A 2BJWA 3DQPA 1PI3A 2GAAA 3LJKA 3NAQA 1DEKA 1VJ0A 3MSXA 4PNZA 3N59A 5KWJA 3GLGA 3C5HA 3V2HA 4U5QA 1ZH8A 2QGZA 3BIFA 3FF4A 4WNAA 4YI3A 1QR6A 3ROKA 5DTIA 4UEQA 4DLTA 4UHCA 3IQZA 3GRKA 4OK6A 3OJWA 1YHNA 3BJRA 2X41A 3HWX1 4Q1AA 1QXSA 2GARA 3PUHA 3UJ7A 1PD1A 4B6RA 3SFZA 3EVGA 4ZOBA 4C6TA 2V54A 2HDOA 4KRXA 5G53C 1CE8A 4NU6A 5H59A 1NPTO 3FMFA 1U2EA 3FCCA 1WULS 1K4MA 1RYZA 3EG5A 1KYIA 2VH2A 3RTEA 1R9NA 4EFDA 3D2BA 2O5VA 3CWQA 3DBLA 5AJUA 5ETJA 3W5BA 5LNK6 3ACBA 3AKYA 2G63A 2KE5A 2Y2UA 2WZDA 1X7XB 3VHXB 3K8OE 2VTEA 4D4MA 1ZR2A 2GJKA 2E21A 4Y2JA 2PAAA 2OXTA 1NYRA 3BK1A 1T5IA 4KGDA 3IP9A 4XVHA 4NMMA 3WLRA 5A5GA 1Z22A 3JQEA 2PL1A 4D4HA 5E8RA 3QPWA 2HKIA 1NULA 1R64A 1PT9A 2GWHA 2B3DA 4J16A 5GOZA 1U3GA 4KAAA 3GNTA 4I4TA 4I2NA 5JV5A 4QYWA 4C2BA 1CEEA 2Q1SA 3TRIA 3AP1A 2Q29A 4TLAA 4RDHA 2AOXA 1C3JA 5LQCA 2J6IA 4ZJPA 2G1KA 2BD0A 1CIJA 3IB6A 3ACCA 2XA9A 4LPSA 1I1OA 1S0UA 2XT0A 2I6UA 3EULA 3S28A 1WSAA 1CQJB 3X2EA 2BKUA 4BWGA 4HNAA 1B43A 3DMDA 4ZXPA 5JROA 1ODJA 1MJHA 1ZN8A 3Q5DA 4UBIA 1TJYA 4IH1A 5I8PA 4YP9A 1H2BA 5BSKA 1SQSA 2FX2A 3DEIA 2ZJZA 5F3WB 4ZQEA 1N9KA 3MOIA 5EJFA 4FFDA 4ND8A 4PZ0A 4Q3BA 3EIQA 2GEFA 3EGCA 4C4ZA 2CLKB 3I4CA 1F06A 5SZHB 3P0EA 3IAXA 4RTLA 4GW3A 1QNLA 3PXDA 2JFVA 3LFHA 2RK3A 3CMCO 2BBWA 4LZLA 2CLSA 2RIRA 3MCZA 3FDXA 3PICA 4KGVA 3RYTC 2ZREA 5TPWB 3AILA 5FR1A 3H4TA 3OAAD 5GZ6A 2WM2A 3B36A 3WI7A 5KQSA 1K6MA 1DOZA 3ZCSA 4EA9A 5JH7F 3X3HA 4QRHA 1N8NA 3UQYS 4L5AA 1Z63A 1IUNA 3L0OA 4G0VA 1L4HA 4RPKA 1O0SA 8ABPA 3JASA 1U2QA 4JUFA 1YRLA 2AN4A 4RTMA 2Z8YA 1PJAA 3JTEA 3RSGA 1JH9A 4XB6B 4A0QA 4YRBA 1OTHA 3URMA 4DR4B 4DA8A 2XXAB 5CNMA 3BULA 4P22A 2V6MA 2AJ8A 2H1IA 4WLNA 1JR4A 5ILQA 4CDMA 1TA0A 1YRBA 5CVTA 4GX0A 1ZNWA 3KSRA 4PSVA 1O58A 4N76A 3RO7A 2YWEA 1B16A 4MJLA 4DRXA 4ZHQF 3IH5A 3R6TA 3T1TA 3IMEA 2A3NA 3WDMA 1JR6A 1K5GA 1A97A 3FXAA 4LSZA 1AQUA 4R9SA 3WLNA 4TYWA 1HE5A 4PGFA 5G02A 1ZUHA 1ZW6A 3AUAA 3B60A 1L2TA 3FYCA 3H1AA 1E3MA 1U31A 2B34A 3GMIA 3N0TA 5B1SA 3MOSA 3S3TA 2C8LA 2O8NA 4ONEA 5J40A 3WNBA 2ZXEA 1LDMA 3DR3A 1KI8A 1YHZA 2XW6A 4TYNA 2PWAA 3UT5B 2B5OA 1GGNA 3PHHA 3JSAA 2HAEA 3ROMA 1YR8A 3PE4A 1U7UA 2Q5IA 2ZUWA 1JJIA 3IP1A 3F5DA 3JU3A 4J7CA 4LOIA 2R6FA 4U2GA 5ALXA 1OHHD 1SGWA 4ZEXA 1ZZEA 1RXYA 2BM0A 2W93A 4IDAA 3RNOA 2DFLA 1DXYA 1GZ3A 1XF9A 2WAMA 1BHJA 2YW9A 4KFTA 1GL6A 1W2WB 4E09A 2W6CX 4P31A 4U6NA 1T0BA 1Y80A 3IPCA 5KNCA 5D7BA 3DH0A 3MWDB 2V7EA 2BISA 2JGKA 1GY8A 4MRMB 4QBHA 4ARUA 1QIGA 3H8WA 3PT5A 4B73A 1XTIA 1X1CA 3E48A 4Y6PA 3MTGA 2CT8A 1MU0A 3OA0A 3SJBA 3KQKA 4XWYA 4GMXA 3IDFA 2R2AA 4E3ZA 4LJSA 4BVGA 1S3IA 4OHYA 3UK1A 3WHLA 3KLPX 3N2ZB 4PFQA 1DNPA 3CKMA 5IJ9B 5HZGA 3BMNA 2F55A 4EAAA 4OJYA 1E2JA 3U7FB 4J7UA 1M6NA 1WCYA 1ZGCA 4Y6SA 2M6SA 3OOJA 1Z6AA 3DVAA 3DDWA 1LLUA 1YACA 4KQIA 4FFBB 5HFJA 1NC1A 1VB3A 5DM2A 4AKIA 3UMBA 5K0FA 3I9JA 2ZSBA 1Z5ZA 4JC8A 2QG6A 2GO1A 4F3CA 4XRGA 2XNKA 1E3SA 3HB7A 5BN3A 3FVTA 1XXHA 5ABPA 1TVEA 1YH3A 1DAKA 1GGMA 2NSHA 3KLNA 3LUPA 2OC4A 1CWUA 2FWBA 2WHEA 3ZNOA 4EHHA 2AN3A 3L7JA 1U2DA 3SEQA 1E5LA 4MIYA 3ZWVA 4HVTA 3JTMA 3KZKA 3NT4A 3C3AA 3N2YA 4YPOA 4J8PA 1QHXA 1IXRC 1AUXA 1G4AE 1F4LA 2OVBA 3C3WA 4ER3A 4RXMA 1L7PA 2ANBA 2SCUA 3UAGA 1C0EA 3G9QA 4BO7A 3IT2A 3TZ6A 4HJRA 2D54A 3GRYA 1E7YA 4QT0A 4C0QC 4EI7A 2ENUA 5CT6A 2O48X 2VDWB 2ZU6A 1MO4A 1XTJA 4O2AB 2FKNA 3A11A 1NN0A 1RTTA 3PQ2A 1OXMA 4YRLA 2R8RA 3ESZA 1OX4A 4FQ5A 1EX1A 1HYBA 5FORA 2WQ7A 1B3BA 2WJGA 3D6JA 3QLUA 4MYDA 8ATCA 1B8PA 1DKLA 2X2OA 2VF7A 1EYZA 2G1JA 3MELA 4EVRA 1TCCA 2HJGA 3O3CA 1RYBA 1H4SA 4MH0R 4AZ0A 4XIJA 4R0NA 2P41A 3B3JA 4J07A 1A82A 1IOWA 1V9CA 2JRCA 2QWXA 3B13B 1AS0A 1MENA 2CMGA 3BL5A 3P0HA 4TKLA 3ORSA 5DLYA 2PPLA 1SB9A 3SAJA 4EY5A 1CVIA 1NN5A 5HKBA 5LVAA 2ZT5A 3E9YA 4MB2A 1DEHA 2OCDA 4JUBA 3D2LA 3H0CA 5TQJA 4ZI2A 5IDWA 4BVJA 1L7BA 4WI1A 3AVYA 1WW3A 3O2JA 2H1VA 1P1RA 2R7NA 4XM1A 4Y9UA 4FCTA 1YS4A 3RK4A 2PWZA 1RZRA 4R2XA 2H9IA 2XE8A 5AVRA 2A9QA 3EZFA 3M34A 1EVQA 3NP9A 2AMVA 4ARVA 1YB4A 3LW7A 4B5LA 3LYHA 4CKCA 5JR3A 4J7AA 1TVCA 2C5EA 4LRUA 1X7HA 4NBTA 1F0YA 3U40A 3UIEA 4HH1A 2DLNA 4EHIA 5IKXA 4PSAA 3PE6A 2QSUA 1Z8HA 3H18A 1YOVA 1UT6A 2XLBA 3AF5A 1T25A 4KQ6A 4M0CA 4Y9DA 5INTA 1UWLA 1QE3A 2GF9A 4FIZA 5IX8A 3U2QA 3GA7A 1XE3A 3QWAA 3B8EA 1P39A 1SBZA 3RSSA 4KEAA 3ZX5A 5AICA 4FILA 1MAHA 3RVOA 4BDSA 2VNIA 2XHEA 4DSOA 1TO6A 3FYSA 1EGMB 1L5KA 4KHPB 1TEXA 2AX4A 1M1YE 3GRAA 2I2AA 3I3OA 3ZKWA 4W5OA 3PUKA 1A4RA 1SCDA 1BFDA 3SPXA 3CVOA 5IKMA 3KPUA 4TRNA 3QUBA 2FZLA 5I5EA 2Z83A 1XG5A 3FVWA 4FYWA 2XT6A 3LKDA 4OQDA 1SQGA 5JS2A 4BX0A 4IHKA 2WOOA 2EJWA 2Z3WA 4MNTA 5D85A 1OTYA 3DD1A 2O0KA 4NV3A 4QBGB 1T3GA 1I1HA 1ZN9A 1C4KA 4CYMA 4Y6LA 4MPRA 4WBXC 3S2GA 3DQZA 4AJOA 4BX2A 4JJ7A 4E46A 3GYGA 4ZGWA 2X8LA 4R4JA 3E4DA 3T1YB 3INRA 3IUJA 4R0VA 1QGUA 1HE8B 1KZ6A 2Q3CA 1L5GB 3AEZA 1AM4D 4F3TA 3T9BA 3G9XA 4EEKA 3A9WA 3KYDB 3E5HA 3ED1A 2ZQYA 2R7KA 2EAUA 2BGLA 1GVHA 4TTAA 4DPLA 5LOVF 2QBYA 3SGLA 2OYSA 4KVGA 1IMJA 3FNBA 4UEKA 3FOZA 1U3UA 4M38A 1S8NA 3N5CA 4BNUA 3O91A 1K8RA 4AL4A 1JILA 1THTA 2R47A 1EX6A 5IASA 5B57C 5JT1A 2OCKA 3PIIA 4YN3A 2BKAA 4XDYA 3U3MA 1KAEA 5CU7A 5CA1A 1M2FA 1V5IA 2V7GA 2BUBA 3PQDA 5A9SB 4OHBA 1SPXA 2TMGA 1KNXA 3A70A 3FPKA 3BKWA 4B32A 1ETHA 3ACDA 1SBYA 1BKYA 2CLIB 3HYLA 5BWMA 1HGXA 3QFTA 4WVFA 2VUIB 2F7SA 2QRKA 3BWYA 3DXFA 4FCVA 4IG4A 3IKMB 3SWWA 1DIAA 2A0KA 3G02A 4H7PA 1KVUA 1QRDA 221PA 1V1RA 4P2GA 3B70A 3W2TA 421PA 1KVRA 2YKGA 1FYEA 4QFMA 2JJ2D 2Q3HA 2CY0A 4GXTA 1OU0A 2NGRA 2DKOA 3QXJA 5DGIA 5JJCA 2IL1A 3KJFA 5KOYA 1AGRA 1MT3A 3AC0A 5L3SA 1U6JA 3OPXA 3GA5A 1Z3CA 1EK1A 3A10A 1E7MA 3I6BA 3I9LA 4IIDA 5FWYB 4DRYA 4CKWB 5DLDA 4LGYA 5EAIA 5A2QA 3JQ8A 3M5WA 121PA 1H9BA 4FHDA 3CY6A 4O4IB 4RS3A 1NUSA 1W6UA 3IBCA 4CV1A 4GNKA 1IUOA 2J5KA 4DLXA 2RFLA 2XE4A 5IFKA 3FFAA 2UUAB 5FO1A 3INTA 4DIOA 1NR7A 4GT1A 1ZXBA 1U5CA 3B6IA 2AG5A 1QTIA 2CDNA 1PFGA 2FUG1 4RZ3A 3B1XA 2OFOA 4FYXA 4JZYA 5JDCC 3DA8A 4H1TA 4QTTB 3ZLBA 4B2IA 3D1JA 4M8KA 4UXHA 4D44A 1J0DA 5CCDA 5A03A 3E82A 3UV3A 4U0JA 3GLUA 2CXRA 4HS4A 1EH5A 3AFHA 1GPBA 2QRGA 3V6MA 3GLIE 2DUJA 1EEHA 4DUZB 2X2EA 4YJDA 3UJDA 4AF7A 3LT1A 1LA2A 4TXNA 5JAQA 2WFZA 1GAEO 1TPYA 3JYLA 5IJ9A 3PEFA 1PV4A 2FJPA 4EIWA 3U17A 2O1WA 3QZUA 4M49A 2VYNA 5EXTA 2X3FA 1JJ7A 1EHIA 4DJFC 1ANKA 1E2IA 2JFQA 2K7FA 4D9JA 4OJKA 3H9QA 3SS7X 1WHSB 4A5SA 5AOCA 4E03A 2AYYA 4E5UA 1H4TA 2WWIA 1LV8A 2X0FA 2FWPA 4WVLA 2JVIA 5BR4A 2F43B 1GG8A 1QHSA 2ZRLA 4FFVA 1OKKA 4K5QA 4OXQA 3WK9A 4BNKA 1Y98A 4UJ3A 1GTMA 3WV5A 4A03A 1Z6ZA 3UJ8A 4XXHA 3HYNA 3F97A 4LY3A 3T4UA 2I8CA 2HQOA 1KI7A 4IS2A 2JDIA 3OF3A 5CTAA 4W9RA 4ZAVA 3NV7A 2VPQA 2YCLA 1N8TA 4W63A 1RAFA 1TUIA 4YJHA 3KZXA 4JOSA 1RLUA 3KTAA 2VRCA 4IFTA 3QI2A 3L46A 2BSQA 4L9RA 5TGTA 3AR8A 2BFCB 4AZ3B 3M6IA 4Y9TA 4EYGA 4AMYA 4D42A 4QFCA 2J9RA 1IM5A 1NQOA 4WLOA 5T4FA 4A10A 1XQVA 2F1KA 4EL5A 3K9BA 1QVWA 3KBBA 3J81A 2R6JA 1U3TA 5AQ1A 3AXSA 3KB2A 2Y4NA 1PG0A 2VUHB 1P81A 3NUGA 3STXA 3NR2A 1Q20A 1NLFA 3KPJA 4FGSA 4KK4A 4YDRA 3HUDA 4KH0A 1I51A 4FNAA 1M34A 3UB2A 4JVMA 4EHJA 2HK7A 1NVWQ 3SXPA 3C1UA 3CZ4A 4WXEA 3LUCA 2H4FA 3JZAA 3LX6A 4BNNA 1XZEA 1HZZA 2ZAGA 2Q0HA 3PEUA 4WNYA 2GN2A 4O2RA 2IBSA 4BIIA 1H0KA 5EQFA 4FFMA 1KDVA 3D8BA 2Z9CA 3BGIA 2IOHA 3OU7A 3OPMA 4JP1A 2P1ZA 4HQFA 4JEMA 3SMQA 2BVNA 1RXEA 3ZNPA 4UDYX 4BNXA 3GLHB 1NQTA 1MB3A 1U0FA 3H5LA 4RBNA 5I4CA 2DPHA 3T52A 1I2AA 1FNSA 3RUAA 1GQ2A 2GKSA 2Q3JA 3E84A 4PBRA 1JMKC 1V8DA 1G21B 1LBIA 2H48A 3HHPA 4AURA 3K0HA 1KFCB 1SKBA 3I5UA 3TDNA 4BFWA 3WK7A 2QJFA 3FI9A 2HJ9A 3ZU4A 1JLLB 4J3JA 2HA6A 4KGXA 4MQEB 1B00A 2CFSA 2G76A 2OZLA 4Q47A 4IO1A 4QULA 5H83A 4ZYYA 5FBVB 4CEHB 1QLHA 3QSYA 4YAEA 1NT2A 1R7RA 3RT7A 1Q0RA 4ZOLF 5FFMA 4O2BB 2IU4A 4LCJA 2I7TA 5B53A 1IQUA 3KD2A 3T3MB 1FFXB 4UNPA 3UVEA 2EJUA 4MVJG 1HYEA 3LVRE 1VE1A 1F4VA 2FX3A 2EFDB 4RACA 4CKBB 4CMEC 2PQMA 3RS2A 2XWPA 1WEKA 3SVLA 2A5FA 4RD4A 3PG5A 1VIMA 3P2IA 3VR5D 4B87A 4HH0A 5CURA 2P0YA 2VJNA 2X1LA 2ZUCA 3L0SA 1N2EA 2F00A 2KSQA 3SZOA 4ZRMA 3IOMA 5JMWA 3B48A 2BFCA 4AMUA 4AZ3A 2P3LA 4E15A 3B6JA 3MCWA 4FDVA 5AHOA 5AM5A 1E9FA 2IVZA 4AY5A 4DFDA 4UHFA 5AQEA 2XGOA 4ZDIA 1DX6A 4Q4DA 2A9VA 4C4XA 2BDEA 2PYIA 4YUVA 4B3RB 3OKCA 4K46A 4TZ6A 3FTPA 2Q2WA 4YY3B 4L4UA 1KORA 4NTZA 4BVLA 3KAJA 4AJ2A 2RGRA 5IH3A 1UJ5A 3T7RA 2UYGA 3HSYA 1NDUA 1UMCB 3P0RA 3OWOA 3P9RA 4IWXA 4UNRA 3ZH9B 3FRJA 4J9UE 2BKXA 2QJRA 4M21A 4OHWA 4US2R 3KZVA 2CB9A 3AGPA 1BYUA 1SN7A 1EA5A 1X7YA 5K2MA 5LDGA 5SV2A 3QOFA 1A9OA 3B6ZA 5ERYA 1CY7A 1QOQB 3RC2A 4GRDA 1PLJA 3FW1A 4O4LA 2R97A 2O8BA 1EUDA 1M34E 1IXYA 2ZRAA 1YRWA 4PIPA 5EHZA 1NYLA 4HGYA 1EDBA 4P38A 1TQ8A 1A5BB 2I7VA 2QM7A 2WF7A 5E0KB 1H5NA 1F3LA 4IV0A 3EIFA 5EPOA 3PFBA 1UBFA 1CBUA 2XYHA 2EKDA 5AKZA 1HTTA 4M88A 3U19A 521PA 4S12A 3R6DA 3BMCB 3QVVA 1UK6A 4JWKA 3UO8B 5L45A 4OSEA 5DGCA 1NPYA 3U4HA 4DA4A 1EVZA 1GCUA 4ZMBA 4X8LA 3I64A 3DLHA 1XN4A 3CLHA 1UBGA 3GPIA 3MQ2A 5A3SA 4AX8A 3W5JA 1XMOB 3GUUA 1NKSA 4JLSA 1T8TA 1UXIA 2FDXA 2ZB8A 1V11A 1MW9X 5BSFA 4MZXA 1WSDA 4KE8A 4ZJZA 1QBKC 4ZO4A 3VAAA 3NIWA 2IS2A 2AMYA 1FQKA 2I6SA 4XEUA 2IDJA 3KU4A 4DIBA 3H11B 3E9MA 4J0EA 2XOKD 4TMTA 4A91A 4JI8B 3H83A 2BCEA 2JGDB 2ZULA 4M1OA 1G6Q1 4RLSA 1B73A 3TW8B 5IABA 1RBYA 2DQYA 2PL9A 2VN8A 3DM5A 3DLPX 4IHAA 5IYZA 3JQBA 3AVUA 1HG1A 1IUPA 2CHFA 4NNOA 2QN8A 3K6SA 3TB6A 1A96A 2HQBA 1MAWA 4ZDKA 2PBZA 4R2LA 4C5CA 8OHMA 1K86A 3ZW7A 1FXSA 2CXUA 2LCIA 5KYYA 1JMYA 1Y9DA 4GFDA 4IM7A 4PO8A 2EXXA 4M54A 4ODIA 1QRAA 1J9ZA 1YJCA 3FNIA 1TTHA 4ENRA 1NNLA 1XJCA 2EKPA 2FXVA 4PANA 3EFEA 1DADA 2B2CA 1P19A 3K4PA 4B43A 3IUNA 3JWJA 4BV2A 4N6NA 3MT8A 3PC2A 3TX6A 1SKQA 4GPBA 2XECA 1NKVA 1ZCBA 3F9CA 4C21A 1GCAA 1OLXA 4MKXA 1RPNA 2VSOA 3F5FA 4L57A 4D0GA 1E4EB 1LWOA 1P7CA 2DUWA 2Z5LA 3F73A 3K5WA 5T4EA 3MXOA 5AR1A 5JI3E 2M6LA 4OUDB 1QRSA 5KINB 4W9NC 2ZI4A 3CNOA 3ICPA 2WTAA 1ECFA 4IDEA 1F8FA 1E2MA 1K2WA 1PU2A 3ELDA 3I23A 1OCEA 1VE9A 4P4SB 2XVYA 5REQB 3N76A 2AF4C 1BW9B 1TCAA 2J32A 1BU5A 2NWQA 4LYJA 3W4KA 1ZIYA 2LKCA 4LF7B 1PYGA 4IMJB 1UFOA 4HPXB 4TWAA 5BV7A 2B8TA 1TNDA 1ZGHA 1Z3IX 4ZJUA 1AX9A 1BEZA 4HUQA 4OH7A 3OWXA 2CD9A 4RSMA 4BMCA 3OT1A 3T99A 1JN0A 1V3UA 1QX3A 4NJOA 3SJAA 3TOSA 2WWGA 4HT3B 1GUFA 4P4LA 1VG1A 3T0GA 4TWBA 2Z08A 4GUAA 1M9NA 2FMFA 4HDSB 4ZI5A 4RJ2A 1XB2A 2Q6IA 5C8XA 4RY8A 5FFNA 3EPRA 3G0CA 4LVNA 1Y8AA 3T5CA 4RHCA 2IPNA 3PU6A 1DZ3A 1MFZA 3EA5A 3MT0A 5DASA 3WBKA 1OI2A 1PS9A 1XROA 2XMDA 1U90A 3FPFA 3WB9A 2PUFA 4QM7A 1XXHE 2VC2B 1NY6A 1AB6A 1G8MA 2Q99A 3GLTA 4O8ZA 5C8YA 1ZOPA 2PT5A 3IUQA 1J0CA 2Y1DA 3T3NA 4BKPA 1G5QA 1VM6A 1RP7A 3CW8X 3GG2A 2BRUA 3GCXA 3R3SA 4NHEA 3ESBA 2PWPA 2AXPA 2NVWA 3QVTA 4FYPA 5KQGA 1H1DA 1ML4A 1OAOA 3B3QA 1QIKA 4LNHA 5KO2A 3K70C 5FI0B 3BJMA 3WQBA 1V37A 4R40A 2ZTUA 1DEXA 1UOQA 2N3ZA 2GF0A 3R0XA 5FXMA 5F7OA 1MV8A 5T57A 5TT1A 1I3KA 2HCJB 4DMUB 1T2NA 1KI6A 5CFRA 3VDQA 4E2FA 1JECA 5CRIA 5C1DA 2R7LA 2RD2A 3A4VA 3Q0IA 1KO8A 2OGSA 2P2SA 3GEEA 3WL6A 1DRKA 1FYWA 1L5WA 5CNKA 4HNTA 1AZTA 3FRIA 4ZVKA 4K03A 5I9TA 3ZD9A 5F1YA 1QP0A 4MRPA 1JHPA 1RDFA 2VPWA 4REQA 4JI2B 5C51B 1JZSA 1MXHA 1CUFA 3TYXA 2EC5A 5DCUA 5EQJB 4CU5A 5IARA 4S1NA 2C2BA 3QEJA 4TM7A 3V3TA 3E0QA 4XD7D 4WZBA 1RRKA 3QOYA 1L5NA 1RXWA 4CEJA 2PS3A 4TT8A 4E4TA 1EG7A 2DWOA 3QMWA 3IFSA 4F92B 4NOJA 5KTRA 1E63A 5K0ZA 2JCSA 3EW9A 1WMEA 4ARZB 1P1IA 1A5AB 1UXHA 2QX6A 4IKEA 3CT6A 4EARA 3HCCA 3EFOB 5K8TA 3Q7RA 1JHVA 3A2MA 4YONB 1QIHA 3ZQJA 4R8RA 4YCAA 1JKJB 2WMYA 1A2BA 1PS0A 2EFEB 2Y6VA 2ZI7A 3EVBA 3GEDA 2Y68A 3NRJA 3OJLA 3WVNA 2YMQA 2YDXA 3KO8A 2C2KA 4D79A 1CUCA 4B4WA 3RC7A 4DV6B 2V7XA 2AZXA 1XELA 2P4HX 4TV9B 1X1SA 3TAXA 2VZLA 4JX8A 4G3XA 4MV5A 3VDXA 1VMIA 4BE4A 2R60A 4F6RA 1H2HA 2W2LA 3STWA 3FZQA 3GLGE 4DXDA 4TMFA 2P4EA 1M1NA 1TIPA 1ZD1A 4HB3A 3C3KA 2G5PA 1DXHA 1KGSA 2NQ2C 2VDKB 3QX8A 1Y7LA 5JJKA 1AUQA 1ZK2A 1L4NA 2Q3FA 3QU7A 2GZ1A 4INAA 4PPQA 5EWJB 5J5AA 3Q3VA 3OZGA 5GV8A 1XEXB 3I30X 5B6PA 1TO1E 5JYEA 1YR2A 4XJSA 4JVOA 4O1HA 1KE1A 4WKNA 5K3FA 1VIYA 5EJ4A 3GEMA 1BN6A 1T6ZA 3M81A 2VZ0A 1X7YB 3O4FA 4EA8A 3ENVA 1UM9A 1T0IA 5GJCA 2J3EA 4PLCA 4LMAA 2JAXA 1FLNA 2ZBEA 4QOSA 1JQLB 2ZETA 4DRXB 5LFAA 1TL7C 3DV9A 5CBKA 1QFXA 3W3AD 1NDHA 1SBIA 1YR7A 3HO6A 1F8GA 4GLFA 4JIMA 2ATIA 1U5BA 4PZDA 1QK4A 3KT8A 4KR0A 4PFKA 2QAJA 2BFOA 4TVOA 2IYNA 3H42B 5E9AA 1FDWA 3LMKA 3T12A 1CZHA 1RLOA 1OI4A 2DQSA 3ZZNA 2P6OA 3OPQA 2YFKA 1O97D 3QE0A 3WLJA 5MGBA 2O2DA 3X0DA 2QR3A 1XVTA 2A5DA 2DWUA 2G4VA 2OKGA 4MCHA 5FLKA 1LW6E 1S3FA 2JGMA 2CMHA 1P45A 2YV5A 1KA9H 3OCWA 3OOYA 4G5FA 4MS1B 4TMKA 3U48A 2XQGA 3GO4A 3O4HA 3ZV6A 4KQ1A 1ZVMA 1P1BA 1WXHA 1OV4A 1NIPA 1WW2A 2G82A 3KPWA 4K26A 3CX7A 5F35A 4QGBA 2FPWA 4NBWA 2GRJA 1VPEA 1UKYA 3BRWD 3DKVA 1JYSA 4QQ8A 3Q0EA 2F64A 2POQX 4M0LA 3RSHA 1O95C 4QLOA 1G7TA 3BMOA 4PQYA 2ZSEA 4D0NA 1Z7EA 5KVQA 3E2MA 2JH8A 5J4VA 1JE1A 4PIMA 5J2UA 3U7QA 1CUYA 5KU1A 3PQEA 4PHFA 1IN6A 1M33A 1Q5PA 1T34A 2DZDA 2GEKA 4I1VA 4MP3A 4BZQA 4EM6A 1EFAA 4LQLA 1W19A 2YIMA 1N25A 3QVLA 4M1SA 4OG2A 5CGZA 1XPUA 2C2HA 1XTKA 1RJGA 4EFMA 4GI5A 5ITZB 3H3JA 5LP6B 1KBQA 3IR5A 5T3UA 4RE6A 1LBSA 4CUZA 3LT2A 2ISCA 2GOYA 2IYAA 1SM4A 2DYKA 2M98A 2R96A 1DO8A 3AU9A 1QH0A 4RF5A 5EZ5A 4L4SA 4BQRA 4RF2A 4YV7A 3TQFA 2G5TA 1ZJYA 3ZWDA 2N9UA 1I7PA 4Q3KA 4XX0A 5ALPA 1Q84A 2QE7D 2VP9A 1W4AA 3RKUA 5AUNB 3V1MA 4CT5A 3H2BA 4U63A 5LBIA 3FKJA 3E2PA 4QDKA 5ALOA 1U8ZA 1JQBA 2BUCA 3G8DA 1QBGA 4NU5A 2X4LA 2X7XA 4FHGA 1NT4A 1CRWG 3KFLA 1FEZA 1USIA 4G37A 3AHJA 4UDNA 2VF8A 4LMPA 3X43A 1W36D 1JB1A 4EB6B 1SHJA 1WQ4A 3C98A 1H5UA 3UW1A 3OT5A 2R79A 3MTBA 5EHGA 1WZ2A 1G5RA 3NHBA 4G9GA 4WCFC 4W1PA 2J3LA 4ML3A 4Y2UA 2D3TA 4OQFA 3THRA 2I91A 5EHIA 5CYFA 3MJSA 4CNBA 3VR6H 3OZSA 4D0RA 4YTEA 5K0GA 4M0MA 1B1AA 4ZPXA 1L4EA 4IDGA 2XMGA 4P7KA 1YSCA 4I4NA 4HFRA 5E38A 3TVDA 2BTEA 1RQXA 4YJFB 2VDJA 3JYNA 4KDCA 1ZP6A 1CY1A 3AVPA 3MYRA 5DCWA 4DR6B 1UOPA 2GPTA 1R0SA 5CFPA 3AF6A 1J2YA 3PZRA 2NXNA 2AUMA 3SZMA 4RKYA 1MABA 3ABIA 2H17A 1A2QA 5CMLA 3LRPA 4DIKA 5SY9A 2N75A 2OO5C 1I80A 4G09A 4HYTA 4C2TA 1WB9A 1X9IA 2WICA 3KHSA 1UBUS 4F8YA 2DH6A 3F98A 4DNOA 4QDZA 1SZPA 1JDJA 1HRKA 3COVA 4LJAA 4Q82A 4O4LF 1AZLA 2HDHA 3CCCA 4FS3A 4KL8S 3L7YA 1ECGA 5E1DA 1IMOA 2BRUC 5FBKA 1I1NA 4RM3A 3SEFA 2OBYA 3RUEA 5U4XA 1DAOA 1Q0UA 2G9VA 2AFVA 3K4HA 3DW3X 4FYYA 4WKPA 2C5AA 2HGZA 3GFFA 3RNLA 3V00A 3VZCA 3WA7A 2R0QC 4JDUA 3BFVA 2V58A 1IBRA 3AV3A 3C3BA 3W05A 4YV0A 5C52B 2V97A 3B89A 3KNZA 1KKMA 2DULA 3QFSA 3QY0A 5H7XA 4D9HA 5I7UA 4PO9A 1DBVO 3CLVA 2PPVA 5DTRA 2B35A 4IMRA 2FMTA 2ZR7A 3DULA 1M2GA 3VR2D 3KXPA 3AW8A 2X77A 1HLFA 3KYCB 3UXMA 1SRRA 1D09A 1Y5IA 3A1NA 1YOVB 2ACWA 1T9AA 2PKXA 2Q3LA 3DBLB 1MX1A 3FMPB 3N6XA 3ZIUA 2LW7A 2OHVA 3SQWA 3NBYC 5DDIP 1C5KA 4K6FA 4LRXA 1QQ5A 3HUEA 4MR9B 1EFRD 2DLCX 1LJ8A 3FPLA 2WE7A 4AQYB 3NKVA 1KHTA 1VLMA 1OBFO 1MH1A