3D1JA

Crystal structure of e.coli gs mutant dmgs(c7s;c408s)
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
475
structure length
475
Chain Sequence
b'MQVLHVSSEMFPLLKTGGLADVIGALPAAQIADGVDARVLLPAFPDIRRGVTDAQVVSRRDTFAGHITLLFGHYNGVGIYLIDAPHLYDRPGSPYHDTNLFAYTDNVLRFALLGWVGAEMASGLDPFWRPDVVHAHDWHAGLAPAYLAARGRPAKSVFTVHNLAYQGMFYAHHMNDIQLPWSFFNIHGLEFNGQISFLKAGLYYADHITAVSPTYAREITEPQFAYGMEGLLQQRHREGRLSGVLNGVDEKIWSPETDLLLASRYTRDTLEDKAENKRQLQIAMGLKVDDKVPLFAVVSRLTSQKGLDLVLEALPGLLEQGGQLALLGAGDPVLQEGFLAAAAEYPGQVGVQIGYHEAFSHRIMGGADVILVPSRFEPCGLTQLYGLKYGTLPLVRRTGGLADTVSDSSLENLADGVASGFVFEDSNAWSLLRAIRRAFVLWSRPSLWRFVQRQAMAMDFSWQVAAKSYRELYYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glycogen synthase
publication title The Crystal Structures of the Open and Catalytically Competent Closed Conformation of Escherichia coli Glycogen Synthase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 158
structure length 475
sequence length 475
ec nomenclature ec 2.4.1.21: Starch synthase.
pdb deposition date 2008-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00534 Glycos_transf_1 Glycosyl transferases group 1
A PF08323 Glyco_transf_5 Starch synthase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3d1jA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3d1jA02
2ASVA 2QRPA 3CEJA 2SKEA 3DZCA 5ENZA 3ZCTA 3S27A 3CX4A 3ZCPA 1L5VA 2BFWA 3BD6A 4N3BA 1JIVA 4GPBA 3G2NA 1LWNA 3MTBA 2GT1A 4WADA 3NC4A 2G9VA 3L79A 3MRXA 4KQMA 2WTXA 4BQIA 1JIUA 4CTNA 3CUWA 2AV6A 3H4IA 2QRQA 4FZRA 4N9WA 1JG7A 4WACA 2VCHA 5LQDA 3WC4A 4RENA 3TSAA 2VSYA 1FU4A 2G9RA 2XGSA 3WAGA 3C4VA 3HBFA 2IV3A 1B4DA 2X6RA 3NB0A 3Q3EA 4MHOA 3MTAA 1EM6A 2VCEA 2QRMA 3CEMA 3ZCRA 3E3OA 4GYWA 1ABBA 3CUVA 2ZB2A 4N3CA 2QN7A 4NESA 3RSZA 1Z62A 3TAXA 4LDPA 2QRHA 2GM9A 3OY2A 5DXFA 1Y8ZA 3ZCVA 3MRVA 2GJ4A 2X6QA 2GPAA 2BISA 4BFCA 1FTWA 2F3SA 4AMGA 1L5QA 4REMA 2ECPA 4CTOA 2G9UA 2C1XA 3MS4A 3IAAA 3UYLA 4AMBA 2H1HA 1VGVA 4RIHA 4BQFA 3EBOA 3RT1A 1P4GA 2X0FA 3BDAA 4W6QA 4XIFA 2HY7A 3OKCA 4N3AA 3MSCA 3PE3A 4GZ5A 1PSWA 1WW3A 2QN9A 1GFZA 3C4QA 3G2LA 1SXQA 3ZCUA 5DLDA 4HWGA 2R66A 3HBJA 3HBMA 1YGPA 3CUUA 9GPBA 1O6CA 4MRAA 4EL0A 4RIEA 4F96A 1P2DA 1UZUA 2VSNA 3HBNA 1E4OA 1FS4A 3UYKA 4AY6A 5HXAA 1F0KA 3ZCQA 4CTMA 1YA6A 4YUAA 2JLBA 3QKWA 2XGOA 4AY5A 2PQ6A 3G2JA 3MT9A 1FU8A 3DDWA 1NVKA 2JJMA 1KTIA 3T3IA 2IV7A 2H1FA 3ZCSA 2QN8A 2SKCA 4GZ3A 2AW3A 5DU2A 3WADA 2QZSA 3CEHA 1P4JA 2PRJA 2Q6VA 3PE4A 2QN2A 3COPA 3E3LA 3GPBA 3GUHA 1L5RA 1M5RA 1GPAA 3RHZA 4HLNA 1FU7A 3T3DA 3Q3IA 4Z5XA 1WUYA 3G2HA 3T7DA 2F3QA 1RZUA 3TOVA 3MRTA 4X7RA 1P29A 4F9FA 3OKAA 1EXVA 2O6LA 4EL5A 5JTTA 3DDSA 4X7PA 2ACVA 4YI5A 4EKYA 3OY7A 2R4UA 3VUFA 5TMEA 1QM5A 3MT8A 2F3UA 3AMVA 2R4TA 1L5WA 4WHMA 3BD8A 3CUTA 1P2GA 2FETA 1PYGA 2P6PA 1Z6QA 4X7MA 1Z8DA 1GZ5A 2XA9A 3CUYA 4M7PA 3G2KA 1UQUA 1C50A 3L7DA 1E1YA 4GZ6A 3S29A 5GPBA 3SYRA 2QN1A 3MTDA 1WV1A 3OKPA 1K06A 3SYMA 3IA7A 1NLMA 2QN3A 1FTYA 1P2BA 4RIFA 1FTQA 2F3PA 3BCSA 4PQGA 3H4TA 4LEIA 2IUYA 3OT5A 4NC9A 3VDMA 5C1DA 4XI9A 3S2UA 2PYDA 3OTHA 4CDRA 1L5SA 1NZDA 1K08A 3OTIA 3T3EA 2QRGA 2GEJA 1A8IA 2IEGA 4KQ1A 1XL1A 3RSCA 3MQFA 2ATIA 2ACWA 1C8KA 1QKJA 1GPBA 1C8LA 5D01A 2QLNA 3BEOA 4MI9A 3T3GA 4X6LA 3T3HA 2XMPA 1XV5A 1RZVA 4MHSA 5IKOA 4F97A 2R60A 3BD7A 1LWOA 1BX3A 1H5UA 2C9ZA 3D0RA 3S0JA 3EBPA 4RIGA 2C1ZA 1GG8A 4RBNA 3QHPA 1XL0A 2PYIA 2FFRA 2QLLA 5IKPA 3T5TA 2VG8A 2IYAA 3Q3HA 1PNVA 1XC7A 1Y6FA 1JIXA 3D1JA 2IW1A 2IYFA 4KQ2A 1GGNA 3BCUA 1WUTA 1L7XA 2BGTA 3BCRA 5I45A 1IIRA 3L01A 1L6IA 3L7AA 1Y6GA 1P4HA 1AHPA 2XCUA 3L7BA 2PRIA 1J39A 4FKZA 1JG6A 4RIIA 2IEIA 1Z6PA 4RELA 1FA9A 3VUEA 1UQTA 2AMVA 1NOIA 3NCHA 2AZDA 4MI6A 4MI3A 4BQEA 4N39A 3O3CA 4NEQA 1NZFA 2X0EA 2OFFA 2QNBA 4YI3A 2XCIA 1XKXA 2QLMA 3C48A 2XGMA 2XA1A 1FC0A 5TMDA 3FROA 1V4VA 1HLFA 2GEKA 3MT7A 2GPNA 1RRVA 4AN4A 3L7CA 6GPBA 5TVGA 4QLBA 2SKDA 3NP9A 4MICA 1WW2A 1C3JA 1JEJA 4EJ2A 2XA2A 2F9FA 1XOIA 5JTUA 2BGUA 3S28A 2GPBA 3MBOA 2JZCA 4GYYA 3CV3A 1NOKA 2R68A 4M83A 2G9QA 8GPBA 3DD1A 2YJNA 2C4MA 4EKEA 1F6DA 2FF5A 3OTGA 1GPYA 2X0DA 3E3NA 5D00A 1PN3A 1WV0A 3G2IA 7GPBA 3NP7A 3MS2A 5TMBA 3VDNB 4M60A 1AXRA 3D0QA 2KS6A 3NPAA 4L22A 3MS7A 4G2TA 1IXYA 1NOJA 1SXPA 3NAZA 5BNWA
chains in the Genus database with same CATH superfamily
1JH9A 3A4LA 1ETHA 1ZISA 3DGFC 4YN3A 5IDQA 3T4UA 1CZKA 1WVMA 3A9UA 1TM5E 3BH7A 3IUPA 3CLKA 5G1OA 1DAOA 1JHAA 4KRYA 1GGMA 3BGDA 4I4TA 1KPHA 4I1OA 4KHPB 1EJ0A 2BFPA 2NUAA 4G09A 2VRNA 2TMGA 3OT4A 2BOVA 1Z6XA 5H9VA 3FNEA 1FTGA 1SD5A 2B98A 3GLGE 4HPXB 3BJZA 1WUJS 4IMPA 4RL4A 1GOTA 4WADA 3NTQA 5LQCA 2IVZA 3MRXA 1DLIA 3K9QO 3L79A 2G5GX 1X15A 3TK1A 3PDJA 4DLLA 2HIHA 1O4WA 1M6EX 3TAHA 4ZCRA 1QG2A 4UU8A 4KYUA 4BB5A 2IBTA 1EB9A 2AG8A 4P4UA 5IDWA 5I9LA 4BLRA 2GRUA 4IOMA 2C2MA 2EU8A 3WL7A 4DDWA 5DLPA 1CW2B 1KAQA 4TWJA 3ROTA 2NUTA 4RTLA 4DV5B 2NIPA 1L5HB 3EA4A 4IV0A 3FCSB 3WNQA 1LVUA 1XZGA 2QVBA 1BXGB 4QT4A 4HH4A 4US1R 3QMPA 4XGRA 3X1WA 3RC2A 4Z1OA 1Y4DE 1AGNA 5EUBA 2Y0PA 5JI3E 1GPWB 2UV8A 3F2VA 7YASA 1EK0A 1BX1A 2QUBA 1MX9A 2V8OA 2QQ5A 1D4FA 1ZCFA 3T06B 1H2AS 1VP9A 5TPWA 5IT0A 4GZMA 2VK4A 1X94A 1YSCA 3N8DA 4MW0A 1TJ4A 4C30A 5JXJA 1B4DA 2QQGA 4OYYA 4C2AA 2FR1A 4QZVA 5JY1A 1SCNE 2MSDB 3FIUA 2RGEA 3M6XA 5CM8B 4UDYX 1R8XA 1RBYA 4HUTA 2HX1A 2XZPA 3Q15C 2PNFA 4MS3A 4WKNA 4W9NA 2P27A 1SQ6A 2FWRA 2R8RA 1QV7A 2I87A 3ANNA 4G89A 1M7HA 1U11A 1X8KA 1NUHA 2ZB2A 4N3CA 1Z62A 4QO8A 2KM1A 5SY9A 3OJFA 2XRZA 3THXA 1S1MA 4NK5A 4B6GA 3PHLA 1LBSA 1GHTA 2ZB4A 4HAIA 4J7CA 3WNZA 2QXTA 4UE6A 1JKXA 4U8GA 1YJ8A 1G5TA 4BKUA 2G40A 1Q11A 2ZULA 1ODJA 1ADBA 3UJBA 3ZYZA 3EPKA 1J5EB 2GPAA 2A58A 2HPVA 4AYXA 3H2JA 3ZY4A 4V0ME 3TVTA 1KI6A 2X8JA 1A7UA 1J9GA 2AN1A 1IMOA 3PE6A 3U60B 2PUAA 1R74A 1G0NA 4NZZA 4AMGA 2C5GA 3ZWKA 1VTKA 2B78A 4DR6B 1Q7EA 2EKZA 3CW8X 5KNDH 1CUSA 2BGLA 1XA3A 2VUSA 1FRQA 1F7UA 2P67A 2G9UA 4XRGA 4Y6GB 4EW6A 4KWHA 2NU6A 3GNTA 7REQB 1EE1A 2P1DA 4EYSA 1I8TA 1YFJA 4LF7B 3MCVA 4AYTA 2B4QA 3ACCA 2JHCA 3INYA 4DA7A 4YB8A 3AQIA 3KWLA 2NLOA 4RY9A 3S7TA 3BN3A 4OH7A 1QTIA 2BMJA 2L17A 3FMFA 4YXWD 5GVRA 1OZAA 2Q2QA 4WK4B 2V9CA 1KFJB 4HNSA 1IMJA 2YFYA 3D64A 2PO7A 4LDQA 5FR1A 4AMUA 3UB2A 4B3MB 3LIIA 3Q12A 4PG8A 2G76A 4Z49A 3K9BA 3A3KA 1I24A 2VDWA 2ZIZA 3JQPA 2X5JO 4NZNA 3RK1A 2WKRA 3BRCA 3C4QA 1ZMOA 4LDAA 4MVJH 5LZ4A 3RUCA 4NXMB 4UTOA 3ZCUA 2AW5A 3TDMA 1YHZA 1IQUA 3S2YA 2W4MA 5DLDA 4BVAA 3P19A 1DC8A 4ZV4A 1BHJA 2A7XA 1J1ZA 2CXPA 3BWDD 1RP1A 2HYIC 3RC8A 5KYWA 3OPXA 1OV6A 1YGPA 4HKTA 3CUUA 4ITRC 2EVWX 4CDGA 1IVSA 1Z7BA 2WIDA 4JD5A 2JGKA 1TD9A 3PGMA 1CULC 4OQQA 4DG8A 2OLEA 2HCJB 4U7DA 5ICFA 2OWEA 3HJUA 3NJ8A 2D59A 4EITA 1T2DA 3RF6A 1T4DA 1YJQA 3OSZA 3SLKA 2AGVA 4BP1A 2OMKA 1TT7A 3P0HA 2ZBUA 3O4VA 3WQRA 4CT4B 4DIUA 2JIOA 2FMXA 3DVRX 4LDRA 1FNCA 1G291 2JDIA 2HQ1A 3KUDA 3OPVA 4AY6A 4S24A 2NQ2C 3BERA 3I2HA 3DL0A 4FQ5A 3ELYA 5EL0A 3U13A 3ND8A 2FPPA 4A5OA 1YC5A 4TRNA 4WESB 4ND1A 3QKWA 3WGYA 4PHGA 2CXTA 3T9BA 1KETA 3JQ9C 1A8HA 1DXQA 5MFPA 1EVZA 1J99A 1SNYA 1I1OA 2W6QA 2PT7A 3BTSA 4RTRA 3KBBA 2AQHA 1QYWA 2PSDA 3O5AA 4LHEA 3KZMA 4UE2A 5BO5A 4F8YA 1U98A 3RABA 5HIJA 1H2YA 1SIUA 4RLQA 5C31A 3C45A 3WKBA 1YI8A 1FMJA 4G23A 4G9BA 2ZAMA 2IXBA 1B8PA 3DV2A 4NHOA 1Q1BA 4ISCA 3E23A 5JAUA 1U9CA 2ZM6B 4IDNA 1KNQA 3BORA 4DIBA 6REQA 3DB2A 2RGAA 4CIBA 1YDMA 4YMIA 3W5UA 5IU6A 5FBWB 3DFUA 3KJHA 3G9ZA 3KR1A 3WWPA 3D2CA 2ANCA 3GPDG 4KXFB 5T4BA 3QX9A 3I4FA 5AK4A 2R6JA 3KTOA 5EUCA 3COPA 1W2WB 2DLNA 2FUCA 1NMXA 4MWZA 5HDBB 4BAGA 1JU4A 1JHUA 5ADWA 4X6UA 1T9GR 4HEA6 4JT4A 3O8NA 4Z9FA 4P83A 1YR6A 1M5RA 4YS6A 1E0SA 1JR3D 4OXXA 3R8CA 3RSFA 3SIRA 3N87A 4RY2A 3P20A 1Q6ZA 3C8UA 5CLLA 5IKEA 2I8CA 1ISGA 1B14A 5AQEA 1QG6A 1Y3CE 2HJGA 2NUPB 4O4HF 4M3NA 4P7GA 4FWTA 3I6BA 4MA0A 1MXHA 2ZWAA 4G1FA 4IZOA 5C8ZA 1F48A 1T8PA 2Q1XA 3ABRB 3FDIA 3I58A 3KT0A 2BHLA 2HLPA 1NQWA 2J3HA 4HZIA 3STUA 1KJ9A 1RYEA 3ZHSA 5I7SA 2H1OA 2NU9A 1EDBA 1VFNA 1ZESA 2FV8A 2ZT6A 1S0UA 1TU3A 3FB4A 3GCGA 4UBJA 5I4CA 5HQTA 4P81A 1VIVA 2IYXA 4BMVA 1ODFA 2V7EA 4CLRA 5LNK1 3LFHA 4JR2A 3NT5A 4BNVA 2ET6A 3WYNA 1AA6A 2OG1A 2Q7XA 3E05A 3PHBE 4KGVA 4XPIB 4WCFB 1LEHA 2CNLA 2DHCA 5EQFA 2BTOA 1NC1A 2O1EA 4HAZA 4DARA 4GDFA 3IUJA 3KPVA 4QYTA 1HZJA 1SRQA 2MJLA 3AXSA 3H6KA 4WN9A 5L3RA 4C7MA 2F3UA 2R4TA 3I6QA 3I0NA 4Q18A 4E4RA 3QF4B 1ISSA 1P2GA 3E7XA 3Q8LA 3VHQA 5I9IA 1Z6QA 1PW7A 3AEKB 3WJAA 1U1IA 1Z8DA 5DBOA 1PUJA 2Y9MB 2A9RA 4EY3A 4HFNA 2CDAA 2D5LA 4GF5A 4JX8A 4F21A 2PFSA 3P2IA 1VHTA 4K6GA 2IS4A 2OQIA 4YRZA 2ACKA 4NDNE 2XQKA 4OI2A 1J33A 1C50A 3HU5A 4CV3A 3R3VA 2ESRA 3AOGA 3WAJA 4BTLA 3IJRA 3HVJA 2YY5A 3G9UA 4RWZA 1J56A 1QTRA 2XOXA 4L2IA 4J94A 1P9NA 5IZ4A 3ZDZB 1MABB 3GJZA 4TYMA 4CNBA 2ES4A 4BUCA 3KUKA 4FKBA 5FRDA 1AX9A 2OV3A 4X91A 5DTRA 3Q8XB 4BO2A 4F06A 1MN6A 1ECCA 2Z2YA 4M88A 3K4PA 1BSVA 2J3JA 3NO4A 5LLSA 3TRHA 4DILA 1X1AA 2BI7A 4FFRA 3HRKA 4UOZA 4F72A 2XT6A 1DU4A 4FGZA 2DPGA 4QYIB 2HR1A 2BVNA 4XWAA 1BN7A 3KK0A 4EHAA 3WFJA 4IH4A 4Z86A 2WJVA 3I45A 3KPWA 4BZZA 2I6XA 1P18A 1TKCA 2MINA 3DTNA 4A6PA 1QSGA 5C1DA 2A2ZA 3SPXA 3G0BA 1LPMA 3GGGA 3SR0A 1GVNB 4Y98A 4JB2A 1WAMA 4TKZA 1SVUA 1IPHA 3ONNA 1TB4A 3GQVA 1D09A 3R5XA 1N32B 5ADHA 1VKRA 3UHOA 4QTUB 3CF0A 3KT6A 4J3FA 1E3WB 1V3UA 1U5BA 2R97A 3K70D 1GRVA 3O9ZA 4KQEA 3H2SA 2LKDA 3P0IA 4ZCTA 1JDBC 3M5WA 1G98A 3T7EA 3V4FA 3WDKA 5E1BA 1L7RA 4AKSA 2B8WA 2QSJA 2GXAA 1XTSA 4DDMA 4U7FA 3SR3A 4JA2A 3KOYA 1TCVA 3GZNA 4KB5A 5TQVA 3EPHA 1MOQA 2UVQA 3C74A 1GZ7A 3FLAA 1ZNQO 1PHRA 2XRFA 4P3PA 1X8XA 2JGLA 1ZN2A 2NYVA 3SNKA 3KLNA 4F92B 4CM5A 4F04A 4HXYA 4AFNA 4BWYA 2QUAA 2NU8B 5CB6A 4HDMB 2I91A 3NVDA 4HS9A 4LWQA 1EFTA 5AKYA 1DB3A 4FMDB 1BE6A 1O9HA 3DF7A 3N8GA 4PIVA 3T5MA 1GDHA 1BX3A 3HKBB 2ZBDA 4MPPA 5AUQA 4ZHSA 4E2YA 4KXWA 5GV7A 4O0LA 1PKEA 5AK5A 3TLJA 1K6EA 4H0NA 3UAXA 4ABTA 2OXIA 2PYIA 1FLDA 4PTYA 3X3HA 3R6WA 3FRIA 5K6RA 1ZH6A 3G02A 1DOAA 1Q84A 4JITA 4YJHA 4UPDA 4QFDA 1G63A 3DMTA 2HA2A 2Y77A 1T3SA 1CY7A 4Q1DA 2IW1A 2GCOB 3CVUA 4N7MA 2ABWA 4RM2A 5A03A 1ULUA 3EZYA 3UJ9A 4Q4DA 2FK7A 1XD2B 4JJZA 3VR5D 3BCUA 4ZAXA 2KBFA 3I9LA 1RPZA 1PBNA 3A0RB 3D6FA 3H6GA 3C6QA 1DTEA 4LDZA 4LGMA 4IXWA 2WQ7A 1OASA 1KMCA 1JGTA 4BMYA 1DEHA 5IYZA 4Y9SA 2C99A 4O2LA 4DWVA 1U1GA 3FCOA 3KTAA 3QBVA 4V3CA 4YRFA 2Y68A 3CINA 3ZZTA 4V0OA 3GYGA 2I5PO 3KXKA 1PAUA 2JARA 3REGA 3ZWVA 4NEGA 5JJIA 4KCGA 3UQYS 4IYJA 2WT4A 4MI3A 3O3CA 5KYXB 4URFA 5EP4A 3OZUA 3PVCA 4MKIA 2JBHA 1R10A 4LF8B 3IVGA 2ZUBA 2ZITA 4RZSA 1T8WA 4HB0A 3RSGA 3TW8A 1F38A 4OYRA 3H11B 1M8JA 3FFXA 4TSFA 1V6AA 1Z2NX 1UBKS 3FTCA 1FFHA 2VWHA 4LY6A 2IEYA 1CVRA 3WDLA 4YT5A 1EIWA 3LBAA 1OC2A 3H9CA 5ULLA 1I3CA 1RFGE 3LMKA 2A86A 4KOEC 3V7NA 2QSZA 4CMBA 1M54A 2CL0X 1HEYA 4RHXA 3F8TA 2UVPB 1K2VN 2BE9A 4PLCA 4ADSG 4EOGA 4KPUB 2PMWB 5ESDA 5ESRA 4MCJA 3ZHTA 1YRAA 3B3AA 4XYGA 2QTGA 5DSZA 3GD5A 1PWZA 2JFVA 5ILGA 1E9VA 1M5UA 2GILA 2L69A 1QYXA 2PY6A 4Q6WA 1AZLA 5CYOA 1JPVA 3OOSA 5AKLA 3RR2A 4GRDA 5HF6A 4MEJA 3R4CA 3VOTA 1JEJA 4DAOA 1SHTX 1CUUA 1R15A 4DMLA 2XNJA 2DCUA 5IK2D 4RF3A 3KQKA 2YWXA 5TC4A 5CA0B 4KH0A 5CFMA 4MRRA 1S3FA 5CITA 2ORVA 1G5RA 4H7FA 4JJIA 2QVGA 1E0AA 3KWMA 2JH3A 5LA6F 3GA7A 1C14A 3CJTA 1U3WA 4QUIA 4QOGA 5BWCA 1KRWA 1M6NA 2HPZA 1TIKA 2W37A 3EQ6A 3E2IA 4YH1A 5BUQA 1K7EB 1AKWA 1RHJA 1W6RA 2FMKA 3MWGA 4C7JA 4ZI7A 2YJ3A 3BTVA 4QJIA 2DC1A 1N5RA 1SXJB 3HJFA 2J1LA 3GU3A 4N7RA 1JJVA 1Y80A 2AA3A 2FOIA 3ICPA 3KHKA 3OTGA 4H15A 1IZ8A 2ISQA 2PPVA 2RHTA 1PT9A 2QL7A 4NU8X 4CMAA 4ZTBA 4DG9A 1CYDA 4GI1A 2IBMA 5F7OA 2ZREA 5JAPA 3JWGA 1VOTA 3OEWA 5CDTA 4E7PA 4HP8A 1RRCA 4A1FA 1DS6A 1Z08A 1UMCB 1MU0A 1ZOOA 3IV7A 4K9SA 3SIPA 4JGGA 4KEAA 4QU9A 4EO7A 1AXRA 1Z6TA 2QMHA 2X0RA 2XZLA 4BMZA 3V4VB 2X1MA 2GD0A 1UKAA 3L9XA 1J0CA 1NPDA 1K88A 4BGIA 3JD4A 4DGQA 5AUOB 3AVXA 2EGUA 1FOEB 4LPKA 4QUAA 4RTQA 1VLHA 3M4XA 1LU9A 5GY7A 1IJBA 2FW0A 2FGJA 1IXKA 3A14A 4X95A 3QX3A 3R8XA 2NU7B 4WZBB 4MDYA 5HFNA 3NH6A 3O93A 5HKBA 2O8EA 1UPXA 1Y82A 5FWYB 4FI3C 1WEHA 4YBZA 3AR4A 3PYXA 3E8XA 1ZBDA 1TCAA 1X8JA 1A82A 2WYUA 4B3DA 1HA3A 2JA1A 2VBCA 4B3JA 4CCWA 4L16A 1PS9A 2FTKE 4YO8A 1C3EA 1WMEA 2H4XA 3O75A 3Q4GA 3SEFA 3VC3A 4TZ0A 4OHVA 3VKFA 1EDDA 3BMOA 1LSOA 3KEMA 1XT6A 1NW8A 4ZCIA 3ZWPA 1I4OA 3TEMA 1WY7A 4LVCA 4Q24A 4EPYA 1H65A 1W36B 1N78A 1V9CA 2WTXA 3GLFB 1I5RA 5A1TA 3ONWA 1F2TA 1HRDA 2E85A 5GZ3A 4HADA 4YIHA 2ZATA 5DXJA 1UL1X 2BSAA 2OECA 2XMCA 1PR5A 2Q8PA 1N3IA 3QG1A 1CD5A 1CLUA 1JSZA 1V9SA 4R2HA 4RA9A 1OFTA 1OZGA 1OILA 2DFKB 2O3SA 1KE1A 4DMMA 2B69A 5BV8A 5BMOA 1H22A 2P11A 1MRNA 2IUFA 1H0KA 1SK9A 2P9ZA 4Q4HA 4WACA 4RC9A 3NFYA 2H16A 3CZCA 1MDFA 1D0VA 2VZ8A 4GXRA 2V7GA 4LV8B 4DNOA 3PEWA 2V5AA 3ISVA 3VU0A 4GOKA 3C3JA 1ODIA 3QOFA 4JLKA 2G9RA 4FZVA 2IXAA 5SYNA 4GMGA 1CFZA 3UMMA 4F1WA 1H2RS 4JYPA 2GPSA 3C4VA 1NU6A 5JDIA 2BSQA 4CU5A 3PJDA 4CW7A 2WKSA 5EZ5A 3BIFA 1P1RA 3EDMA 4OBEA 3EQ8A 1KYIA 3OQJA 4YAJA 3UK2A 2E87A 2PBRA 2GA9A 3BMQA 4OJTA 3C8DA 3H1BA 5EQDA 3GH3A 2HU8A 4C22A 2C04A 4XJTA 3LL4A 4FOTA 4JP1A 3DE4X 1WDTA 4M76B 3ZCRA 3WRWA 1PG2A 5DO9A 4AF7A 1BE0A 1WB6A 4P5EA 1AIPA 4KAAA 2HJSA 2A5GA 4M9ZA 4E5VA 3GRKA 3F9RA 3H8SA 3VKGA 4Q37A 4HNQA 2PKWA 3SM3A 4UZSA 2P0YA 2QGFA 4XJVA 5LKAA 3K4QA 3EFOB 4FFDA 4RJJA 3MRVA 1UBCA 4MDHA 1Q17A 4JUAA 4FMBB 1YHNA 1K3FA 4N5DA 1UWVA 2WJPA 1XVAA 5F52A 3B7WA 1K7YA 3UWMA 1BS1A 4UOQA 4ER3A 2MSWA 5KYYA 3HUFA 3AW9A 2X7XA 1XTVA 2ZCJA 1MVLA 2NXCA 2V7BA 4PGGA 4P7FA 4NKRA 2Z8YM 2IOFA 2OPBA 1ZD3A 5AKEA 2IPAB 2Z9BA 5KNBD 3C5CA 4MYHA 3K05A 3UHPA 5I3CA 2DLCX 1VDZA 4P0TA 3H5LA 1ZOLA 4BB6A 4BBZA 3V2HA 3TBHA 1HZZC 2D7CA 2RHOA 3L9WA 4PPQA 3HACA 3SK0A 2RBKA 5C8XA 1GAEO 1TMYA 3H5WA 4I4IA 3SHWA 1BWSA 2FP4B 2Y05A 3EBOA 4YV0A 5C1OA 2B5WA 4PRZA 1QE0A 3CONA 2WPNA 2X0FA 3IBYA 4RPCA 4DSZA 1WEKA 3W4IA 2QNIA 4Y3UA 5CVEA 4DLVA 1DQRA 4DQ0A 1L5HA 2HT1A 1BW9B 1QHFA 2G8NA 2CK3A 2X0KA 3O91A 1BXGA 3PE3A 4GZ5A 4PNPA 1PTJA 2AFHB 2CFIA 3KPJA 3BRWD 3JQFA 5IBPA 5HCUA 3IELA 3PFBA 3ICQB 4HXFB 4UCFA 2XB8A 2P9YA 5C51B 1RS0A 1N1GA 3BXPA 5FBQB 4GGOA 3IUMA 2AC7A 3UQZA 1I14A 2E37A 3OMWA 3V2GA 2HU5A 2I33A 1EBUA 1XAGA 3ISJA 3PQ8A 2YV3A 1C9KA 3DL2A 1COZA 2ZB8A 4LXTA 3WL8A 4WJLA 5AWFC 5TNXA 5LJIA 2R4QA 1OIWA 4N6NA 1CP3A 1W87A 3EDOA 4TWZA 2FXIA 3ZGNA 1Y48E 1NW6A 2OCKA 4FILA 2E4WA 3VR6H 4QX6A 4LK3A 1WXIA 2YWCA 4N01A 3PC3A 1DCMA 4QARA 5IFKA 2FR8A 2JVKA 2ZSDA 3Q9UA 4TN1A 2W5UA 5GJVC 3ZWWA 5C5CA 4H77A 2YCLA 4IQFA 1XTBA 1VQ1A 3THRA 2Q5EA 4JBWA 3VSBA 4IQ0A 2ODAA 4PC6A 4GPEA 1KMQA 2HPAA 3FF1A 1R6TA 2GHRA 1KYWA 4LTMA 2VRCD 3Q98A 5KNCA 1KP3A 2WPDA 1FYWA 1HUQA 1NZJA 1R8SA 4GKVA 1WSWA 4OD0A 3EPJA 3ABOB 3EIXA 2XYQA 2CJYA 4DQLA 3CN9A 3OA2A 4QM7A 1LV8A 2YWFA 1NQTA 1OBVA 2C20A 1T9KA 1T24A 3GO4A 5ITWA 2CY0A 3IMFA 2B2NA 4FB4A 3E9NA 1CRPA 1I4LD 3DCYA 3OX3A 1U8ZA 1DBVO 3L84A 7REQA 1DSSG 3FNRA 3WK6A 1ST2A 4WNYA 3GNSA 1EKXA 5LCXA 4AECA 5CM9C 4D81A 2NVUA 3IR6A 4C0HA 4R9VA 4RVOA 2NGRA 5E6RB 5KC8A 1JG4A 2ROQA 1MCZA 2OESA 2VNKA 2PG3A 3L07A 2VAVA 3FMIA 4K6KA 1JFRA 4JL6A 4Y9TA 3RYIB 4EYQA 1UBOS 1GQFA 4LJLA 4Q7KA 1LDNA 3HSKA 5FEUA 1M0EA 4A0FA 4HAYA 1I2BA 3BGVA 4G6ZA 4ENRA 1DAFA 1BFUA 2J6HA 3E3LA 1VA4A 1L4GA 3S6JA 3OZTA 1QCYA 4DIFA 4MP3A 3EXHB 3EN0A 5ALSA 3DV0B 4ZVTA 1YB1A 2P0AA 3WHKA 3ER9A 4BLOA 4D4GA 1RKQA 4BIIA 1GL3A 4M1TA 3RKUA 1S89A 2WWWA 3EPRA 2JB9A 3EH1A 2FPWA 1O97D 4J9UE 4RZ2A 3EMBA 2AWOA 2V9PA 3CNNA 4ON9A 3SDSA 5A3QA 4HNTA 3DBRB 3GGSA 3HYSA 2A0KA 2YN0A 3BXHA 1S9DA 1QHGA 2HSDA 2O8DB 4TPKA 3O3NB 4BUZA 5EUMA 1CKEA 1G7SA 1E32A 2P65A 3V1TC 3TJZA 5MN4A 1GKYA 1ACMA 4UOEA 4PFQA 4FFBB 2WJYA 2W9XA 3DDSA 4G5SA 5BR4A 1E96A 1ZD2P 1SBQA 1QHYA 3DZFA 5EIWA 621PA 3Q5EA 4L74A 2JCBA 1OPRA 2Z1MA 3K1YA 5ADUS 4BNTA 1Z4MA 3OIGA 1N0UA 3HQ4O 3RE1A 3I83A 2V96A 3GL9A 3O73A 3RVQA 1H2ZA 3VR4D 1RQ7A 4AUKA 4EA7A 3VNVA 2O57A 4F2DA 4WESA 3MT8A 1M1ZA 2I54A 3VPDA 4D82A 4ENTA 1DOHA 2CDBA 2H8GA 3HXTA 4RVDA 5J2UB 2RIPA 3LV8A 2AOXA 2QAGC 2C3UA 4RFSB 1G41A 2EJBA 1OW3B 5HE9A 2VAWA 3ET4A 5YASA 1Y9DA 1LLDA 3HV2A 2BMVA 2L82A 2W43A 4GD3Q 5BT9A 1IAVA 2DPMA 1W47A 4YMTA 2W2PA 3FWHA 3I6MA 4KFSA 1WCXA 1CHNA 1SAYA 4Z99A 3IPCA 4P3OA 3J7AC 3EOZA 1JSCA 4KTVE 2A4KA 3JSAA 2HDHA 5EPUA 3UXYA 4OOEA 2GESA 3OOJA 4TTPA 1UWKA 3ID6C 3LDFA 3O92A 4OPMA 2ZUEA 1TX4B 3CE6A 4YUZA 4RLHA 5DCLA 4MYCA 2DFNA 2XQFA 3WMFA 1GU1A 1U0FA 4IIGA 3IA7A 3V8QA 1FEZA 2R3SA 3X44A 4B85A 3EF3A 2OZKA 4YP0A 4PZYA 1E7QA 1WB5A 4C4YA 4QOFA 4JOBA 1M34B 2NZ8A 3BCSA 3FOBA 3IVAA 4J1TA 4X5OA 4KDEA 1DWQA 5ERYA 3COYA 1GV1A 1W1IA 2RG7A 4PZ0A 1M5TA 4BRSA 4E5UA 5EJ6A 3AU8A 4EENA 4DY6A 4Z2YA 3JR7A 5E9QA 2VBGA 4MYDA 4DLZA 3KU1A 4OUDA 5BSGA 2PYDA 3SXPA 4YALA 4E70A 1PWHA 3Q9NA 3FCAA 1U7ZA 4Y2YA 3LWBA 2M98A 1EWKA 3LPAA 4F91B 1BKYA 1IVNA 4CCSA 3CLSD 3TMYA 2PN1A 3M3DA 4DCPA 3DTVB 4D80A 1IZZA 1NW3A 3A6KA 2RHDA 4P1ZA 5LWHA 2C7QA 1GRNA 2F1OA 5C7IO 4B71A 2W11A 3H7AA 4U5XA 4MZDA 1Y7TA 2ATIA 3I05A 3ODGA 1X3LA 3NYWA 3ON5A 4QTZA 3GVHA 2OZLB 4D02A 2Z6QA 2PKCA 5CW2A 1UJ6A 1RAHA 4XPIA 1UWLA 2PMKA 4ID9A 4WCFA 1O03A 3GGJA 4BZPA 3EEBA 4MW6A 4MKGA 4RHTA 4RXMA 1G1AA 2W6CX 3QVWA 5ALKA 1KK0A 2C2HA 3IIJA 4MLPA 3QF4A 4ZYZA 1FFYA 1Y33E 4CEJB 4C0KA 4GX2A 1IBLB 3C97A 1J7JA 3EGIA 3BWMA 4ISBA 1HQDA 4JSTA 1DL5A 1P2TA 4DUGA 3MN1A 2G8LA 3AVTA 1E79D 1LWOA 4FCCA 4KE6A 3VYRB 1I6LA 2X19A 3IB3A 3M1YA 3TDKA 1J0EA 4B2YA 3HVKA 2V65A 4QDTA 3QEJA 4QODA 2Y8EA 4OFBA 4R1LA 4WA8A 3OVMA 1CQIA 1XI2A 2VG8A 4R1PA 1NVDA 2FN8A 4F5YA 4C6HA 1DWPA 2Q8NA 3FHCB 4QDOA 3QLVC 5ICCA 2PGXA 3LPNA 5BQPA 1R4AA 2WFMA 3FYUC 1UKCA 3W9YA 1RMQA 2FQ1A 1ISPA 2HGZA 1CUBA 3O8OB 4JELA 4BVBA 2IUTA 3EISA 5F35A 3VNBA 3ZVKA 2IH2A 4NYIQ 3EYAA 1IATA 4P8RA 4FXOA 3PXGA 5HVNA 4B3FX 1L7EA 4UHCA 3C15C 4GP6A 4D8VA 2IS2A 1LBEA 1O0CA 2AI2A 4AXBA 1QBGA 2B7CA 1CC1S 1GP2A 5I7OA 3QKTA 2J59A 2R5FA 2ZJ3A 5EVJA 1OYWA 1J8FA 1BEUB 2IEIA 3DCIA 4ND8A 4UNQA 1Z6PA 1RC8A 3IUYA 3QVMA 2VNHA 1QFMA 4BXOB 2UXDB 1AKYA 3G2QA 5EXEA 4AKTA 2R1ZA 1KHTA 2JC3A 3PD1A 4HEQA 2WTUA 5CVJA 1DC7A 2JBAB 4M1QA 1SKYE 2VZLA 2AYZA 4MI6A 4Z8XA 3TRKA 3AJ8A 4BEBA 2V3WA 5HQ3A 2GO7A 3B2NA 4H18A 4LMBA 3R76A 5JO0A 4EHKA 4BLUA 3G7NA 4NYMR 3N76A 2M6LA 4BX8A 1MB3A 3DWGA 3NZEA 2X0EA 1E3WA 1Z5PA 4QA9A 3U0VA 3HEMA 3PDIB 1C80A 1G5IA 1NFRA 3QFHA 5AD1A 2JG3A 3TLEA 2VO1A 1IBSA 1GD1O 2CZGA 3EGEA 2WTEA 3IESA 1XNJA 4G0XA 1KAGA 2XGMA 1FUYB 4QHSA 1BHQ1 2WTNA 5LXTF 2WSIA 2ERYA 1P91A 2PANA 3H5OA 4C4RA 3RIGA 3PVSA 1KZ6A 1XTRA 1Z39A 5G4KB 5ED0A 3ZI0A 5EWLB 5T7BA 4OYLA 3HHPA 3KR2A 2C2GA 2RSLA 3CX3A 3B3FA 3II6X 3GVCA 1B8VA 2BKLA 2H4ZA 3I30X 4F56A 1KK1A 2WK1A 3NHSA 1QNLA 2A9KA 6GPBA 3SCZA 5JC8A 2R7KA 2X3FA 3I92A 1E1LA 4UFNA 3GEPA 3SHTA 2EBWA 1IZ7A 3ECSA 4LRXA 4YGYA 1MAAA 4RULA 4PE5B 5SZJA 4QUBA 3JVIA 1YJBA 1E66A 1V3QE 1QHNA 1E61A 1K63A 3ZU6A 3NHUA 1Z6GA 2PUCA 1G9TA 2GK3A 4NX2A 2GPBA 3WMRA 3CV3A 1NOKA 3EIEA 1KY3A 1RCFA 4I5FA 3VR3D 3BGSA 2EDAA 5IBQA 3UUGA 2F1KA 4M2LA 5DN6A 4IMRA 2BEUB 2YFQA 2ZR9A 3T1VA 1V25A 1FDIA 3QLUC 1GAJA 5DISB 4H7DA 5EJMA 1I01A 4Y2JA 2RAPA 3OQPA 2GCOA 3JYNA 3VO1A 2YJNA 3MWFA 1ZWLA 2GEVA 2C4HA 1JZTA 4C2TA 2VPQA 1XD2A 1GQQA 1HOTA 1AH2A 1F6DA 4HRXA 2PS0A 4G97A 1KI8A 4JC4A 5AJUA 4CKYA 1MH9A 2R2GA 2ZBQA 3EOAI 4NOLA 4JLMA 3PWSA 2H65A 1Z4IA 2ZKIA 1W75A 3W2EA 4R9SA 1O6GA 3HWSA 2VHUA 4PZPA 5JCZA 2RH9B 2C7OA 2EQBA 3T7TA 2AB0A 3IGFA 4MV4A 4P92A 5FPPA 2IYLD 2JANA 4XQ0A 1BMTA 3CLRC 1Z75A 3TZEA 5KHLB 2GB4A 1YBAA 1SC3A 3OZRA 3W5IA 4PV7A 3V4ZA 2E82A 5IBRA 3FOAA 2KS6A 2I6FA 3T1NA 4EVIA 3HFSA 1VJDA 5EKTA 5KYXA 3UPUA 3DLTA 4NJMA 3SJUA 4EJFA 2FZLA 2VTBB 3GGCA 2F1HA 1P44A 4Q3BA 3VNQA 3I1JA 3D6MA 3U40A 3FCCA 2YS7A 1AQJA 2FZCA 4JI4B 2VDVE 1KORA 2EGGA 3KKEA 3H11A 5LIPA 2CVFA 3IEXA 4LIPD 1AK1A 2ASVA 1GTZA 2J3MA 2WNIA 3ZQ4A 1JYFA 2PLFA 3AUXA 2SKEA 2WM2A 3ZVMA 1KJ8A 4FDAA 1ZAYA 2FPKA 4M9XA 3ZCTA 3WICA 5JAMA 2H2FA 4GLLA 1BAPA 2NZ2A 4KXNA 3SD7A 5G0VA 3WMEA 2B0CA 2WUVA 4XWTA 3U3ZA 4R71A 2WKPA 4BBAA 4UXHA 4QGAA 3PKJA 1J1IA 4LMRA 3A1CA 4KPUA 5HG0A 3SSMA 3JYOA 2EXXA 1ILEA 3BWCA 3P8ZA 2Q3FA 1F6BA 2VRBA 2W4QA 4UHFA 1LWNA 1WP4A 1YB6A 2XZTA 3IYLW 3NXSA 1KQNA 3SKVA 1H5QA 2B4YA 1KDVA 5TMPA 3DUWA 3GDWA 5BUZA 2GCPA 3VYUB 4EI9A 4FB5A 2D7DA 4ZZIA 2IHZA 3QFRA 2CB9A 4E0BA 4LHXA 3H84A 5A4IS 1UC9A 3CH7A 3MHPA 1C1DB 2GHIA 4ZCLA 2GM4A 1E2DA 2UYQA 3SF8A 3CX6A 4PAWA 1QDUA 3EC1A 3IPRA 3KQSA 5ALNA 1DBWA 3AM1A 5ER9A 1NVGA 4JYCA 4XB2A 3QPDA 4DVGA 2I99A 1USWA 3GAZA 2B3TA 5FBVB 4O0MA 1Q20A 5FI0B 3HO1A 1DQPA 2GKGA 1JG1A 2CHUA 3TSAA 1DX4A 5FNZA 1D5WA 1NE7A 1SXJA 4C78A 1RAGA 3RGWS 4G0PA 4X8HA 5HIMA 2Z6UA 1BD3A 2QV0A 4JASB 4YRAA 3ENKA 3VYVA 1O2DA 1T0PA 2C3YA 5EWJB 4BFUA 1EVKA 2GBLC 3U3RA 1E62A 2N3ZA 4J0QA 5KUTA 4LWZA 1UMCA 2IV3A 5ARBA 3NKLA 1L8XA 3FOFC 3FWZA 1E99A 1SUIA 2WHEA 1V43A 4CETA 3LPMA 1PYOA 2NO1A 3GFVA 3F6PA 1SHUX 4Y7DA 1XYYA 5CR9A 2VCEA 3DW1X 1X1RA 1TO1E 4PLZA 4EUNA 3KL2A 3DZ8A 4I81A 1LK5A 2QN7A 5CB4F 5FAKA 4JQYA 4I55F 4WI1A 3TZLA 4BV9A 4KXYA 4EMSA 3PXUA 3NH9A 1K8YB 2QRHA 3SICE 3BREA 3WGKA 3G89A 1B1AA 1QHEA 1S8OA 3GBPA 4CKBB 4QJ3A 1AKMA 3LD9A 5B58C 1M2JA 4WZBA 3AUYA 1X7WA 1JA1A 2X6QA 2C59A 2BISA 3NASA 2WHYA 3QXGA 3NDJA 4ZCQA 1PK8A 1W4AA 1NM5A 3OD5A 5FWYA 5AVVA 2FH5B 2MDTA 4EVQA 3KP1A 1EZZA 4J2OA 3TNDA 4Z3OA 3LC2O 4TXMA 4KLZA 4X20A 3ZQJA 1KFKB 2C8KA 5FLEX 1CUYA 1NI4B 3CT6A 3VH1A 1CR1A 3E8MA 3I32A 1JRLA 3KFXA 4HF7A 4NBUA 1R37A 1ZY2A 4FBMA 4RSGA 4RZXA 2G17A 4EZBA 4TMKA 4EA6A 5LU8A 1VECA 2WM9B 3UK0A 3W3AD 1MG5A 3T7SA 2W6JA 3HU3A 4MR7B 4WNIA 3GLFA 1UIMA 3ED5A 5ALUA 1C3XA 2ZJAA 4MHTA 2G1PA 2NZJA 1N9ZA 4PO8A 4QD3A 5FUYA 2J6IA 3GRVA 1RAAA 5GINE 2GKSA 4JQOA 3HADA 4MW2A 5HJ2A 3VRHA 1ONPA 2IHVA 1NVUQ 4RSMA 3UXHA 2A78A 3GJSA 2PD3A 2VQ3A 3G23A 2C61A 3AVPA 3A9WA 1EMDA 1XRPA 3MMXA 3NHRA 3UMYA 2GVZC 2P6MA 5DTQA 3ROXA 2VSXA 1ULSA 2Z1NA 1IM8A 1IBCA 3O9MA 2PWPA 4OF4A 5IBCA 4BPBA 1IC6A 2HWYA 2PZ8A 3PQEA 2AI1A 5JJCA 3DMDA 3HR4A 1LH0A 4DVJA 2CEAA 4LE0A 2EZUA 2RI1A 2Q0QA 4O4JF 5TJ9A 5CFOA 2WWHA 4PTLA 3WZ2A 4TTTS 4BN5A 5CH5A 4HYQA 1OWLA 4GMXA 4O4LF 3G85A 3ROZA 1PZFA 4DCTA 2DR3A 2FUG1 1CF4A 1PFWA 2J08A 3IDSA 2E89A 3MLBA 3ZEAA 4IQ8A 1DV1A 4DYVA 4PQYA 5DBFA 4E5KA 2FWMX 1XU9A 3PDWA 2GDJA 4QQRA 3U39A 1RMYA 1XZDA 3G2PA 3WWEA 4BVFA 1ACLA 3ZJVA 1C9DB 1A9PA 3HLKA 1TA9A 1CJVC 1T4CB 4I9UA 5FI3A 1TQ2A 1GPJA 2G6BA 1UM9A 1D4ZA 3KKKA 4E32A 3M2TA 1BS2A 3FW1A 3UYKA 4EPWA 2GARA 4YAIA 2IHTA 5JH7F 3OLQA 1G7RA 1OBOA 3EFOA 2RGGA 2AN9A 3HS3A 3S40A 4Z3KA 2XVZA 5JSZB 3KZKA 2YS6A 3DPIA 4RK6A 3VH2A 5DM70 1MIOB 2F3TA 4KUHA 1KOLA 3TZBA 2VP5A 5ES4B 1I2MA 4JGIA 2JGJA 7AT1A 5KWJA 1YTUA 1CDOA 2IIBA 5AXBA 4CLHA 3ILYA 1EX7A 1KDTA 1QCZA 2HSGA 1I10A 2AYXA 2J6CA 4E4YA 4KITB 2DUNA 4LVNA 2GBGA 5AKZA 4M49A 3L04A 1E9RA 3FWNA 4G1UC 4AW9A 4WK2B 3EMKA 2VSOA 4FU0A 4MTLA 5A5FA 3T3IA 2IDJA 4P58A 4ZARA 2HDOA 1DFHA 2I80A 2HHHB 4K87A 3MIIA 2ZWVA 4Q9AA 1AO3A 2R1UA 4E94A 1AHHA 3EC2A 4GLJA 2YN4A 4NAUA 3G5LA 1PWYE 3HCOA 5ILQA 3E2MA 3WADA 2JFPA 2A5LA 4S3MA 4CM4B 4QLAA 2H2HA 1XK6A 5IFLA 4DR1B 1BW9A 1H69A 1ID8A 2P4HX 4NPCA 1O8BA 2O1SA 3BA1A 3KYCA 4JCCA 1M9NA 4QU0A 1Z2DA 1TYEB 1O57A 4XQEA 5TVKA 2Y1GA 1GFWA 4MZXA 3VDXA 3JTMA 3WOHA 4YRSA 1V0JA 3L7LA 2XODA 1AMUA 3E9QA 1L4EA 1WS6A 2V1XA 1ADGA 2ZJFA 5ANRB 5CYGA 3ZDAA 1N9GA 2QM0A 4OQ4A 3IMCA 5JC1A 5CXQA 3PR3A 4BATA 5DSTA 1AUXA 3I4LA 1V7CA 3WG9A 2VC2B 2YICA 1X2EA 2WVHA 3IE0A 2YXDA 3WK4A 2EKQA 3RWBA 1YT5A 3HU2A 3TSWA 1EP3B 2EWWA 4N8EA 4DTCA 1WNFA 2E6UX 2GI4A 3OWOA 4XJSA 3VYSB 2YQ4A 4PSCA 1M73E 1RJEA 1XTIA 4BX3A 3PC4A 3IAEA 1EPUA 2DULA 3K30A 1ESNA 2HV8A 2EZ4A 3HABA 3MXOA 5ECYA 1SRRA 5CDHA 3OQOA 3EWIA 2WR8A 3HCBA 1B00A 1JILA 4O5AA 1VSTA 2RKWA 2SHKA 2GHTA 5HCIA 1XQXA 3SYLA 4FGJA 5FTWA 4D96A 4LBWA 3CNLA 1Y5MA 2G28A 2MR6A 2FQXA 3OIFA 3RUIA 1QGDA 3MILA 3UZUA 3WISA 3DFZA 3HC7A 3LRPA 5HCNA 2V5VA 3TFWA 4JVMA 3V2UA 4NYJR 4BKRA 4Y1EA 1U3TA 1J6UA 1GPUA 3DAOA 4DUPA 1L5WA 3CUTA 4Z0PA 4WL0A 4ZQEA 1XYGA 1AUVA 1FSZA 3PLAE 5B2ZA 3RASA 3WSTA 1A9ZA 2ZG6A 3OAAA 2BCGY 3IOBA 2NZWA 5CVDA 1MA3A 2H1WA 3AW8A 4P7KA 4J6FA 5M29A 1K98A 4QICA 2CJFA 3HY6A 1OAOC 3KKOA 1H2WA 3O1JC 4BV3A 2Q5JA 1G3RA 1IAQA 1DC4A 2JJ1A 4YP6A 3IILA 5KTOA 3ECAA 3KAJA 1ADFA 4I5DA 4KDRA 1FFDA 2MOKA 3KQHA 5E6RA 3ZXUB 1X80B 5LZ7A 1OI7A 3A9SA 1XU7A 1Z0ZA 1ZD1A 1TVKA 1GNPA 3H17A 4X85A 3R9KA 4TS4A 2ONCA 3WVNA 1IHUA 4GNKA 1DLJA 4O2RA 4UZFA 1ZCBA 2PJZA 1Z4QA 3UK6A 4C05A 4EHLA 1TTTA 4KR3A 3OIUA 4H7EA 1QUEA 4WGGA 1JHRA 1N8KA 1QF7A 2JIPA 1IPEA 4D6YA 1MDBA 4YRMA 5G0TA 4MYUA 1MFPA 2Q3JA 4MAAA 3ZHUA 2FGKA 4CFZA 1TK3A 2PV7A 3ORYA 4UW9A 4MV3A 3NVMB 2C2OA 2BDEA 3DV0A 5K3AA 5LOVA 1Y6FA 3K1JA 1YI0A 4A2CA 5C37A 4GM1A 4LXUA 4NC9A 4JJKA 5JCPA 3QWBA 1N0VC 4D46A 2FUNB 3DBRA 3MMNA 4G5RA 5ALHA 1KR5A 2ZT5A 2Q3CA 3KB2A 3N2ZB 4RW0A 1B3BA 4ZCPA 3TQTA 2O3TA 3EA0A 1Y8AA 2YIDA 2PLRA 3HDQA 4X54A 4ZVVA 1TFRA 4G5GA 3LK6A 3R6DA 1LBHA 5CVTA 3LP8A 2AFIA 3VR1A 2AQ8A 2VDOB 1B7GO 3BKWA 4KQ1A 1QPBA 2QG4A 2H48A 3QXJA 5CLQA 2HZ7A 5CB8A 1C0PA 3PHGA 4RMGA 4XKJA 3SQWA 1TEXA 3B3JA 1L7OA 2HO4A 4AJOA 4JOSA 2P1ZA 2GZHA 4NONA 2UUAB 4KO8A 3W78A 3NHMA 3NKVA 2MT9A 2VF2A 2J4CA 4BLTA 2YXNA 3BEOA 4MI9A 1TADA 4NYJQ 4I4TF 4KMOA 1TKRA 3OH8A 1YZFA 4UEWA 3U80A 2IZZA 1ZG3A 3DGEC 2B2XA 3K09C 3V46A 1Z45A 2GZDA 4QUJA 4D9IA 1XV5A 1W0JD 3DDNA 5CHYA 1JU3A 3A2NA 4YCJA 4CMKA 3URKA 4JK3A 4LYYA 1QONA 3D0RA 5JRDS 3BG5A 2Z95A 1YE3A 1RZRD 1N9KA 3C3PA 3KJXA 2ZUTA 3RVSA 3PEFA 5P8WA 4LA4A 4U2KA 1N4AA 1MENA 1QHIA 1WCWA 3AOEA 2QTLA 3ORSA 5KQRA 1M2NA 3RTEA 5C46F 1PV1A 5JRJA 2HQOA 1IY9A 3FCXA 3AFMA 3MLEA 3OZSA 2J3KA 4XVHA 1BYIA 2BWJA 1DO0A 3OZCA 4Y0NA 3WWYA 3BF8A 2CNWA 3IQXA 4C7BA 5A06A 2G08A 1FYFA 2XH8A 3I4CA 2E21A 2ZJYA 4JCOA 1S3GA 1TDJA 1P74A 1UXJA 2NO7A 1ODCA 4YYZA 1HX7A 2IH5A 1VPTA 3M1AA 3V1LA 3WSWA 3OBBA 2A9OA 4QL3A 1IIRA 4KVZA 1U2TA 5BRJA 1UOEA 3ITEA 1UT6A 2O3QA 2ICAA 3EZ9A 3L93A 5LD2C 2FMTA 1BNCA 1M34A 3ROFA 2XB4A 3B48A 2DUMA 4WECA 4WCDA 2IU3A 3E8SA 2PKQO 4UTVA 1PZGA 2DGDA 1U9IA 2W2OA 1BA3A 3NCHA 4IHJA 2ZVDA 4B6PA 1E2QA 3BULA 4RTMA 2O20A 5IAAA 1J70A 1H6AA 4LKRA 2VUTA 1JJIA 1SBHA 2O2HA 5C4GB 3LUCA 5DNYB 2O2GA 3A4IA 2K2QB 3ZVRA 3K70B 3JW8A 3GRFA 5A4AA 3FUWA 4GUDA 1RYDA 1USVA 2GSDA 3UN1A 4A91A 4QEDA 2WF7A 2RJ3A 2EYUA 3UJNA 4QAJA 2DM6A 3C8HA 3FPBA 2AZTA 3DMHA 3JYHA 5CXUA 1Z37A 4B0PA 4KTTE 2GFHA 1XVLA 5CYPA 1U7HA 3A32A 1XTTA 1G9XA 3N2NA 3EVEA 3EGXA 2NYUA 2DY0A 2UKDA 3DDCA 3FMPB 1J09A 3OCUA 1C8VB 3USZA 1PJ4A 2OZLA 1SOVA 2Q4RA 3PQCA 3VPAA 3VZCA 4E21A 2ZYGA 3K35A 3QBEA 2AR7A 3R8FA 3I5AA 1EDEA 5EVCA 5I47A 1HLFA 1I1NA 4IDFA 5FLYA 3TG8A 1IHPA 1NUUA 4HFJA 4MQLA 1HT1E 1LGYA 1P1FA 4L8WB 1CQWA 4OLBA 2DBZA 3U7QA 4I3FA 4QUHA 4D9HA 1YR7A 4LFAB 5AUPB 3FPEA 2C0QA 2ZYAA 3FFBA 4IDHA 4QREA 1R4NB 2I29A 2HN9A 1Y6QA 1HE8B 3AP3A 3W3ZB 1VHJA 1UDRA 4AZSA 5LN1A 1XOIA 2PO5A 4M8SA 3P2OA 4ZQHA 5FULA 2C0PA 3JZMA 4WUTA 1GSAA 3I9OA 4DNPA 1N6NA 1XLTA 2R68A 3AH8A 2F1IA 4FCVA 4FW9A 4MQ5A 3PHCA 4N5LA 2BGNA 5EMLA 1Y1RA 3WLOA 5T3UA 1J9EA 1XEXB 4OHOA 5DNAA 4AULA 4D9KA 3PCRB 5HS4A 2WU3A 4LKOA 4RAOA 4BKPA 1JFSA 1W94A 2RGWA 1NJ5A 4GBED 2V4MA 4TUYB 1DDOA 1USUA 2GKOA 1SA0A 2G25A 3FPLA 1CG6A 3G0OA 4GRAA 1PEDA 1JVNA 1JLKA 2I22A 2GN9A 3NAMA 5BT8A 1ICEA 3FLEA 2HLHA 1KVSA 3TNLA 1P7PA 3ZE2B 2XV1A 1CEYA 1CNFA 2V7PA 4LJ4A 1CE8B 2GXQA 3FSRA 2CYAA 2BGIA 3A10A 3NP7A 2AOUB 3VTFA 3W7VA 1DEAA 4RTSA 2P9EA 5CNMA 4YV7A 1C7IA 3BJIC 3VDNB 1U2EA 2H7CA 1W30A 2YW2A 3E7FA 4BXOA 4MVXA 4OK3A 4E51A 3JQBA 1SCDA 2Q1TA 3LCCA 2JBAA 3RWMB 4CG2A 1T15A 3LYHA 1N7GA 3ZIUA 3G8AA 3EE6A 5K8CA 3PT9A 4HLUC 5LZ8A 5BWOA 1NN0A 5DI3A 1GWNA 3NYQA 2A0XA 3N0WA 4G2TA 4X84A 3PDIA 3U7IA 4N4AA 2ISSD 4RY0A 2Q6OA 2O5EA 1JHMA 1DXYA 1Q19A 3GAAA 1SHKA 3KOUA 1N0IA 1RJGA 3O1HB 2Z58A 4GZLA 4B8YA 1ZYUA 1VM6A 2CGEA 1JVBA 2OUKA 4OOFA 2PGJA 4JYBA 1ZCAA 1Z25A 1JXMA 2IE0A 3EVAA 5G4KA 5EWLA 3KQMA 4CLXA 4DSAA 4YRKA 1UBEA 2BI8A 4XTCS 1PL0A 2DQ4A 2G4CA 2I1VB 3KB1A 5FA6A 5A0FA 4E09A 5IANA 1PR0A 4KE7A 5T41A 5FP0A 2W2QA 4FHFA 4A7PA 2J5XA 1F8YA 1SQFA 1UBFA 2IU4A 4A82A 1E9CA 1ZVJA 4HEA1 5IJ0B 3NHJA 5KJFA 1NGSA 2YHBA 3PA6A 3NDIA 4JLOA 3QU7A 4PN7A 2PCLA 2QXYA 3NETA 4O33A 2JZOA 2M6KA 5KIAA 3JD0A 3VJMA 1YU6A 3N5CA 4AICA 1VLVA 4J16A 1N77A 5A3SA 1RI3A 5JWHA 3WJ2A 4ER7A 3CW2A 4OXQA 3V6LA 5KOJB 3LG2A 1ZXBA 3N7TA 3BMCB 3OFNA 5IS2A 1X9GA 4KBFA 2ZUFA 1QP4A 5KOYA 4L73A 2D2VA 3UICA 1PQYA 3D5EA 3VR6A 5D5QA 1RBQA 2BEUA 3PC8C 5CX4A 4ZVQA 3UW3A 1Z5VA 5JYEA 1ECPA 4KFTA 1JMKC 4RDXA 5KYNA 1BO6A 1J2EA 1QOQB 3NONA 1YE8A 4DAEA 5AHKA 2RJNA 4H59A 4K9LA 3AHJA 3HR8A 4DGSA 1HQCA 3QEBZ 5LQKA 2RC6A 3BMNB 4UEKA 1QQAA 2I6GA 1WHSB 3IKJA 3GJ3A 1JR2A 1E2UA 2EP8A 3L8YA 2C2WA 3FNHA 4JU8A 2G06A 3U49A 5JYBA 1XNHA 1I51A 2D0PB 3M4JA 3LGXA 5KSPA 2OT3B 1CDDA 5K0GA 1GAXA 2H51A 1TYBE 2QTWB 4ZQIA 5G0SA 2OSBA 5K3CA 1D2EA 1ZNWA 4IRUB 4B6EA 4X65B 1HH4A 1DIHA 2FZVA 3A1SA 4A27A 1V1JA 2P2LA 2BE7A 2YXEA 3P1JA 3DE6X 4KV7A 5EXTA 3UXMA 1R66A 4B3HA 1KL7A 4NDAA 5TQ0A 1IHYA 4C20A 5C35A 2VTBA 2YTZA 4QNRA 3AVOA 2BC9A 3CR3C 4RD1A 4RJ2A 2D5AA 1FVHA 3UTDA 2F4VB 3T1OA 2WWGA 5DP2A 4Z4FA 2OCBA 3RBXA 2PKYX 3Q41A 4RZHA 3ZQKA 5KNCH 1Z13A 5BNZA 4LXYA 3T3OA 2PBFA 3JQRA 3ZN2A 3LXXA 2D6FA 3ZLTA 3KLPX 2O7VA 2RGRA 3AYXB 3BQ9A 1Q6YA 2K5UA 2F3SA 1A1SA 4E1BA 2O8CB 2BGKA 2LDXA 3SI7A 3DP7A 4EJSB 3DNPA 2QRVB 4RKEA 4ZT4A 3VKWA 3EIUA 1TF7A 3GPCA 1QP8A 1N6OA 2ZETA 1HDCA 3MWYW 4Q1BA 4H6PA 4Q9JA 4Q9KA 2EFEB 3IA2A 4JVSB 2HSWA 3IOEA 5HKOA 2MSNA 3V1MA 3ORQA 4IIBA 1T8SA 2NO4A 2R6GA 1H0HA 5REQA 2PZGA 3SM9A 3TPFA 3UT5B 4PG5A 4EZIA 3U7FB 5IAJA 4MV9A 3SHOA 3BUSA 2C2BA 1IN6A 2D0DA 1ZN8A 5IT5A 1E9BA 1E7WA 1MC4A 1YRWA 4GX0A 4ZK2A 2HF2A 2BGMA 1L8OA 2VPPA 4MVYA 4WINA 4F45A 5TLSA 4AWAA 4N3NA 3MCTA 4GPZA 1PSWA 1IN7A 1ZGJA 2JEZA 2XNCA 2AJDA 3OLXA 4X66B 4ZRNA 4OV6B 3GP5A 1QB7A 4YBRA 1RE1A 3B6KA 1SU6A 1KY4A 4AX8A 4F6LA 4AJKA 4ZJZA 2OO7A 4NBTA 2PXCA 2XVXA 4GL2A 1RVV1 3Q40A 1I2DA 1RQLA 1UQRA 2QZ9A 5EWJA 3BK1A 3A1FA 3AF4A 1QFSA 1TAUA 5E9JA 5BOVA 1DC5A 1OTYA 1VBMA 3FKSA 2J5QA 3O3MB 1O6CA 1W581 3IXMA 2D1SA 1DJNA 4OQYA 3FWPA 1WPGA 4HK4A 5DCYA 1K66A 2BLLA 2TS1A 3S68A 1W1UA 3NRCA 4U2GA 2XWJI 1H8ED 4BTVA 2CWWA 2GWRA 4B35A 1UAYA 1ZDMA 2VI5A 4J7UA 4EW2A 4CFYA 5SYAA 1OKKD 1AGYA 2PFKA 1X38A 4FHEA 2GNOA 5B1SA 1OOEA 5FI5A 4G5HA 4CKBA 4CTMA 4BC1A 3VSAA 4O4IB 2DFTA 4K6MA 4PXYA 4FUTA 2ZB3A 3WKCA 3IAFA 4I14A 4JJAA 1XRMA 3JU3A 2GTPA 3BIWA 4U2CA 5F2NA 2P77A 1S2DA 2FA9A 1M1NB 1PFGA 3LPDA 4JY7A 4UMEA 2V74B 3NNSA 1ECGA 1N8SA 1X7XB 2BKXA 3FYDA 1LW7A 2WC1A 2HUNA 1XJWA 3HJHA 5CJPA 3HWWA 1WKCA 3UMJA 2VOJA 5EJ2A 1FFXB 3JATB 3R23A 3LCJA 4TTRA 3AM3A 1KTIA 4UQPA 5CCBA 1K7XB 2P7IA 4P35A 1MJ5A 5CH8A 1ODKA 4MR7A 1NJSA 4BRZA 3FI0A 2OE2A 2ZDHA 1EFDN 1DE0A 3G8BA 3ADKA 3M3HA 3QU5A 4OGFA 1EXWA 2D00A 4NY1A 4QRDA 5IAEA 3DCJA 3WIEA 1Z38A 2DTEA 3JRXA 1DUIA 1OSNA 2WSLA 2LVBA 5EWMB 1RQRA 4D3SA 3DVAB 1F2UA 2H1VA 1T9AA 4REOA 3ZBUA 4B81A 3N86A 1JDJA 4DJTA 3DBHB 3D4PA 3EZFA 3T4XA 5KJCA 4J0CA 3CC8A 3NLLA 3JZDA 1YULA 3R3WA 5I5GA 1K7FB 1YBMA 1V35A 3ESAA 4YRQA 1DIGA 5IYZF 3RIEA 1KYTA 1UXGA 3GRPA 5AVZA 4M8KA 2WU0A 4M1KA 4XSVA 3SLRA 1KERA 1KSFX 4WW0A 4BNXA 4OHZA 1T3TA 1FU7A 4CLDA 1THMA 1DWOA 3WIUA 1OVGA 3R5SA 1ADYA 1ZUNA 2QVCA 2ZTHA 4U7PB 4Z4GA 3NGXA 3QPBA 3QE3A 1ZIXA 3QEAZ 2IYZA 4Z4CA 2B3DA 1XSEA 3N2YA 4L08A 5JS8A 1YRQA 5K0BA 1LDYA 2OCDA 1W48A 3IP5A 2W8BB 1LFAA 1ABEA 2WBLC 3K9HA 4NZ9A 1P17A 1SGWA 4CBVA 4X94A 4I8DA 2Z43A 2ONKA 2IF2A 4EL5A 3M1LA 2PL9A 4R5HA 4FIZA 3AESB 1T4CA 4FK8A 1J00A 2VP0A 2QAJA 2KI5A 3UW1A 2GD1O 5T5QA 2NYAA 5DGCA 3Q3CA 3NWJA 4D2IA 5ALTA 4C4OA 5T4HA 3GBVA 1FE8A 4AZWA 4QUDA 4HI0E 1QV6A 1N5IA 3VR0A 3UCEA 1H9BA 4EKGA 1N5JA 2VF8A 1T3LA 1XCOA 2OGTA 5KHAA 4L4UA 1S96A 4QYWA 4R68A 4EDHA 2QBYB 1ZGBA 2NTVA 4O29A 2UYOA 1DQNA 5CIQA 3OPNA 2MYUA 5A71A 1S4QA 1DRUA 4ZV7A 1MFZA 1H3FA 3X43A 4YECA 1ORVA 3ELWA 4WJZA 1V4NA 2FG6C 1D6SA 5LWQA 3O47A 5BOSA 1ILWA 4R9UC 1R27A 2YHIA 4DQDA 4A0GA 1PJ8A 1NNLA 1T2FA 1HY3A 1VSBA 2CNOA 5JCOA 3O4RA 4K2AA 3I9KA 4PFSA 3W04A 5I7VA 4FC6A 2HA5A 3MJHA 4GBMA 5LP6B 2X9LA 4MUIA 2QX4A 3W4KA 4F5DA 4N0MA 2D7JA 2I3AA 4NECA 1S02A 1VI2A 2CLIB 2CYCA 2ODNA 5F2OA 4CM4A 2ADMA 5EERA 1WY5A 1JIQA 5T57A 5HWSA 3SFTA 3OZGA 3K0FB 3KLBA 1RQ2A 2NSJA 3W1VA 3HLYA 3I9FA 1GUAA 1NRXA 1ZIYA 1E98A 2PSEA 2AJBA 1FTQA 2F3PA 1JDVA 3FRHA 4HQOA 4PQGA 5ALXA 2EG5A 3SZRA 5J4VA 1T0BA 3EZXA 3C43A 3SIWA 2G1JA 3OF3A 1H9CA 4G0ZA 3IKTA 1DAIA 4X1YA 1VBKA 3MOIA 3U7EB 3PC2A 4LZPA 1P1JA 1JAIA 2WWXA 4D9MA 3JAKB 4RSHA 3S2UA 4EEXA 5EJ8A 1ZLYA 3TVDA 3GB9A 1JG3A 1V7ZA 3EGWA 4LX0A 4WAUA 4IGEA 5FTKA 4EUSA 2NQ8A 3CCCA 2ZIWB 2O2CA 1TJYA 3ZE8A 1N6RA 5E3IA 4B87A 1XMJA 2C9CA 2QE7A 4FHZA 5G4LA 1NXVA 3DC2A 2PCJA 3LPCA 1SCUA 2AJCA 3T9FA 3ZVLA 3E7DA 3TZQA 4JBNA 2VJCA 1WMFA 2OAGA 2ZSBA 3KQOA 3LW8A 4IVQA 5DNVA 5FPHA 1C8LA 3KIPA 2MIIA 3K9GA 4MUJA 3TTVA 1FLNA 3G0IA 2JDID 3S1AA 2FPIB 2XMBA 3KV3O 2B1QA 4ND6A 4IRXA 5F3WB 5KB3A 1IB6A 5HTKA 3HXQA 4CWAA 2TMKA 5BNFA 2JLAA 3D9QX 5FL3A 1Y1KE 4LC1A 3J7TA 4OHXA 1V11A 4F86A 3S81A 2C54A 4CMIB 3WI7A 4F97A 3L7YA 4LNHA 4EG4A 2AMJA 1BE8A 2X2FA 3MYYA 3BSFA 3D43A 3Q2IA 2X8LA 1EUQA 4TZ6A 1AUOA 1QWOA 1SQ5A 4URYR 4FEYA 1OREA 3SZ3A 3MJCA 2RJOA 5TJHA 4F2WA 2Y0BA 1GSOA 5B1HA 1M2EA 4EF5A 3GR6A 3E7PA 4ECAA 1AHNA 4JFAA 4X44A 3NBUA 2XUDA 4D9EA 5BNIA 1SXJE 3EXAA 1JT2A 5DLYA 1WBJB 1U6JA 4HVTA 1HFWA 1VLLA 2DWPA 3N9IA 3N2KB 4YP7A 2P9HA 3LHSA 2QUKA 3TB6A 3VO2A 1X80A 3H8JA 1QPGA 1I7SB 3F4BA 5CBPA 3OU7A 2GN4A 1VYHA 1AB5A 3W06A 2XEDA 4X00A 3ZHCA 3ZJUA 2JLWA 3NEPX 3WP0A 2PS1A 3K15A 3RC3A 1YDWA 3L7AA 3L7BA 2YCBA 1WABA 1UXOA 1WNTA 5KZMB 4DR7B 2HREA 4Y6LA 1JKFA 4H6VA 3HDGA 3HE3A 4KN8A 1JR3A 3EG9B 4IXMA 1BX0A 1U7TA 3R7SA 2JLRA 5LQAA 2O7NA 3E9DA 4WT7A 5IPFA 2IHYA 2IXDA 2YUIA 3RK0A 3T1HB 1YQUA 3F4KA 4PBSA 2QT9A 2FI1A 2Q6LA 1EI9A 4TV8A 1JPJA 2APJA 5KTSA 4NEQA 3G1UA 3BGWA 3UUFA 1VC2A 1A98A 3B6IA 3MJDA 3X0DA 3U9LA 3OP4A 1XF1A 3EC7A 3QWHA 4JJFA 4WZBE 4V2UA 3RS7A 5H16A 5AKGA 2NP6A 3PS9A 5CK4A 3VZSA 2O9JA 3VPSA 3AIKA 3D4LA 4E15A 2WJHA 3SU8A 1N6KA 2ZZMA 4C0WA 2RH5A 4MUXA 5CLJA 3D3WA 4I1YA 5D8DA 3W6PA 1K3UB 1WP9A 4ARZB 2AOTB 4URXR 3GPLA 5ARDA 2X2OA 3IVCA 2GHQA 3J81k 3UOAB 4HXEB 2QW8A 2E3JA 2O14A 2RGUA 2I2AA 2KQUA 2YX1A 3W2TA 5L51A 1FPQA 4OREX 5A04A 1PFQA 4BE7B 3GLFE 2GERA 3TKLA 5TGZA 4WRRA 4QLBA 2O07A 1T4MA 4P22A 2SKDA 1Q1EA 1CP2A 2LIPA 2P5TB 3T7RA 5LZ9A 4MQ6A 2FVYA 3A4YA 1KEWA 3IP6A 4XM2A 2OB2A 3ICOA 5JTUA 5J2TA 1E2HA 4Y6SA 3OHSX 4GE3A 2GPYA 2O0KA 4HDRB 1QIJA 2D4HA 4IZIA 4OMCA 4ROTA 4IDEA 3VBCA 3MW8A 2IXTA 2CV0A 2YZKA 4RKYA 4MPTA 4BLSA 1QDLB 3L8ZA 1SKBA 2ZWOA 3FZGA 4XM0A 1G20B 2C3PA 2UZ4A 5CG1A 3IQZA 3OE5A 3GLGB 2DPXA 3L6BA 1ZJ6A 4FSHA 5A4FS 5DLEA 1TUIA 4BU0A 5LLDA 4EKEA 1B1CA 3CRVA 3TR0A 2V7QA 4NE2A 1XO1A 3QKIA 1GR0A 1VGRA 2JFBA 4H1HA 3WHLA 1X70A 1CEEA 1LKZA 2JCVA 2QI9C 1JHZA 3NT2A 2BIFA 4EFDA 3W5CA 1PT7A 1NLYA 1QMPA 1XZEA 1AKTA 4DLUA 2IBSA 3KC2A 4ZCSA 3MAJA 3CF4G 3EQZA 2R8PA 4NV3A 2B8NA 2ID8A 3R41A 3WKAA 1I9GA 4BP9A 1B6TA 2CD9A 3RADC 3FFTA 4DR3B 2D2XA 2M1ZA 3OURA 1KDYA 4C7VA 4IDPA 1PK9A 2BZ0A 3WZLA 4EG0A 5FCDA 4YJ3B 4F8EA 4FUQA 1SU7A 2QPTA 3JR3A 1ODTC 4FDMA 4FFOA 2NV6A 4PSUA 2PUBA 2HMVA 2F64A 4M53A 4C3UA 1IXYA 1H93A 3SLGA 3WAKA 1AQLA 4BNZA 1L4FA 1EVEA 5JALA 1HBJA 4KNWA 4LPSA 1I5EA 1L4BA 1V95A 2W6NA 5FA5A 3VO9A 2WJ6A 1JJFA 1SJ9A 4H3SA 3CZAA 5CXSA 3IHTA 4YXFA 4X8OA 3STWA 1N33B 4FFVA 4GW3A 2HSZA 3DFIA 4OLHA 2Z83A 2IPXA 1KZ1A 3F46A 2A35A 4J7AA 2PT6A 4XFJA 3WLFA 1S3IA 5PNTA 2BJHA 1A2BA 3ZCPA 4DWWA 5C32A 1XYVA 2LGJA 4ZAZA 3L0PA 1G18A 1AQYA 1QQBA 2IS1A 4R31A 1HXHA 2RHRA 3CMCO 3NBXX 4UEJA 3UENA 4LY3A 221PA 3KUUA 3PD0A 2HM7A 3EGOA 5TQ2A 4AMYA 1R4NA 3PLNA 4FBLA 4YV1A 2O05A 2XE7A 2IY9A 1FVXA 1GN9A 3CLTD 4B7UA 1AKQA 3PXEA 3HDVA 4PFKA 3IQEA 4W63A 4C6RA 5AW4A 1GNLA 2Q45A 2CVZA 3FVWA 4GS5A 5A0TA 5FF9A 3TYXA 3P26A 1G8GA 1B73A 1U7WA 1XEXA 2A9JA 1UBRS 1WVIA 1QMGA 4NCKA 3HCWA 1CERA 4GO1A 2I6QA 1P7ZA 5KPJA 4FEEA 5IT9A 3LQ2A 3E9RA 3DQQA 2GF9A 1OUMA 4R9RA 4BEWA 4BFYA 4R3UC 1DBQA 4MCIA 1J25A 1GQRA 2CMGA 4D3XA 5SYMA 1P7WA 3RANA 3QI7A 1L4YA 3GCXA 3ZHZA 2AQIA 4M1ZA 2C97A 1YRHA 1IK4A 1XVIA 3AKEA 1CE8A 1WMSA 3ORFA 2ZRQA 2AOUA 4N54A 4YP5A 1FZTA 2OILA 4QIHA 1PGNA 3LO5A 1V5EA 2BFBA 3VVBA 3SXUB 4KPYA 4P82A 1P62B 2F43B 2PVSA 3A1EA 3PC7A 3D4IA 3Q3EA 4FHGA 5KX5A 4PYRA 4CVNA 1A9RA 1M72A 2R7AA 3I8XA 3SHFA 5HPYB 2C2XA 3KJGA 5BWMA 1ZMRA 3K6KA 1DOZA 2OYRA 5KDDA 4W7SA 2B35A 3HBAA 3KOZA 1K5DA 5GM1A 5L9AA 2BJVA 4KWIA 1P1HA 1PL6A 3KKNA 1FBTA 1E1QA 1RVDA 5HF5A 2RONA 3NC0C 5AXAA 2JLYA 1WETA 5HKKA 3WYEA 1XJCA 1MJNA 2PVCA 2YMLA 5A4JA 4M7OA 4QDZA 4TSFD 3S8YA 1PS0A 1LD3A 4ZO9A 4WFQA 1YZ3A 3F3KA 3TW4A 4TOIA 3AI7A 1XWIA 2FEMA 3DZDA 2CNBA 2VL7A 3IT3A 3LKDA 1U2DA 1G8YA 2PL3A 2Q0SA 4OU4A 3DMTC 5CLFA 3RUEA 3FIJA 4RD3A 2ENWA 5EP1A 1ZKDA 4REMA 2IWRA 3TDNA 2YHUA 1EGAA 2W2LA 3O0DA 4M9QA 1NLUA 3MXTA 2VEDA 2WZBA 2C03A 4FYPA 4CF7A 5L6MB 1SWWA 3L0YA 4Z9BA 4UTNA 1XPUA 3IAAA 4HQLA 2Q2NA 4BDSA 4FGSA 5IK2A 1RWPA 2H1HA 2BGWA 3PL5A 5JMWA 3KE9A 3MTIA 1NBIA 3HCCA 1HF3A 1Q83A 3GJ5A 5KOJA 2LP4Y 3QPAA 3BMCA 4FC7A 4TXJA 4B17A 1IG3A 5I7EA 1MBZA 3FFAA 5GV8A 2C83A 1RABA 1H1TA 1W0CA 1GTG1 3D5QA 3EEQA 5T64A 4TYYA 1ZO8A 3LI2A 4ZI3A 4YDHB 2WABA 1A97A 4R0NA 3GFFA 4TKMA 4FDUA 3UB4A 1KYXA 4BIMA 2DP4E 3WLNA 3N2GA 1A2KC 3KHUA 2QTMA 1LK0A 1CZNA 3PUZA 1SXQA 3QYFA 3CTPA 5FHQA 5L3QA 3BMNA 1JHQA 1WHSA 4GWLA 4KFUA 1N2BA 3ZHOA 3L4BA 2A3NA 2CLDX 3HBJA 1P9OA 5FTLA 5K99A 2AFIE 5JS2A 1RXUA 4HLQB 2SBTA 1QZUA 3I2IA 3M49A 4DBLE 4I9GA 2P4UA 5C8DA 1ENYA 4XM1A 5DGTA 1PU2A 2GXSA 2X22A 3D8TA 3ADBA 2C9OA 3IAS6 2JIBA 3FY4A 5E2IA 4U7JA 1UADA 4TM8A 5B1EA 1QPZA 3L1UA 4BQSA 2Q4EA 3PB3A 4YJ2B 5L4NA 2H2IA 3BIOA 4OVKA 1CUHA 1FS4A 1NW4A 3EEYA 1AXGA 3FKJA 4II2A 3A7EA 4OXNA 4YFYA 1E9AA 1SOUA 1UPUA 3Q3GE 4G0MA 3VGPA 2HNBA 1AHIA 1KJZA 2ZSFA 3A4TA 3WLIA 1C4OA 1E63A 4JC0A 1TK2A 5IMBA 3COZA 3LKVA 3ZDXB 2JLBA 2RB4A 1D0IA 3BWEA 5KSZA 2G7ZA 2CFTA 2IYUA 3WLPA 3ZI4A 3R3JA 4M1YA 4K8RB 4KN5A 2XGOA 3SDBA 5KO2A 4OQMA 4YCSA 3I52A 3H1PA 2E9SA 4XQ9A 4X60A 5IDXA 3V3TA 1FJGB 4L1KA 2Z30A 4AG5A 1EFRA 4OP3A 1YCFA 3RHFA 1C0KA 1ZH2A 1NVKA 2ZI3A 1HOXA 3FR8A 3H1FA 4G0OA 5IKXA 1A71A 3P2KA 3ZDEA 4FNAA 2WUWE 1SUEA 3HZHA 3ZV7A 2V55B 3HM2A 3IDQA 3KD3A 4QGFA 4F6CA 1FUEA 2ZE6A 1Y81A 2B1JA 4H17A 5J47A 3I5XA 1LQ2A 1XDSA 2DU8A 1A4UA 3AR8A 3PGA1 3SKYA 5ADVA 1NJFA 1Y1SA 5JT1A 1YOVB 3WWDA 1BXKA 1X7YB 1NWHA 2H4YA 3RGGA 4QBKA 1M34E 1NW7A 3WIOA 3BRQA 3LP5A 3QXHA 1RQNA 1Z68A 2Q6VA 3CVVA 3HN6A 1W19A 3JCZA 1O96B 4JLVA 2ZXFA 2XCOA 3U4GA 3CNOA 3F7OA 3GUHA 5TXGA 4ZGBA 1R0RE 1EVYA 1S1CA 3DE1X 3STXA 3AR9A 1U31A 3FOCA 1Z6YA 1UMDB 4OQDA 3C3WA 1J06A 3FYCA 1T0HB 3RHZA 1RLJA 2G7MC 1V26A 2EERA 3ILSA 3KJZA 4CTJA 1N5LA 5LDHA 3T5PA 4RK1A 1TECE 2NOAA 1NSTA 2WF8A 3LH5A 1B6SA 4A16A 4GIBA 1W5EA 1H9AA 1PYDA 2WB2A 1DQSA 1MO5A 1PFYA 4C3ZA 4YLYA 3QVTA 1CUVA 3C3MA 3I5UA 2YY6A 3KBOA 1I6MA 2O7RA 3L3BA 4JSYA 1TPYA 3LSYA 3T5AA 2YVAA 3D6HA 5A3JA 1EXVA 1IHOA 3CCFA 3M6UA 4JWTA 1T4GA 3PWKA 3AC0A 4PC2A 4X7PA 3VU3A 2GRAA 5DH9A 3PBKA 4RQAA 5A3VA 2R44A 3B85A 4N18A 5ALWA 3UKOA 3ZDBA 4QGGA 1JEDA 1QCDA 3MNFA 3VU1A 5JXGA 4O4IA 1MC1A 2R4UA 1NVVR 2ECKA 4EO9A 1WBBA 1DKRA 3H2ZA 3E70C 4RQTA 3VJKA 1A0OA 1DZIA 4J0FA 3AIMA 2NO0A 4C4TA 4YRGA 5CT6A 1M1NA 2MHCA 3NDRA 4GEGA 1X7XA 2GN2A 3O7MA 4FMDF 3ESQA 2LD4A 4AK9A 2JFWA 3RS4A 4P4GA 3L4EA 4LBYA 4X8MA 2CLMB 3H8VA 1FFXA 3JATA 1TTHA 3UMVA 1HDGO 2IC5A 2N1MA 3BA6A 4WUVA 2GZ2A 1K6MA 1E6EA 4HB2A 1FNSA 2PT9A 1ICIA 2CE2X 2GA8A 4KO2S 1J20A 3LHKA 3NAGA 3IR5A 1NIPA 1UOOA 4RF4A 3TSZA 4IUYA 3GAMA 1E2KA 3LLCA 5EEGA 4YJKA 1PR9A 1LY1A 1S8NA 3D7SA 1R4MB 1YH3A 4CL2A 2OV4A 3ET5A 5EWMA 3N58A 3DVAA 4ZAVA 2OXTA 1L3CA 1P6XA 3RU7A 2V9ZA 3DBHA 2OQRA 3SXJA 4BVEA 3IB6A 3AHDA 5J4YA 3CRZA 4TT8A 5AH0A 3ZXSA 1E3MA 3B9BA 1SFRA 4DYHA 1OBFO 3QEKA 4J4HA 4Q01A 4PYJA 4N0EA 1HR0B 1J2TA 3PF8A 2ZW9A 3OMLA 2IWHA 1Z63A 1TZ2A 4GWKA 1TQHA 2QYSA 5ERXA 3GMDA 1NUPA 1O0BA 4OQFA 2LW7A 1WMBA 5AM5A 5L95A 3U44B 1MD9A 2R96A 2BD0A 1GTVA 2AEEA 3LUHA 1JUDA 3CN7A 3NKFA 1P7YA 3N6VA 2W8BA 5DV9A 1FS5A 2C9BA 1R0ZA 1B6GA 4CL0A 4ARIA 2FSVA 2A88A 2YWRA 2QU8A 3AYZB 1XL1A 2BUCA 3HEBA 3IE2A 5IXYA 1GCUA 1TC2A 2D54A 1BU5A 3AESA 1GRCA 2B61A 2FHPA 4WLFA 5BV7A 4RCVA 1LNZA 1PO7A 1PDOA 1WULS 2JLQA 3V32A 2A5YB 4RH1A 2UYHA 3HB9A 2WJZB 4JS0A 3L0SA 5KPDA 2O06A 3PYLA 2EKLA 1OLXA 3BPSA 3HZZA 4B6FA 3H9EO 3VNAA 2YASA 4F4HA 3I01A 4MWEA 2WQZA 1RZVA 1JT9A 1V41E 2CW5A 1T1JA 2VWQA 2WPDD 2DG2A 3KO8A 5EFZA 1FX0A 2XMSA 4J1SA 2NNWB 1UAGA 3KFVA 1PTJC 2IY8A 1D0SA 1MVOA 4MIKA 2NZUG 3S0JA 2CV1A 1U0TA 4IIJA 5HF8A 1ZITA 4CNQA 2B92A 4KGZA 5F7XA 1L1RA 2H5EA 3DTTA 1SOAA 1YS2X 2NXJA 4PRKA 4RBNA 1L1QA 3QHPA 3IULA 4GR4A 5AT1A 2R25B 3ZHRA 3LUPA 1U7DA 2REOA 1PNVA 5AR1A 4TKLA 2G67A 2JD0A 4GPTA 1A96A 5GGXA 2IFTA 3GDHA 3KUXA 2FF7A 4KQIA 1ZU4A 1MZVA 1KK2A 2JIRA 2JAWA 4EHIA 5LP6A 4RWEA 1UAAA 3QUQA 3RHSA 3HKCB 4ZYUA 3C1AA 3CKKA 3L7NA 4M0KA 4HVLA 2BGTA 3OEHD 3RJ5A 4JMPA 2R6DA 3D6UA 3PJGA 2HK9A 1L6IA 3EVGA 3IT0A 1P4HA 3H9JA 3HB0A 2BF4A 1DP4A 2WOOA 3K0FA 3KZ1E 2VPZA 2FRDA 4FYVA 1J0XO 1FNDA 5JISA 1TJ3A 2J9XB 1LVGA 2DBRA 2H17A 3HPQA 1UT8A 3IP7A 2Q2VA 3AKZA 4IFEA 3IODA 5FPKA 5DGDA 1ELOA 4JT9A 2AT1A 4DMUB 5JW6A 3I5YA 1BMDA 4ZAFA 5DOVA 1JQ5A 2BYTA 4R6WA 1JKIA 1EQUA 3BD9A 1WUKS 2FNAA 3K8OE 3RSQA 2CKDA 2JCSA 4F5ZA 3PNVA 2A1TS 4OXIA 3R7DA 3O03A 1U02A 3GQBB 3W8RA 3OOHA 4BRUA 1ZVMA 2QMUA 4MWDA 1BJTA 3ZH2A 5A2GA 4YI3A 4YMLA 4FX5A 1QANA 4G07A 2EZ8A 4N0DA 2CNNA 2IGTA 3LVRE 3HBLA 1UZNA 3PFIA 4HH1A 4URUR 1KYQA 5KVAA 5LMNB 5JJ5A 5E6SB 3VR4A 2I8LA 1FCJA 2VKTA 3OCZA 3ONDA 4JBGA 5B7NA 1BU8A 1TC1A 2YOGA 3P2MA 2VKQA 1D3AA 4AJPA 3TH5A 1UEJA 2JLVA 5TVGA 4XUGB 4Y2VA 2IPNA 3K0HA 5CX1A 1II8A 1LBQA 4G41A 2ZYDA 3ACBA 4QQKA 4UUQA 2OQVA 3L1JA 4XH9B 4I7EA 4CMIA 3H2BA 2ONYA 4MQBA 1HYQA 4PF1A 3NIDB 3S8EA 1Y5LA 1PJLA 4UBMA 3HUTA 4G0QA 4FR2A 2XT0A 3NBAA 4Y2HA 2D1YA 4O5OA 3PGVA 3CIOA 2ZXEA 5LIRA 4IIXA 3HYLA 1KPGA 1FRVA 1G3MA 1VJ0A 2ZUUA 4W5RA 4OQEA 3W8DA 2ZI5A 1QOZA 4Q3AA 3WYCA 4BZQA 1E4YA 1CR0A 1FMTA 5CNIA 1SR8A 1Z3CA 1NYLA 1Q74A 4DIEA 3FPSA 4BX2A 4Z9AA 2V58A 2Z9CA 4YP1A 2J3IA 1FNBA 1BH2A 3F5FA 2QP4A 4MO2A 4PZ9A 4TQ9A 1YIOA 4H6WA 4U6QA 2MTBA 1IUPA 1JQJC