3D2AA

Structure of 1-17a4, a thermostable mutant of bacillus subtilis lipase obtained through directed evolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
179
structure length
179
Chain Sequence
HNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKAPPGTDPNQKILYTSIYSSDDMIVMNYLSRLDGARNVQIHGVGHMGLLYSSQVYSLIKEGLNGGGQNTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipase
publication title Thermostable Bacillus subtilis lipases: in vitro evolution and structural insight
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 68
structure length 179
sequence length 179
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2008-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3d2aA00
4UBOA 3WKBA 1JJFA 2XUQA 2JF0A 2VT6A 3JWEA 1VE6A 3EBLA 3P2MA 3UMJA 5LZ7A 1EK2A 4F0JA 2HIHA 3AFIA 4BCBA 5AI0A 2JGMA 4B80A 1MPXA 4HRYA 3WJ1A 1ZD2P 2CMFA 1WB5A 4P92A 4K2AA 5EI5A 4I3FA 3OC0A 1DT3A 3C6YA 5IVDA 4Q34A 2PBLA 2G5TA 4ZV7A 1UOPA 3I28A 2XUDA 5ALTA 1MJ5A 3LLCA 1UKCA 4WCVA 4L9AA 1A7UA 1CEXA 2ES4A 3W04A 1XZEA 3U1TA 1E8MA 1L7QA 4BCDA 5AKIA 1BU8A 1JT2A 2JGIA 3A70A 5ALXA 4B83A 4QZVA 2RI6A 4Y2JA 5AKKA 4B9EA 4OU5A 1K6EA 5ALMA 3DYIA 3DL7A 1LPPA 4CFSA 1PV1A 5D3KA 1O6GA 4DGQA 1QIIA 4W9RA 1UKBA 1U4NA 4UBIA 5AOCA 5JAUA 1DTEA 2ZYIA 2QJWA 1IMJA 1DINA 3FWHA 1L7AA 1IUOA 1VE7A 3D2AA 3TJMA 3VKFA 4JYMA 3WL5A 4BP8A 2XMBA 1EDBA 4CCYB 5A71A 1ETHA 3VJLA 1ZD5A 3V9AA 1VXRA 4IQ4A 1YASA 1BN7A 4K5QA 1DT5A 4Q3OA 1ZICA 2WHPB 1QO7A 3I2HA 1EDEA 5K3FB 1RWQA 3K9BA 4EY4A 3FNBA 1LZLA 2H9YA 1QIHA 2Z3ZA 1CUVA 2H7CA 2J3DA 4ARAA 2WJ4A 1I6WA 4UHHA 2WFLA 4P9NA 3PI6A 3I6MA 1THTA 4FNGA 4KACA 2CKMA 1XKLA 5AHXA 4H77A 1YAJA 5HKAA 5LP1A 3WIOA 2VTVA 4GWLA 1RYYA 3ANSA 5AH0A 5AOAA 4MYSA 3NUZA 1CUFA 2OGZA 1CLEA 4DMCA 5JAOA 2B20A 4ZI5A 3DEAA 5EIEA 5ALYA 3I1IA 2VQ6A 3AIOA 4A5SA 3RM3A 4WDRA 3A2NA 4ZREA 2HRQA 1SC9A 2ZVDA 2DHEA 3BF7A 5JASA 1R1DA 3O0DA 2XUGA 4H7HA 4KEAA 4CCYA 2XMGA 3I2KA 1ORWA 3V1LA 2CUTA 4J03A 3WKEA 1IUNA 4IH1A 3O4JA 4C88A 3OOSA 1LPOA 5K3FA 2J3QA 4LYDA 3SK0A 2OCKA 5T4EA 2ROQA 5IVKA 1BN6A 4OYYA 1WB4A 2WIFA 5HF9A 3WWEA 5A6VA 4LXGA 2HRRA 2IIVA 2HFJA 1R50A 1BE0A 3GBSA 1MT3A 1WM1A 4QDOA 1HPLA 4AZ3A 4EBBA 1GQRA 4UBNA 4L72A 1ODCA 5E4YA 1DX4A 5CH3A 1MX9A 2ORYA 5D6OA 4NS4A 3K6KA 5ALGA 1ACJA 1E5TA 5IKXA 1QIFA 2C4HA 3PFBA 1ORVA 2PUHA 3MUOA 1QGED 4OB7A 5AM2A 4DLNA 2XUHA 5BWBA 2DQYA 1BCRA 1LLFA 3C43A 4AQDA 5K3DA 4CG1A 1XZJA 4PV7A 3C6ZA 4Y2RA 3Q0TA 5C8XA 4J0CA 2PSFA 2NW6A 2XDWA 2QTBA 5DYYA 1XZFA 3HYSA 1SCKA 2JBWA 2JIDA 4N8SA 2XLCA 4ROTA 5BWCA 4MYDA 3Q8WA 4U2BA 1AMNA 3X3HA 1JMYA 2V97A 4X7BA 2H1IA 4ETWA 1IZ7A 1OXMA 1XQVA 3B5EA 4MJ3A 3I6YA 1UKAA 2WM2A 4N8DA 1XFDA 3VXKA 1G4HA 4GW3A 4AB1A 1E89A 1ZD3A 5C81A 2OG1A 3NWOA 5F4ZA 3V1MA 1QO9A 2OXEA 3WYNA 2RAUA 1P0IA 2PSDA 1ISPA 3GELA 4QNNA 5CTAA 4G5XA 2D0DA 4BYMA 1SOMA 2QVBA 1XLUA 2WUGA 3WL7A 4RE6A 4QDXA 4ARBA 5CT9A 4MEAA 3EQ7A 2HU8A 1HKHA 1H2YA 3OURA 4TVKA 5FXMA 1MX5A 4OD0A 3O95A 1TAHA 4UBJA 4XWGA 4K6KA 3NGMA 1RP1A 3DQZA 5HK8A 3V48A 1YR2A 2X5XA 3QMMA 1VA5A 3IBTA 3EIOA 3IA2A 3DOIA 1CR6A 2PU7A 4GXNA 5AI4A 1QZ3A 2R11A 4UBMA 3U0VA 3FYUB 1CUGA 2B4KA 2XI4A 4DTCA 5AK6A 3C87A 3OTQA 4TGLA 5AM4A 1LPAB 2PM8A 1IUPA 1J06A 3LIPA 2V96A 2XUOA 1GPNA 3ZI7A 2EDCA 4FOLA 2CJPA 1UT6A 3IUMA 1TCAA 4BVLA 5FOQA 1XZCA 1ZOIA 1H2XA 1VZ2A 1QE3A 5AI9A 3GUUA 4HRXA 5ESRA 1MX1A 2XQJA 5ALKA 2XLBA 1XZAA 1WPRA 5JAPA 5BV7A 4HTAA 4HXGA 2ZSIA 4AO7A 1XZIA 4M0FA 5JYCA 5DTIA 3BWXA 1X2EA 1YCDA 4K6GA 4F60A 3FLEA 4A23A 3FCXA 4TPKA 3HLKA 3H2HA 4ZV9A 4I4CA 3BL8A 3QITA 4WY5A 4IH4A 5AKXA 3WK7A 4B84A 4ZGBA 1Y37A 1WHSA 2HFKA 2B61A 5AJHA 4QDUA 1Q83A 5JAHA 2ZJ7A 3FAKA 3LCRA 2O7RA 3QPDA 3O9MA 4E15A 3G9XA 4YK7A 2VJDA 3D2CA 2XMRA 5DYWA 2P8SA 3H2KA 2OQIA 1AQLA 4KE7A 3DKKA 1DWOA 3F97A 1QIEA 1F0NA 4X94A 5K3CA 5JD4A 1TK3A 3DS8A 1K63A 3CXUA 2IX9A 4GDMA 5JZBA 4X6UA 4BAUA 3FVTA 2BUAA 4DNQA 2RHWA 1W4LA 5JATA 1OILA 3W9UA 4AO8A 3STWA 4EB0A 3EQ9A 2WKWA 3G0IA 2QJRA 5ALZA 3LP5A 1JFRA 4UHFA 2X76A 4LIPD 5YASA 5HF8A 2FX5A 5CH8A 1LPMA 5CURA 1X70A 2BUBA 3QVMA 1KU6A 3O4GA 3I6ZA 4KAFA 3EF3A 4P08A 2H7XA 1SFRA 4M0MA 2WUEA 2ZYHA 4EY6A 3WKAA 2QM0A 3C6XA 4G4IA 4I19A 4OPMA 2FJ0A 3F9CA 1EA5A 3MUNA 1BCSA 3KOOA 1CPYA 4P93A 4NMWA 4KE9A 1LZKA 1WOMA 3ESCA 4BZZA 2CB9A 4OYLA 3H04A 4G1FA 2WIKA 1QFMA 3HI4A 1XRPA 3I2FA 1AKNA 4H35A 1XLVA 5SYNA 4RNCA 5CBKA 4KE6A 2GYUA 4YX9A 2PX6A 3OM8A 3HEAA 1AGYA 4WFIA 3A6ZA 4ZXFA 5HF5A 2PSJA 3RLIA 3T52A 4C01A 4H7JA 3YASA 3STVA 3H1BA 3ILSA 4QE3A 1CUYA 4U2DA 4C87A 3BDIA 1N5MA 3QMWA 4BRSA 1HQDA 4C4XA 2I78A 2WILA 5JZ9A 2H7YA 2WIGA 1JMKC 1CUXA 1Q0RA 2B9VA 1XRLA 7YASA 5DNVA 4UFPA 4G8DA 1CUDA 1JKMA 1WHTA 2C0PA 3BF8A 5EIHA 1Y7HA 4MWSA 3WQHA 2AJBA 3ZPXA 3WA6A 3KDAA 2XMQA 3HXKA 4G9GA 4UBLA 4HZGA 4FLEA 3IUNA 4WJLA 3E0XA 3WK4A 3G9UA 1GPLA 1EXWA 4S0XA 1HL7A 2YASA 2QRUA 4X91A 1BROA 2AJCA 5FPQA 3GROA 3WKCA 2IITA 4UFNA 3DJYA 3AINA 3G0CA 4ITVA 4UHBA 2ONCA 5AKJA 5E4JA 1KEZA 5DTJA 3B3QA 3PUIA 5C8ZA 1G66A 4BZWA 3V1KA 2HADA 1C4XA 3C5VA 5JANA 1H22A 4BVJA 2PVSA 1QJ4A 3TEJA 5JZSA 4G4GA 5ALSA 4EY8A 4OSEA 2GYWA 3DNMA 1G42A 1E8NA 3VJMA 1EB9A 1CVLA 4Z49A 2VT7A 5LIPA 4JYPA 4U2FA 4XX1A 3SX4A 3WA7A 3HABA 2JEYA 1JJBA 5E2IA 3R3YA 1TRHA 4FLFA 1D07A 1WPXA 1N1MA 3M3DA 3QPAA 2XT0A 1XZGA 3CN7A 1ODTC 3ICWA 4FMPA 2C5GA 1A8SA 2O2IA 2O2HA 4J3JA 3KWJA 1JU4A 1TKRA 4H7KA 1K4YA 5FUMA 1CUCA 2W22A 5DNUA 4C4ZA 1VJ5A 3I2GA 3VVMA 2VEOA 1A8QA 1GPKA 1LBSA 3DL4A 4HXFB 1CUZA 2AXEA 5ALIA 4KAAA 4X00A 5T4BA 4J0DA 4BB0A 3E3AA 5LKAA 2WLSA 1XROA 3DD5A 3WK5A 2VAXA 4UBKA 4B7ZA 3STUA 1XZHA 4X97A 5ALOA 4FFWA 4BE4A 2VF2A 1HDEA 4J7AA 1H2ZA 2QOEA 3PF8A 4Q05A 4BDTA 1SCIA 2WG2A 1AURA 5CT6A 4C4YA 2WHPA 2XUJA 3SWWA 2R8BA 5JD5A 3PDCA 1WB6A 2VATA 1N8SA 1EX9A 1YB7A 4W1SA 3STTA 1UK9A 5EIAA 3PE6A 2GBFA 3H19A 1QOZA 5ALNA 4FNMA 2BUCA 5AKHA 2VJAA 3KWFA 1MNAA 2HA4A 3R40A 3C5WP 1Q84A 1QTIA 3PUHA 5EHQA 2K2QB 5LZ5A 1NU8A 2OCGA 4WFJA 3ESBA 3WK8A 4AN0A 5LKRA 3FYUC 2YH2A 3JW8A 4KE8A 4JNCA 1ZI8A 4RPCA 2RONA 3BIWA 3GA7A 4UHEA 5DWDA 2DHCA 5JALA 5CXUA 4B81A 1XZMA 2I3DA 1ODSA 1GGVA 4CCWA 2VAVA 1BS9A 1DU4A 5AK5A 4LHEA 3M83A 1W52X 5ALWA 3OG9A 3KD2A 5DYTA 4UUQA 5K3EA 1GZ7A 2ZYSA 3R41A 5AOBA 1EHYA 1YA4A 3DOHA 5LZ2A 3O4IA 1JI3A 3H2GA 4UFOA 4YASA 1QIKA 1MAAA 2HA6A 3PFCA 1USWA 4GI1A 2DR0A 1XRMA 4CI9A 4XIIA 1LPBB 3IDAA 4J0KA 4JUIA 1GT6A 5A2GA 2AJLI 1MU0A 2VJBA 4XVCA 3D4LA 4DMFA 1R9MA 3S8YA 3C45A 5AI8A 3FBWA 4GBGA 5EHZA 4H0CA 3D59A 5SYMA 2HA2A 2HA7A 5JD6A 2C0QA 3W2TA 5D7BA 2Z8ZA 2RIPA 4AZ0A 1UOOA 2JGJA 4LYEA 5AKLA 3G8YA 1U2EA 3O4HA 3OPMA 1E66A 1CUAA 2BGRA 1LBTA 1CUJA 4O08A 3WL6A 2D5LA 5HZGA 1NX9A 5I8PA 3RARA 3QPCA 3UUFA 4QA9A 2OQVA 4AMYA 2WG0A 4WFKA 1EI9A 3PF9A 2VJCA 5HFNA 1XKTA 3BDVA 4V2IA 2WUFA 1CUEA 2GBGA 1CUIA 5CXXA 3WYDA 4KJXA 4HS9A 4Y7DA 1DQYA 4XJVA 1O6FA 4B85A 2BGNA 3PICA 4KRXA 5ALJA 4G8CA 3AZOA 4AX4A 1IVYA 4OB6A 1XZDA 2C7BA 4OB8A 2ACEA 4G8BA 5A7GA 4QDZA 4C89A 2YXPX 2WU3A 3VDXA 4W1RA 2HHAA 1Z68A 4H7EA 4U2EA 3EQ8A 4W1PA 5J3JA 5AI6A 2JGEA 1CUHA 3FYUA 3BXPA 4OU4A 5HQ3B 1BEZA 5AI5A 1AX9A 5C8VA 4U2GA 4FFVA 4ZWNA 5I7UA 5DLPA 1YS1X 3WL8A 4FBLA 5AK4A 3C70A 2XB6A 2HU5A 2Q0XA 2QUBA 5C7YA 3ED1A 4PSUA 1VZ3A 1LPNA 1K5PA 1ZI9A 3AILA 4INZA 4BDSA 1YSCA 1T4MA 2WG1A 3WLAA 3STXA 1HBJA 5AKZA 4PQEA 1BEEA 5ALVA 4IH9A 1CUSA 4QLAA 5BOVA 4LXIA 3MGAA 1A8UA 2G63A 2EDAA 3HRHA 4HXEB 2QZPA 4B0OA 4H7IA 3G0DA 3QH4A 1GXSA 3JYHA 4MQMA 1CUUA 3GFFA 1E3QA 4YPVA 2HU7A 4GEGA 2XQGA 1UXOA 1UWCA 3VJKA 2WSLA 3WI7A 1MN6A 1L7RA 4W63A 4BP9A 3TRDA 1AZWA 4U2CA 2GBIA 5HQ3A 2WU4A 3B12A 5EGNA 1PFQA 4X3CA 2UZ0A 1TIBA 5AKEA 3AIMA 1FFAA 1AC5A 5CW2A 3L1JA 3C8DA 5LZ9A 3IULA 3ESDA 5CH5A 1FJ2A 3I2IA 1VA4A 1F8UA 2VA9A 1VXOA 2CEKA 4W1QA 3G02A 5CT5A 4PO3X 1UOQA 3AIKA 3IUQA 3FLBA 4KR0A 3F8SA 3CCBA 3ZWQA 5KREA 2CBGA 4C6HA 5D3ZA 3QMVA 3K2IA 1R88A 4QEKA 4NVRA 1FSSA 3I1YA 5HCUA 2WQZA 3IIIA 3H17A 4H7DA 2X8BA 3DDUA 5AK3A 1OCEA 2BCEA 2XQIA 4BC0A 2XMSA 5LZ4A 2VSQA 5AIBA 2WIJA 1QIDA 2V98A 5AM1A 5EHNA 3G0BA 3FYTA 2JGFA 3M81A 2O7VA 4PSCA 2XQFA 3N0TA 4RE5A 2Y6VA 3H18A 5KWIA 2QMQA 4HVTA 1KU0A 2LIPA 4BBZA 5AIAA 5DNWA 4FTWA 5A7FA 5JIBA 1XQYA 4EY5A 2WUDA 3FLAA 5LZ8A 3E4DA 1UZAA 2QS9A 2XMZA 1U65A 1W6RA 5H3HA 1TCCA 4DM7A 2PKYX 4N8EA 3WZMA 4WY8A 3FSGD 3STYA 4X93A 4K6HA 2WJ3A 2J4CA 2WFLB 3WK9A 3G7NA 3ZLVA 4FWBA 4WDQA 3AJAA 3CCCA 2JGKA 3ZLUA 2OGSA 4G9EA 4MEBA 4NZZA 3ZV7A 2FJPA 1EH5A 4Y9SA 4J0IA 4B82A 4EY7A 3IURA 1T2NA 4GHWA 1QTRA 4DIUA 2I03A 4KYVA 4E11A 3FVRA 1EVEA 2PSHA 2GZSA 5ALDA 1XZLA 4X71A 3BIXA 3O9VA 3BE8A 1THGA 3NOXA 3ESAA 3KXPA 3D3NA 3WWPA 3DKRA 3LIIA 2WTNA 2I3ZA 1JJIA 3WKDA 3ICVA 1QLWA 2XUFA 3R3WA 5ALQA 5FDFA 3HJUA 3ANTA 5K3BA 4Y2TA 5IH7A 5ALRA 1QFSA 1MO2A 5AKGA 5CRIA 4IO0A 2XUKA 1ZD4A 1GKLA 4N5HX 4DSAA 4HAIA 3W05A 1C7IA 3WIBA 3V1NA 4QLOA 3IUJA 1JU3A 1QIJA 5HKBA 2J4FA 1B6GA 2OAEA 2DQZA 3AUKA 5IVIA 1C7JA 2AJ8A 1ZGCA 5EFZA 2HA5A 1QIMA 3R3UA 4JH0A 2AJDA 4Y2YA 1EK1A 1EB8A 2XUIA 3LS2A 4BE9A 4L0CA 3E1GA 1TCBA 1FFBA 4BCCA 5CT4A 1IZ8A 2GZRA 5ALLA 1QIGA 2XE4A 1E8DA 1DQZA 3CN9A 4J0JA 3WWOA 3RK4A 2WHQA 4BRZA 4DNPA 3WJ2A 2XUAA 4ZRDA 3F98A 2ZSHA 3KSRA 3G9ZA 6YASA 1VOTA 5AP9A 2Y2VA 1FFCA 1K8QA 2EEPA 3VISA 1CUBA 3RKSA 4AMZA 3QBJA 4PF1A 4B0PA 5AICA 4DSZA 1MNQA 2ZJ6A 2OAGA 1NU6A 2O2GA 1ZGBA 2HM7A 2Z8XA 4FBMA 2PSEA 1WCYA 3A2MA 3WWDA 1PJAA 2GBCA 1R9NA 2C58A 5HK9A 1QONA 4G4JA 4QDTA 1UK8A 4H7FA 3WMRA 2OGTA 3HC7A 2PPLA 2DCMA 2QKYA 4OCZA 4Q82A 5LLSA 2PU5A 2QXUA 2OCLA 1S8OA 2DHDA 1CRLA 1J2EA 2PL5A 2QXTA 2QUAA 3R3XA 3QZUA 2BAGA 2XUPA 4CG2A 2ECFA 3BJMA 3VVLA 5T4FA 3A2LA 3HZOA 4Y2VA 4X6YA 4Y2UA 2YYSA 5EHXA 4EHBA 3L1HA 4GLBA 4J0HA 1ZIYA 1GKKA 5LYYA 2BFNA 2RGUA 1UK6A 2WJ6A 2E3JA 3UUEA 1YA8A 4PSDA 1BRTA 1MTZA 4MQLA 4X92A 4X6XA 2G4LA 4AN1A 1Q0ZA 4Q1VA 5FPPA 5IVHA 5T4HA 2WFMA 4DNOA 4Y2PA 1VKHA 5E4TA 3H0CA 3G0GA 4DYHA 5A62A 5JARA 4B6GA 3HACA 3IVMA 4RGYA 4H18A 2Z5GA 5ALFA 4A16A 3R0VA 2BKLA 3TGLA 3FCYA 1XZKA 3C6BA 1EDDA 4Q3LA 5FP0A 4UHCA 3W06A 5A7HA 4L3WA 1N5RA 3QYJA 2XMCA 1FFEA 1P0PA 4FDMA 1GQSA 2GYVA 3WZLA 1MAHA 4E46A 4BVKA 4PNZA 1Y7IA 5HFAA 3WK6A 5CT8A 2QT9A 1P0QA 5FRDA 4DNFA 2JEZA 3W9BA 1XRRA 1DWPA 4UHDA 1CIJA 3H2JA 5AM3A 4BTLA 2Z3WA 4FHZA 1YAHA 1CQZA 2Y6UA 4EUSA 2V9ZA 5KWJA 1W75A 1YB6A 4X85A 4QWMA 2BJHA 2ZYRA 5ALPA 4EZIA 1J07A 4PW0A 4FLMA 5HF6A 4DMHA 2WHRA 1H2WA 1F0PA 4LXHA 5K3AA 4GECA 1B41A 1FFDA 1XZBA 1LGYA 1ZI6A 5FV4A 4UPDA 3T4UA 2XMDA 2DFPA 3R3ZA 3S2ZA 5K5EA 4Q3KA 3F96A 1J1IA 2Y1KA 3D5EA 1LPSA 5CMLA 2W6CX 3BJRA 2HL6A 2FUKA 4D9JA 2WIDA 3AZQA 4N5IX 2OPHA 4Y2SA 1W76A 5ALHA 1R4ZA 4BC1A 4CIAA 5DJ5A 4F5ZA 1CFJA 2ACKA 3MVEA 5FKJA 4BATA 3SC2A 3D0KA 1DWQA 1W1IA 3HSSA 4QWWA 4Y2QA 2PUJA 2JGLA 1SCQA 2OCIA 4F21A 2C5FA 4MWTA 4X95A 1HLGA 1CQWA 4BAGA 1XQWA 1TQHA 2OLEA 3WWCA 4KRYA 3N2ZB 4J0GA 3DYVA 4JEIA 3G9TA 2RHTA 2CZQA 1XRQA 1XRNA 4X90A 1F6WA 1VLQA 2Y2UA 3I2JA 1P0MA 4FKBA 2ZJFA 4MXDA 1A88A 4CG3A 1UFOA 5KBYA 3R3VA 3D7RA 2DSNA 1UK7A 5ALEA 3FSGA 5AM5A 3H2IA 4BTVA 1U8EA 3L1IA 4BAZA 1DX6A 1R3DA 5AM0A 4LKOA 1XLWA 1ACLA 3GZJA 2HDWA 5ISMA 3F67A 1M33A 1YS2X 3QM1A 5AO9A 3AZPA 1X2BA 2WFZA 5JADA 3DCNA 1LNSA 4CIBA 1CV2A 5AKYA 2WTMA 5I9IA 1XQXA 4B9AA 2HA0A 3H1AA 3DLTA 1AUOA 1ZJ4A 4OUKX 2G5PA 3C8HA 4IHAA 4DMKA 4AXBA 1EVQA 5ALUA 1EINA 2QR5A 5FLKA 4M0EA 1G5FA 2HA3A 3FOBA 4E14A 4Y2XA 1ZIXA 3ZLTA 1ZJ5A 3D2BA 3IB3A 2XQKA 4EA6A 3M82A 1H23A 4AO6A 4KAJA 1CUWA
chains in the Genus database with same CATH superfamily
4UBOA 2JRLA 1G6OA 4A5OA 4GXQA 1AHPA 1T3HA 3DVSX 1R4AA 2J46A 4B4KA 2JKVA 3GNTA 1J2TA 1VE6A 2W6PA 2J7PD 2ZDQA 2GMWA 3DE1X 3EBLA 5GVRA 4DQKA 1T4GA 3UMJA 3ICQB 1NOIA 2DH5A 3DDOA 1LDYA 1R0WA 1SC1A 2PRYA 3HVJA 4L7VA 3X2FA 3ZV6A 1L3IA 3AFIA 5AI0A 3FZYA 1S9HA 1AQIA 3VJRA 3MFYA 4QGAA 5J58A 1WLYA 1Z7WA 4XEHA 2G77B 4OOFA 3WJ1A 2GZMA 1ZD2P 2VPXA 3LT5A 5J2TB 4O3FA 2K87A 3HJAA 1X0VA 1E98A 1IZ0A 4MI6A 3TQSA 4O1MA 1FMCA 2FEWB 3RUAA 1DC8A 5F5LA 1DT3A 2XZPA 3EF0A 4HYYA 4EAQA 4RVSA 4CYMA 5KYNA 4V0RA 4ZOEA 4ZCLA 4K87A 2BEVB 1QZZA 2FOLA 4YQZA 3K2EA 4FMCF 3VHXB 1MFZA 4WMLA 2G5TA 3RJZA 1Q3KA 2BDEA 4ZV7A 4AYXA 4C1NA 4JUBA 4YRBA 4Z7NB 5DP2A 1EK0A 3FPGA 4UJ5A 1M1YB 5ALTA 4JJEA 1GZ3A 3LLCA 4BUCA 3A1NA 3L79A 1QO0D 3HO1A 4WCVA 3GFQA 3ICEA 2FLKA 2ZAOA 4CGYA 3FUXA 1QMPA 5BNFA 3ET5A 1KK3A 1A7UA 2QTHA 3W04A 2UYCA 2JIRA 4XB1A 2FAXA 2AVDA 1S7CA 4JJ7A 4BCDA 4C22A 1BU8A 4JVMA 4C14A 1JT2A 2YUIA 1A95A 2P67A 5INTA 4CDGA 1P2SA 2RI6A 3KT3A 4Y2JA 5AKKA 1HURA 4OU5A 2W6OA 4LMAA 4D0GA 1CEQA 3FE2A 4ZT5A 4CDRA 1IQPA 1N2SA 4REMA 5CYPA 3MTDA 5ALMA 4C0LA 3U5TA 5LJIA 1C8VB 2PMKA 3DYIA 4LYYA 5JI3E 1QAQA 2LKCA 2C2ZA 3Q3HA 4ZRNA 2C5AA 3OZCA 1DBWA 1PV1A 1UMKA 1VE5A 2B37A 2VG8A 2XEXA 3RVDA 3PDHA 3IOCA 4RZUA 3FBTA 3HKBA 1U8CB 1V1RB 4DGQA 3ZWDA 5HIAA 5KVAA 3ZZUA 2WC1A 3F5FA 1P9RA 4W9RA 3FMGA 3U7JA 1IAQA 2C4MA 2XVAA 1YQEA 2YCBA 2YUTA 3S29A 1BE6A 2FUG1 4NNOA 4B6FA 4RY8A 4B73A 1SH7A 2PJZA 2QJWA 3CX4A 1M1ZA 3PBKA 4NBVA 2ZEJA 4UE6A 2IX3A 4HQFA 2GDZA 4PLHA 3DNFA 3O8LA 1A77A 2P1ZA 3OY7A 3QE0A 4QDKA 1FQWA 3TJMA 3VKFA 3ZIAA 2AZTA 4EPRA 1UFKA 4KYIB 4ETIA 4JYMA 2ZBGA 3NETA 1E4EA 3WL5A 5BURA 4J91A 4MKXA 1AQ6A 4G0OA 4FEGA 2LCFA 3KEMA 3C4VA 3CZPA 4G97A 5A71A 3VJLA 3WXMA 2H1SA 4NYJR 2VQFB 1TQDA 1YASA 3CZ4A 4CIYA 4EITA 5AVRA 4F1JA 4P7KA 2BP7A 4FGLA 3R8FA 2J0SA 3EZ6A 4QEDA 3P71T 2F4NA 4HAOA 2BEJA 5ADHA 3ZDRA 2NP6A 2WHPB 3GGGA 4DHEA 1DIBA 2YVLA 4HR7A 4N6GA 2VDPB 1SD5A 3TJRA 2SBTA 4EHJA 1TK2A 3P20A 5I8WA 1KBOA 4K88A 4IDEA 4DYVA 3JS5A 4II3A 2M32A 4D2IA 2RGWA 2J0VA 3K9BA 2PKQO 2RMKA 3FNBA 3O5AA 2YYAA 4I1UA 3H9JA 3SFZA 1KJWA 1MZPA 3F7OA 3PHBE 1T2VA 1QIHA 1OWNA 1KZ7B 1IEVA 3LPNA 3M4JA 1OH5A 3IVAA 5CDFA 1C3OB 2BEVA 3MS4A 2X15A 3VHXA 2RK6A 3BB1A 3I5MA 2CXSA 3CF6R 2AXPA 3OJ0A 2J3DA 1NMQA 5G53C 4JOQA 3KLOA 4JT9A 4LEIA 4XQEA 5JSYA 2GD6A 3R5TA 5JE8A 4ETNA 5B55A 2OSBA 4KLAA 1R0SA 3F3SA 3JQAD 3FJYA 1GUDA 1TKAA 4HNQA 4OHVA 3E5MA 4WADA 1I6WA 4UHHA 1B6RA 4LJ6A 4E4RA 1A4XA 3PI6A 1OH8A 4Q00A 3E58A 1KR2A 5FA8A 2YWXA 2YHUA 1GQQA 4NPHA 1L5GB 3RNOA 3UMYA 2C78A 4PAQA 5BN5B 4RCVA 1U31A 2X7JA 2VZ0A 5HKAA 3BEOA 1W96A 4FFPA 5LP1A 4V39A 4AI6A 1NXSA 1V47A 1PK8A 2GRJA 2QX7A 4GWLA 4I36A 1NQ5A 2HO5A 2JLRA 4TKMA 1L4FA 1HI9A 1KBQA 2FPLA 3CSUA 1J20A 1SN7A 2YL2A 3QKIA 1KEEB 1T0BA 5ABPA 1YR7A 2GCEA 1G19A 5LSAA 2IYLD 2VA8A 4B6JA 4FN5A 3NUZA 3BJEA 1BCRB 1HT0A 1MORA 1DXYA 3OJEA 4G26A 1Q6ZA 1S1CA 4ZU6X 3RYTC 1D8AA 3OEHD 1GTVA 3C7CB 4DY6A 5KKNB 1TD9A 1IZYA 4IPTA 1CLEA 2X22A 4ZAGA 5DH9A 3O93A 4YAFA 3CZRA 2NO7A 1JTFA 4AKTA 2JLUA 4JV5B 4QBTA 1SD2A 3I1IA 2E4AA 4RELA 3EVTA 1J25A 3WLRA 4KITB 3T94A 1X87A 3H3XA 5TSDA 4ZI7F 2ODBA 1YTLA 3AIOA 4G0YA 3N3BC 3OQIB 4NHEA 3KEFA 2FP4B 3CW9A 3I5XA 4RVHA 3TEMA 2Z1MA 2G28A 1FS5A 1D4FA 1TJ5A 2DHEA 1UPFA 3EZLA 1TX4B 3CR8A 5JOQA 4P2BA 2IHTA 1Z4OA 3BM5A 1R1DA 1KJYA 1T8RA 2A14A 1YJAA 1GPH1 3ND7A 2PGXA 2XUGA 4N40A 5B1SA 2CJWB 3U4CA 2ZM5A 4JLOA 4R2HA 4HSEA 3I2KA 1WQ3A 1GV0A 5G1PA 5JPDA 3M4XA 4EO4A 2VHJA 2CUTA 4J03A 3LBNA 4JT4A 2DUJA 4IH1A 4M9CA 3TS1A 4C88A 3VA7A 4CEHB 1VKNA 4BZQA 2DSTA 1LPOA 5BOSA 1YMVA 3FOFC 3ZVMA 3NBFA 1WL8A 4XGQA 1TZKA 4KIGA 5JG7A 1E6CA 2FPPB 3GN2A 3MS7A 1NXQA 2OCKA 1C41A 3HYTA 2F1HA 2H2FA 4ZO9A 1D5CA 4ZN6A 5IVKA 1HE8B 5KOHB 2HQRA 3RC8A 2PS0A 1DJOA 3QI2A 4GP7A 1XZPA 3CC8A 4LFAB 1Z2CA 2ZUCA 1HO3A 5HF9A 4WNCA 1O97D 2OC4A 3VI4B 3HVKA 2VSFA 4FNAA 3CEPB 2IIVA 5LQMA 2HFJA 4PR0A 1UBOS 3MWDB 4CEJB 2AE2A 1BE0A 2UXDB 3RNLA 2PA0A 3EEBA 1MT3A 1GD1O 2VKQA 4KXQA 4QDOA 2A67A 2Y71A 2ZANA 5TQJA 4ESOA 5C3MA 5JUWA 2E5LB 2FJUA 4AKIA 3KOYA 2HLHA 5F2OA 2QRNA 4IV8A 1NJ8A 3B1XA 4V0OA 3IQFA 4BJ5A 3QU4A 5CH3A 1T3TA 4F1KA 3ZXXA 5F73A 3K6KA 1ZXBA 3EXG2 4FGKA 2I6TA 1T1EA 5BN5A 5KQSA 2B5OA 3LZ6A 1V43A 2C4HA 4TQUS 3LHKA 5TEVA 2YOHA 5GV7A 4HX9A 4J75A 1QGED 1FFYA 5JHHB 3MEQA 2QTTA 4QXAA 13PKA 5B4UA 4ZQEA 5EZ5A 1ULTA 4YMIA 4DANA 2G0AA 1KEEA 2O54A 2R1VA 1EM6A 1EEHA 1OIVA 1QDUA 3AV0B 1ZJYA 3FTNA 3AW9A 1UJ5A 2H5IA 4DLUA 1KK1A 4FOOA 1R37A 4KX5A 1BCRA 1JR4A 4RL4A 3V6LA 1ISJA 4K9LA 3EYWA 3DV0B 5HUQA 2GUWA 1RRKA 1XZJA 2PRZA 1KVSA 2F2TA 3KEOA 2R6AA 4JB8A 1SHZA 1WOYA 3JWJA 3W7VA 5FNVB 1WBDA 3P9XA 2NW6A 2APJA 2XDWA 3BB3A 1DHTA 3NEJA 1IUKA 1ISHA 1UBSB 2ZCUA 4KGVA 4Q37A 4EKGA 4NU0A 5T3UA 1DJMA 3EW9A 4ZAWA 1WSAA 3C3AA 3A4LA 3OQIA 2FP4A 3CJTA 4N8SA 3UIEA 5B7NA 4HGOA 3WL4A 3PWZA 1C9YA 1KP9A 1DKLA 1FX1A 5HIMA 2AX4A 2NVUA 3O21A 4YDRA 3LF1A 2X1VA 2F3TA 4U2BA 1YWGO 4PS0A 3CSSA 1AMNA 3NXKA 1SGWA 4U7DA 3PX7A 5JS6A 2X3UA 3G17A 2CJWA 1G5TA 3TW6A 3DWEX 3N87A 4IF6A 4F71A 1XI2A 1KZ4A 1F06A 1IZ7A 4C0XA 6Q21A 1MO5A 1L1EA 1OXMA 4OQYA 2X77A 4WBXC 3QNMA 4FZ5A 3PGKA 3I6YA 1UKAA 3OF2A 1E2FA 1XNGA 5HGJA 4CEHA 2X41A 2EVWX 2SNIE 5I7SA 2A3RA 3PC2A 2YIDA 2FK8A 4JAVC 4AFNA 1ORTA 4IMRA 4J16C 4RY9A 1JBQA 3NM5A 4OI4A 4P4GA 1Q14A 4GC9A 2FPPA 4YA6A 5K4AA 3ZWVA 4YTEA 5C81A 1L6IA 2UKDA 3IHKA 5EPEA 5KOHA 2A92A 4EMTA 2OG1A 4FKZA 4B4VA 2GYYA 2NO9A 3U3OA 2BM8A 1B73A 2JFHA 1N9KA 3QG1A 2VJMA 1RHJA 3O2SB 1QO9A 3DMGA 3Q10A 4N0DA 4N3CA 2PQ6A 1E6KA 1L5WA 2Q3MA 1ISSA 4V24A 2RAUA 4C07A 1FFGA 2F1KA 3KQVA 4LTMA 1DDGA 3O83A 3UA4A 1XYGA 4LTDA 1NRJB 5HIIA 2H57A 4DM4A 1RQRA 2YXDA 1BDIA 4BX0A 4BYMA 2D1YA 3GGDA 1SU7A 4BNNA 2PJDA 2PR7A 3OE1A 2HWWA 2XCUA 1BMFA 5CG1A 2HK9A 3E84A 3LWBA 3WLSA 4LDAA 3HCAA 4NMMA 2W4MA 4QT0A 4HBZA 3RG8A 1VI5A 2V4MA 5JC8A 1Z75A 4MEAA 3EQ7A 3O92A 4OFXA 1NQAO 5LXTF 5T41A 1CHDA 1RPTA 3OURA 4QQKA 4PYMA 1MX5A 4OHWA 2ZBUA 4I08A 1GLGA 1V5FA 2LV8A 3GDFA 1P4AA 1AY0A 2DWOA 2IQ5A 2ZT5A 4XWGA 3UJDA 3EXFB 3UOGA 2JGRA 3TSWA 1GKUB 1YR6A 1YR2A 2PGLA 3KZ1E 4R8KA 4JXZA 2VCYA 3F6PA 2MU1A 4PXAA 3BHNA 3L8HA 1XR3A 2XCQA 5AQ1A 4JSRA 3IBTA 3EIOA 3KXLA 2BTQB 3DOIA 4EUEA 2QR3A 3DR5A 3G2IA 3TM5A 1ZJZA 2H4YA 3MRVA 3VYUB 3LQRA 1CR6A 2ZJ1A 4MI1A 2PU7A 4H2DA 3HRKA 3C2QA 1VIYA 4NESA 1Z5UA 3SXPA 4D8WA 2R11A 3NZEA 3M1IA 1G7TA 4QYSA 3N05A 4UBMA 1YULA 3WS7A 4E5KA 4R2IA 1Z2NX 4BGEA 1CUGA 3TQCA 1GGMA 3CVJA 2B4KA 2Q5CA 2XI4A 1W46A 3QWHA 5AK6A 1JIUA 5A9RA 2P9TA 4YRMA 2I2DA 4TGLA 4TS3A 3T3MB 2DT8A 4JELA 1JLHA 1KEPA 3LZDA 3USES 3GUZA 1PJCA 4QKQA 4JLVA 2AGVA 3S81A 1DRVA 1FP2A 3MJFA 3IPLA 1IK4A 3ZTWA 1IUPA 2PL3A 4F85A 2WYOA 4FINA 4HH4A 2Z95A 1J49A 2O5VA 2XEDA 2QTVB 3RVBA 3UGQA 4CR7A 4LBZA 4MCIA 3R5FA 1PL0A 2BE9A 3ZI7A 3OOEA 1AXRA 1USUA 4R2XA 4D4JA 1XSEA 1I2CA 1EM8B 2R62A 1SOWA 3W5DA 1UT6A 4MV8A 3QYAA 1KF0A 1QQTA 3NDPA 5HYVA 2IV3A 4YP6A 3K9GA 4BVLA 1FUEA 1Y3AA 5KAPA 2GF0A 2UZAA 5FOQA 2CUNA 5KYWA 2IP1A 5D3MB 1UH5A 2CHVA 2GJAA 2IA5A 3DZCA 5AI9A 3WDMA 1LSSA 2BSXA 3AH8A 3P32A 4GWKA 4HRXA 4IJMA 4CF4A 5L3VA 2C77A 3ZQ6A 4QVKA 1B15A 1DXOA 1JIIA 5HBRA 5JCJD 2GXUA 2RGDA 4YS6A 3OFVA 5JAPA 2ZUSA 4UAJA 5BSVA 4OH7A 3TH5A 3KAKA 2CNBA 1NTOA 2RFLA 4HXGA 4NE7A 3SX0A 2ZSIA 3UANA 2PNJA 4OK5A 2WF6A 3OF5A 2I3BA 4AO7A 5FL7A 4DR1B 1I33A 1G5QA 1OR8A 2VDMB 3PHHA 1X77A 2VDKB 1JR3E 1GQFA 2H6EA 5DO9A 1AO3A 4HNUA 5K4GA 3ZJVA 2XTAA 4KCGA 1QR6A 3GZ4A 5AXBA 1MB2A 3V2UA 2N46A 2XOXA 1GNRA 5FWAA 1I0IA 2BZ0A 1GLVA 3AONB 4A23A 5H59A 4DOMA 3QQ5A 3GLKA 1TUEA 3AJEA 3QEKA 4DWJA 1GPUA 3PCTA 4OXKA 5JAHA 3SGLA 3JQRA 1E60A 4Q02A 4TMVA 5GIOE 4TYNA 2VJPA 1NZDA 3EXFA 3HM9A 5AW0A 4LHVA 2GHIA 2W9XA 1NURA 5JJ5A 4A15A 1WXHA 2HR1A 1KYWA 3RH0A 5CLIA 1AV7A 2BTQA 2Q9BA 1KO1A 1Z83A 3CUTA 3ZE6A 4B6PA 3LQ1A 1DS6A 3KPYA 3AU9A 3L92A 5TNXA 3VO1A 1Y4AE 2AKAB 4OXIA 1E2QA 1E0JA 3PRYA 1DIGA 3WNVA 1KOJA 1R5NA 4WAUA 4DVGA 3D6AA 3JX9A 3N0VA 3DFKA 4L5BA 4R8VA 1WJGA 2V7QA 3TE6A 3WK7A 2V8OA 3L18A 4JBNA 2CVZA 5LYJB 2FZGA 4WZZA 2JNWA 1Y37A 3WLHA 4LWQA 2BKVA 1N75A 4KN9S 1HFWA 4CKCA 3C4JA 3D43A 2QUHA 3N2KB 4KO8A 1MF7A 1VKJA 4FZJA 2IP4A 1E9SA 4XCXA 1Z4JA 2O8CB 3DCJA 1HLPA 3WX0A 4LZAA 1MC8A 3RYFB 2WM8A 2RI1A 4QDUA 4RM2A 4A2PA 4B75A 1CVIA 5TV2A 5IKEA 4KREA 4ND4A 2OFPA 4EG8A 2OFXA 2XKJE 5FBRB 1BCSB 5K8UA 3U3MA 5DGXA 1ODKA 5C5EA 1WZUA 2G67A 2YINC 3UM9A 5JZOA 2QTVA 3LCRA 3OZ7A 1HOXA 4KVFA 3QPDA 2ZYGA 4HMPA 2JFFA 1OZAA 3O9MA 4CN9A 3SLGA 2LPMA 1AA9A 1FDVA 3BK2A 3GT3A 4WPGA 5JCOC 2GPBA 1EM8A 3EZYA 5KCMA 3PPXA 1IY2A 2P9JA 4F3RA 1KPHA 1EX1A 2XMRA 3L0IB 3L7NA 5IBPA 4LF8B 5B1EA 2A59A 3U48A 4G5SA 1M2HA 4GD3Q 4MYCA 4DBVO 3PEYA 1ESNA 1AQLA 2V7XA 4ZTUB 2BJVA 2FDXA 4DQVA 2XGMA 3DKKA 1DJQA 1Q74A 3F7NA 3LSTA 5D3MA 2IHKA 3T61A 1PJLA 2PQ2A 4BKRA 2QR2A 3GEMA 3VHRA 1QIEA 1K8YB 3MYRA 3LLMA 4JYCA 4M1TA 4RYDA 2Z9CA 4ANFA 4DIFA 2XCRB 3AUXA 3TPZA 3LV8A 4WJZA 5TJHA 4WESB 3RCBA 1NBWB 3RRXA 4F38A 4YAIA 1CSEE 5IDQA 1AQNA 4K05A 5LLTA 5DLEA 5HPYB 3GX1A 1TK3A 3JWIA 1ZN7A 3AF3A 3OA0A 3UK1A 4TQ9A 2WF8A 3GPBA 3CZAA 2RGGA 5DLDA 1UJCA 4BWGA 1QYCA 1IXRC 5EGSA 3B3GA 4F06A 3HWSA 3GYBA 4NRDA 2WP8J 1B74A 3JVDA 2RHWA 1W4LA 1DNPA 1IOWA 3BZWA 3DE7X 3OEEA 3OQ1A 3COSA 5CX1A 5GGXA 5CFNA 2JFWA 5IF3A 4S1NA 3EGDB 1E2KA 5J23A 1IQRA 4AO8A 3KNZA 4EYQA 3PUJA 4ZD6A 5I9SA 5HP4A 4EB0A 2WKWA 3G0IA 2TRSB 1PP4A 1WR8A 3NIBA 2I29A 3GAFA 2MR6A 3DZIA 5B6IA 4PZYA 1V25A 5DGIA 4D8YA 2W7TA 3IVGA 4LIPD 2FG7C 3L4SO 5G1OA 4ZK6A 1XP8A 1WU8A 2J6IA 4BFXA 5A4AA 6LDHA 5CH8A 3IT2A 1R4NB 2DLDA 1HEIA 4EI2A 2WB4A 5EINA 3RVPA 3I8OA 4MLPA 1QVVA 4QM6A 1KTVA 1V35A 3L7BA 2XCOA 5BSWA 1V8DA 2BDTA 1SVWA 2OD7A 4C2AA 3SI7A 3SF8A 1F3OA 2DG2A 4GZLA 5LYJA 3FDJA 1Z6QA 3OJWA 2QQ0A 2H7XA 3CWQA 3N2KA 4BO0A 4FE3A 2X0RA 3W3ZB 2O8CA 3NM4A 1WQ4A 4OX9Y 1XTQA 2JAPA 2VR1A 3RYFA 3HFJA 3MT7A 2ORWA 1P91A 2PKEA 3ADBA 4KR7A 1SUIA 5IZCA 1BCSA 1LLUA 3PFKA 2PS9A 1IG0A 2ZOSA 3KPWA 3OTHA 3KOOA 4JCCA 4E7OA 2L0XA 5CD1A 1J5EB 4BP1A 2X6QA 4A8PA 2JI4A 3OKPA 1R0KA 2P2LA 3RT7A 2XB4A 4BZZA 3ABOB 3RAGA 4LKRA 3C6KA 3IXLA 1FNDA 1M6HA 3DOUA 4OYLA 4X1IA 1D6JA 5H70A 4E03A 3H04A 4X24A 4G1FA 4TTIA 2W90A 4Q4HA 4MP3A 2AUTA 3HI4A 5HEKA 1XRPA 2AQIA 2A0WA 3T3EA 2CLLB 5FPTA 5DZSA 1AKNA 2HLPA 1LBHA 2OZLB 4FFBB 5EEHA 3G5MA 4AY6A 1C9JA 4C2TA 4RNCA 2I7VA 1RTTA 2JCGA 2JFXA 2GD2A 3ITDA 4N5DA 5FPSA 4BEBA 1K7FB 1OXXK 5ARCA 2XT6A 1Y9DA 3B8EA 4YX9A 4A36A 4WESA 3M7IA 2FXIA 1PZEA 3GDHA 3OO0A 4XEUA 2JFQA 5E3IA 3OM8A 3RJ5A 1DUSA 3ZE1B 1M0TA 2IU3A 4TX1A 4H60A 4WFIA 3AOEA 4B3BA 4DA8A 2GKSA 2PKWA 1Z4KA 4QUGA 4EW6A 1L1RA 2OXRA 2PSJA 5H9WA 3RLIA 3T52A 1L4YA 1CJVC 1M6VB 2R5NA 2WE7A 4E5DA 4JBGA 3EVCA 2IK8A 4NCKA 1J42A 4QE3A 2P5TB 2QGZA 1CUYA 4U2DA 3CF4G 4DABA 3P96A 5BSTA 5BNTA 5FBVB 3DWFA 4PQGA 1JF8A 1TQ2A 1ZSNA 3U81A 3DE5X 2H9AA 3EGDA 4C4XA 1WY7A 3A3YA 3NFYA 3KQPA 1HK7A 2FFQA 1JEAA 1QH1B 3N39C 2WHEA 4QGBA 3LU1A 3G89A 2C9CA 1CT9A 4FPXA 4L27A 1JR3A 1NPDA 2B9VA 2HREA 4NK4A 1U8FO 1LFDB 4G8DA 1CUDA 2IZ7A 1VJGA 4OVKA 3IOMA 3FUWA 4BMYA 5JECA 4G1VA 4CQNA 4MYRA 2ZQ5A 3FTQA 4I2NA 1B43A 4MVJD 3BF8A 5EIHA 4F2DA 2FZLA 3VGJA 4OI0A 4PAGA 3F2VA 1LK5A 1QCDA 4IXNA 3EQZA 3IAM6 3RRMA 4BN5A 4Q19A 3TI9A 1EUQA 4BUZA 3M4YA 3ROGA 1Y6QA 3A6GA 5MGNA 3HNPA 2ZSBA 3IUNA 4WJLA 1T2UA 2EFEB 1VE3A 3PYLA 2REXB 3WK4A 4B3IA 1E3DA 3G9UA 4KHZA 3UMCA 3GMDA 4JZKA 2XCLA 1CY1A 3CR7A 3LO8A 4IDNA 1KOGA 4X91A 5BWNA 4IIFA 2RAPA 2CNKA 5IC5A 4H7PA 4LV8B 4QFCA 3HY6A 3OIGA 4B1FA 2IITA 1FJHA 1TJ4A 3U1BA 3S3TA 1I24A 1YR9A 1G4AE 2IBTA 3LBYA 4O4HF 4DMLA 2EP8A 2JEOA 3PKJA 4OTZA 1QK4A 1RBYA 3GYGA 3GLIB 4MGHA 2WMOB 3OQHA 3R9IA 1VL6A 5CLJA 4DCUA 1KEZA 3FR7A 3GJQA 2ORIA 4LVNA 1L5SA 3PUIA 3QV2A 1GL6A 3NKVA 5SZIA 1AUVA 1SMKA 4IW3B 3A1VA 1SCNE 3CLSC 3CF4A 1JQLB 1L4UA 5JMWA 2EW2A 3V1KA 3IJEB 3TUZC 2OZLA 4FFBA 2GJSA 4XIGS 5DDIP 1K8XB 3LX8A 1LQTA 3X1MA 2M98A 3B2QA 2R00C 3KB6A 3KYJB 3FNHA 2BKAA 1H22A 1QH9A 4B7AA 1WAMA 3A0UA 4D4LA 5HSGA 1IXYA 3LPLA 2GEBA 4OQQA 1J2YA 4AG5A 1BDBA 1W73A 1G8MA 4KPGA 4S2EA 3OLXA 4KTVE 2ZXFA 4WLEA 3UKOA 3ZCQA 4C0KA 4K0KB 5DT2A 2ZBVA 5ALSA 1FP7A 1M6VA 2YY7A 1A9SA 1JKXA 2FPXA 3BXOA 2FDCA 2GYWA 2O14A 3K0AB 4YRCA 2G08A 1E1QD 4GKAA 4TYQA 1EX7A 3BMCB 3L0CA 1ZK0A 4J3FA 4TS4A 5FOUA 1M2KA 1CR1A 9GPBA 4IR7A 2RGNC 4PZAA 5KNDD 2BPOA 5FOWA 3SX4A 5HZMA 3WA7A 2C3MA 3RBAA 1FUYB 1YZLA 4N3GA 2BGLA 1EFKA 3HYNA 3GQBB 4BOYA 3Q1KA 1P9OA 2AH5A 3MCTA 1HFEL 2ZETA 4UC0A 2NPFA 3RSLA 4EX7A 4ZYYA 3F8TA 3TBHA 1C9MA 3IIMA 3OT4A 2GETA 3B2NA 2R8RA 3QNUA 1DBRA 2A2ZA 3ZD9A 1G98A 1J8VA 1QP8A 3B9RA 1ODIA 1SKYE 3ZE2B 2XT0A 2KE5A 1XZGA 1WNTA 2FMUA 3EEFA 2BRUA 2PTGA 2ZT7A 5ETJA 3ZV4A 4DCTA 1LK0A 1B0PA 2E48A 4TXLA 4KR9A 3UJHA 1D0VA 1ODTC 1PWXA 1YXMA 2V7VA 2VYVA 4YALA 3E1SA 2JZNA 4MI3A 3TIGA 1PJSA 4RTJA 1Z8FA 5L4NA 4UUMA 4XUDA 1MH9A 3LTNC 1UBMS 2VK8A 1O8BA 2MMGA 2BY4A 3KWJA 3UAXA 3OLZA 4NZYA 4O4IF 2A9OA 1IK6A 1ZRHA 3SZLA 4BMDA 5BVGA 2PXXA 3Q5GA 4GQBA 4KLZA 4M6WA 1CJBA 2W22A 2CXQA 3QBDA 2EAUA 3ANLA 3TLKA 2H1RA 3I2GA 3VVMA 1LBSA 4LMBA 3D0OA 4MRNA 2ERCA 3DOJA 2WYVA 3RSOA 4CZ2A 4KFCA 3U4GA 3P4XA 2YDXA 3N0WA 5ALIA 4KKVA 4BB0A 4J0DA 2Q5HA 1P2GA 4WASA 3HN2A 1XROA 1ZWLA 3WK5A 3QSGA 1NE7A 1S2DA 4WQMA 4JFRA 4JJFA 4EHHA 1V6CA 3IR7A 1IWOA 2ZPAA 1JEYB 3DPUA 1GSAA 3OZDA 1HYHA 3O8QB 3FRJA 4KN6A 4NOMA 1H65A 1Q0TA 1C7QA 4W5NA 1XZHA 3T9BA 1XJQA 5ALOA 2EARA 1EUCB 2XTZA 3LBHA 1ZK4A 1ZMRA 1WBBA 4E4YA 4OA8A 1MBZA 1NP6A 3WHPA 4OAQA 3I9LA 4O59O 4FI3C 4JFAA 1ETUA 4YHHB 4J7AA 2HSWA 5E38A 4I9UA 2QOEA 1QGAA 1M66A 4DLKA 1NYLA 3TEFA 1P9NA 1ZQ1A 4BHTA 1U9IA 2FX2A 4BDTA 1QP0A 3A0RB 4P0PB 3EPJA 3FWYA 2FTKE 1DOZA 2WG2A 5AVXA 1SVOA 2C4TA 4QBHA 5CT6A 3VI3B 4QFBA 4ENWA 5BMVA 4C4YA 4UE2A 5ENDA 5U9CA 1OX5A 2QENA 2ZW9A 1YU9A 5DPMA 4HS4A 5B4VA 4JMLA 5KS2A 2EL7A 4FMBB 3K0AA 1WB6A 3LWZA 4HX5A 4I1YA 5CUQA 5I51A 4DDTA 4B6SA 1RAEA 2NXNA 1YB7A 2JZCA 2Q27A 1UM9A 5AUOB 5JJIA 4LF5B 1PFUA 3L43A 5E1DA 1B76A 4FHFA 3MBIA 3NBYC 1NR7A 5K0JA 1YC2A 4C0BA 2X4LA 2VXYA 1UK9A 3HWRA 5BN3B 5LLDA 3IKLA 4GMFA 3GQBA 5IKOA 5MHTA 2HWYA 2OR3A 2UZ3A 2DLNA 4P84A 5G3YA 3FHJA 3TZLA 3QFSA 1V5EA 2ZSEA 2VWQA 4OP2A 4E5PA 1F60A 4NC9A 3IIKA 5ALNA 4ZVQA 2BBWA 1BXZA 5DOZA 1L5RA 4B3GA 3VC2A 4C6TA 3JPWA 4EO9A 1GHTA 1JHZA 1KYXA 1UWVA 4N0PA 1OSNA 2YNMA 3PA6A 2ZSDA 4PBTA 1WVMA 2OLJA 1EGAA 3FOWA 3R40A 2R7LA 3C5WP 3WIEA 3ZE9A 1JSCA 1NI3A 3CLRC 2XZDA 1DAKA 3B5JA 5CVVA 1Q84A 3PLNA 4AK9A 5A9SB 2ZUWA 4P3OA 3A6HA 4R41A 4NDZA 1NU8A 4ER0A 1NF8A 2QLJA 1PYOA 3OCXA 4J9VA 1N8KA 1UXHA 4BNMA 4BRUA 1BVYF 4URFA 1TIPA 8OHMA 1X8KA 3B9QA 3IXQA 1MH1A 1YVEI 5C4IA 3AEUB 1AM4D 2GM3A 1XAHA 3ZDXB 3G2HA 5ELLA 3WK8A 4JQZA 3SBXA 2OOKA 1QM5A 2PFGA 1LEHA 4YY3B 1E69A 5C8YA 3F4BA 3VPAA 3VNSA 2I1QA 4FYYA 3DMTC 5L7YA 3RLFA 1Z36A 2GRUA 1I7PA 3MQ4A 1G8HA 3RU3A 1XWWA 1MEJA 3ACDA 3UHOA 4HNTA 4MW6A 4M1OA 1ZI8A 3MT0A 1JEYA 4UCQA 4AZ0B 4BFTA 3OQNA 3UXHA 4R31A 4LK2A 3D6JA 4EX6A 4RJ2A 2FN4A 2G40A 2JBAB 4X7MA 2H1LA 1OBOA 4KPEC 1SXQA 3CW2A 4XFKA 3EXEB 3CQ9A 5CIWA 5CPBA 4ND6A 2QD4A 4HWKA 5D6NA 1JAXA 4RPIA 3RRFA 3M0EA 4ESVA 4OFWA 2ZRNA 1XZMA 1Y8QB 3C4QA 1W581 2G7ZA 5FTLA 1ONPA 1T1JA 3CLHA 5H0IA 4CCWA 4JASB 3CVWA 4G9BA 4UJ3A 4WINA 1HUQA 2BHSA 2F9FA 4OI1A 3IUEA 1TZCA 1R18A 1UIMA 3JV7A 3L8DA 5ALWA 3IE1A 3DAPA 2HQSA 3SYKA 2VSYA 2GPAA 5EFOA 3WNZA 5JQGA 3T1TA 3EPKA 1FDTA 1WV0A 2A0YA 3JWPA 3UJ8A 3QKUA 3NXSA 1GZ7A 1ZA2A 1TA9A 1GIAA 2ZZNA 2QAGC 5J2UB 4IIDA 4F6LA 4EF6A 5BN3A 3T9AA 2LCIA 5GV8A 2OBNA 1KSGA 2BN4A 4HTFB 2A57A 1SVMA 2J3KA 6ADHA 1Q12A 2YWJA 3E82A 1WV1A 1E6LA 3JARA 4HZUB 3OZBA 5BXQC 3SJZA 4IDDA 4MV4A 5HW0A 3C3XA 3VFDA 3H2GA 4YASA 4AZWA 1E0DA 2H29A 3V7UA 3JY6A 3NOQA 4KW7A 4OH1A 8AT1A 2DR2A 1FUUA 4PYLA 3Q40A 1PO7A 2PMBA 5KMGB 1RKBA 3RS4A 4NLLA 3G13A 3N9IA 2H8GA 4CV2A 4BFVA 1L4HA 5EKSA 2OO3A 3MJEA 3ZU3A 1ZD8A 2JVKA 2QV0A 3U39A 1UAYA 4ENPA 5DV9A 1MGPA 4OKIA 4HCJA 4UEOA 4M1KA 4YYEA 3EDQA 4F2HA 2IYYA 4L28A 4JQCA 3U6BA 1U94A 3AR5A 4ZT3A 1ZRSA 3WHKA 5H02A 4FYPA 1KS2A 2P78A 2DBRA 4J0KA 4JUIA 4DJAA 1AUQA 5A9SA 1JH9A 3RUCA 3DDHA 3PNVA 1N7JA 1RT9A 4YMHA 5LD2B 1TYDE 4TXNA 1KP3A 3T3IA 4RTKA 1BHSA 4Q39A 1JDJA 2NWQA 3DLPX 3ETLA 2AJLI 3TQIA 1PVDA 1RIIA 3OJXA 3RS2A 4ENRA 4XVCA 1OLSB 3DBLB 4MUXA 4PLTA 4DMFA 2F43B 3AEUA 4ZGWA 3ZBQA 2GCPA 1O87A 1SHUX 3I83A 1G6KA 2VHQA 5AI8A 5LB4A 2N3ZA 3U17A 1QKKA 2WWRA 3TMKA 2VJKA 3X43A 1N78A 2FW8A 5SYMA 3VR4D 2A7XA 1EX6A 1TOAA 4C7OB 2RJOA 4NV3A 4XWKA 1WMFA 4MKGA 1TEHA 4MZXA 1NYRA 2O0MA 4UNPA 5D7BA 3Q2OA 4YAOA 3VR5A 4BZPA 1JFFA 2KLBA 5DGDA 4YJ3F 5E9WA 1QE0A 1CB7A 1IJFA 5BW4A 3CX6A 3UMBA 4AZ0A 6PFKA 1R10A 1SKUA 1T9KA 1UOOA 1ZUD1 3IQWA 3D6NB 5ICEA 4D1YA 1V8ZA 1XVIA 5AKLA 2X9LA 3G8YA 3VHLB 2RARA 2WAYA 3DZFA 4CV3A 1OVGA 5D00A 2RHBA 3U4DA 2WJZB 4F9TA 5HA5A 1L4KA 1N57A 4GPD1 1EDOA 2DFKB 3EXEA 4Y1GA 3THRA 1J70A 3CU5A 2YJNA 2Y99A 3HCNA 3M6IA 4ZYWA 5K0FA 2NT3A 2Z2IA 4Q66C 4RD2A 5AVJA 3AJDA 2FVXA 2EGHA 5G40A 1LVGA 1Y8QA 3IJPA 3ZHQA 3N28A 1JYSA 1ML4A 3HXQA 5FIUA 1CULC 2H5LA 4HWSA 2FEAA 3E9YA 1NV9A 2D5LA 3IBFA 3T9FA 3WVNA 1XVLA 2DR3A 3ZCUA 5I7RA 5HZGA 1QC5B 1T5LA 4GI7A 4YP9A 3R1IA 5I8PA 1SULA 4RGBA 2QJFA 4D3XA 3MT9A 2XSZA 3RUEA 2ZK7A 4NFYA 1U7XA 3TGPA 1G7RA 4EBFA 1CEEA 1AZTA 2MTBA 4ECAA 1XEWX 5IP5A 4R3NA 3T6KA 3AF4A 5J2UA 1EI9A 2XA9A 2CUZA 4RSRA 3E3LA 5HFNA 2QJTA 2G09A 2V6FA 2FEOA 4HTFA 3NG1A 3FTEA 4XM1A 3TGWA 1MPTA 2QL9A 3VUFA 2N75A 3PB3A 5DBOA 2R84A 4HZUA 5JAZA 1N8TA 2GHQA 1CUIA 4XRGA 2B2CA 4GOLD 1VSQA 3TQOA 5KDOA 1JEJA 4YYZA 3NBKA 4HWPA 4KJXA 3NBXX 3STHA 3WQRA 3K1YA 3MLAA 1FTWA 4NJEA 5IDVA 2JDIA 3D1JA 2B25A 4XJVA 1HXHA 1O94C 2IXFA 4EHFA 5KVVA 2J85A 3ZHZA 2FMTA 3T4EA 3SHQA 3IR6A 1GXSB 2XOEA 3Q4GA 3DE6X 2Q49A 4Z4QA 1QXSA 2Z57A 3BTUA 1U5AA 5H80A 2LGJA 1ISMA 1HFJA 3GVPA 3M4ZA 4G8CA 4YMGA 3LQYA 3AZOA 5JXHA 1ZM9A 3LW8A 3HTXA 7ABPA 3WWZA 3BREA 2A1IA 1LS1A 5HX7A 5D51S 2J9RA 2Z6QA 3W9SA 3RFUA 3J81A 3GEPA 1W5BA 2OV1A 1RXYA 3HO8A 3ZCVA 3SSAA 1S4MA 3DBLA 2YXPX 1NXOA 1XLTA 2WU3A 3EHDA 4OAOA 2P0EA 3DZKA 1OJLA 2ICAA 4BQEA 3RVKA 1XTZA 3KKKA 2DULA 4W1RA 5CBPB 1K5DA 4B4OA 3EQ8A 3DXXA 5J3JA 2GI4A 2WI8A 4CKZA 5EIXA 4C7OA 3FYUA 4O4IB 3B1JA 1Y48E 4YRJA 4WXRA 5CVDA 1P7WA 2V7TA 5JWRA 4PGGA 3T3NA 2X40A 5AI5A 2EJUA 3I5UA 1AX9A 4HPXB 1OROA 4LY9A 4PZDA 1SD1A 2CYAA 2IF2A 2YV5A 4K81B 3U31A 5F3DA 3GH3A 3M9WA 2P40A 1QBGA 4ZOQI 3Q8KA 5I7UA 4HD8A 4IIVA 4P1ZA 1R5BA 4N3BA 1EFPB 1I2MA 3CX8A 5H1YA 3OD5A 2UVPA 1YS1X 1VMIA 3CE9A 3GFBA 4G81A 3W8FA 3BXHA 3WL8A 1QCYA 4EJFA 4ZJYA 5K8JB 4C7JA 2QRZA 4DG9A 1GGEA 2XB6A 2Q8QA 2HU5A 3REOA 5C52B 1UZNA 1WP4A 2XNCA 2VOEA 4OLAA 2N1BA 1DL5A 1NVXQ 3U61B 1JJVA 2BFWA 5C7YA 1E1KA 4AJNA 4PSUA 5J4LA 1K5PA 5H8WA 4BXOB 4HRAA 1QC5A 2QMHA 3B52X 3HQ4O 3UK7A 3GJ6A 3AILA 3TRFA 2YQZA 3EOAI 5DNEA 5EJ7A 2YZNA 2Z58A 5KPDA 2BI8A 1RZUA 3SDBA 3UPTA 4ZHQB 4LXTA 2ZIVB 3WLAA 1GRQA 1VJCA 2I2CA 1P4RA 2P2DA 2YFKA 3Q2KA 1OFIA 3TLGB 3KQSA 4P34A 2JD2A 2H16A 5AKZA 3TVDA 1E64A 1VCIA 5ALVA 2EZ8A 4LXXA 3WGJA 4CKWB 3U60B 2ZJZA 3PT5A 4FD2A 2IGBA 4GQAA 1CW2B 4DG8A 3BD7A 3K20A 1XTVA 5IULC 1TC1A 5BOVA 3O8OB 1XO1A 3BK1A 3DAYA 3KT6A 3LP6A 1EYZA 5CW1A 5SY4A 3KB1A 1ZCFA 4Z8YA 4S1PA 4Q15A 1A8UA 3K8QA 1YGYA 5GONF 4J6EA 4JC4A 1U0SY 3BILA 2G63A 1FJGB 1EG2A 1V3VA 4HXEB 4S0ZA 2FQWA 2EF1A 3U3RA 2ZJBA 3LUKA 3BD6A 4CTNA 1GXSA 3EULA 3IV9A 3JYLA 1NW4A 3PNQA 1KC3A 1CDDA 1FS4A 4HUTA 1SUBA 3RYIB 4EVQA 3DTYA 4FCVA 4PCLA 5JEDA 3GFFA 4A03A 2G9RA 1E3QA 2OAP1 3ROMA 2CNLA 1S9DA 2HU7A 4GEGA 5LDDC 1E77A 1MMFB 3G2KA 2OV3A 1SU8A 4GZ5A 1EGMB 2FCRA 1VKZA 4F5WA 1K4KA 5ICCA 4LHZA 1KYZA 3MD0A 3REFA 3CRRA 2LXNA 1NHWA 4RY0A 3ROQA 2R47A 1U7TA 3GBPA 1J6UA 4Q4JB 3QFHA 1JHDA 5E0KB 1KI1A 2I1LA 2ZWAA 4ZQIA 3TRDA 2HDOA 5CDSA 2Q0QA 3NH9A 1I6MA 1SXJC 3TN7A 5CBPA 1DSSG 2L17A 2YICA 2BVNA 1ZRNA 3QUQA 5IWAB 1W36D 4MQ4A 1Q1QA 4O4IA 1KI9A 1SUAA 1P3DA 1P1FA 2BR4A 1AKQA 4NWIA 4LZZA 3B12A 3C1TA 1G41A 4KSYA 4UNIA 5THQA 1EFCA 4L76A 1SXHA 1VIVA 4CLEA 4M8IA 3UWMA 4Y2GA 1DLIA 3EE6A 3L8ZA 1GU1A 1Z7BA 3RSGA 4BFLA 3DL2A 3K9WA 4BU0A 1EFPA 3FNIA 3OEWA 3PQ2A 3W3AD 1N0WA 3A4MA 3OJCA 4L85A 3DLCA 4D3YA 2QTLA 1EVJA 5FWXB 5CW2A 1UBNA 2DZDA 2CLKB 3FPBA 4KRFA 4FIDA 3TAUA 1QKJA 1LSUA 4R3WA 1L8AA 1DVRA 2QRHA 1F8UA 1ZVJA 5A2QA 2PPVA 2HPAA 4MQEB 2SCUB 5DW0A 4R71A 4LJSA 2GXAA 3TL2A 3NYQA 3A3KA 4CF5A 4BXOA 1E79A 4PYNA 2BEUB 3O03A 4FHEA 4N47A 3TFQA 4OQDA 5K2OA 4KL8S 2ZRHA 4FGWA 2OSVA 4FONA 1UQRA 4KR0A 4ZHQA 2P77A 3OHSX 3TLGA 2CL0X 5KOJB 4OJQA 4X3PA 2OZKA 1SCUB 4EGSA 4E70A 4GMKA 4NULA 1GYQA 4BO7A 4DZTA 2HTFA 4C6HA 2ZZMA 1ODLA 3QMVA 4FFOA 1J97A 1JEQA 3O8OA 4I81A 3ST7A 3WGGA 3I1YA 3ZXIA 1OAKA 2V3VA 3O90A 2IXDA 1T6BY 4QBIA 2XOKD 2H08A 1BA2A 4B40A 1H1DA 1XVTA 3DDUA 4P22A 2DYKA 1OCEA 5FR1A 1RJEA 4BC0A 2OORA 2WT9A 4NNJA 5JU6A 1HTBA 2WIJA 4Y2HA 4XOUA 4KGXA 4UQOA 3URKA 3RYIA 5L9AA 1QIDA 5KHAA 1E7QA 2V98A 4EHIA 5EHNA 2W98A 2Q29A 2Q8NA 3N75A 1NN3A 1JG6A 1KI3A 3WG9A 2IKQA 1SIBE 2R66A 4LSMA 2O7VA 4V2UA 4QGFA 4EFLA 1QCZA 1SPXA 5JYEA 1ZKMA 1XU7A 1QHNA 3G85A 2Y6VA 2EKPA 3H18A 3R3SA 1Y4UA 1XOIA 1BKYA 1DE0A 2WJPA 3PUWA 3L8YA 4PYIA 4Q4JA 1B6SA 2BOVA 1Z8HA 3QMPA 4KVGA 5AHKA 4ZV4A 3ZZTA 2F3UA 1E94E 3UOWA 3TNJA 3ER6A 3WQBA 3J80A 3UAVA 5DNWA 4D8VA 2R7AA 4FTWA 4BFSA 1G8JA 3L01A 4JI6B 1Z38A 3S2YA 4Q4AB 3LPCA 3ZW9A 1E62A 1HZZC 1E9CA 3O91A 4GT1A 2PGNA 3GGCA 1N3BA 4U7JA 1LJ8A 1D2AA 1NPYA 2Q1YA 3OHPA 3V2HA 2Z2ZA 5JNTA 2XMZA 4YP5A 4JVLA 4BLSA 4FM9A 4L8YA 3AFNA 2OQRA 3IVCA 3ZHYA 4DM7A 1PGQA 4IJQA 2AYYA 3H3FA 1TQ8A 2P2CA 1I2BA 1RYMA 3WZMA 3U80A 5FWXA 1GYPA 3I05A 3QFFA 3STYA 4X93A 1OMOA 2EX1A 4JWTA 2WJ3A 2WFLB 3KSAC 4HMOA 3DL0A 2SCUA 3ZLVA 1CS0A 1IH8A 3AO0B 5CLFA 5LOVF 2PUVA 2BEUA 2I4TA 4FWBA 2B0CA 1T9AA 3JQCA 4F5EA 5KYYB 4R1LA 1K6XA 3MJDA 2FZ4A 1QH0A 4K03A 1I7LA 2R6GA 1LLQA 1N5LA 1DKPA 1CDOA 4XX0B 4BUJA 4RZ3A 2I87A 2GD1O 5GOTA 3BSWA 4BNZA 5LQCA 3PFIA 3ZZ0A 1T0HB 1O0CA 3QE3A 1FW8A 4G9EA 3AK4A 4EHNA 3G49A 4RL6A 5M3BA 3W5UA 4D4HA 1Q11A 4HLNA 1RLMA 1EH5A 2FJPA 2P2ZA 1G2PA 1WW8A 4EY7A 1KBZA 4JZYA 4D56A 3IURA 3GCZA 1M1NB 1T2NA 2A5FA 3K5HA 3OIFA 3DDWA 2JFPA 1Z9BA 1YHZA 4RV4A 5HHTA 1FPMA 4UD6A 4RK4A 1P8JA 2YN4A 2I03A 4KYVA 4ZOAA 3S4YA 4Y6SA 2Y05A 2VP4A 2Z98A 1IY8A 3T7CA 1EVEA 1RYZA 2IHYA 5AJYA 3MA0A 4OBXA 5DWQA 4KYTA 2PSHA 1NIJA 1EXMA 2GZSA 2WT8A 2I6QA 3CY6A 2PX8A 2HZ7A 3ITEA 3D3WB 4LI3X 5TARA 1EXDA 2GX6A 2JKYA 4O2BB 2HB6A 1DBIA 2O52A 2WKQA 4EEKA 1THGA 1H6BA 1FRQA 4B3JA 2R751 4C0WA 1EUDB 1OBHA 3LPAA 1K08A 5BSGA 1R0ZA 1RWBA 3HFSA 1HDOA 2PO7A 3FNEA 4YV7A 3W5JA 2XVYA 1AIPA 1V7PC 4YBZA 2DTXA 4N01A 3VKGA 5DM1A 3ICVA 1QLWA 1BFKA 4N5MA 4BNHA 1EWYA 1RI5A 3BFPA 2X0NA 5ALQA 5FDFA 1IXZA 4RMHA 4RTOA 2F67A 4RVCA 5FUBA 2ODNA 1DEOA 3KQYA 3GMTA 5IH7A 1F7VA 1I51A 1XJ5A 2R1TA 3VUEA 1WVGA 1AZLA 2AV6A 2H0AA 4CL0A 4UTNA 2L19A 2YWGA 4MB2A 2GF9A 1TLFA 4BQOA 1J0XO 4W7SA 1ULAA 1MO2A 5CRIA 1LNQA 3P0EA 5MN5A 1L8OA 4PSKA 3ILHA 3RIEA 2JJ1A 1U3TA 2Y1FA 3E2MA 3GRZA 4HFJA 4PCVA 3HA7A 1P0FA 3T15A 4TKZA 1T8YA 5AUNB 3NHPA 7ADHA 4DSAA 4MINA 3ZCRA 1JUDA 1OOEA 1E2LA 4HAIA 3A3NA 4KQGA 3RS5A 1N0VC 4B4DA 2G9VA 2YVAA 5EZSA 4F11A 3OKAA 4Z53A 1WEKA 2G76A 5CEJA 2JZOA 2J33A 4WNAB 1QWSA 1V48A 4FP9A 2QDXA 3KALA 4IEEA 1F6DA 3COZA 4PHHA 4E1VA 2P91A 4EI8A 4NCAA 1KMMA 5EE9A 5KYYA 1E9BA 2PY6A 3B3AA 3A1UA 1MVLA 3EMVA 2CMKA 3AYZB 1J1UA 4RLFA 4HAVA 2RJ3A 4XX0A 3VZSA 3KBOA 3VOSA 4QLOA 1Q3TA 4ZA2A 1OU0A 3N0RA 3IUJA 3GLUA 3ABZA 2EFJA 3BICA 3LCCA 3FHOA 4Z4EA 2HCTA 4NZPA 1G20E 2AR7A 2YOFA 4PO8A 3VYWA 4B6QA 2BFDA 3SIWA 3RWOA 1E3EA 1YO6A 4WKCA 1M1NA 4CNBA 5HRAA 4AJPA 5ILOA 1CNFA 4LN1A 1CBUA 3EUFA 1E96A 4WXPA 3RAJA 1Z5VA 3P9IA 1XDSA 4PFJA 2HA5A 1XN4A 3BYZA 5CEFA 2VCEA 3ITKA 4LF9B 4JH0A 4RA6B 2AJDA 4Z3OA 4OLFA 1GCUA 2Y93A 1FDSA 2FPWA 2MJLA 3MJCA 4KPUB 1MAUA 4KSCA 1O08A 1R12A 3ECAA 1EB8A 2XUIA 1QQ5A 3D3WA 3FR8A 3AWDA 3IAS6 3HN7A 3RVRA 3ER8A 4O2BA 4JU9A 4GM0A 4M37A 5KNDH 4JDPA 4BCCA 3OF3A 2RE8A 1D7OA 5ECGC 2FWJA 4F96A 2FFRA 3HBFA 4LMPA 2Z1DA 5LCXA 1RM5A 1QIGA 1EUDA 3MSCA 2HPZA 3PFHA 1N3IA 2BF7A 2C00A 2FR8C 5GONB 2AFHE 3EAGA 4BNKA 4FYJA 1Z39A 4HQ6A 1EXNA 4F0JA 5IXJA 2CJYA 2F48A 3AKYA 1E6WA 2O2YA 1AD2A 2IU0A 1EHCA 1ABEA 4D80A 5A0VA 1DRJA 2PUTA 1T8SA 1ZEMA 5GP1A 2DY1A 2GAIA 2XUAA 2ZWOA 3ICCA 3OZUA 1PEAA 2V45A 2JGNA 2R60A 5H5JA 2O07A 3PQ7A 1V39A 3G9ZA 3JYQA 5IJWA 3EFOB 1VOTA 5AP9A 3CUYA 2I1VB 3OLWA 3PNLA 4PHFA 1SA0B 1PL7A 4FS8A 4LDZA 4P3XA 4A1FA 2XIJA 2AW5A 2EEPA 2X2EA 1UJNA 1A96A 4DCPA 1WO8A 1JPUA 3DB1A 3GA5A 4KIUA 5B58C 3NRJA 3VISA 5ELMA 3PLAE 4ARVA 3W6PA 3AHGA 5IHPA 3RKSA 3DKVA 3E2PA 3I9OA 1ML3A 2G4VA 2PSSA 2VH5R 4B0PA 5A1JA 5AD1A 2QY6A 3VVCA 5GJBA 1DUVG 5LUAA 2NUAB 3OEYA 1OLOA 2GEJA 3OUZA 3VYVA 4EG4A 5F23A 2GAOA 3KKZA 4RAOA 5IVPA 3CRMA 1RJFA 2GAFA 2P2YA 4TWZA 4YHBA 2ZROA 2P7IA 2D2IA 3UXMA 4XD7D 1XX6A 1WDMA 2IZZA 1WCYA 1XPJA 3F0TA 5EXEA 4D9BA 4TLDA 4I8DA 1Z62A 2J6BA 2FSVA 3FKJA 3SEQA 1IYZA 3F4KA 3VZPA 3WWDA 4BLUA 4UOZA 3OU2A 4FJ2A 5K20A 4DM3A 3V7FA 4G1BA 1P7ZA 1UK8A 3SM9A 1NBHA 2OGTA 2Z4SA 4FYMA 4NEQA 4C43A 2ZZKA 2XNJA 4BY9E 2PZJA 1Y5MA 2A78A 2ZUTA 2PU5A 2FV8A 1PRYA 4S1TA 5A0FA 2OCLA 3OX3A 4DUGD 2QXYA 3SE7A 2H2DA 1JEEA 2VXCA 2QXTA 3C3DA 4XB2A 3TTVA 3C1OA 2QUAA 4GPZA 4Z4IA 2EQAA 4ZC1A 4IHKA 4DA9A 3H4TA 1QH8A 4KQIA 4RA6A 4XA8A 5IMSA 3GR6A 1BVUA 3D5QA 1KFJB 3ZXUB 3VVLA 4EB6B 4KQ9A 1UDCA 4KPUA 1G20B 1ECCA 4KLNA 3HZOA 2K5UA 4PRKA 3U4QB 4Y2VA 5J1SB 3GP3A 4YQFA 4X6YA 4XQ0A 3CEAA 5BY2A 1ZZEA 2X4IA 3JQPA 3PXCX 3RE1A 1QUEA 2ZR8A 3AP3A 2YYSA 2XWPA 1X8XA 4L02A 2FZWA 3EGEA 1ZR4A 3HUEA 1GKKA 1UT5A 2BFNA 3CRZA 2RGUA 1UK6A 1Z33A 1Y1KE 4HVAA 4KMOA 1YA8A 2GPSA 3AW8A 4L07A 3SF0A 5KNBD 3SVLA 3A05A 1E2HA 1QQ6A 1ZOOA 2ERYA 1GVHA 3GCDA 1TM5E 3ELWA 1SA0A 3OZSA 1ZM2A 1ZC4A 3EXIA 2AFHB 3HUUA 4H31A 4AN1A 3FMOB 4CHTA 2J67A 3T5TA 4UMFA 2FPUA 3P4UA 4UDOA 3VPDA 4HJRA 2VXBA 2O3TA 4H4DA 5CDUA 5ICSA 5IVHA 3DG9A 5B57C 4F4JA 2JLWA 1SXPA 1S02A 2AZMA 2WDPA 3Q8XB 4J2HA 3H0CA 1RVV1 5FPKA 1PDVA 3G0GA 4DYHA 3UWPA 4JYBA 3VC7A 2NUAA 2W0SA 3E9DA 2BI7A 3W2FA 5A62A 4YMUA 3NC0C 4C6SA 2PZEA 3QVVA 1AT1A 4GZMA 3D6HA 4G5FA 1HZJA 3OICA 3HK2A 1VG8A 1N2IA 3GPIA 4NEHB 5BWMA 1IIBA 1CE8A 4RKQA 5FFFA 2CSXA 4KTTE 4KDEA 2FU5C 3KM0A 4LSGA 4K9OA 3THXB 1F8FA 1PWZA 1YRAA 2VH1A 1EFHA 3PXEA 4A16A 2R1UA 1DZ3A 4LRYA 3TZHA 3WRWA 4MAAA 3R0VA 3MMZA 2GCIA 2OP0A 1LDMA 3REQB 3FHCB 2BKLA 1V0JA 2XXBA 1P6QA 3MSXA 3MOGA 5IXSA 3I30X 3TGLA 1V1MA 2NV2B 4OQEA 4EHDA 2FR0A 3NKLA 3FCYA 4OLHA 4CIDA 2CHQA 5AW6A 5C35A 5F77A 5ULLA 3RRYA 1OT3A 3GLGE 3ZVKA 1W47A 2R4TA 1MAWA 2ZS9A 3B13B 3GZNB 2ZT6A 4Q3LA 3SXUB 4B48A 3JQBA 4MOWA 3B6EA 3MOIA 1QHHB 2IQIA 1P6UA 2F64A 5A7HA 2VDRB 1QQBA 4L3WA 5A5VA 1IEXA 2WMNB 3CH4B 2PL9A 3B9BA 1X1QA 1Q1NA 1FFEA 4J43A 5TPZA 3KLBA 1BOOA 1R5OA 1UXGA 3I64A 1RLOA 3UJ9A 4CBVA 1QJCA 5TMPA 5BPFA 1ISGA 3G0OA 4HQNA 4E2WA 1GQSA 2B2XA 2YXLA 1RQPA 3I72A 1N34B 4LYHA 4EB6A 3CF0A 2MSWA 1DKNA 3WZLA 1G20A 1AQJA 2BFBB 1L0BA 4P81A 2CLHB 2ZE8A 4MTLA 3WLIA 4N18A 4D57A 3U4QA 4DT1B 4NFHA 5BRAA 4QOFA 1NMZA 4GRIA 5M2QA 2OCXA 1EBFA 3ZHXA 2BEKA 5ERXA 1Y7IA 3OPYI 3B8HA 1EWVA 4TWAA 3AY0A 4NZOA 4NZ9A 4AJ2A 3O7MA 2PLRA 2QT9A 1T24A 3ESRA 3DFIA 2CMGA 3DT9A 4GMHA 4FGSA 1R0CA 1ZMXA 3W9BA 2A5JA 5C4MA 5LQDA 1CU1A 1R8XA 3TLAA 1WXIA 5B37A 4P4LA 4WZBE 4LJ8A 4OHXA 4AYTA 1AH2A 1OFUA 3KV3O 5G0WA 4IIEA 1RXUA 5EWJB 3IIEA 1SUWA 5D5QA 4D3FA 4Z51A 3H2JA 3VH1A 4LJ5A 2H11A 2P8JA 1NPTO 2QP9X 2Z3WA 4FX2A 1ADFA 1P17A 2AFHA 2NTYC 2QSJA 1YAHA 5A4JA 4HGPA 3CPSA 4Q21A 1MC5A 3SKVA 4D4MA 1HNXB 5FUXA 3AR7A 4TTSA 4EJMA 4QWMA 3ZWYA 3W1VA 2IYQA 2R65A 2HI0A 3SQWA 4UTVA 3HS3A 1L1FA 4UNRA 1S3SA 2F3PA 1PJQA 1T8PA 1TA4A 2PZKA 1PT8A 3PGXA 1J2JA 4QJ4A 4FLMA 3BGIA 1NUSA 4QC2A 4RACA 3GUYA 4C1BA 1QZTA 2C83A 5D5HA 3TOCA 4LXHA 4Z86A 4XWAA 3RS3A 3NIDB 1NQWA 3TKYA 4DXHA 5A4MS 3HJBA 4WSOA 3O8CA 3D7NA 3VRHA 3U56A 3R3HA 1NF9A 5AW3A 4GECA 4G5OA 3RG2A 2HMTA 3EEIA 4P2GA 4HDKB 1P77A 3KOZA 1J2UA 1H3EA 3REQA 3UJCA 2VPIA 3FMVA 4BKPA 1DQNA 3P2YA 4K7JA 5K5EA 3W5IA 2OB1A 1C30B 3NTUA 3BOSA 1FX0A 3O38A 2VHCA 4XSVA 4HQKA 3ZH9B 2GDJA 3KJEA 3D5EA 3WTCA 1LPSA 1BGXT 1MC1A 3JSAA 3C5EA 2N0SA 5JS7A 2G5GX 4AP9A 3P2KA 3SXUA 3VHQA 3E61A 3CUKA 1QHHA 4JY7A 4E5UA 1GTJ1 3OBBA 2NAFA 5HNKA 5EYPA 1BMFD 2OPHA 2GZDA 4KO1S 1RJDA 3QW2A 2E0IA 2J48A 4ZCMA 2HCRA 1FRVA 4CIAA 3GLGB 3E7XA 2RGRA 3EQ6A 1KR5A 1P4GA 4R3UC 3TLZA 2AHOA 3R7WB 3SZMA 3UGTA 2BD0A 2Q1WA 1GTMA 2EWVA 4DT1A 1GSHA 3G2QA 5ERGB 1W1IA 3CB2A 3A8TA 2R6HA 1UBTS 3JWGA 4ZO4A 1PUJA 2EW1A 2CXXA 3NBQA 4HLUC 4PPFA 2PUJA 4LYAA 4UULA 3SYMA 5B2ZA 4GICA 2OCIA 3FWNA 2GPJA 2GLUA 2H2WA 3L49A 4RWEA 4FYVA 2VBCA 1G5PA 4BLPA 3M6MD 1CQWA 1U3UA 4R2WA 1U1CA 4CQMB 1XQWA 1TQHA 4MZDA 4X20A 1QGUB 1UMCB 4KRYA 4ER5A 2BFAA 5DRYA 5EWJA 4NBTA 1XTRA 2Y1GA 4WOPA 1OPRA 1RPZA 2OZEA 4ZI2A 2HJVA 2H4HA 4INJA 3DYVA 1KJIA 3P2EA 3QOXA 4HLQB 1GZ5A 1M0WA 3FOAA 1Q0PA 1DBQA 3Q9LA 4J16A 4WLVA 5KSPA 4E32A 1PR4A 1PFVA 2WTBA 4G0MA 2VDLB 1OI4A 3QEMB 4YJFA 4BVHA 2G4CA 1PGJA 3K1JA 3L7AA 3EGVA 4IIJF 3EPRA 1VLQA 1PG2A 2H48A 5L45A 1P0MA 2V5AA 1SG0A 4ZQHA 4LYGA 2GSWA 1KJNA 2TMGA 3IA7A 3O8RA 1R66A 4HRVA 1YQGA 2RKBA 3GOHA 1X7YB 2PX5A 4XYEA 1TL7C 4K86A 1FQKA 2I5PO 2NYVA 4P0TA 1I30A 3Q9SA 5DISB 5IS2A 3B1YA 3P27A 3QLVA 3EF1A 1H8HA 2L18A 3BK7A 1CY4A 3IPAA 3KOMA 4XJSA 5ED0A 3WWYA 2C03A 4D92A 1MZVA 1YKGA 3JZIA 1JQ5A 1G9XA 4U7GA 5FA6A 4FGJA 4Q9NA 4RULA 4TV8B 1M5UA 2JJ2D 3G2PA 3OZIA 1VP9A 3FSGA 1VE1A 1D9ZA 3QEAZ 4CMGA 2C5SA 3EZ7A 2HGSA 2CLCX 4B2YA 2G72A 3OQJA 5G41A 2OM2A 3O75A 4BTVA 5FWNA 4Q1BA 4BFYA 4I9GA 5IK2D 1C30A 5JFTA 4BAZA 4DV7B 3JZAA 1LB1B 1MB3A 3D6TB 4D97A 1CFZA 5KTTA 2D13A 1Y82A 5AM0A 3BZBA 4MS1B 3QVXA 2R0QC 2VP6A 4WK2B 1ACLA 4C5CA 3GZJA 3SQDA 3A9UA 2GB4A 5L3ZA 4CPDA 4B3RB 1YI1A 1YS2X 1DELA 2CSUA 1X42A 2FWRA 2XADA 3QM1A 1CZKA 1WMAA 2ZUVA 2FPOA 3UCFA 3AZPA 3U37A 3BA1A 3DTVB 3KZXA 5L95A 1LNSA 5A05A 3RS7A 2QD2A 4CIBA 1W8DA 2P9QA 1DEHA 1ZESA 5J40A 5I9IA 3IP5A 3EGWA 4BQRA 3GLGA 4JLAA 4CLDA 4B4WA 4V1CB 1XD2B 1UCFA 5H68A 4KQXA 1YFJA 3H1AA 5D5PA 3CHYA 5KOYA 2PUFA 3C3PA 2R96A 1AUOA 4CM8B