3D2CA

Structure of 4d3, a thermostable mutant of bacillus subtilis lipase obtained through directed evolution
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
179
structure length
179
Chain Sequence
HNPVVMVHGIGGSSSNFEGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKYLDGGNKVANVVTLGGANRLTTDKAPPGTDPNQKILYTSIYSSDDMIVMNYLSRLDGARNVQIHGVGHMGLLYSSQVYSLIKEGLNGGGQNTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Thermostable Bacillus subtilis lipases: in vitro evolution and structural insight
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Lipase
total genus 72
structure length 179
sequence length 179
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2008-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3d2cA00
3LLCA 3SC2A 4M0EA 4UPDA 3OTQA 2K2QB 2AJ8A 1IUNA 3UMJA 4G4IA 2FX5A 5HKAA 4QA9A 4YK7A 3HC7A 3DL7A 5ALUA 2XUJA 4LYEA 2O7RA 4J0IA 1XRNA 4N5IX 2V9ZA 3WKCA 1H2XA 3QYJA 1XLVA 2W6CX 4OB8A 1GXSA 2J4CA 3ANSA 4BDTA 2XUQA 5ALJA 3O9VA 2J4FA 5EGNA 3FOBA 1WOMA 1CUBA 4KAFA 1KEZA 3G9ZA 5JAOA 1G42A 1MNQA 4OU4A 3QPDA 2PUHA 3HZOA 2WUGA 5ALVA 2HM7A 1JJBA 3DKKA 3FVRA 3VVMA 4BVJA 1BEZA 1UKBA 3H2JA 2HADA 2VEOA 4H18A 3EIOA 4Y2VA 3T4UA 1XRQA 3RLIA 1QOZA 5CMLA 4AN0A 1DX6A 1EXWA 3GBSA 4CCWA 3DNMA 2PSJA 5AICA 3O4GA 4CG2A 1R9NA 1U65A 1CR6A 4BAZA 3W2TA 1DWQA 4TGLA 5CW2A 5EHZA 2DR0A 3IUQA 4L0CA 5FPQA 4UHCA 1CUEA 1XROA 2HRQA 1Y7HA 3C70A 4ZI5A 3DKRA 3G0BA 2HL6A 3D3NA 1VKHA 4INZA 2WJ4A 2QJRA 1VXOA 1R3DA 3VKFA 1QTRA 2Y2UA 3MVEA 4U2CA 5AK6A 1B6GA 2JEYA 2WHPB 3KWFA 2WG2A 4I4CA 4K6KA 3TEJA 1XZFA 2AJDA 4HAIA 1XZBA 3F98A 2OAGA 3W9BA 2RI6A 4BAGA 2CB9A 2XQKA 1S8OA 1HPLA 4BCBA 2BGNA 4P92A 3K9BA 3ZLVA 2R8BA 1CVLA 4FNMA 5AO9A 5FP0A 4KJXA 4J0CA 5DWDA 4FFWA 1YA8A 4Y2YA 5HFNA 3CCCA 2I3ZA 1DU4A 1ZJ5A 4X6XA 3IUMA 4U2BA 2WIJA 4A5SA 5K3AA 1J1IA 5LKRA 3D4LA 1UFOA 2ES4A 1RWQA 4H77A 2JGKA 4ZRDA 2PSHA 4CIAA 4C89A 4J0HA 1PFQA 1R88A 3ZI7A 2OLEA 4LXHA 1MTZA 3G7NA 4BC0A 1N5RA 6YASA 4LHEA 4L72A 2AJLI 2PU5A 1QZ3A 1T4MA 2QR5A 2PSDA 4G5XA 4WFIA 1CUGA 3RM3A 3TJMA 3IURA 4UHHA 4FWBA 5CT5A 5A71A 1W1IA 1NU8A 1RYYA 5A7FA 1BN6A 4OCZA 4F60A 4Q3LA 1LPAB 2ONCA 3CXUA 4FTWA 4QE3A 3U1TA 3D7RA 3F97A 4J7AA 1LPNA 2DQYA 4CCYA 4U2FA 1CUJA 4ZV7A 4OYLA 5IVDA 1XZIA 3VJMA 2QM0A 4IH9A 1BN7A 1W4LA 3FLAA 1EB8A 3R41A 3JYHA 3Q0TA 2X5XA 4E11A 2ZYSA 1BS9A 1JMYA 4HZGA 1CQZA 5A62A 1GQRA 1BU8A 1EVEA 5K3FA 2XMDA 4Y2XA 1L7QA 2OG1A 2BGRA 4P08A 5FOQA 5JD5A 3FCYA 2OQIA 3WYNA 3HACA 3FSGD 5AM0A 2Z8XA 2V97A 5DTJA 1VA4A 2OGSA 1XZKA 4B80A 4C87A 3BJRA 1VE7A 4X3CA 2GYVA 3K6KA 2OGTA 1CUHA 5YASA 1ORVA 3JWEA 3HJUA 2ZYIA 1LPSA 4FDMA 5BWBA 5HF9A 3OG9A 5AOAA 4WFJA 3QVMA 2HFJA 1UOPA 5IVHA 5I9IA 4M0FA 2XI4A 2OXEA 4BC1A 4KE6A 3C6BA 4BE4A 2ZYRA 2H7XA 5ALSA 3M3DA 4EY5A 5JATA 4GLBA 5ALOA 5HK9A 1J2EA 1R4ZA 3H18A 3VJKA 4RGYA 2XUOA 1EX9A 2VSQA 3VJLA 5AOBA 2WFZA 4DSZA 2O2GA 5JALA 1YS2X 1SCQA 3QM1A 4Y2JA 3IULA 2ZJFA 3OC0A 4MXDA 2ZSHA 2XUAA 4BDSA 1X70A 1L7AA 2XUFA 2Y2VA 1GT6A 3G8YA 4CG1A 2UZ0A 4DMHA 4MYSA 1MU0A 1A8SA 3DDUA 1EDBA 3D59A 5JARA 3EQ8A 1DWPA 3E1GA 4LXGA 1HLGA 1AC5A 3WLAA 4EBBA 2IX9A 2OAEA 2WIFA 1WHTA 3QMWA 5FPPA 4C4XA 3VVLA 1IUPA 1CUZA 1XZMA 1K63A 3C5VA 4QEKA 2WIDA 2GBCA 5ALGA 1ZI9A 4OU5A 1ZD3A 4PQEA 3A70A 3WK8A 3DL4A 1PV1A 3O0DA 2BJHA 1X2BA 4B82A 5K3FB 1ZOIA 3R40A 3M83A 2OCKA 3ZV7A 1OCEA 3AIOA 4BTLA 1EVQA 3IUNA 1G66A 4W1RA 2QRUA 3C6ZA 2DFPA 4MWTA 1F6WA 4RNCA 1F0NA 4G8BA 3JW8A 2I03A 2PU7A 1ACLA 3LIPA 3BF8A 4KYVA 1QIJA 3V1LA 3IUJA 4MEBA 4H7FA 4BBZA 4WJLA 4C4ZA 4ZV9A 1YCDA 3V1NA 1EK2A 4FBMA 3GA7A 1XQXA 2BUCA 2ORYA 5ALWA 2RAUA 4OYYA 5AH0A 2XUPA 3CCBA 3R0VA 1L7RA 3WJ2A 2WFMA 4A23A 3LCRA 3FVTA 4X85A 2EDAA 1YASA 1TCAA 1EA5A 5A7GA 5LZ7A 4FMPA 3S8YA 2G5TA 1KU6A 2FUKA 5EHNA 3ESBA 1QIDA 2NW6A 5ALXA 4S0XA 4HXEB 1R50A 3DQZA 3GUUA 1EINA 3PE6A 1UK9A 4H7DA 5AKZA 2QUBA 3C6XA 2XE4A 4JH0A 2HA4A 4QLAA 5DNUA 4Q34A 1XZEA 3WIBA 3D2AA 3SK0A 4FLFA 2JGJA 2Z8ZA 4HTAA 5C7YA 1QE3A 4G8DA 5FUMA 1BCRA 1HL7A 1U8EA 1R9MA 2O2IA 4Y9SA 4ZREA 3KOOA 5HFAA 3WZLA 4FLMA 2WSLA 5IKXA 4GEGA 3OM8A 5HQ3A 4X00A 2XMBA 1EK1A 2I3DA 4W1QA 4CI9A 5AKGA 4N8EA 1K4YA 3ILSA 1E66A 4KAAA 3K2IA 1IMJA 2CKMA 3ZLTA 3WZMA 2WJ6A 4PW0A 3EQ9A 5T4EA 2XQGA 3F67A 1M33A 3IB3A 4HRXA 2XT0A 2RHTA 3IDAA 1JU4A 3H2GA 5A2GA 5IVIA 2OCIA 2JBWA 5JASA 4O08A 3BJMA 3Q8WA 2FJPA 3NGMA 4B0PA 1WB4A 3DOHA 1GPNA 3LS2A 5CH3A 1AKNA 2WUDA 4PO3X 4WCVA 4H7IA 4EUSA 1VOTA 5I7UA 5A6VA 3L1HA 4DGQA 1FFDA 4HXGA 4AZ0A 4WY5A 4KAJA 5AKIA 5IVKA 4F5ZA 4DMKA 2Y6UA 4G9GA 3OPMA 3DD5A 1A8QA 4W63A 1QFMA 4FKBA 2EDCA 4N8SA 5CURA 4LYDA 1JU3A 1MNAA 1BRTA 1CUIA 5JANA 2QTBA 5ISMA 1T2NA 5ALHA 5FKJA 2HA2A 3AINA 3PUIA 4AO7A 2RONA 1QGED 2X76A 4UUQA 1AGYA 4B84A 1UK7A 1TCBA 2XQJA 1QIKA 4X91A 1W6RA 3PF8A 1CV2A 1XQYA 1DTEA 2C58A 5D7BA 4TPKA 4RE5A 3C43A 5K3EA 1BE0A 3H2IA 4FHZA 3RKSA 5DNWA 1MX1A 4H7KA 3G0DA 3M82A 3KDAA 4AZ3A 3STYA 5AKKA 2WG1A 2D0DA 1ZI6A 5HQ3B 3EBLA 3FSGA 3FWHA 3NWOA 3V1MA 4MEAA 1W76A 2HA0A 1Z68A 3MGAA 4K6HA 2EEPA 1E8MA 4QWWA 5CT6A 4XJVA 5K5EA 3V48A 5I8PA 1XRMA 4GXNA 2DHCA 2GZSA 2XQFA 3WK9A 4Y2TA 3F8SA 4C01A 1XRLA 1A7UA 1CEXA 3BE8A 2C7BA 2H7YA 5AI6A 2DCMA 1THGA 5BWCA 4I19A 4Y2SA 3STUA 1LZKA 4MQLA 4B9EA 3NOXA 2JF0A 4UFPA 5C8XA 3A2NA 4LIPD 4H35A 1SFRA 3B12A 4CIBA 4KE9A 2B61A 5HF5A 4IH1A 5D6OA 1BEEA 2XMSA 3E4DA 3I2IA 1CUWA 3AZPA 1EI9A 1W52X 3WJ1A 1ZD5A 5CRIA 2CEKA 1QIHA 1LGYA 3FCXA 3AJAA 3I1IA 3I2HA 2HRRA 5CT4A 5AKHA 3WK6A 2XMQA 4AX4A 2JGIA 4QDXA 4TVKA 3I2KA 4ARAA 2WILA 1USWA 1WCYA 3OOSA 4C6HA 1SCKA 1Q0RA 5AHXA 4YPVA 4U2DA 2BKLA 5KREA 1UKCA 5ALLA 5AKXA 2Z3WA 1FSSA 1J07A 1H2YA 4CG3A 2C5FA 2HIHA 1QJ4A 5KBYA 1N5MA 3BIXA 1JKMA 1THTA 3ANTA 2G4LA 2VT7A 3V1KA 5DNVA 3H17A 1UOQA 2OQVA 1JT2A 2PBLA 2RIPA 2GBIA 4JYMA 4U2GA 3AFIA 3BL8A 2AJCA 2GBGA 1VA5A 1TQHA 2BUBA 2Q0XA 4EB0A 2WTNA 3WL7A 1CUAA 3BWXA 3FAKA 4BB0A 1TCCA 2PPLA 2HFKA 2AJBA 5ALQA 4PV7A 1XKTA 4KE8A 4PSCA 4OD0A 1YSCA 3G9XA 3B3QA 2PUJA 1R1DA 1P0PA 1PJAA 1MT3A 1ISPA 1I6WA 4UBJA 4XX1A 4JNCA 2BUAA 2O7VA 2PSEA 5AM2A 4J0KA 3H04A 1JFRA 2WHRA 2HA7A 5LKAA 5JADA 3W04A 4UHBA 4UHFA 2XLBA 1MX9A 4L9AA 4UBKA 1UK6A 4Q3OA 1CUCA 4X95A 4AXBA 4Z49A 3T52A 2WJ3A 2BFNA 1LBSA 1O6GA 5AI9A 5EHXA 3DOIA 5DJ5A 1J06A 2VATA 4KRXA 5AKYA 1DQYA 3FNBA 3C45A 1KU0A 2XMGA 3PFCA 1DT3A 5AK4A 5ALYA 2VJAA 1NU6A 3HYSA 4B7ZA 3CN7A 4P9NA 1DWOA 4PSUA 1CUDA 2VT6A 2FJ0A 1EHYA 4UHEA 3ED1A 1C4XA 4QDUA 1MN6A 1G4HA 1LPMA 2PX6A 3HLKA 4GDMA 4GW3A 4XVCA 2C4HA 5AI5A 2VQ6A 1QLWA 1QO7A 1AX9A 1TRHA 5JZ9A 1YS1X 3LIIA 3QPAA 3WIOA 3QITA 2DHEA 1UKAA 4XIIA 3VXKA 3D2CA 2WKWA 2HU7A 5CH5A 3WQHA 4BVLA 3QH4A 2XUGA 4BCDA 5LZ5A 4W9RA 3A2MA 3PI6A 3O4IA 2VJCA 1ZICA 3L1IA 4ITVA 1SOMA 3VDXA 5LZ4A 1X2EA 2YXPX 4BCCA 5EIAA 5K3DA 3S2ZA 5C81A 1UT6A 4BE9A 4M0MA 4Y2UA 4D9JA 5KWJA 3G9TA 3KD2A 1CFJA 1XFDA 1IZ7A 1ETHA 1DQZA 3HRHA 4BVKA 1DT5A 3WA6A 3CN9A 1LZLA 4X71A 5HKBA 1CUVA 3QMMA 5AIBA 1WPXA 4QNNA 3IIIA 1WB6A 2WG0A 2C0QA 4RPCA 1H22A 5JZBA 4E14A 4EA6A 2D5LA 3WKAA 3C87A 4RE6A 4UBIA 1YAHA 1SCIA 2ZJ6A 4H0CA 5AKEA 2YASA 2J3DA 2BCEA 3TGLA 1QONA 5C8ZA 1UK8A 3IVMA 4N5HX 1Q84A 5H3HA 4QDZA 3WWDA 2ECFA 5JZSA 1WB5A 2XUKA 5IH7A 5ALZA 1AZWA 4JUIA 3AILA 4UBMA 4DNQA 4AQDA 4CFSA 3I28A 1CIJA 1TK3A 4X93A 4Y2QA 1ZD4A 5ALRA 4AMZA 1LBTA 1ZI8A 2XB6A 1XZDA 3E0XA 4GECA 4DYHA 3I6YA 5K3BA 4JEIA 1MO2A 4OPMA 1H23A 4HVTA 3W05A 3A6ZA 5LP1A 4B0OA 2G63A 3AUKA 1E8NA 2HA6A 4Q1VA 2DSNA 1IUOA 3FYUB 3PFBA 1P0IA 5T4FA 3WI7A 1Q0ZA 4IH4A 1MAAA 4MJ3A 3R3ZA 2AXEA 2CMFA 3WWOA 4H7EA 4AN1A 3H19A 4G1FA 1YB7A 2B9VA 1W75A 3WKDA 1TKRA 3ESDA 4ZXFA 2YYSA 4WY8A 3GELA 3AZOA 5ALTA 1Q83A 5CTAA 3I2JA 1E3QA 2QVBA 3DS8A 4JYPA 1AUOA 5AKLA 1XQVA 3FYTA 2XMCA 3KXPA 5FLKA 2VA9A 2XMZA 1QIGA 4B81A 2OCGA 1LNSA 1FFBA 3HSSA 1B41A 3HXKA 4ETWA 1CUYA 2QZPA 3I6ZA 4U2EA 3W9UA 4F0JA 4AO8A 4IHAA 3STTA 4B6GA 5HF8A 2JGLA 2ROQA 1YA4A 4BYMA 4OB6A 3WWPA 2HA3A 5D3KA 3D0KA 3IA2A 4ZWNA 2WFLB 4BTVA 4G4GA 3PDCA 5EI5A 5ESRA 3P2MA 5EFZA 4BP8A 1DINA 5DTIA 3X3HA 4UHDA 3WKBA 2PKYX 3RARA 4EZIA 1E89A 5F4ZA 4AMYA 1GZ7A 3GFFA 3GROA 3H2HA 4FNGA 5AKJA 4BATA 4HRYA 3TRDA 1VLQA 2P8SA 3G9UA 4EY7A 2XLCA 3B5EA 1UXOA 5E4JA 1CUFA 3C8HA 2ACEA 3ICVA 3DYIA 2WUFA 3G02A 1XZCA 4W1PA 1JMKC 3BDIA 2WU3A 4KR0A 5AI0A 4GBGA 1CLEA 3WL8A 1Y7IA 1F0PA 3D2BA 1CPYA 2QS9A 2BAGA 4BRSA 4X7BA 1FFCA 1HKHA 2QOEA 1A8UA 2C5GA 1VE6A 2ZVDA 4BZWA 4BRZA 1FFAA 1HDEA 2OGZA 1GQSA 5A7HA 2ZJ7A 5E2IA 3D5EA 5JAPA 4XWGA 3O4HA 3C6YA 2HHAA 2C0PA 5LZ2A 1MX5A 1WM1A 4WDQA 1ODTC 1WHSA 4UBOA 3H2KA 5BV7A 4UBNA 3I1YA 5DYTA 3M81A 2VAXA 5SYNA 4EHBA 4I3FA 4GWLA 1QIEA 4E15A 2Z5GA 4Y2PA 3FYUC 3C5WP 1K5PA 2WIKA 1AQLA 4GHWA 4MWSA 5AM5A 2YH2A 5CT8A 4KRYA 3WL6A 3WWEA 1JJIA 5JD6A 2Y6VA 2WTMA 4X6UA 4CCYB 3I6MA 2ZYHA 1IVYA 1YB6A 2IITA 3F9CA 4DTCA 3N2ZB 1ZGCA 3FBWA 2B4KA 2OCLA 2GZRA 2WHQA 3WKEA 4ZGBA 4J0JA 1UWCA 1U2EA 1E5TA 2CZQA 5K3CA 1HBJA 1WPRA 4W1SA 2QJWA 3O4JA 1GKLA 4PF1A 1XRRA 4KE7A 4P93A 3EQ7A 2GBFA 1XZAA 5LZ9A 3R3XA 1BROA 3SX4A 5T4BA 3W06A 2WLSA 4J0GA 5AP9A 2XUDA 2H1IA 5CXXA 3H1BA 3WWCA 2JGEA 2V98A 4BP9A 1H2WA 4PNZA 3STWA 4HXFB 3WK4A 4Q82A 1ZD2P 4IO0A 4X92A 3ZPXA 4B85A 1QFSA 1XZHA 1N1MA 3FLEA 4FBLA 2VAVA 2XDWA 1ZGBA 3WL5A 1C7JA 4F21A 1CRLA 5LIPA 2RGUA 4KACA 4MQMA 1H2ZA 4PSDA 4DMCA 4EY6A 5AM4A 1EDEA 5AI4A 1LPOA 2W22A 3ZWQA 4X6YA 2HDWA 1UOOA 4K5QA 3WYDA 5E4TA 5BOVA 3DEAA 2B20A 2J3QA 5J3JA 1HQDA 5LYYA 4Q05A 1SC9A 4QDOA 1EDDA 1ZIYA 2PSFA 4DLNA 5T4HA 1JJFA 1TAHA 3PF9A 2VJDA 1ODCA 1XQWA 1ODSA 5ALKA 2PVSA 1RP1A 2ACKA 4A16A 1JI3A 2VJBA 3UUEA 2I78A 2CUTA 4KEAA 2CJPA 3MUNA 2Z3ZA 1K8QA 1D07A 2JIDA 1O6FA 3OURA 1ACJA 3PUHA 4C88A 1K6EA 3I2FA 1G5FA 1CUSA 5ALEA 4MYDA 4B9AA 3WMRA 2HU8A 1VXRA 4QDTA 3F96A 3U0VA 3O95A 2WHPA 1OXMA 4BAUA 4DIUA 3QMVA 5D3ZA 4DM7A 1C7IA 5SYMA 5LZ8A 2VF2A 2HU5A 4OB7A 2X8BA 3AIKA 2JGMA 3I2GA 2H9YA 3FLBA 4B83A 5ALIA 1QIIA 2O2HA 2JEZA 3V9AA 2WUEA 3QBJA 4LXIA 5FV4A 4DNFA 4DMFA 3IBTA 1XRPA 2R11A 1LPPA 3HEAA 1AMNA 4AO6A 3HI4A 3DYVA 2QXTA 3BXPA 5AIAA 1CUXA 5ALMA 1F8UA 4X90A 4YASA 3ICWA 3GZJA 4G9EA 5HCUA 2GYUA 2XMRA 4G4JA 1ZJ4A 4LKOA 1DX4A 3A2LA 3ZLUA 3BDVA 1QIFA 2WIGA 1FFEA 3STXA 5AK3A 1AURA 5AM3A 1ZIXA 4NS4A 2WQZA 1NX9A 3DJYA 4N8DA 4OSEA 3L1JA 3QPCA 3KSRA 2WFLA 2Y1KA 4J0DA 5AM1A 1IZ8A 1GPLA 5LLSA 3C8DA 5DYYA 2DQZA 1MPXA 3YASA 5DYWA 1GPKA 4J03A 2HA5A 4Y2RA 7YASA 3NUZA 3R3UA 4FLEA 2H7CA 3STVA 5C8VA 4ROTA 3AIMA 3E3AA 5FXMA 4E46A 3G0GA 3LP5A 4EY4A 5EHQA 5AJHA 3PICA 1FJ2A 5EIHA 4HS9A 2PM8A 1QO9A 2OPHA 5HZGA 1CQWA 3G0IA 4J3JA 1LLFA 1YR2A 5ALDA 2ZSIA 2QT9A 1XLWA 5HF6A 3VISA 4QWMA 3DLTA 3BF7A 2V96A 4QZVA 1E8DA 3R3WA 3H1AA 4V2IA 4X97A 5FDFA 4X94A 3UUFA 1GKKA 1VJ5A 4K6GA 2E3JA 4Y7DA 5HK8A 2RHWA 1P0QA 4WDRA 1QIMA 5CXUA 5FRDA 4G8CA 2JGFA 5JYCA 4NVRA 5JIBA 4GI1A 1QTIA 5JAUA 1U4NA 2XUIA 1UZAA 3MUOA 2QXUA 1LPBB 5ALFA 1OILA 3HABA 1EH5A 3QZUA 1XKLA 4UBLA 2IIVA 4OUKX 1MJ5A 2CBGA 4Q3KA 4UFNA 5CH8A 2QMQA 3EF3A 4H7JA 1XZLA 3H0CA 3WA7A 1GGVA 5CT9A 4UFOA 3DCNA 4K2AA 2VTVA 2PL5A 3R3VA 4NZZA 5E4YA 2G5PA 4DNPA 3G0CA 4AB1A 2QKYA 2XQIA 4FFVA 5JD4A 4C4YA 4DNOA 1BCSA 5AOCA 4EY8A 3BIWA 4NMWA 1XLUA 3R3YA 4BZZA 5DLPA 1N8SA 1P0MA 1XZJA 2LIPA 1VZ3A 5AK5A 5ALPA 4IQ4A 4H7HA 1VZ2A 2QUAA 2DHDA 5EIEA 3SWWA 3AZQA 4L3WA 5ALNA 1ORWA 4QLOA 3N0TA 3WK7A 2WM2A 5CBKA 1CUUA 2XUHA 1EB9A 1Y37A 3ESAA 1TIBA 2GYWA 1XZGA 3KWJA 4DSAA 1A88A 4WFKA 4YX9A 5JAHA 4FOLA 3RK4A 3FYUA 3WK5A 3ESCA 5AI8A 5KWIA 2WU4A 1YAJA 3O9MA 4ARBA 1MAHA
chains in the Genus database with same CATH superfamily
1N36B 1DWUA 4L2IA 4UW9A 1MC1A 3DFZA 3K0AA 3M5WA 4G07A 3G7SA 3TZKA 2A5FA 2I7CA 4QYTA 2K2QB 3KC2A 1AS0A 4KIUA 1DB3A 1ADYA 1SK9A 4PIVA 3C41J 4GRIA 4NWIA 1HDIA 3VH2A 2Y66A 4UOZA 3UT5A 3E05A 1T2EA 3UMJA 3V9PA 4A2QA 1JQLB 4QA9A 4FFSA 2MR6A 3OU6A 1BA2A 4XFDA 4YC7A 4Q21A 4LYEA 4UULA 2O7RA 1G19A 2Y0DA 3F1LA 3O9ZA 1Q7BA 1JR4A 1VL1A 1KI4A 4EPYA 2GN8A 1CHNA 1N5IA 4GQAA 3IP6A 4UZFA 3QYJA 3QEAZ 3D7KA 2CLKB 3ANSA 2JIPA 3C7DB 1QYCA 1HK7A 1N6IA 3AB8A 4MKZA 4BNDA 2JLBA 3AFNA 5ALJA 5I7VA 4L4YA 5L3QB 4IW3B 4RNDB 2BFWA 1UZLA 3DOFA 3GP5A 4FHEA 3R3SA 4YMLA 2JBAB 1OX4A 3KWMA 3CIFA 3UJPA 4Z7OB 4NFLA 1M7BA 4GBMA 3E2IA 3KEQA 1L8LA 3NHLA 3WRVA 2IYZA 1E7MA 1KEZA 2QV7A 5EPUA 3USZA 3V4OA 1XL0A 4BNWA 3RG2A 2IPXA 1ADFA 1HYQA 3RJZA 2AFHE 4P4GA 4PIMA 4ZAYA 4DL9A 3I61A 3A3OA 3KLPX 2JFFA 4UVHA 3RFFA 4EHNA 5HNKA 1NWCA 2WUGA 4OGGA 4P4UA 4UEJA 3BOSA 1QE0A 1Z4IA 1ODLA 2ZKLA 4EX7A 1GG8A 2IU6A 2LRHA 1J70A 2LD4A 5F1YA 1J1ZA 1H1DA 4W8GA 5A9SA 3I23A 2P6RA 1S4QA 3DKKA 4JLNA 4KBGA 1N0UA 1PWXA 2R62A 3ROXA 1EUZA 2QRKA 2IV3A 2QRGA 4HL6A 2ODQA 4FKZA 1DJQA 3T95A 3T5MA 4BQNA 4BX8A 2IZ0A 5FPKA 2VIIA 2HF8A 3NETA 3VJRA 1UKBA 2BMDA 2OTCA 5D00A 3OY2A 4PWYA 4B71A 4TLMB 1L4BA 3JQBA 3K4HA 3RYCA 5IT4A 3WV4A 1JHPA 2ZI5A 4LTDA 4HAZA 3HKCB 3T4UA 3RC2A 3RLIA 2J41A 4B6QA 3MHTA 3BGDA 2CJYA 1PU2A 4ND8A 4IRMA 2NXCA 5CMLA 3W90A 4AN0A 2Q3EA 4B7CA 3E5HA 1M0TA 1YI1A 1DX6A 3BSWA 4KG7A 4MVJE 2W6ZA 5H16A 3KFXA 1XF9A 5A6SB 1J97A 4TQ9A 4CLXA 1MC4A 1SEVA 3RTCA 4CCWA 1VIVA 2BPOA 4IYJA 4V0SA 3F6PA 5GY7A 5AICA 2PSJA 4EOGA 3QI7A 4F3RA 4L78A 3L46A 2Z4RA 3O4GA 1JG6A 2YN2A 1R9NA 3E7DA 4XUCA 4YXWA 1Y8ZA 3OOEA 1JHVA 1XCMA 2B78A 3HCRA 5H68A 4ENWA 4OX9Y 4LY6A 3WSWA 4J16A 6REQB 2WPDD 4TT3D 3OIDA 2ZUSA 5E8JA 1UXJA 1T6ZA 3TR0A 2BFDB 3D6JA 3VPSA 5EHZA 2DR0A 1X6VA 4UHCA 5KJ6A 4U63A 1YVPA 3FPLA 4KVZA 1NYTA 3UEOA 1EWQA 4OKIA 4MULA 4CKEA 3AKYA 3H4MA 1X7XB 1Y7HA 4CKXA 3KFLA 4ZI5A 4XR4A 2HI0A 4RIFA 2UUOA 4BKMA 1GL3A 2SKDA 4ZMSA 2QG9A 4NULA 3D3NA 4C7XA 2AFHB 2W37A 2ZJ5A 4HX9A 4KO2S 4R2MA 3I45A 2QJRA 1I0ZA 1KP3A 1VXOA 5JCJD 1P4GA 1R3DA 3FKSA 3EISA 1QTRA 4U2CA 3OZ7A 4AROA 5AYVA 4Q37A 1B6GA 1IULA 1SVIA 2P1ZA 4XYLA 2UUBB 1YQUA 1E9EA 2XYGA 1QKIA 3JYLA 3K16A 1EPUA 2F1OA 3K05A 1O03A 1THMA 1TF7A 1V2HE 1X92A 4XQ0A 4ZOBA 1XZFA 5J5CA 3A9TA 3GLIA 3T54A 3IPRA 3M6AA 4HAIA 4P53A 1J2JA 2O8CA 1AO0A 1TW3A 5BSWA 1PN3A 3W9BA 4ZI7A 4HX2A 1P75A 5ITSA 3OLXA 4EMUA 2XQKA 3LWNA 4F6RB 1MG5A 3H6GA 3QELB 1RSZA 2XSZA 1I1HA 3EW9A 5C4MA 5KU7A 3I0MA 3I3SR 4IFTA 3UB2A 4L8YA 4BCBA 1I2ZA 2BGNA 1HZJA 2OB1A 1OE0A 2GDJA 3PFWO 4P92A 5CB4B 2X19A 1QFZA 3M6UA 3JR7A 5AO9A 1NUSA 1QHFA 2RJOA 2WJVA 3LOUA 3OX1A 2XT9A 3QF4B 5BURA 3MRSA 3R0ZA 1QH1A 3V2GA 3R23A 4YI3A 4DT1B 1CJKC 1OI2A 2OYSA 1K8XB 3G17A 3CVVA 1ILEA 2H31A 4NS1A 1QCDA 3EYWA 1I24A 1KNQA 1OX4B 1WMFA 3LW8A 4PC2A 4QGAA 4ZOLA 4HLUC 1DU4A 1KJ9A 2HBQA 2IYXA 4LW8A 5L8VA 5DISB 4BLPA 2XCQA 4Q7JB 4X6XA 1Y8AA 3LE8A 4NZMA 3VNVA 4OXYA 4DRZA 3FFXA 1J6UA 1K2WA 4L8GA 3ZU5A 3ENNA 2WIJA 4GXTA 3A06A 4BEBA 3ZG6A 3N2KA 1ZOPA 4MYTA 1MTOA 4N54A 1L7XA 4H77A 4QFMA 1J24A 3N53A 4QNMA 4XQGA 4DANA 1X74A 1EJBA 2IA5A 1I5RA 2BFAA 1JE1A 1SXHA 3KDSE 1KPIA 4S1WA 2IYSA 4ZRDA 5DN6D 2Q4RA 2ZANA 2F59A 4C89A 2OZLB 3PC3A 1UWKA 2CWDA 3IJEB 4DDTA 1SVUA 2ONYA 3FPFA 2G9VA 3TOZA 4DIMA 5BYBA 3QUBA 3ROZA 3S1LA 3RVJA 1DMRA 5LU9A 4I1IA 1GU0A 5TB5A 2C57A 2F90A 2ZUDA 1XTBA 2PT7A 3HL4A 4JLPA 4M89A 4R69A 3OEYA 1GFIA 2WOJA 3NHRA 4L72A 1QFYA 2AJLI 2PWPA 5ENDA 1Y89A 3LCJA 5KCMA 4R2JA 1U28C 5THKA 4GOKA 5D3MA 4NJEB 2GD1O 2C59A 2G4CA 4FDUA 4DGSA 5KOHA 5IJAA 1R5BA 3LLMA 4HGNA 4EJMA 1OX5A 3L0DA 3IURA 2ZAOA 3Q41A 2OWDA 1J0DA 3HGQA 3Q5GA 4FWBA 5KSPA 4NCJA 3RS3A 5LR6A 3NNSA 4K88A 4CNQA 2FMUA 2H4XA 4GOXA 3LUJA 1RYYA 3GJ0A 4RJTA 1YQWA 5A7FA 2ANCA 3BGWA 1VM6A 3KR9A 1UANA 1Z82A 4UHKA 4X7RA 5KVQA 5TQJA 4HLDA 4XD7A 1T10A 2VT3A 3KKNA 2I9PA 2PR2A 3CGGA 1LPAB 3PX3A 4KOAA 4MVJI 4LZWA 3UGTA 3KVRA 5H4HA 3H6HA 3G2LA 1DCMA 1U8UA 1ONNA 2OKGA 3VZDA 4FMDF 4XB6B 5MFZA 4J3FA 1DSSG 1NE2A 4DTIA 4BFTA 2OBXA 3F97A 3PFGA 1CF4A 1NLUA 4LHZA 2QE7D 4DVGA 3D3KA 3AEYA 3LDGA 3UK0A 1WV0A 2VRWA 5F5LA 1CUJA 1DAEA 2BMAA 3TG2A 4N47A 4ZYXA 4OYLA 3RJMA 1UBRS 4KIJA 3FYHA 3UWMA 1UFVA 1VE1A 1XAJA 2E1RA 8MHTA 3PCTA 2YVQA 1DBRA 3HCWA 2QNIA 5CB4F 1W4LA 2K4MA 5EIBC 1VBMA 1R8JA 1XJQA 1YB4A 2QTTA 4RXTA 3WGQA 4AYXA 3OX3A 3HMQA 1N2EA 5SZKB 3JYHA 3K1YA 3Q0TA 1DKPA 2WT8A 5ULLA 1QZZA 3ZGVA 2Y77A 2FHSA 2X5XA 2XDQA 2UZAA 4OOFA 4BJ5A 3DBIA 2G71A 2NUTA 1T5LA 4QYSA 4X6LA 1RLUA 2VAWA 2W43A 3WLJA 3KLNA 2ZDQA 1XXLA 2OO5A 4UVDA 4WERA 3AC0A 1DAPA 4M7PA 4M22A 4MPPA 1PFYA 1JAIA 1DBIA 1TO6A 3LU1A 2ODAA 3NEYA 1DDGA 5FLEX 3ZNNA 1J8DA 2GARA 2JHFA 3QY9A 1KVRA 2HNAA 4HXYA 4LZNA 5CX1B 3BG5A 1KVTA 1HYGA 1H94A 4CMAA 3GY0A 3T5PA 2CGEA 1E5DA 2W2LA 2W8ZA 3C3MA 4IHQA 3WYNA 4BMCA 5CCEA 1HT3A 2AMVA 5CW1A 3DEYX 4J1QA 1PRYA 1PK8A 5BQ5A 1VRCA 1L4NA 3E18A 1XZKA 4FDVA 4JMPA 3FROA 4C87A 1B43A 4HMOA 4ZHQB 1ULTA 5CA0F 1XEAA 4TRNA 3ZCVA 3NS7A 1BHJA 1PEDA 3A7DA 1BGWA 4OY3A 3GN2A 3FTEA 3FCOA 5KI6A 2X2EA 1G2QA 4MNTA 4ZI7B 1ZESA 1IG0A 2D8AA 4BWVA 3EX7C 2DEUA 5E95A 1LI4A 1BJKA 1MDFA 4IMRA 2JCVA 5GOTA 4R8SA 3VR2D 1NBME 3IC5A 5T6MA 421PA 4DUGD 3E7FA 3OEHA 3CYFA 4JZYA 4G36A 2WRZA 3VTZA 1E1RD 4ZC1A 4BN0A 4D92A 4E2YA 5BOSB 5ICCA 5JXIA 3C15C 2PD3A 1ENYA 3BVPA 5CEEA 4QPZA 1VLVA 3TSWA 1K3FA 1TTQB 5IYZB 1WDTA 2FA9A 4WFJA 3SR3A 4HNUA 3OWHA 4YCAA 1K75A 2NXEA 1OLXA 4M0FA 2VOJA 2OVBA 3E9QA 3H3XA 3N74A 4TMTA 2JZCA 1IXZA 4KLCA 3C6BA 1RCTE 2ECPA 1U94A 1Z6QA 3B8EA 1E3EA 5F2EA 4FYVA 2QMOA 1J7KA 1D6NA 3RRFA 3NAZA 4WGFA 1JKJA 4PO1A 4GLBA 5A5FA 3ZX5A 5ALOA 2Z8YM 4F45A 3MWLA 1K6JA 5A05A 1ICEA 3OU2A 1B8NA 2V58A 4H0NA 1SULA 2QRLA 3RIXA 5JT1A 3GMTA 2OZLA 5HKOA 1ZGGA 1U9ZA 1EX9A 2YKGA 1XQ9A 1ZCJA 4HDRB 4ER0A 5IZCA 4IL5A 2VSQA 5DI3B 1UBFA 1QGDA 3A1FA 2A9VA 1MDBA 2A94A 4GMGA 5AOBA 4F3CA 4Y3UA 1Z7EA 4OVKA 2QY6A 4GP6A 1N2HA 4Z3KA 4Q7EA 1SC1A 2O2GA 3ZZ0A 3DMDA 1RAAA 2VQFB 3KT8A 5JALA 1YS2X 5KVSA 5AJYA 1N3YA 4PGMA 1SCQA 2BMFA 3ENVA 3QM1A 2VUIB 4TTQA 2G40A 3OZEA 4HDKB 3IULA 2ZJFA 4UXJA 4Y2JA 3R7WB 1NOKA 2GEDA 3VDQA 1ZFNA 4FS3A 3K8OE 4KXLA 4HWRA 4LY9A 2IOFA 1PGNA 3BXHA 1ZUD1 4TN1A 5AVZA 2OUKA 1GV1A 2B5WA 3G8YA 3G2NA 4HD8A 3NGXA 3WBBA 4DMHA 1Y6GA 1VJRA 1KYZA 4PHFA 2YZNA 5HUQA 1E2JA 2I7TA 3S2YA 1A8SA 2B4AA 3DDUA 1J0CA 2OY0A 1HM5A 4WSOA 3AUTA 5KHAA 5L4NA 1WAMA 1BJTA 5M5BA 5AJUA 2VCHA 1VHWA 1TO1E 4N18A 1W5AA 5CXSA 4I55F 4LXGA 3RTDA 4MS3A 4NYJQ 3SQMA 5EJ6A 1AC5A 4A3SA 5FHQA 3WLAA 3FFAA 5IAGA 2O3JA 4IDDA 1W0KA 3E5MA 2R1TA 3GD5A 3KIPA 4JWKA 1GTG1 4RPGA 1GR0A 2OAEA 4R16A 4C0AC 4DJ5X 5FYQA 4KXFB 3GC6A 1LJUA 2DGDA 1NQOA 4LRYA 1V7QA 1KDOA 1YCHA 2BKXA 5EQFA 1Z36A 3G7UA 3BORA 4FP9A 4E5KA 5DOVA 2W2MA 2VA8A 4H6XA 4RA6B 1O0CA 1K63A 2V74B 2NXWA 4M60A 3IKLA 2ZUBA 3ILHA 1ZXBA 4YYEA 1M8PA 4QEKA 4JI5B 4CN9A 1NW8A 3P9NA 5FA6A 1ZD3A 1XQ6A 3D7SA 4OK6A 5IDWA 2ZGVA 3DKVA 3B82A 3DL4A 2UUPA 5JC1A 1PV1A 2RHMA 4GVPA 1DOAA 3WDKA 5B4VA 2FRDC 2X3YA 4AT1A 2YQ5A 6AT1A 3CT4A 3MMNA 1Y1TA 1FBTA 1DOZA 1ZOIA 2G9ZA 2HDNB 3BIFA 1N4AA 3BYZA 4MR8B 2YFKA 3GRPA 4FDTA 3G2JA 2EW8A 4PFJA 3RIGA 1N5DA 2P77A 3ZE1B 2PLRA 4BTLA 2ZRQA 1SK8A 1JN0A 2W0SA 3IODA 4YUXA 2PYIA 2JGRA 4CF7A 4C6RA 2VHYA 1QRAA 1IG3A 4PPQA 4W1RA 1DL5A 3C0KA 4FMDB 4IEFB 2QM7A 3OEED 4JVMA 2AZ4A 2DFPA 4YP9A 1GZ5A 3RFXA 2H1OA 5EXDA 5C7LO 4JOQA 4OP3A 1T9AA 4HVAA 5JI3E 5JTUA 1F0NA 1JQ5A 2EKZA 3R0XA 1PZHA 3NBUA 3AEKB 4GICA 5HKKA 4C2TA 4EHFA 4EHJA 5TEVA 1Z63A 2GF0A 2A3RA 3AW9A 2O6LA 2WVHA 5HG0A 2OAQ1 1UXHA 1QYRA 3LIPA 4TKVA 1X7HA 4GMFA 4C0XA 3B1YA 3CH7A 4WUVA 4UQLA 5JJIA 3BF8A 1NJFA 2W6MA 3AVQA 3DBLA 3MWFA 3V1LA 5BWNA 4NV1A 2OSVA 3DE7X 1GKYA 1DFHA 2O4CA 4RJLA 4N0PA 4C4ZA 3I8XA 3KZCA 3PNOA 1GTVA 1YCDA 4ZV9A 5BMOA 3I92A 4MH0R 2W6PA 2C96A 1Y4DE 1EK2A 2X58A 2O2DA 3GA7A 3M6XA 3SIXA 3UXMA 5A2QA 1TZMA 4HMQA 4D4GA 1UM8A 3NXSA 3RG8A 4PGAA 1JIKA 4GGPA 5FWAA 2XXJA 3VU9B 3PQ4A 2ORYA 3NTXA 2ZT6A 3BH0A 3V8QA 5ALWA 4DJEC 2Z5LA 3EFOB 4EW6A 1DAKA 1C1YA 3AR2A 1XN4A 5AH0A 1ZVVA 1L6IA 3L6EA 3A9RA 3NHUA 4JSRA 4QO8A 13PKA 2M6LA 4P0PB 3LHSA 1RJ9A 3WJ2A 4XCXA 3TQSA 4WLOA 4AD8A 5REQA 1N6NA 4J4HA 3W3AH 5E6RB 4A23A 4Y6GB 1XE3A 4BNIA 3LWZA 3KETA 4L0MA 2OBLA 2D1RA 5H4GA 1MOPA 2Q1YA 1FVOA 5H59A 1C0PA 4LJ8A 4FN5A 4C4AA 4JXKA 4FMPA 3Q7RA 3UT0A 3OT5A 2BEUB 5E0OA 1A2BA 5JQGB 2QW0X 1SXJE 4NYMR 3E61A 1U0LA 4ZHSA 2XPCA 4TMXA 3KOXA 2R6DA 2D0PB 4RH3A 3SOPA 1BKSB 3TLXA 3E7XA 4V0MA 2QPOA 4MVJF 1TAGA 5BYKA 2NUPA 2NWQA 4JLBA 2Z4TA 3OOWA 3WLPA 2RHRA 2YCLA 1SBYA 2IODA 3VX4A 3L79A 5IMSA 4RZ2A 3V7WA 2VHUA 2VNIA 5AW6A 1EINA 3UMMA 1DKNA 4CMEC 4EUFA 3PGJA 5AKZA 2XJ4A 3C6XA 3EXFA 1QYXA 3ZQKA 3GPIA 2Y9MB 4WZAB 3BZBA 1G9SA 4C0SA 1KOFA 2VLIA 3PHGA 1WBJB 5EPEA 4BLSA 2QTAA 4RTNA 4IV8A 4UOQA 2I2BA 4EP1A 3N8DA 2PO5A 1ZO8A 3ANYB 2A1TR 3PL1A 4RORA 5K1ZA 3WIBA 3SK0A 1RC8A 1NVKA 4CKWA 4HUQA 2Z8ZA 5KIAA 2BI4A 5CM8B 3L0ZA 1QE3A 3WHIA 5FUQA 3GLKA 2VXBA 1HL7A 1U8EA 2J3MA 3HA2A 4BRUA 3K0SA 3AVPA 1NF8A 1E0KA 2BIFA 2GN1A 4TLEA 2UXCB 1R0SA 3JXEA 5G53C 2IQ5A 2J0UB 5HFAA 1T0IA 1UMBB 3MCAA 4PYOA 1IK4A 3PNSA 4FLMA 3DEZA 4X7MA 5FIUA 1OFTA 4TL9A 3GGCA 1EA7A 1MB3A 2R6CA 4GEGA 4NE9A 2Q3CA 1J0BA 1KOJA 4OXXA 4TQGA 1DKRA 1JJ7A 1U1IA 5CVUA 4KW7A 5EJGA 4NBLA 5CJ2A 4AVYA 1MC5A 3F47A 5K9ZA 2HLDA 2CVPA 1QHHB 1SU8A 3NZEA 4HCJA 1J7JA 4W1QA 4BMZA 1ZJZA 1Z6XA 3NVDA 3R8FA 1E9SA 2CNDA 1D1SA 2GM3A 2YY7A 4N8EA 1FSGA 3ILSA 2DJ5A 3HY3A 3IAEA 3OOYA 1E66A 4Q3CA 2AOUA 3KFVA 4ZMBA 2CW5A 1XP5A 3ZLTA 4HJXA 3CSDA 1LC3A 3IVGA 4LGCA 1HNZB 2IZ5A 2WJ6A 1LF0A 2SCUA 2J5RA 3OQIA 3PXUA 3AFHA 4PW0A 3RF6A 2GTHA 3VSEA 2FLKA 4DQUA 1N75A 1FFXA 1OFHA 5EQTA 3TNDA 2EERA 1MRNA 2YS7A 4XWYA 2C4UA 3IE2A 4Z86A 2X5NA 4W5QA 3WB1A 1ZVKA 2PFSA 2AL7A 2JAPA 1PT6A 3F67A 3PQDA 5G0UA 5HIMA 1CE8A 2C5LA 2JJ2D 2F2TA 3OETA 5KSYA 2NX2A 3AERA 3LFUA 2V3CC 2W2QA 2P9ZA 3IDAA 2DULA 1F8GA 1G98A 2IZOA 2QM3A 2NUBA 3I2YX 3PTLA 5IVIA 2XGJA 3WZ2A 2WE7A 1EM8B 4K8OA 4FS8A 1G21B 1N2OA 1U7OA 1S9HA 2F62A 2FYTA 4UHJA 2XB2A 1NQVA 1M7HA 2C4VA 3OQNA 4H3SA 1EWVA 1ACMA 2FJPA 1BXRA 2DQSA 2J6IA 4WNAB 5JNRA 3ZGYA 2M1XA 3ENQA 3GBVA 3ZBUA 4X8OA 1KHHA 3AG5A 4K9NA 3OJ0A 1R0LA 1ZVJA 5KAMA 3DOHA 3IEXA 3P7MA 2VDOB 4W5HA 1GPNA 1AKTA 4MPTA 5HMLA 3WXBA 4Z2AA 1TOAA 5KYWA 1Q44A 1QCCA 5CH3A 2WUDA 4MV9A 4PO3X 3QKRB 1IWOA 1EXNA 4M54A 2Q6VA 4CL8A 1R37A 5G40A 4EHHA 1M1NA 4G5RA 1RWXA 1GVNB 1FNBA 2BGJA 3DHEA 2VBCA 3HE3A 2A9FA 2RMKA 1MXFA 1NW4A 1T5DX 3H4IA 5LB4A 5A6VA 4MZDA 4MI6A 1FFDA 4HXGA 1CQJB 1R6XA 2QRNA 4HHEA 2H0QA 4AZ0A 2SHKA 2C7OA 5J2TA 2YJ3A 2I1VB 2XAAA 4CI0B 4EB6A 3ZZUA 3RK0A 1WXXA 2B4RO 3F7MA 1OWLA 5AKIA 4WLVA 3OJXA 2HMTA 4C0HA 2CLLB 2GCOB 3LUCA 3OE7A 1A72A 4RHTA 2WNHA 4RJ2A 1ONSA 1U2ZA 3FB1A 1Y1SA 4DMKA 1A2KC 3GLGE 1BZYA 1JLSA 5GMOA 2FUEA 1TECE 4MUIA 2EDCA 3H5NA 4N8SA 4R1SA 4WAUA 5KMGB 1CQIB 1O54A 5BSMA 3UMCA 3HYLA 4M83A 4WZZA 3UWDA 4RBNA 1II9A 1CUIA 4ZK2A 1JV2B 1P1FA 2VJLA 2M6SA 3EXHB 3WFZA 5ISMA 4JN6B 4D98A 5KWVA 2OM6A 4JVOA 2XTMA 4CM3A 1P31A 1NXOA 3L40A 5HFJA 2PLFA 1F12A 1JX6A 1DC5A 3BWVA 1GTZA 2ZEJA 3N2GA 4FFRA 1D2HA 2EL9A 4Y1RB 5ER6A 1W4AA 4AO7A 1R66A 1OASA 3M7IA 2RGXA 5DK4A 4MIOA 3KM0A 3FHOA 5ADUS 1TCBA 3H9QA 4IIGA 3JALA 4PO8A 3SQNA 4ASUD 5HRCA 1CV2A 1DTEA 1JQKA 3G5UA 5IUJC 3KTAB 3FPGA 4DKXA 2FNAA 4B6PA 1X8JA 3DZHA 2G25A 1E2DA 4H2DA 4LMPA 4IHKA 4RM3A 4ZJYA 5K3EA 3BM5A 3SKVA 2CV0A 2CLMB 2POCA 3NHZA 4EUHA 1JEDA 4JODA 1GO2A 5LA6B 3QVTA 1OBOA 3BE4A 2M2IA 4CM4B 3C24A 3TSYA 1CERA 1G59A 1T91A 3ZHRA 4ED9A 2ADFA 3KX2A 3G0DA 4KTVE 1FA9A 1ONOA 1FNSA 1P81A 1NM5C 3KDAA 1YCGA 1T5IA 2RBEA 3L6OO 3RU3A 4AZ3A 5I8WA 1LKZA 2WG1A 3AUYA 3OZSA 4OBXA 2HQBA 1NR5A 3TTYA 3ZIUA 5TPZD 1CSEE 1C1XB 3KE9A 3LXRA 2GK6A 4F3YA 1FLAA 1ZPDA 2GD6A 3FWHA 1DPFA 1QS0A 2EYUA 3SC6A 4YR7A 5AVXA 3V1MA 1NXWA 4K26A 1MA3A 2JGAA 1IBKB 2XTAA 3FAZA 3HA7A 3PCRB 4R84A 3N0RA 4AF8A 1M1YA 3WLHA 4IRXA 3IEKA 4DCOA 3SSOA 4EHDA 3P1JA 4K6HA 4LX8A 1XTUA 2HQRA 1W96A 4LWOA 1TA4A 1I3OA 3IPLA 2GWHA 2VT2A 1FTYA 3P9QA 3J81A 3VPHA 5I8PA 2GAIA 2CLIB 2ONKA 3GG9A 4I3GA 2B5VA 3FFBA 4BWFB 5IFLA 2R3SA 5GGYA 1SXPA 3VR6A 4AKSA 5I7WA 5K01A 1HL3A 5KKNB 4G0OA 2SICE 2GCEA 2E4ZA 3SGLA 1XDBA 4GRAA 1SA0A 3PUXA 2OUIA 1YHZA 1VBFA 1RYHA 3FDFA 1XSEA 3VKUA 1I6KA 2O8NA 3ADPA 3M6WA 3NJ8A 2IWRA 3RYIB 3WNVA 1DC6A 4R7TA 2Q2QA 1GZHB 5KSZA 5K03A 2HDHA 3IV7A 4RJJA 4MQLA 3U3ZA 1OTYA 1T3HA 4IZIA 4PZZA 5FWDA 1CRPA 2WD7A 3D7LA 2JF0A 3F9RA 4KQ2A 1PR0A 4MV3A 4UFPA 3ICEA 2Y1GA 3CW2A 3FTNA 3T0IA 3EPPA 3EEIA 3QIAA 5BXQC 1W5BA 2ABWA 4PSVA 1V7CA 2V7TA 5KUTA 4O0LA 1G291 1V71A 3LO8A 1W93A 4LIPD 4MV5A 2WF8A 4HQFA 1FRQA 2QEQA 4QGHA 4RELA 4UU8A 1V5IA 2Q3JA 4U5XA 1XVAA 4Q1AA 3EWIA 3U5ZB 4KE9A 1RYZA 3EULA 2MSNA 5KYUA 1X87A 2DR2A 4Q4AB 3EXFB 4IH1A 1Q12A 2QN2A 5JRDS 2ODBA 4FIZA 3RUAA 5D6OA 4EW1A 1E2LA 1TZ2A 1QOQB 3JYPA 2WYVA 2XMSA 3F49S 4U00A 3E4DA 4ND4A 4R68A 1ESZA 2QF7A 1JSRA 1L1EA 2JRCA 5JJ5A 4QTZA 5F5NA 2IXDA 3WWZA 2ZS7A 2PBRA 2BFMA 1B42A 3RHTA 5CPBA 1NFRA 3WQRA 1SUEA 5EXTA 2WINI 1PR9A 2VZEA 2L2QA 2OZPA 3CEJA 2YVKA 4TN5A 4KWHA 3F1KA 1ELOA 1TCUA 2ZWIA 4UCFA 4X20B 5CRIA 4ZDJA 1LGYA 1ZD8A 1U5CA 1EQ2A 1AKQA 4L1KA 1NURA 2ZSAA 4QNRA 4MRNA 3RUFA 4M86A 3O8OA 1UFRA 1QCZA 5CT4A 4FQ7A 4FGKA 4GX0A 1Q2XA 4LI3X 3RNOA 3U16A 4BJHB 5C5DA 4H31A 4AX4A 5AW4A 2CT8A 4Z4CA 4AZWA 2OO5C 1GN8A 1OH8A 3PGVA 5KYXA 1LNQA 1GPH1 3A14A 3OH8A 3HN6A 3WIUA 3I2KA 3FM9A 2ILTA 2R79A 4JQZA 3LPDA 1R18A 3HCDA 8LDHA 4MGEA 1C9DB 4TTJA 5CTJA 2WILA 8ADHA 4RVUA 4JV5B 2PD6A 4BJ6A 1HE3A 2WKSA 4UMFA 1SCKA 3LAWA 1DXHA 3ECCA 1HORA 2YWDA 4YPVA 1KIMA 3OFVA 3OKPA 5A3QA 3L06A 4BB9A 1U3VA 3UJ8A 4DC9A 1G6HA 1E6LA 1P9OA 4FKMA 2A92A 1WKBA 3LFHA 4YLEA 1GARA 3R75A 2NZVG 5IWCA 1E1QD 1PFVA 1J39A 3HP4A 3F2VA 3JALB 2C1ZA 3W8RA 5FBWB 5F3WB 1TYCA 2V45A 1QQTA 2H2WA 4X84A 4UVIA 5JZOA 2C94A 2O3SA 2IELA 3WS7A 2C88A 1MVOA 3AFOA 2AG1A 2VSOA 3OY7A 1XJ0A 1MRZA 3C16C 2ZIWB 3WWYA 3LQKA 4DCGA 3ADOA 1N5MA 4ERNA 1PX0A 4X45A 3ZKWB 2VHCA 4PIPA 1OFIA 4I4LA 4UU0A 3V1KA 3T1QA 2J48A 4BV8A 1XLTA 1UJMA 3H17A 4QO7A 1UOQA 1IY1A 1L7OA 1EM8A 5DSXA 4FILA 4WZBA 2PBLA 5LQCA 4PC6A 3FCEA 3VU1A 3L0BA 3I64A 4B4DA 1CDOA 2NG1A 2W2VA 3UBMA 4ALJA 3FKSD 4PPGA 2VBIA 5B3JA 2V5AA 4WACA 1JAHA 4RVSA 1FVFA 4JYMA 1TEHA 4WEOA 4I9FA 2WU1A 1U8XX 3N0VA 1NOIA 2YOFA 3HHPA 2AQKA 3A2KA 1DE0A 2ALJA 2BDUA 4RHCA 4IX1A 3OPYB 2P2SA 4DRXB 4YJFB 1RCUA 1TQHA 1VA5A 2HLNA 2I34A 4EGJA 4JBXA 1E3JA 2V3WA 3HB9A 2Q5LA 2BUBA 3ITDA 3QKRA 3ZD8A 5REQB 5LWHA 2OV1A 1CIPA 2I65A 1AUVA 5A0TA 3BB3A 3IQGX 1UM9A 2Q0XA 3TZQA 2RCNA 4PG8A 5DNYB 3SAJA 1H4TA 1FYDA 2J6CA 2WPDA 3M4XA 1S02A 2Z2JA 5AOVA 2ZB7A 4V0NA 3O38A 2QN9A 3PC4A 4MV6A 3MGCA 2C3OA 5I8ZA 3ZEIA 4AS3A 1NBMD 1TCCA 1E98A 3HXTA 3IB6A 3PRYA 2HFKA 2EF0A 4IILA 4M1MA 3IVCA 3SP1A 1E79A 3UG6A 1CZLA 4HJRA 5U9CA 1HE1C 4CEIA 2DKFA 2JL1A 4TXMA 2I8LA 5ALQA 3WLKX 5J2TB 4PV7A 2VYQA 4KE8A 3SF8A 3WBJA 1HDXA 2JRLA 3EJ6A 4OD0A 1UZMA 1U6IA 2IW3A 2BEVA 4O2RA 4H17A 1Z12A 4LBWA 3ELYA 4YRQA 4Z3DA 5TQVA 4Q7MB 3UJ9A 3VR5A 4V1CA 4RX1A 3GLRA 3DLIA 4ON9A 4UTVA 4BWGA 5BNZA 1Q21A 3K6JA 5C4GB 3PJFA 4L5IA 5AW9A 2VJMB 1U0BB 1VGRA 3OUTA 1GHTA 1I6WA 3WGYA 4XX1A 4JNCA 2QMEA 3QXJA 2HT1A 1YZNA 2O7VA 5DX1A 4CQMA 4PS1A 3ZNQA 2PSEA 1Q3HA 2JIBA 5K0EA 3CRZA 4KO8A 2HA7A 1F2DA 3MQFA 5JNSA 2VXOA 5JADA 2E9SA 2MSDB 1U5BB 2GK4A 2QX6A 4UHFA 1PHRA 1T25A 4C4RA 3CRNA 3GVCA 3EG5A 4RLQA 2P1DA 1Q11A 1MX9A 3FHLA 2ID8A 4H4CA 1CRWG 1HETA 3OSUA 1PJZA 4UBKA 3MGBA 4G81A 2JDID 4FZJA 4X95A 4Z49A 3ORYA 1Z39A 2B94A 3R7FA 2VP3A 1XEXA 2HBRA 2WJ3A 5BR8B 4YONB 3V00A 1P80A 2W6JA 1PL7A 3SYKA 2GCIA 3K0KA 1SNYA 1G9TA 1TMGE 1YKGA 2NVUB 3LZ6A 4C0LA 3L82B 3THWA 5EHXA 4M9QA 4WK0B 1NN0A 1WUHS 1WQ4A 3LL7A 1YBAA 2F3TA 4F38A 3GA0A 2HXGA 1SR8A 2EJWA 3PNMA 5CA0B 5J4VA 3NKFA 1HUQA 2QU7A 3K70B 3C45A 1KU0A 3O6VA 3UWKA 2XMGA 2N0SA 4ALMA 4DZTA 3PFCA 1DT3A 3HUEA 1C0KA 4G4SP 3UWPA 3L8DA 4AKIA 1JR2A 5LOVF 4Y2GA 4M8SA 4EQ6A 1E96A 4P3XA 2JJ8A 2VTEA 4H08A 3SKXA 9LDBA 5JJLA 5JBIA 1JAXA 5TQ2A 2WZDA 3U1BA 2BEKA 3RTGA 4I6EA 3R76A 1P91A 1YD7A 3Q2OA 4EYQA 3JY6A 3EGDA 3Q0EA 2AZMA 3C3JA 4LJKA 3TWOA 3H5LA 2X6RA 3RVNA 1EHYA 2J3LA 3A6PC 3OPNA 4D3SA 2B4YA 1JB9A 3FETA 3K9GA 1NAHA 3S3TA 1P4RA 3DLCA 3ETHA 3NUQA 4RFVA 5JWRA 3LY7A 3QGMA 3UVEA 2C4HA 5BQ3A 1WD7A 2ZLBA 5AI5A 3EEFA 1N2XA 1AD2A 1IIBA 3IIJA 4HS4A 2YW2A 5E2AA 2JAHA 3L01A 3JR3A 1XKQA 2AFHA 4TYPA 1BWQA 5GZ6A 1J0EA 5BNWA 1M83A 1TRHA 5LUBA 1E2KA 1UT8A 2F00A 3D3WA 1HYEA 4KXXA 3ZE0B 1L4FA 4YMUA 3WIOA 1N2SA 3LUFA 2JNWA 2O07A 3F7NA 3CZQA 3CZ9A 2WNSA 3HZHA 1XK7A 1JNYA 1FRFS 1UKAA 2AFIE 2IE0A 3PNBA 4HWPA 4Q3DA 3CEMA 3GHHA 4W8HA 5JROA 3H0EA 2PUDA 4XDYA 2XOKA 5C46F 4TUYA 3ZW8A 2YCBA 1VG0B 2AC4A 3QU5A 4OHUA 4OLJA 4QREA 1O95D 1KTIA 3BICA 4URFA 5E9QA 1NVVQ 4KPUA 2QM8A 4TOIA 4CDGA 3SIPA 2D1FA 2HBYA 4EJSC 4LXTA 3LVQE 4MR8A 4Q7LA 2XKKA 4W9RA 4DHEA 3AVTA 3PI6A 4ZAZA 1GCOA 2ZDGA 3A58B 3DP9A 3BILA 4ZT7A 5L6LB 3L1IA 3LSTA 3QVKA 1VPLA 4ITVA 3ND8A 1QFJA 1SOMA 3ZTWA 2TMYA 1CIVA 4HGQA 3RVBA 4DPKA 4BO5A 2HCJB 1A9SA 1V3UA 2WTAA 2DETA 3KQYA 3T7CA 1T1RA 5ICGA 3S81A 5CLFA 3VNAA 5DM1A 5DVZA 1GZDA 3SN6A 1RRGA 5EZ5A 2BW0A 1SJ9A 5E6SA 1R5NA 4YJ3A 3GQBA 4ZGGA 2EQ5A 3HJBA 5EIOA 1FRZA 1KY3A 2CVQA 2Q2OA 5J4HA 4J6EA 4MKIA 1DHTA 3FYDA 2P6NA 4R7GA 5FTJA 1CFJA 4HLQB 1ETHA 1PYGA 4ZVPA 5CVVA 2XTNA 1MCZA 3IVAA 3S8MA 4DV1B 2Q21A 3A8TA 1DT5A 1QB7A 1UR5A 3KQPA 4OGFA 2VNKA 1RI1A 2YHBA 3OU7A 1DTWA 2IEBA 3OPVA 4JB0A 5LBUA 1EE1A 3DO5A 1CUVA 3AFMA 3O8OB 3WOHA 1TEZA 1DEXA 4DA7A 1JR3E 5AIBA 1CQIA 1V8FA 2WR8A 3LCMA 4DR7B 1FIUA 2FEPA 2WG0A 1TJNA 2C0QA 2JIMA 2WEKA 3GRRA 3MTDA 1SHKA 2P1RA 3KEOA 2W9XA 1E9RA 3H05A 4FEGA 4GSYA 2YV1A 3RRXA 2XYRA 3WQQA 4ND8B 4EELA 3HLTA 4EK9A 4S1VA 3C8ZA 5T57A 1H9CA 2IYWA 1WXHA 3C87A 1AQYA 1NDUA 1F3LA 2FPPB 1OXBB 1UWLA 4LYYA 2QN3A 4GAEA 3CONA 1I01A 3EZLA 5D3QA 2V7VA 3CIOA 3OKCA 4A2WA 5CA1F 2ZI3A 2PV0A 2PX5A 2NAFA 3TGLA 1SHUX 1U7UA 4FYWA 4R2KA 2GZAA 1QONA 3VR0A 5C8ZA 5LQKA 4OHBA 1NR7A 1B73A 1RI3A 3J7TA 4URXR 1J0XO 3BK1A 4PZYA 1RJEA 1HNXB 1RYEA 5H3HA 4Z0HO 5FTMA 3RD5A 4FMBB 3H75A 1BFDA 4F2WA 5HJ7A 2WA1A 1WTAA 4U7DA 2E7ZA 3DE2X 2NNLD 5ALZA 2VPQA 4O0MA 3K35A 4JUIA 4DSNA 1HNWB 3W5VA 7REQB 4AQDA 2AEMA 2X0RA 3DZKA 3EEBA 1TK2A 3UC9A 3P4UA 1NWHA 4A82A 3LY9A 1TK3A 2G76A 4UZEA 4LV5B 3WADA 3TLYA 4CM8B 4MGKR 1SKYB 4QBKA 5M3BA 3A3YA 1ISGA 1HI9A 1UODA 4HWSA 4AMZA 1LBTA 1SBQA 2VYVD 2O57A 3OMLA 2D5CA 3O4VA 5FLXA 1S89A 2XB6A 4J2TA 4RFLA 1Q57A 1ST3A 3IT2A 4B4WA 2GZDA 1YUNA 4LJLA 2ZZMA 1S3GA 2G09A 2H00A 4GECA 4JIGA 4L16A 4MW5A 2PYDA 2QA5A 3FDZA 1TD1A 4UTNA 1Z35A 1D0VA 1WUKS 4BO2A 5JMOA 4NCIA 4RTPA 4C29A 3A6ZA 1HFWA 4ZTUB 2GZ3A 3NV7A 4DLRA 3QNMA 4GI7A 4UKDA 3UK1A 3WSTA 4KBFA 4KPEC 2OD2A 3JWGA 2VRNA 1OGIA 4B6SA 5TGDA 3DUFB 4D8UA 2IGBA 2XF8A 2D4HA 4F6RA 1QAOA 1JPNA 4OH7A 4B74A 1W36B 1ZNYA 3AUKA 4OJTA 3GMDA 3KSBC 1BW9A 4ZT3A 1CB0A 3NH6A 4LSZA 2EGGA 4D56A 1OLOA 1FDIA 1MABB 5C5IA 3CJQA 4MLCA 4Q1VA 1GRQA 2YWGA 1I4TD 2YC4C 5E8RA 3TBHA 2DSNA 3CX3A 3U2QA 4ATNA 3FYUB 3AOGA 2ATXA 2FQ1A 2FE1A 2HH9A 1AQJA 2J0UA 2VP4A 3PFBA 3V33A 4Y6SA 4EDFA 5M29A 3GP8A 2F1HA 2RHDA 3C3BA 3C6MA 3FMVA 1D1PA 4QUJA 2P2CA 1Q7RA 2FX3A 3JRNA 1BKDR 3FNIA 5J4KA 5KTMA 4XX0A 4QXOA 3SHTA 1U2DC 1NE7A 1NTRA 2CMFA 2FV8A 3O3OB 4MDHA 4Y67A 3WWOA 2QVZX 4MKRA 4QUKA 2AZDA 4KZPA 2PUEA 4I81A 4KUGA 1QH0A 3H19A 1UXIA 3SC4A 3W77A 5BN4A 1PFGA 1PZEA 2PXAA 3PEUA 1Z2OX 5J47A 2BKUA 4ZQIA 1Z8HA 4PZCA 4IDNA 3CG4A 1NGSA 2H11A 3PRJA 1L5HA 4F3KA 2Z9DA 5SICE 5ENVA 4TTTS 2DBVO 1R9GA 5DCUA 2YNMD 2DPHA 3NHSA 4ZEWA 3K2EA 4GO1A 4W7SA 2Q0HA 4NFHA 4D7AA 3WDMA 2QN7A 3O21A 5ICMA 1C8BA 4HMPA 2V6GA 3UJ6A 1NL3A 3L1KA 3DS8A 2RBKA 4LNAA 2I1LA 3DKIA 4MV7A 4UUOA 1DAOA 3EDYA 1OI3A 4K3UA 4PC3A 3BFXA 4OLFA 3KLOA 3VYWA 3T3NA 1CE8B 1XQVA 1G3RA 4XFKA 5FL3A 2Q5HA 5T67A 1G6KA 1OXSC 3JQAD 4OIMA 4BASA 2CMKA 3WAJA 3EZ2A 2ZWOA 3BREA 1T5HX 3OA0A 1AH2A 5FLKA 4W9NC 3MMXA 3OEHD 1L5GB 3QU2A 2J9XB 3NU1A 1SXJD 1YZUA 2W4IA 1QIGA 1WW8A 2C4KA 2TMDA 4G1MB 3J80A 1LNSA 1XR3A 3A3KA 1J20A 2C7QA 2WFAA 3UAGA 2FW6A 1B41A 1QGOA 3EPLA 1NKTA 4JJ7A 2QZZA 1GAWA 1RQ2A 1O1YA 3H4VA 2VTKA 1ECLA 4GMXA 4YIKA 3T7JA 1CUYA 1QR2A 2CLSA 3I6ZA 1JXMA 3Q40A 4L5AA 4KQMA 3Q9LA 1GNQA 3RS4A 1CG6A 5DHTA 3S0JA 4JLWA 2QRQA 5JY1A 1WY7A 1HDYA 3P2IA 3GJ7A 3STTA 1VCHA 3U7IA 2PX2A 2B3DA 2R8OA 4B43A 4GKVA 5ELMA 4F7WA 5A5VA 2N9UA 1NFQA 3TDKA 3DWGA 1E99A 2RH4A 1ZHFA 4BYMA 4UXIA 4MWCA 4OB6A 2QU8A 4R8KA 2GPNA 3GO4A 5K6TA 4P5EA 4Z2YA 1W46A 3LNTA 1QDEA 2I9KA 1YIDA 2IZZA 3N6XA 4ARSA 3E48A 4FZVA 1SUWA 1L5FA 4P86A 4B7UA 5HOEA 2EZ8A 4PVCA 4A8JB 3QLVC 1RJGA 2IY9A 3FRHA 3R6LA 4IBOA 3WGKA 4B2IA 1Q17A 3VTKA 3HXOA 1RWOA 1YGYA 2EP8A 3MIZA 3W2FA 1GQQA 5IAOA 2QIOA 5DTIA 5B4UA 2WVAA 2CXQA 3FDZB 3OFKA 2OECA 2P2LA 3KQHA 3RUDA 1KH3A 1RLTA 2BFFA 3KRTA 2REQA 3N1UA 1VTKA 2WDPA 2H51A 4P36A 3RARA 4C5BA 5BN1A 1WD5A 4EZIA 1C7FA 1E89A 2GEUA 2WMNB 2XDAA 3AG6A 3HVKA 4AMYA 3IMEA 4HRYA 4ER3A 4PEVA 4Q19A 2DUNA 1R6DA 4OGWA 1QUFA 5D84A 4GYKA 4WUTA 4Q1DA 2AS0A 1Z9BA 4UE3S 4UU1A 4EG4A 1F51E 1O87A 2P9BA 4GDFA 3U7QA 1EFLA 2JAWA 4ZO8A 4GPZA 3EQ6A 1RP7A 1Z33A 4B3CA 1XVVA 4TYYA 5IW8A 1TM3E 4KGZA 3P19A 2JD0A 4K87A 3ZV5A 1I3CA 4Z53A 5K0SA 2V7XA 4GLFA 4PBSA 4P83A 1GZ3A 3GPBA 3P26A 4RUKA 3D31A 1BW9B 2MSLA 2R87A 3AY3A 3DYIA 1XZCA 2HKIA 3LTEA 4HG2A 5EE0A 4KLRA 4XX0B 3LSYA 4TTAA 4TUYF 5H7XA 1BFKA 4DQVA 2R7LA 3AM1A 3BSFA 3FPAA 5L3QA 1FQWA 3DVQX 1CLEA 1F2TB 2BZGA 3WL8A 4M0DA 4PRYA 4BLOA 4LEIA 1UCFA 5BN4B 4B3IA 5BMVF 2FR0A 3W78A 5KJFA 1PTKA 3HKEB 1PR1A 1ZH8A 2YYYA 4QJBA 4TWAA 4XKJA 2EX1A 3MILA 4JC4A 4TS3A 5A9TA 3ZEAA 2BAGA 3LYAA 3PWTA 4G86A 4NG4A 5DDIP 3OZIA 4BO7A 4JC0A 1Z6GA 3VMMA 3D81A 4HWOA 3QWBA 2NPFA 2QOEA 4KNYA 1C50A 4QXAA 3SF0A 2O2JA 1KZ7B 2YJ5A 4C4PA 3S1SA 3ICOA 1GDHA 1W8DA 4PG5A 2VHZA 3TLCA 2ZVDA 2V7EA 5BQXA 2JFPA 4HR7A 4BZWA 4HH1A 4BRZA 1Q74A 2P9YA 1YH3A 1R3UA 2Y68A 4N9QA 4ACBA 1GQSA 2ZUWA 1W5EA 1K3UB 4Q4DA 3WMEA 2ZJ7A 4O6VA 2TMKA 5E2IA 2GN2A 3RSCA 3AR4A 3T8YA 1TGYA 1IWPB 1DRKA 2KMLA 3ODGA 3THRA 4K28A 5C3UA 1JQ3A 1OVMA 2R6JA 2AEEA 2M1ZA 1DJLA 2XRZA 5ITZA 2A5YB 4R01A 4RMHA 2Z08A 4HQRA 4O4IA 5A06A 5BXYA 2PMKA 1PS8A 1N6OA 1YDMA 3AV0B 3ULKA 4BN4A 3JU3A 1GAJA 2AWNA 3GI1A 4ITUA 2PKWA 4V0LA 2ZSFA 2W2KB 4G1EB 1DC3A 2EBFX 4DR1B 2X8WA 3PENA 3K09C 2WYIA 1Z29A 5JI2E 2QD2A 5BWLA 3RUHA 4ICIA 2V6IA 1FX1A 3ENWA 4JL6A 5C1IA 3ADCA 1T2AA 3PHLA 5KHLB 4DAEA 2GMWA 3ZIDA 1WABA 1XG5A 5BV7A 3K0CC 3I1YA 5K0ZA 3M81A 2NYAA 4MVCA 2WTXA 4EGAA 2PZMA 4CIYA 1K8RA 3O94A 3I12A 4NY1A 1OTXA 1IZ9A 1HSOA 3CG0A 5L95A 4W82A 5KQSA 2ZTHA 1KEWA 3VC2A 1I51A 3ODPA 1VL0A 1TMKA 2GA9A 2MHCA 3CUKA 4C5AA 1X7GA 2O0KA 4KYUA 4MKXA 1MV5A 4NOMA 4DA6A 1NI3A 3AVWA 1YK1A 3MFQA 3I42A 1IMOA 5CG2A 2A8YA 4E4YA 2GPWA 4ARUA 4I3HA 4E0BA 3NJ4A 4RFSB 1KRXA 4DXDA 2CC2A 5AW5A 3BMNA 1A95A 2QMYA 2IP1A 3HHEA 1AQLA 1YDHA 3OLWA 3NIWA 2WYHA 1PX2A 3HUTA 4EF4A 2YH2A 2UZ4A 2ASVA 1SCAA 2A1TS 3PGXA 4R1TA 3MBIA 4UMVA 5CT8A 3ZH2A 2IZ6A 4J4BA 4LHVA 4D46A 1XRJA 2I4IA 2CKDA 3V8PA 2VP5A 4RKRA 1DLJA 3VZBA 3GDWA 3MJTA 1JJIA 1CC1S 1M6YA 2A0YA 3B6IA 1Q50A 1LTKA 2OHHA 1D4FA 2Y6VA 4OREX 3R0IA 2XA9A 2YV4A 4MYUA 3U80A 4GPEA 1YB6A 2IITA 3K6RA 2IKSA 2FPIA 1NRIA 1NW5A 3ICPA 5KNCD 4FGJA 1PVDA 4DTCA 4EYOA 4ENSA 1V1MA 3FBWA 4YCCA 1VMAA 3MT9A 4BNYA 2ZRKA 4V0KA 3EZNA 1RADA 3KXKA 4OHXA 3P27A 3WKEA 3X1DA 2C54A 3C6KA 1Y80A 4JJGA 4K9OA 3RVMA 4XGRA 1Z38A 4RY8A 3DLAA 1BWSA 1XFAA 3HADA 3OP4A 2ORED 4KGVA 3DBHA 2CZQA 3ROEA 1DQNA 5EWMA 4C7JA 1HBJA 3UAXA 1N2CB 3VZPA 1XDUA 2FB9A 4IDEA 5KNBA 5CM2Z 1P73A 4A1OA 4MKGA 4WH0A 3SJ7A 4IQFA 1DKUA 1MHPA 2Y4OA 1LDBA 3HKEA 4NU5A 4WZAE 1XZAA 3JVDA 1URPA 1CKEA 2E82A 2JFNA 4NMHA 4RMNA 2F7SA 3QFHA 1S2OA 1BROA 1W0CA 3R44A 3GYGA 4NCXA 4QTXA 3PD7A 1CD5A 3VU3A 3RSGA 3IOCA 1FS5A 2CFSA 3P9CA 3ZZTA 3GUZA 1Z17A 2VZLA 2O9JA 1Q0HA 4LDRA 4LZLA 4C2BA 4DCTA 2HSEA 4B5KA 1KA9H 2WLSA 3BHMA 5JC8A 1FU4A 2JATA 5GONA 5AP9A 2QX8A 2H1IA 3MERA 4IGEA 1W30A 2AOTB 2HMUA 3FUXA 3K1AB 1KI8A 2RHLA 4GNKA 3AV3A 2UDPA 4D9MA 1K7CA 5DI9A 4QKQA 1PDVA 4GS5A 1IXSB 3WIDA 5LQUA 2I91A 5TRTA 4CDRA 4D44A 2C7VA 3IBYA 4BKQA 4EGSA 2EWVA 2NM0A 3F5DA 1I0IA 5FJIA 5KYYA 1J99A 2QYOA 3MCZA 4IJ5A 1FMTA 3D6MA 2EBWA 4RDCA 2QI9C 1X0XA 4D41A 2EJCA 3RUPA 3ZPXA 5KCZA 2ZTLA 2AG6A 1XZHA 4YRTA 1N1MA 3A6LA 2JLWA 3ADKA 5DH9A 1P9LA 1RQLA 3H2YA 3SE0A 1DRJA 5AVVA 1MJGM 1NXSA 1SCBA 3AM4A 1V4VA 3V2HA 4HZIA 3Q7SA 2XKAA 3DDWA 3RRMA 3COJA 1O9BA 1CVRA 4UZSA 3SS7X 4YMGA 3QVGA 3H2ZA 4YJGB 5IXYA 5KX5F 3TNLA 1UP6A 4F21A 5IT5A 1U2TA 1E3LA 3LOQA 1GG2A 1J42A 2XRYA 5LU8A 2OSBA 4JYBA 1E6MA 5JAIA 1H2ZA 3EFHA 1Y3CE 4ERXA 4WXPA 1KS2A 1NDQA 2HSGA 4AAYA 2HTFA 3LUHA 3PDIB 2Q5CA 4LGMA 2PMCA 4JAVC 3SZRA 4OFZA 2P9CA 3FHCB 1EDEA 4LYFA 5KDLA 1MENA 5LIRA 1U7ZA 5IHPA 4QVIA 4MRAA 2FPMA 2WB4A 2HLPA 4GH5A 3MCTA 4CEHA 1ZINA 1QVVA 2FLVA 2WSYB 2PH7A 1TM4E 2A7XA 4YGYA 1M3SA 4GMHA 1UOOA 3WFJA 1M34E 5B2FA 3UJDA 3D6VA 2O7NA 4R1UA 3Q7PA 2W6ID 2ZRHA 1PL8A 4HC4A 2PRJA 3ZHCA 5LMZA 1M2KA 1J8VA 3DDOA 3DEAA 2J3QA 2FRXA 4QD3A 1KSGA 5LXTF 3BH6A 4Q05A 3GDOA 5LYYA 5T6BA 1SC9A 4EUKA 1OD6A 3T99A 5L3SA 2NP7A 4IXWA 4GYJA 1LV8A 2B30A 1MQ8B 4DLNA 4HVCA 1BDIA 1P4SA 1OV4A 2OYCA 2RH9B 2CYBA 5IH3A 1EX1A 2BGKA 2JLXA 1CJUC 3IT1A 4JBWA 1Y4UA 1ODSA 4RD3A 3TZ6A 3TW8A 3LBFA 4JENA 3ZCSA 2EZUA 2DR3A 3FMOB 1RP1A 4DLBA 1BXKA 1QRRA 1RMQA 1FP6A 5CX4A 1CJSA 1Y5MA 1RRVA 3UUEA 4CFYA 2G72A 1NF2A 4OHKA 3DUWA 4KXNA 1JFFA 4F46A 5LJIA 3ILYA 1KO8A 1X39A 3PXDA 4DBVO 3KV3O 1BYIA 1KTVA 5JS2A 1OAOC 1T43A 5IC6A 3ZS8A 1FFYA 3OCCA 3PT5A 4Y1RA 1CJMA 5KWEA 1C9JA 1OB5A 4OQYA 3ICCA 1CULC 3ERCA 4UARA 1OH5A 1WO8A 1ID1A 4EWLA 3H3FA 1T29A 2Z1MA 3CLUD 3H9GA 3MK31 3QU7A 1C3XA 4Q3AA 1ACJA 2ZYTX 2QWXA 3TLMA 2JZOA 3PUHA 4OHFA 3TDNA 4CKYA 3B13B 1CW2B 4Q4CA 3FPHA 4BO8A 4RCYA 3RIEA 1ZJYA 4I1YA 1FP1D 2FSVA 3DNFA 3I6IA 5JH7B 1OIXA 1WL8A 1ZDMA 4B9AA 1GT91 3GLHE 3IJPA 5THQA 5JMTA 4LN1A 4C03A 3AUJB 3JQ9C 3RS5A 2C0CA 1UDXA 3U0VA 1RLOA 4FJ1A 1EUCB 4M6WA 2XR1A 4TTRA 2KQUA 1PQPA 3FCCA 1YZQA 2QSYA 2X3FA 1E2NA 5CJJA 3QMVA 1NV9A 2K5UA 3DF9A 5SYMA 2IDKA 2HU5A 2OHIA 4JX8A 4Q03A 2X8BA 5DRYA 4LJ5A 3GLGA 4MCJA 1WMSA 3I2GA 1JEQA 3T7KA 4OI0A 3QFTA 3HR8A 1BQ3A 4ZT6A 2JFYA 1UMDB 1CRZA 3PEFA 4HDSA 5A3SA 3V9AA 2VSXA 3LT0A 1E3MA 2X42A 2W2TA 4V3CA 1SBHA 1YT5A 2R8XA 2H1FA 4LXIA 2DHQA 2ESRA 2G5CA 2GASA 1XX6A 2EGUA 2PZGA 3DE0X 4RS3A 2VUHB 1ZVQA 1WX1A 3SC2B 3IBTA 2MU1A 1L5KA 1ORIA 3ZHSA 4U1RA 3R3HA 1USVA 1LPPA 1QZXA 3LQQA 1IBRA 1JVSA 3QYPA 5DHPA 5EG5A 3DWIA 4KWIA 3X2SA 4KVFA 4F11A 5C37A 1TU0A 5JUWA 1OJ7A 1DBSA 1D3AA 4YASA 3GXBA 3QEBZ 4RY9A 5ECGC 2NO1A 2HDOA 2V4ZA 2ZTSA 1MO6A 3VH1A 4QQFA 4YGXB 5GOZA 2I66A 3BULA 4W5RA 3LO5A 3K92A 4EFKA 1SXQA 1RHQA 1MMFB 4CTMA 2GOYA 1GPYA 1MP0A 3OUZA 4Y6OA 5H9WA 5FTLA 3QBEA 4D8XA 2NGRA 2B5OA 1TM1E 4ZOCA 3M4NA 1YZTA 3STXA 4Z1MA 1YRQA 5AK3A 2QW1A 1C41A 5AM3A 5DF1A 2P4HX 3THXB 4TRJA 1E2BA 2GXAA 1EK0A 4NS4A 5IASA 1BVYF 3SHVA 4GLJA 3CNQS 1DCFA 1JJAA 5LC1A 1JNXX 1YBHA 3SX0A 2CJFA 3PUZA 2V3VA 3Q3EA 4R1PA 4PS0A 4IEIA 2XUZA 4RETA 2J09A 4LYJA 1R8QA 4OSEA 5CVJA 1NASA 4PICA 3OE5A 1ZR4A 3P71T 4RK0A 1LW7A 1M2JA 2WFLA 2YJ4A 3H16A 4J0DA 3IYLW 2C99A 4NZ9A 5HPYB 1MORA 1U2PA 3FOAA 2VYNA 4RF3A 1VMIA 2X7HA 5EL0A 3W8EA 5TMPA 1SAYA 1XMIA 1Y9ZA 2IYAA 3LVFO 4IOKA 3C8DA 4KXYA 1XYVA 4N7RA 4F8EA 2PCJA 1GL6A 1WSWA 2G9QA 5EXPA 3WDLA 2AF3C 1BDMA 4GLLA 3AONB 4WLEA 1V5WA 3GJ6A 4WASA 1GPKA 4UM9D 3EIXA 5CEFA 2B2CA 2HA5A 3UW3A 1E9BA 4B73A 1Q7CA 3C3KA 3AWIA 4Y2RA 5EXSA 2IV2X 5B4TA 1JVBA 3R3UA 1FYFA 1N9GA 2FEAA 1NXXA 4GE0A 3UHJA 4LK2A 3ZU4A 4HSGA 2JLCA 4JI1B 3FTFA 1ID8A 2Z56A 4NCNA 1VJ0A 3EGIA 1RRMA 4XCQA 5HX7A 3ZDAA 4ILKA 4HGOA 2DERA 2O2ZA 1P60A 1D03A 3IQWA 1A76A 3N5CA 1SIUA 4OBWA 2B9EA 2WBLC 3JTMA 4DIOA 1KY4A 1JFTA 3DFMA 1PR3A 3BWDD 4UNQA 2XCOA 4GPD1 2V8OA 1JA1A 1YZHA 4ZT2A 4CMBA 3EGOA 3QF4A 4FZRA 3UJNA 2FW8A 5C0OE 2XXBA 4NPAA 5LCXA 4CLRB 2LZ0A 1IXKA 2PM8A 2B2NA 1YZVA 1F2TA 3V34A 2D6FA 3T9CA 5C2JB 4CIXA 1NVVR 1SRRA 2C20A 4IZOA 4R9NA 5KPJA 1K9SA 3K0FA 1VPVA 3CNLA 4CM7A 4I08A 1TQ8A 1YUMA 5HKLA 2HMWA 2QT9A 4A10A 1P5ZB 1YZFA 4F12A 3EZGA 2ZWMA 3H9UA 3BF7A 5FNVA 1H4SA 4YRMA 1C9YA 3NBZC 2HZ7A 2P3QA 1N78A 1I7LA 4ZQHA 4YY3B 5BR7A 4CHGA 4R71A 1GU1A 5A3RA 3AUAA 5JV5A 5HQTA 3AB7A 5FDFA 4R6XA 3DUFA 3QOYA 4LOKA 4X60A 3WLLA 4C76A 2A9RA 3RHSA 3UUFA 4IDAA 2LV8A 4I5FA 4YALA 3LYLA 2NSLA 1FUEA 2A9KA 4K6GA 3E4CA 4PG6A 4C06A 4L27A 3IR7A 2YHIA 4Y6LA 2ZQYA 1BX3A 3A4LA 1K27A 1W44A 4UAVA 4G0WA 1QPGA 2WSBA 1QIMA 1UT5A 2W8BB 1PSDA 2KX7A 3Q0IA 2WUWE 3B9QA 5F76A 1IEQA 2XTZA 1MG0A 3G2IA 5AVRA 3LPNA 3UJ7A 1KDYA 2JGFA 3PKZA 4N3AA 1HZZA 4MS4A 2JA1A 3AUSA 2MJLA 1GGHA 1QTIA 3BSSA 1HC7A 2YFQA 4TTVA 4ZODA 1VP3A 4AJPA 4EW3A 4EUEA 3JQGB 1OA0A 3PC2A 2VJQA 2GXQA 2ZYWX 2ZSKA 1XD8A 1U4NA 4Q24A 2ODNA 2R7AA 4AJNA 2X9GA 3UOAB 1F1BA 1I0LA 2PR7A 2W6OA 3JQ9A 3HRKA 2IWHA 1B26A 2Q9UA 4BX9A 5B12A 3DHNA 7MDHA 3GCZA 5IJWA 2ZUEA 5FPSA 2HEGA 5CFNA 2Q2WA 5LYJB 2C3UA 1WDWB 3Q3HA 3THXA 1C4KA 1XV5A 4UBLA 4C05A 1T9DA 2IIVA 4OQNA 2J45A 4UUNA 1WP9A 4NZNA 3IKTA 4TMWA 2ZUUA 1KI1A 3D43A 3GLIE 1OXTA 1AIPA 1WSAA 1YQ9A 2VOEA 1C4OA 5TMDA 3VTFA 2RHHA 4ZD6A 4XIFA 4B3JA 1WLSA 3EF3A 3H0CA 2B6NA 3QXCA 3VPCA 3TMYA 1IXRC 2J3JA 4NXMB 5DYNA 1DUSA 4QTYA 3O1JC 1C9EA 4QHTA 3AJDA 3GOQA 5ITVA 3RFUA 1WS6A 3E2PA 1II8A 5E4YA 3A28A 4JBYA 3NDPA 4F86A 4AB1A 4OEHA 2NU8A 2GF9A 1O5OA 2EG9A 2W48A 2HCRA 3E15A 3NMUF 3RO7A 3AT1A 1BXGA 4QECA 1LJ8A 1BCSA 2Q5FA 4MV4A 3CX7A 4N6GA 3RBXA 3VBCA 2LW7A 5AK0A 5BV0A 3OJEA 3TLJA 2JVIA 2WKPA 3N6VA 5LBIA 2BSXA 4NMWA 3KJZA 4BZZA 4V1CI 2QAGC 5DLPA 1P0MA 2PGOA 1XZJA 1DXYA 2YUIA 4TXLA 5JDCC 4F4UA 1Z5NA 3K6SB 3NYRA 3SKYA 2P9FA 1VZ2A 1IK6A 4UNPA 4RTJA 3PQ6A 1JWAB 1Y8RA 1X1TA 1OYVA 1B0ZA 4LMBA 2BKAA 3PLRA 1SVOA 1ORWA 5ALNA 4QLOA 5BNIA 1P33A 3ZWKA 3L07A 3WK7A 5DCWA 1W1UA 2QDKA 1P9NA 2GXSA 1L7PA 5CBKA 3L8GA 3MJFA 1CUUA 2QTCA 1EB9A 2LGJA 2ODWA 2GKSA 2P2YA 1U2GA 3FF4A 3KZKA 4YRCA 2OV2A 4B6EA 3QOFA