3D2CA

Structure of 4d3, a thermostable mutant of bacillus subtilis lipase obtained through directed evolution
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
179
structure length
179
Chain Sequence
HNPVVMVHGIGGSSSNFEGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKYLDGGNKVANVVTLGGANRLTTDKAPPGTDPNQKILYTSIYSSDDMIVMNYLSRLDGARNVQIHGVGHMGLLYSSQVYSLIKEGLNGGGQNTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Thermostable Bacillus subtilis lipases: in vitro evolution and structural insight
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Lipase
total genus 72
structure length 179
sequence length 179
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2008-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3d2cA00
1O6GA 2JGIA 2WIKA 2CMFA 4Y9SA 1HL7A 4E14A 3SK0A 2CBGA 1GPKA 4KAAA 1J07A 5EIEA 3OTQA 4KE8A 3U1TA 1EDEA 2JEYA 1GKLA 3IURA 4QLOA 2Y6UA 1IZ8A 5AP9A 4BAZA 4KE6A 1Y7HA 1W76A 4ARAA 5T4FA 4DGQA 2PUHA 1ZJ5A 5AKGA 2BCEA 5EHNA 1MN6A 4Q3OA 2VA9A 4KR0A 1ACJA 4HVTA 4X93A 5ALSA 5JD6A 1WHTA 3M83A 2R11A 1VXOA 4QEKA 1CRLA 1R9NA 4K6KA 4B82A 3V9AA 1XRMA 2GYWA 2ZYSA 3ESAA 3PUIA 4BVJA 2LIPA 4J0CA 1EVEA 3DOHA 4Y2RA 4FDMA 4GW3A 1FFCA 3G8YA 5C8ZA 2XI4A 5KBYA 1WOMA 4U2EA 3C8HA 1CUDA 5AK4A 4DMCA 3QH4A 3I6YA 1EVQA 4ZGBA 3MGAA 3TRDA 1JU3A 3QPAA 4EBBA 3WYNA 2XMZA 1GPNA 1CLEA 1X2EA 2R8BA 5ALRA 2DCMA 5E4TA 3WA6A 5AKLA 3RARA 4MYDA 1L7QA 1RWQA 1Y37A 5EGNA 4BCCA 2ZJFA 1IUNA 2HA0A 4X91A 4W63A 2E3JA 1AX9A 4M0EA 2WLSA 4K6HA 4W1SA 4H7HA 2D5LA 3NWOA 2YXPX 2QS9A 4CI9A 2VJBA 4HRXA 3A6ZA 3VXKA 5AM3A 5AI5A 3VVMA 5HQ3B 3P2MA 4MJ3A 2PSJA 4U2CA 2ZJ7A 3CN9A 2JEZA 2OQVA 3G0CA 3PE6A 1E8NA 2WKWA 2QR5A 2HL6A 2EDAA 4GLBA 1NU8A 1XRNA 2K2QB 2WILA 3EF3A 4HXEB 1DQYA 3SWWA 3IDAA 2H7XA 3PDCA 3DJYA 4CG1A 5DYWA 5SYMA 4RE5A 1ZI6A 5E4JA 1RYYA 2AJCA 1YB6A 3WZLA 4B0PA 3A2NA 1TK3A 1J06A 3OM8A 1SOMA 3WK5A 4DYHA 5ALMA 1CQZA 4WDQA 4U2DA 2HFKA 2WG0A 5AM2A 4DIUA 3C5WP 5ALYA 3VDXA 1GZ7A 5AOAA 2J3DA 1LPMA 4X00A 3F97A 5A62A 1CR6A 2X8BA 2DQYA 5DNVA 2C4HA 2G63A 1K4YA 4DNOA 4DMFA 3T52A 5CMLA 4AMZA 4WJLA 3R3UA 4BRSA 1CUWA 1F8UA 2PSFA 3L1JA 1R9MA 3WKBA 2ONCA 3M81A 3AIKA 2WIDA 3DQZA 1ZD3A 4MWSA 2B61A 3KDAA 1LPPA 3VJLA 2BFNA 3G02A 2WHRA 4OYYA 3TEJA 3IIIA 1UK9A 2W22A 5C8XA 4YX9A 5A2GA 3ESBA 3C43A 1YSCA 3BF7A 3EBLA 1UFOA 3WK8A 4MQMA 2O2GA 4Y2QA 3YASA 1QGED 4D9JA 2XUJA 1CUJA 5JAUA 5FPQA 4I19A 3KOOA 3O95A 1MJ5A 5LZ5A 5CT5A 4LYEA 2OLEA 2AJDA 4BP9A 2YASA 5JATA 1MAAA 5HF6A 5D3KA 2J3QA 3C45A 5ALLA 2AJLI 4Q3LA 5AK6A 1EINA 3G0DA 4W9RA 3QVMA 3UMJA 4PO3X 4AO8A 4B80A 1RP1A 5JAPA 3K9BA 2WHPB 3W9BA 1EH5A 1QZ3A 4H77A 5AJHA 4OCZA 4K5QA 1EDDA 2ECFA 4U2BA 3AIMA 2JGKA 2RGUA 2HRRA 4BDSA 5KWJA 1UKAA 1PV1A 4J7AA 1QTIA 4TGLA 4HTAA 2ES4A 3A2LA 4UFPA 4PF1A 5HF5A 4B7ZA 3B5EA 2I3DA 2XMGA 1GKKA 3GZJA 5FUMA 3HEAA 4XX1A 4H7IA 4UUQA 3AZQA 3ESDA 3PICA 3F96A 5ALPA 1MTZA 1GXSA 2HIHA 4C01A 1BCRA 5FXMA 3AINA 3ESCA 1WHSA 5JZBA 3VKFA 3STTA 3WKCA 4BTLA 3QITA 3STWA 2P8SA 2HA4A 1YS1X 3WI7A 2GYUA 3D0KA 3H18A 1VLQA 1CEXA 2CKMA 5ALOA 2JBWA 5AHXA 1USWA 3WIOA 3O9MA 5DTIA 4A23A 4QWMA 4X6UA 4UBNA 4AZ0A 3FBWA 4KE7A 1ORVA 3I1IA 1VA5A 5K3EA 4BVKA 1JT2A 5AI0A 3OG9A 1ZGCA 1E3QA 4H0CA 1CVLA 2OXEA 2PSDA 3I2KA 4N5IX 1ZD2P 5C81A 4UBOA 3QM1A 2XQFA 3WWOA 4FBMA 4X92A 2UZ0A 5LZ7A 3FYUC 4J0JA 3DLTA 4W1PA 4RGYA 2CZQA 5JARA 3QMVA 4CCYB 1WB5A 3C6XA 1QIMA 4ZWNA 3MUNA 3ANSA 3FLEA 2JGJA 4WFJA 1XLWA 2IX9A 2C0QA 5AKIA 2BKLA 3JW8A 4FTWA 4PQEA 2OAGA 1ZIXA 4KAFA 4F5ZA 1P0MA 2HADA 3MVEA 3A70A 4F21A 2ZYIA 4DTCA 3G0IA 5AM5A 1F0PA 2GZSA 3FVRA 2ACEA 5FOQA 5K3FB 3F9CA 3H2GA 4W1RA 1CQWA 3HC7A 3BL8A 5HKAA 1YASA 3FVTA 4B85A 1TCAA 5ALHA 4OB7A 1YA8A 1G5FA 4B6GA 1FJ2A 2V9ZA 1XZJA 4FHZA 4EUSA 2O2IA 2QZPA 1ZD4A 5FKJA 2HU8A 3DEAA 4WFIA 4BDTA 2QJRA 3WKEA 5LZ4A 4KE9A 1EHYA 1N5RA 1KU0A 4Q34A 3I2FA 3H2JA 5K3DA 3G9XA 2XUAA 1EA5A 4LXGA 5AKKA 1R4ZA 5K5EA 1CUBA 4E11A 4Y2PA 1IUOA 1LGYA 1HQDA 5ALZA 3LP5A 4A16A 4M0MA 1ODSA 4XWGA 1L7RA 1EXWA 1ZGBA 3DL7A 4X71A 3ZLUA 5CT6A 4QLAA 4X85A 4C4XA 1XZEA 3FAKA 2WSLA 2VTVA 4AO6A 2H7CA 3GELA 1QLWA 4AX4A 2QUBA 4FMPA 1CUZA 3Q0TA 5D3ZA 5IVDA 3JYHA 2HU7A 3QPCA 1EK2A 4M0FA 1A88A 4HZGA 1XZMA 3WL6A 4J0KA 1EDBA 1ZI9A 3BJRA 1THTA 4B0OA 1Q84A 3WMRA 1FSSA 3E4DA 4GEGA 3QPDA 1K6EA 4P9NA 5AKYA 3BDIA 3ICVA 1XKLA 3KWFA 5K3FA 3D7RA 4CFSA 1R50A 4UBIA 3HZOA 1TRHA 1U65A 4IH9A 4A5SA 5AO9A 1LPSA 4LKOA 3WZMA 4PSUA 3HI4A 1UK7A 3OURA 3VISA 2XLBA 3C6ZA 4L3WA 4QDXA 4C88A 3WWDA 3IUNA 4B84A 4Y2JA 4CCWA 2WUFA 1QIFA 2XMRA 2PUJA 2AJ8A 1G42A 3QYJA 1ODCA 1AURA 4HRYA 1LZKA 1ZD5A 2ORYA 4Y2SA 2AXEA 2I3ZA 3WKDA 3Q8WA 4X90A 3FNBA 3WL5A 3F8SA 1XQXA 2WIJA 1XZDA 3R0VA 4J0GA 2VAXA 2VJCA 4C89A 5HF9A 4KJXA 4QDTA 1MX9A 2QTBA 1P0IA 2Z8XA 4XJVA 4PW0A 5T4HA 4QZVA 1NX9A 3IVMA 3QZUA 3U0VA 2XMCA 4G5XA 5EHZA 2O7RA 3RKSA 1N5MA 4AZ3A 3I2GA 2OCLA 1DT5A 3RK4A 1E89A 5ALGA 4I3FA 2FJ0A 4RNCA 3VJMA 4UHDA 4EZIA 4H7KA 5AK5A 3R41A 2DQZA 4AQDA 5AM1A 1CUSA 3BF8A 2DFPA 4IH1A 5FP0A 1A8QA 3H04A 4Y2UA 4JYMA 3DKRA 2HDWA 4MEAA 1J2EA 1UT6A 4OD0A 4UFOA 1VA4A 5LZ8A 4BCDA 2QMQA 2QXUA 1AQLA 1ISPA 3NGMA 4TPKA 5A71A 1XQYA 4O08A 1DWQA 2OGTA 5DLPA 3GFFA 1UKCA 4WY5A 4XVCA 1LNSA 3FYUB 4CG2A 4DSAA 1Q0RA 1TIBA 2J4FA 4C4ZA 3L1IA 5EIAA 2O7VA 5AI4A 3WL7A 4EY8A 1QONA 5CT8A 1UOPA 1XZGA 3DCNA 4J0DA 2VATA 1T2NA 3F98A 2HA5A 4C87A 5HFNA 1BN7A 3V48A 1KU6A 2Y2UA 2XLCA 1IZ7A 2ZSHA 1XRRA 1PJAA 2OCGA 4DSZA 4B9EA 1W6RA 4UBJA 3HLKA 5AH0A 4HAIA 4Q05A 1XZBA 4ETWA 4K2AA 2PBLA 3O9VA 2DSNA 2ZSIA 5FV4A 4OUKX 1D07A 3WK7A 1PFQA 2QKYA 1QJ4A 5DJ5A 1HLGA 1AZWA 3T4UA 3V1LA 1UXOA 3DD5A 4AO7A 3AJAA 1E8MA 3QBJA 4G8CA 1SCKA 2VF2A 2PU7A 4Q1VA 5CH5A 4BATA 2WFLB 1EK1A 2PVSA 2VQ6A 2W6CX 3F67A 2PSEA 5HQ3A 5LYYA 3X3HA 2Z5GA 2C5GA 3C70A 2EEPA 3SC2A 5ALVA 1QIDA 4UHBA 4GI1A 3ZI7A 2QUAA 3HACA 1FFDA 1TCCA 1JKMA 1P0PA 2WJ3A 1C7JA 4J0HA 2ZYHA 5DNWA 1W52X 2HRQA 1VE6A 4AN0A 3WK4A 3CCBA 3I6ZA 1ZIYA 3ZLTA 1UWCA 1CUYA 1ZI8A 4BZWA 1DTEA 2WJ6A 5D6OA 3H2HA 3WK9A 1JU4A 2XUOA 1N1MA 1OILA 2JGMA 2X5XA 2XQIA 5LP1A 3A2MA 5J3JA 1QE3A 4QA9A 1P0QA 4BP8A 1ZOIA 5F4ZA 5FRDA 2B20A 4H7FA 3DL4A 5FLKA 4I4CA 4QNNA 5CRIA 5A7HA 4DNQA 1GGVA 2FJPA 5IH7A 1N8SA 3E1GA 5JZSA 4FLMA 2PPLA 3DOIA 1H2WA 2XQKA 4WY8A 5LLSA 1Y7IA 2JGFA 2BUAA 1H2YA 2JGLA 3S2ZA 1IMJA 3AFIA 1HDEA 4C4YA 5HF8A 2XUPA 3D2AA 3G0GA 4GHWA 1WPXA 4ITVA 4YASA 5JAOA 1OCEA 1YS2X 1DU4A 4KEAA 3C8DA 1E5TA 2FUKA 2Y6VA 1YAJA 1K63A 2ACKA 4XIIA 1VXRA 4UBMA 1BCSA 5ALNA 4J0IA 2BUBA 2VT6A 2QT9A 1FFEA 4ZI5A 1U4NA 4U2FA 4LIPD 4EY6A 5ALIA 3AIOA 3DYVA 1XRLA 4HXFB 3ZV7A 5EHQA 1KEZA 3ILSA 2B4KA 2RIPA 3R3WA 4G4GA 2HA2A 4CG3A 4OB8A 2D0DA 3G7NA 3OPMA 4G8DA 5ISMA 2XUKA 5CBKA 1TCBA 5H3HA 3ZWQA 4WDRA 3I2IA 3O4IA 3WIBA 3NUZA 5JASA 5BOVA 4MEBA 1OXMA 1UKBA 3S8YA 1XRQA 3RLIA 2H1IA 4IHAA 3CXUA 2DHEA 2EDCA 4H7EA 5D7BA 2WJ4A 1B6GA 3W05A 1XKTA 2CUTA 4FKBA 1ETHA 4HS9A 5LZ9A 1WB4A 5HCUA 4WCVA 3SX4A 3BIXA 4EHBA 4Q82A 4BE4A 5ALEA 4YPVA 2QVBA 1WB6A 4UHCA 1ZJ4A 5FPPA 2JGEA 2BUCA 3GROA 1JFRA 4J03A 1TQHA 5JADA 1CFJA 3FYTA 2HU5A 1JJBA 3KXPA 4RPCA 5HZGA 2XMDA 3C5VA 1TAHA 7YASA 3R3YA 3WK6A 4BYMA 5ALUA 1QIGA 3H0CA 5CH8A 5AOBA 5IKXA 5JD4A 3N2ZB 3D2CA 2XUIA 1CIJA 2BGNA 3WWCA 2WFMA 1MPXA 4EY5A 2BAGA 1LPNA 3EQ9A 2GBFA 1W4LA 1ZICA 2GYVA 3FLBA 4N8SA 1GQSA 2ROQA 3H19A 1QIHA 4HXGA 3HABA 3W9UA 5KWIA 1MAHA 3WA7A 1QTRA 1MT3A 4DNPA 1O6FA 5SYNA 4JH0A 3G0BA 4AMYA 4L72A 1VZ2A 1CUAA 4IO0A 1QOZA 4GXNA 2OG1A 4CIAA 3AILA 1QIEA 1IVYA 1QO7A 1C4XA 5JANA 2C0PA 5K3BA 5C7YA 3BJMA 4C6HA 3I2HA 2XUHA 1MX5A 1XLVA 2G4LA 5ALXA 2WHQA 2XUFA 1QIJA 5LIPA 3FCXA 4JEIA 5BWBA 1XROA 4BTVA 5ALDA 4BAUA 1DINA 4B81A 4Q3KA 3FOBA 1A8SA 1JJFA 1VZ3A 5T4BA 1DT3A 5CTAA 5C8VA 4BCBA 1BS9A 2J4CA 2WM2A 3EIOA 2CJPA 1HPLA 1LBTA 1S8OA 4H18A 2RONA 3FLAA 2VEOA 3ANTA 3IUJA 1QIIA 1JJIA 3I6MA 3IBTA 4PV7A 2V97A 3R3XA 2VJDA 3EQ8A 4TVKA 4FLFA 3PF9A 5AIBA 5AM4A 3FSGA 4FWBA 3AZPA 2PKYX 2FX5A 2V96A 2C5FA 3PFBA 2PU5A 2OPHA 4GWLA 4P08A 1R88A 1LBSA 1W1IA 3W2TA 3R40A 4NS4A 4AN1A 2GBGA 4UBLA 2ZYRA 4BE9A 4KRXA 2G5TA 2NW6A 2WTMA 4B9AA 1YAHA 1DQZA 3HRHA 4ZRDA 3GA7A 5E2IA 5EI5A 3WWPA 3H2KA 4H35A 2H9YA 1HBJA 1K8QA 3STUA 2X76A 1Q83A 3H1AA 2WU4A 3BE8A 5AI9A 4G4IA 4H7JA 5AKXA 1AC5A 4ZV9A 4KAJA 5AI8A 4B83A 5AK3A 1CUCA 3KSRA 4Y2XA 4MWTA 4J3JA 2XMBA 4BBZA 1WCYA 4OPMA 4ZXFA 3ZLVA 3V1KA 2XMQA 3IB3A 1EI9A 5A7FA 3HYSA 3I1YA 5YASA 4L9AA 4L0CA 3PF8A 4GBGA 1LPAB 1L7AA 3H2IA 3DYIA 1G66A 4FFWA 3O4GA 3C6YA 4IH4A 4KACA 3GUUA 4OYLA 3H17A 2XDWA 1DWPA 1VE7A 3DKKA 3FWHA 5HKBA 3ICWA 4P92A 5IVHA 1B41A 4G4JA 2OGSA 2IIVA 1Q0ZA 2WUEA 5DNUA 1F6WA 4H7DA 1FFBA 1QO9A 1XFDA 4BC1A 3HSSA 1LZLA 1EB9A 1XZHA 4PSCA 1SC9A 2CEKA 4MXDA 2QM0A 3WWEA 1XZIA 2Q0XA 4U2GA 1XLUA 1DX6A 4X97A 2Z3ZA 3UUFA 5JALA 3G9ZA 4S0XA 3O4HA 3WYDA 1UK6A 4OU4A 3G9UA 5ALFA 4FNMA 5BWCA 1LPOA 5AKZA 4ROTA 2WHPA 2G5PA 2OCIA 3RM3A 4ZV7A 1SCIA 4PNZA 2WU3A 3STVA 3C87A 2Y1KA 2PM8A 4CIBA 5DYYA 1E66A 1XQVA 4PSDA 4FBLA 5ALQA 5T4EA 4BVLA 3D2BA 1CUFA 4X94A 3EQ7A 3E3AA 3K6KA 1HKHA 3DNMA 2VJAA 5CH3A 1IUPA 1QFMA 1CV2A 4DLNA 2HA6A 2Z8ZA 3WQHA 3ED1A 4Y7DA 3OOSA 3AZOA 4N5HX 3LLCA 3DDUA 1H23A 4V2IA 5CURA 2I78A 1VJ5A 5IVKA 2WQZA 4GECA 1UOQA 3FCYA 4UBKA 4DNFA 3D59A 1X70A 2HA7A 3I2JA 2GZRA 4LYDA 2JIDA 2H7YA 3B3QA 4MYSA 1GQRA 2ZJ6A 3FYUA 5ESRA 2QOEA 5AKHA 1AKNA 2XE4A 3LIIA 5HFAA 5EFZA 4KRYA 2XB6A 2Y2VA 3IULA 1UK8A 3BWXA 4FFVA 2HHAA 4DMHA 1WPRA 5I8PA 4G1FA 1EB8A 1WM1A 4UHHA 4X6YA 3G9TA 3D5EA 4P93A 2HM7A 1G4HA 5HK9A 4BC0A 4CCYA 5E4YA 4W1QA 5LKAA 3STXA 3IA2A 1MNAA 3V1NA 3CN7A 5EHXA 2RHTA 1VKHA 4ZREA 2PL5A 3WL8A 3R3ZA 2XT0A 3L1HA 4NZZA 2HFJA 1QFSA 3O0DA 1X2BA 5JAHA 5K3AA 2GBIA 2WTNA 1MNQA 2WFLA 1MU0A 4INZA 1SFRA 4F60A 3D4LA 5AKEA 1BN6A 5LZ2A 1XRPA 2OAEA 3WJ2A 1AGYA 1R1DA 1MO2A 1I6WA 1CUGA 2HA3A 2YH2A 2ZVDA 1A8UA 5ALTA 3D3NA 4F0JA 2VSQA 4BRZA 5I7UA 1YR2A 2VAVA 1BEEA 4GDMA 5DTJA 1LPBB 5AI6A 5BV7A 2YYSA 4UHFA 4NMWA 3V1MA 1MX1A 4Y2VA 4X3CA 1H2XA 1CUVA 4AXBA 1CUUA 1M33A 5AKJA 4N8EA 4BB0A 3AUKA 3I28A 2OGZA 2V98A 4WFKA 3LS2A 1XZFA 1JMKC 3LCRA 3CCCA 1CUEA 2XQGA 5I9IA 1K5PA 3B12A 4G8BA 1JI3A 2WG1A 4UFNA 2BGRA 1SCQA 1CPYA 1BEZA 4G9EA 1XZCA 4QWWA 3DS8A 5HK8A 1XZAA 1QIKA 5AIAA 3OC0A 1BE0A 2DR0A 2CB9A 1EX9A 2WG2A 3W06A 3E0XA 1VOTA 2XUDA 1R3DA 5AICA 3QMMA 3WJ1A 2WUGA 2IITA 3ZPXA 4LXIA 3WLAA 3VVLA 6YASA 3QMWA 1BU8A 2QXTA 2OCKA 1DX4A 2B9VA 4E15A 2VT7A 2PX6A 4LHEA 4X95A 5KREA 3M82A 4UPDA 5A6VA 4OU5A 5JD5A 4G9GA 4UHEA 1TKRA 1XZLA 3KWJA 4EA6A 1DWOA 2GBCA 4ARBA 4FOLA 1H22A 5DYTA 5JIBA 1UZAA 2JF0A 2RI6A 5K3CA 4FLEA 5IVIA 2WFZA 4BAGA 3LIPA 2RHWA 1XZKA 2WIGA 3UUEA 1NU6A 3TJMA 4JUIA 1ODTC 4EY7A 2O2HA 1GT6A 3M3DA 3PFCA 2AJBA 1YCDA 1U8EA 5ALWA 2XQJA 3FSGD 5DWDA 3IUMA 5FDFA 1BRTA 3BDVA 4QDZA 5JYCA 2C7BA 2I03A 3WKAA 1U2EA 1JMYA 1H2ZA 4BZZA 4DM7A 5LKRA 3O4JA 4OB6A 2DHCA 4QE3A 4QDUA 1CUHA 3PUHA 5A7GA 2PSHA 1ORWA 4IQ4A 4Y2TA 3NOXA 4EB0A 1ACLA 4MQLA 3IUQA 1AUOA 5AM0A 4YK7A 1CUIA 5EIHA 1T4MA 1CUXA 1BROA 3HJUA 4LXHA 2Z3WA 4K6GA 2QJWA 4OSEA 1YB7A 4Z49A 2RAUA 4Y2YA 3MUOA 2XUGA 4AB1A 4NVRA 4JYPA 2XMSA 5CT4A 2WIFA 5CW2A 2XUQA 4N8DA 4RE6A 1LLFA 1THGA 3BIWA 4DMKA 3PI6A 2WUDA 4QDOA 3W04A 1GPLA 4EY4A 3K2IA 1YA4A 1AMNA 3C6BA 2DHDA 1A7UA 3STYA 3H1BA 1XQWA 1J1IA 5JZ9A 1UOOA 1W75A 5CXUA 4E46A 4JNCA 4KYVA 5ALKA 4X6XA 1C7IA 3JWEA 5CT9A 2OQIA 3HXKA 3N0TA 2BJHA 3KD2A 3TGLA 2QRUA 3GBSA 4X7BA 5CXXA 3R3VA 1F0NA 2C58A 1Z68A 1E8DA 5ALJA 1FFAA 3VJKA 5AOCA 3BXPA 4FNGA
chains in the Genus database with same CATH superfamily
3SS9X 1ZL0A 1KIMA 1KDPA 1O6GA 1B1AA 1PWYE 4MI9A 1KO4A 2A0UA 2H9AA 1FDVA 4Z8YA 2NO7A 1PNVA 1JAXA 2WIKA 2CMFA 2DH5A 4M99A 4Y9SA 3TTTA 3GFRA 6NULA 5BVGB 5HM8A 3UJHA 3GIDA 4OMFG 3U48A 1T2EA 1T3TA 4S24A 2VNJA 1RYMA 4C43A 4C6RA 4YUWA 2RE8A 1PJRA 1EDOA 4JVMA 2DG2A 3W77A 4ARVA 2QSUA 1CDZA 3IP7A 2I3BA 4BKOA 1IM2A 4F4FA 5J4LA 5LR6A 5EUMA 3A3OA 1J24A 2NACA 3D3WA 5FTKA 2OYRA 4X8MA 1UJBA 4QLOA 5ELLA 3UFBA 1Z35A 4BUZA 3TMYA 3GJ4A 4LRTB 3WGVA 3UKJA 4V0KA 1BJKA 1EVLA 3HPRA 1GEGA 4BAZA 3L79A 3BE6A 1BKDR 1KY2A 1W76A 4L1KA 1DJPA 2XSZA 1OIXA 1VI6A 1Y9JA 1ZUWA 1AUXA 2JA1A 3IEKA 3FNIA 5A4MS 8OHMA 5AKGA 2ZAIA 5EHNA 1LS6A 5KOYA 2YW2A 2PAAA 3JQAA 3PPWA 1NYLA 4OH1A 4CKEB 4AQYB 2PMWB 1DOZA 1UXGA 3K1ZA 5F2KA 4D8YA 2O1EA 3VHXB 4D56A 1CJSA 1EM8A 2NTYC 3FTDA 3JSAA 4HEJA 4U0KA 3WGQA 3L7CA 4EDHA 2GZHA 1TVKA 1ZWKA 2Q45A 5IF3A 3IHKA 1YUMA 1H5QA 1KK1A 4XPIB 1ZK3A 3HDQA 4UZFA 4X93A 5EEHA 3C16C 2QAGC 2FN9A 5JD6A 1X8LA 5JBIA 1CY2A 3FCAA 1SBNE 4US2R 2R1VA 2VRCD 4IP0A 3U44A 1J42A 3M83A 1L4MA 2WNSA 3DZFA 4KUEA 1BQEA 4WOKA 4ZOBA 3TTXA 2V8OA 3PEVA 3L84A 1NTOA 2ZYSA 4RANA 1OAKA 3ESAA 2FR8C 3NHYA 1M6HA 3C7AA 3DOFA 3TX6A 5BRNA 3SQXA 3TTSA 3MRXA 1AGNA 2MSKA 1I51A 4PTLA 4Q00A 4E08A 4J0CA 2JLZA 2P4SA 1CQPA 3Q40A 4PZ9A 5CPBA 5DTQA 5KPDA 2W90A 1AS3A 5D01A 1XU4A 2BBOA 2C2XA 4Y2RA 1W48A 1GN8A 4FDMA 1KWGA 4L8LA 4OL9A 1FFCA 1QTNA 1HDCA 2QQFA 2QXYA 1TTTA 5HG0A 4FCCA 5ECYA 4LUCA 1OTHA 1B43A 2XI4A 2PO5A 3PEFA 4PNEA 1NPTO 5K05A 1QTQA 4BFTA 4B3HA 1GILA 3HN6A 1ENYA 2BMVA 4PO1A 1O94D 3B3JA 2YZKA 1D7AA 2GLTA 1OVGA 3ZNNA 2CZCA 4MYHA 4KYTA 4LV8B 3EPKA 1BD4A 4E4YA 1E4VA 3DUFB 2Q4DA 2VWPA 3JD3A 3W90A 4GR4A 3SXUB 1EVQA 2FPUA 3BHNA 2NVOA 3H9EO 3FB1A 4WESA 1U1CA 4KFUA 1WXWA 5DCUA 3REFA 4AUNA 2BTQB 2GXSA 1O03A 1SVOA 3ANXA 4U0JA 3ZWWA 2O57A 9ATCA 1X94A 2CGEA 2QTWB 3QPAA 4ZRMA 4YQZA 1W4CA 4YI3A 4EBBA 4JL6A 1U1DA 5C8YB 1DHRA 4CEJA 2FHSA 1ECGA 1N0WA 4JQYA 4ND4A 5CX1A 1GPNA 2GGSA 2ZRHA 3AUSA 3PEEA 5B57C 1C1XB 1FVFA 1S89A 4PC2A 5FBLB 2JIOA 2H1WA 5JFGA 4HAXA 3H4MA 4RD1A 1X2EA 4KDFA 4Z0HO 4KXFB 4TLLB 3VSEA 3EEOA 2YHAA 1G5TA 3MJEA 1N6HA 1QP8A 1L8LA 1SXJC 2ODNA 2P9HA 3QPWA 5AKLA 3L49A 3RARA 4MYDA 4BNMA 1G7SA 1UBOS 1JDJA 1L7QA 1J0BA 4LF7B 1JA1A 1HMPA 1Y37A 5EGNA 4D3DA 4UVEA 5KYYA 4QPJC 3QY0A 2VXYA 2YMLA 2YVAA 1WDMA 4L16A 1SQ0A 3SSNA 3GMTA 1YGPA 2OHIA 2P9CA 1OWNA 3HUDA 3LFHA 3QTLA 4FIDA 5AJUA 4W63A 3SYNA 2E3JA 5JDIA 1AX9A 2OHHA 1U0EA 5DIFA 4OX9B 2AX4A 2FVXA 2WD8A 3B13B 3BA1A 3PGLA 4Z7QB 4KN8A 3B52X 4MUHA 2CMGA 2Z5FA 4I99A 2YXPX 3AQ4A 1TF7A 3I3OA 3P71T 5FL3A 3MINB 2VJBA 5KCZA 3VYTB 4AUKA 1J6UA 2V7PA 2CV2A 4JFRA 1LX7A 1DV2A 5EXEA 3PTAA 3CURA 1VQ1A 4RHYA 3LKBA 4JJZA 5AM3A 3VVMA 2FPSA 3EXAA 5HQ3B 2R9VA 2VEDA 1TM2A 2W2MA 5K45A 2VH5R 2FPPB 4MJ3A 2KBFA 1KI7A 2BHSA 4DW8A 5JBNA 2ZI6A 4ITUA 4QBIA 3X1XA 1KVTA 3JQ6A 1N2XA 2C7RA 3P96A 1QVRA 3F4KA 2JEZA 5D1NA 4ZAYA 4DLTA 1O54A 4HFJA 3G0CA 1Z0IA 3MWFA 1FVXA 2E21A 4J3FA 3C85A 2Q46A 3SZRA 3AR3A 1KBOA 3OE7D 5CIQA 3N39C 3WGHA 3HP1A 1E2NA 5DCLA 3S2IA 2K2QB 5KQGA 4TL7A 4AJ1A 4HXEB 4FYWA 3A6JA 2HIMA 4H4DA 4JP5A 4NATA 3SWWA 3IDAA 4DDVA 1P3JA 3DWEX 1F4LA 3SBDA 3M1LA 1SUEA 1T8PA 2H7XA 1U2ZA 3DJYA 5EXSA 4LF5B 2EFGA 5EJ5A 5L4LA 1TYZA 4RE5A 1P72A 5BR1A 2ZIXA 3HYRA 2QVLA 3UA3A 2DBQA 2R4QA 3HDHA 3FZQA 3H4VA 3M4XA 4B6SA 2AJCA 3HKEB 1DKPA 4KN9S 4QXRA 4DILA 5A0TA 3AB3A 3A2NA 3HVIA 3W3AA 4K9RA 1J06A 2QRNA 4NMXB 1TU4A 1BX3A 2XY4A 3EW9A 3F2IA 3WK5A 4EIWA 4EYKA 3GJXC 3PJDA 3DDZX 3RHTA 3UWDA 2YXEA 1LTHR 2GZAA 4I4IA 3UYLA 4CKWB 2UXCB 4P0TA 1N9GB 1ND5A 4HPWA 2YY5A 4MRVA 3RC7A 2ZZMA 3F5FA 4Y1GA 1AGRA 4EF4A 3QJ5A 4ND7A 3AI1A 3E1KA 1AUQA 2V8BA 1BZYA 3FKQA 1UFQA 5SY4A 3CNHA 4QTUB 3I9MA 4R8RA 3C5WP 1UEJA 2QI9C 2BBSA 3L1VA 4QU0A 5ALYA 2B5VA 4IKEA 3TLYA 5A5VA 2HK9A 4FYVA 4YT8A 1RWXA 2AOTA 3I09A 2CY0A 3NT5A 3I83A 4K6FA 1IY8A 3NS7A 5AOAA 5AVYA 3TGPA 1ZUD1 3ROKA 1GZVA 3V6MA 4CM9A 2ARKA 1LPMA 2OR3A 3FMFA 5B6JA 3VZCA 1NBIA 5HW0A 5A62A 2QRHA 5IH3A 4UATA 4DR3B 3U4QA 2DQYA 3JQRA 1Z15A 1IOLA 2PT7A 4H1VA 4CLOA 1Y33E 1XCLA 3NR2A 3V55A 3VOAA 3ILXA 4R81A 1VHTA 2LXNA 3P97A 1LK0A 4MITA 1KMMA 3N6VA 5D3QA 5GV8A 3BCUA 1D3AA 4MIKA 4OXIA 4DNOA 5CMLA 2IK8A 3D9QX 3FWNA 3O8QA 3IE0A 1AHHA 1AS2A 1V1RB 2AOVA 4KQ2A 2HZBA 3UOAB 1F8UA 2PSFA 2FDRA 4ASUA 4ESEA 3L1JA 2FQQA 4HB3A 1HNZB 3LHIA 4BQIA 1P2VA 1R9MA 1TZMA 5AHWA 4CETA 4IHJA 3THRA 2WI8A 4AJLA 3M81A 3I9V6 3A6GA 2QK4A 4ZAFA 3QE3A 2X9GA 4LEIA 1D04A 3EFBA 3GZTB 1KYVA 2FK7A 4DQUA 4TXNA 2WSMA 2BKVA 4Y6OA 1JPJA 3A1UA 3EODA 5G4KA 1R8SA 2H8GA 5HZMA 1LPPA 1V26A 2DLDA 1VBMA 3H87A 1P44A 4IDHA 4KSYA 4WKGA 5BNFA 2JFGA 3KT0A 5E3IA 4OYYA 3KAKA 3F9IA 3GRKA 1FTWA 3TEJA 1JG2A 2AI3A 1N2CE 2ZRQA 4ITRC 1I4OA 2DFVA 2EIHA 1OHHD 4CI0B 4OJQA 3MA0A 3BMNB 3GPDG 5C8XA 4HQLA 3RS7A 3BC1A 1YKFA 5U1PA 1P29A 4MIYA 3HFSA 5A2GA 4RA9A 3BF7A 1U2SA 2CFCA 5DKFA 3VPDA 1U90A 2NXCA 1IXSB 1NY6A 3HDVA 3OFSA 3Q6IA 3NETA 3G2QA 4OK6A 5F64A 3GFBA 4AWXA 2OLJA 2Z9BA 1V16A 4RH1A 5AVQA 2GM5A 1DEKA 4MQMA 3EC7A 3FCEA 1EMDA 2G40A 4N9WA 3WIVA 1QGED 3YASA 3AUJB 5DM70 4HD8A 4LPSA 1AGPA 3ZE7A 3LQ4A 4I55B 5GQSA 2DUUA 1EHCA 5FPQA 1YH3A 2J6BA 4RIFA 3O95A 1U28A 2W2OA 4XD7A 3A9TA 4EA7A 4ZT4A 2ODQA 2X0FA 3PDJA 3C3DA 2OLEA 1QCYA 1W4RA 1GCGA 1X7XA 2KW5A 1NT2A 2FUEA 1V11A 5AW9A 4BP9A 2YASA 5JATA 4D43A 2CLKB 1JIJA 4HPXB 4YBRA 1P1IA 1Y3HA 3ZXUB 3EXIA 1ENPA 3FHOA 4PVCA 1FE8A 1NIPA 3DE6X 4YMWA 4U6NA 2AJLI 3WZ2A 1W85B 1V71A 3H2BA 3KQQA 4RHCA 4F56A 2AG5A 3BTSA 5A6SB 3FROA 4PEVA 4QBKA 5EP4A 4ZU3A 4ZK2A 5FX2A 1PRYA 2RDMA 2AB0A 2QQEA 2WJHA 4W9RA 4Z4HA 1U8CB 2GN6A 1A96A 1PZFA 2GLUA 2ZRBA 1EXNA 3UMJA 4BJ1A 3BSWA 3OEED 5T6BA 3RFUA 4RIEA 3QX3A 1EJ0A 3FI9A 4CEIB 4DF3A 2PX3A 2Q21A 4EQZA 1RP1A 5JAPA 1E3WA 3K9BA 1EBBA 4J16A 3DOUA 2BFBB 4C20A 2P9YA 4FZRA 5AJHA 5SV2A 3HZRA 3BBPA 4G1CA 2OHJA 4RWZA 4WERA 1L7BA 1O94C 3HXQA 2G71A 2O1XA 1VCHA 1NXQA 2R25B 2F1JA 5H83A 2J09A 3KFVA 4KBYA 5FF9A 1Q6YA 3GJRA 4P33A 4JB2A 4ZP1A 2W37A 3EEFA 1P4JA 1I4WA 3MCUA 4UXIA 4BDSA 2VHYA 2YIMA 1PV1A 4YRGA 1LC0A 4RM2A 1VMIA 2GF9A 4J7AA 1W0KD 4PIVA 3SJUA 2Y4OA 2I2DA 2BONA 2EKBA 3A1NA 3MZ0A 4DLPA 4IV0A 4PF1A 5AJWA 5AOVA 3OM0A 3UBTA 3LXMA 1M74A 3BE5A 4DMLA 1RBMA 1JZQA 3DXXA 4J1SA 1M75A 1QG0A 1IAQA 2AYZA 2IY9A 2MR5A 2P62A 1ESDA 2C61A 2HHCA 2F00A 2I3DA 2UZ3A 3A6DA 3N76A 2QTTA 3IT0A 1PQUA 4HOYA 5K6TA 2JB9A 2JLRA 2YHIB 2GUWA 3MCWA 3QKSA 4ZO4A 3T54A 4LYHA 3KQUA 1NOIA 4G25A 3LH5A 4WVLA 3TZCA 3KXKA 1RI2A 2C7OA 3ZHQA 1JSLA 3BAZA 1AKTA 2ZTMA 3PQ2A 5F23A 2YV4A 4NBVA 4PZDA 2ZPUA 4P3PA 4TX1A 3F96A 2F8LA 3G17A 1MTZA 4RTPA 1JPVA 2QRVB 3HPQA 2I22A 2BMDA 1E1QD 1VJDA 2VK2A 4G1EB 4XYBA 2EG9A 4JGGA 3ZU2A 4C01A 1EXDA 2WPDA 1V5WA 3EF0A 3Q8KA 4TRJA 1QGZA 4J8PA 4BNKA 4XGNA 5TLSA 1FPMA 2XHEA 2AZTA 4M1ZA 2GF2A 4R1MA 1J20A 4WE3A 2HSZA 3X2EA 4DXDA 1IULA 2HJHA 2BZGA 2E5FA 4P35A 1IBLB 2VXOA 4LKRA 4CCSA 5E7QA 3WGLA 4E5NA 2OFOA 3AHJA 3NAQA 3MB5A 1WBJB 4K05A 3HXTA 1JFLA 1UFVA 3EXHA 1CRQA 4KSCA 1KGSA 1U3DA 4HL6A 2W83A 3WI7A 2H08A 3FFBA 2F7SA 1RFLA 4Q12A 4ZU1X 3DEFA 3IKJA 5CD1A 3K6SA 2CNWD 4LBYA 2Z4TA 5ALOA 2JD0A 3LY8A 4KO1S 2JIPA 2HMWA 4E94A 1DLIA 1G38A 2ZUUA 5ERXA 3FFWA 3VH4A 5HJEA 1F2UA 4J3NA 2ID4A 3TR5A 1ESZA 1EUDB 3FBGA 1N1EA 3AX6A 4H3HB 5F1OA 2FSGA 2I67A 3SJCA 2PZAA 1ZSVA 2GJSA 3AERB 3AYZB 1KGDA 2AI2A 3FDIA 2J31A 3GB9A 2ZAMA 3MYYA 4X6UA 3WGNA 3FBWA 5CGZA 3X1DA 4H3VA 3H05A 3H9BA 1ORVA 3I1IA 3CKKA 3KSBC 1VA5A 4J43A 3VPBA 4BU0A 1FDWA 2REBA 2IV2X 3SSMA 1JT2A 4EFNA 3GGJA 3UMCA 5K3EA 1DAPA 2R62A 3M1IA 4KK3A 1F5NA 1EVYA 4KXLA 1T4BA 1SG9A 5AI0A 1E5DA 2Z0MA 2VO1A 4YRDA 3OG9A 1G4UR 1ZGCA 3AM4A 5DB4A 5BYKA 1RABA 3ZLJA 4DRYA 3LRPA 1RAEA 1K6XA 3QWFA 4YJHA 5C32A 4XYGA 1QFYA 1UP4A 2OKCA 2C00A 1ZD2P 3CRVA 4QOHA 1NONA 3CZCA 2VF8A 2Z4RA 1IN8A 2RKWA 2MWMA 1YDFA 1SHUX 1XDUA 3GJZA 3WWOA 3KDSE 3UJ7A 4Q66C 1Z26A 4NH0A 4X92A 5CLIA 4YCJA 1O9GA 3JQAB 5FBVB 3S7ZA 3WX0A 4NZPA 1BSVA 3LM8A 4KX5A 1P1RA 3MT0A 4W1PA 1TJNA 3SF0A 3FTEA 4D9FA 1G2IA 1KH2A 1L6IA 1NM5C 2QNIA 4Q47A 2IELA 2SKDA 2VYND 3D8NA 5JARA 4CCYB 2ODBA 3LCVB 4B32A 3NVKI 2EF1A 1OLXB 2QPLA 3CEPB 5CUQA 1WB5A 3C6XA 2K7ZA 1QIMA 3TZ6A 1PCXA 4UM7A 4X44A 4RHTA 1NZDA 1KP3A 2VSXA 3GI1A 4PY2A 1M6NA 3TLGB 4B4UA 3BWBA 4MUXA 4LG1A 4DV7B 1XLWA 3R8CA 4Y6SA 2QD4A 2ZG6A 4WBNA 5BNWA 5JSQA 1NR5A 3L7YA 4B3GA 2OD7A 3GMSA 5AW3A 4M86A 5FO0A 2WT8A 4PQEA 4TLMB 2ZKLA 3EMBA 1GYQA 4ZEMA 2QF7A 4KAFA 3KTOA 5IBPA 3ZJUA 1BWQA 4IDOA 3MVEA 2DFLA 3A70A 4IDEA 4DJTA 4QBTA 5JDCC 4NENA 2MCFA 1U1EA 2ZYIA 4Q9NA 2IOFA 5AM5A 3FZGA 4DLAA 4DHEA 2AGVA 5DASA 1GGHA 2GZSA 2JGNA 4AULA 3ZNQA 1P5HA 2CFSA 3Q1KA 2ACEA 3LLMA 2C78A 3HCBA 3NBAA 5K3FB 3PFHA 1K6MA 2VJNA 3U16A 2P1DA 3FYCA 1ECLA 1MJNA 3SR0A 2LP4Y 3DCYA 4CKCB 3PDWA 1TVEA 2PS0A 3EIEA 3V4FA 1VKRA 3W1WA 1HDGO 1HLDA 1SKUA 1TYCA 2IYWA 3K72B 3WB9A 5HKAA 5JCZA 1QQTA 1RT9A 2XCRB 4JI8B 4B85A 1P1CA 2E2WA 1TCAA 2II6A 2N3ZA 1H2AS 4OB7A 3E5MA 3UH1A 1TUEA 3DM9B 4MWDA 3KVRA 3OD1A 3WE7A 4BRSA 5BXQC 4OX9Y 2J9YB 5FA6A 4B6GA 4UCFA 2OSBA 2PE5A 1XZJA 3ZH9B 4F9GA 1U9YA 3KU4A 4CZ2A 5IJWA 3BREA 4MPJA 5DBHX 3G2PA 3KTDA 2QT0A 5KTTA 1PEAA 1Z3IX 4HLDA 4PGHA 3Q8MA 2O8BB 5AYVA 4CLDA 4AURA 1SVLA 4HWKA 2PZGA 5DWVA 3EC1A 1F3OA 5BN5B 2HKIA 1DPFA 1IB6A 2RHJA 3NOQA 4TMKA 3NGLA 4W9NA 3WKEA 4DA4A 5LZ4A 1RSZA 1Y1SA 1N5RA 2QU8A 1MVNA 2FG5A 3FHTA 1P8JA 2FP3A 2R4UA 1V8ZA 2CVPA 1GSHA 2IPOA 3DHNA 1JFFB 1ITZA 3RJ9A 1OFUA 4B44A 5JXGA 1MQSA 2K6GA 3BK7A 2YV2A 1RQ7A 2PNJA 3TBFA 4ABTA 4OHPA 4LXGA 2JI9A 2GEJA 2YJ5A 3B1KA 4B3MB 2PUWA 4QSHA 2AFIB 1CUBA 3ROTA 5HVNA 5AJXA 4UUAA 1R10A 3PUKA 1H6AA 1LGYA 3EOBI 3I6QA 4GH5A 1HQDA 2G88A 1E2KA 4JN6B 4M8IA 4MV1A 4AICA 1KYTA 1JFSA 4BLOA 4N5LA 3HO8A 5JMPA 3I58A 4D0NA 1ODSA 1LF5A 1SU4A 2GUGA 4XWGA 1SQ5A 5KVAA 4J1TC 4M9RA 1EWKA 2AFHB 1CJMA 2V7BA 1ZGBA 5TNXA 3ABRB 2O0MA 1B0AA 2HWYA 2SCUB 4X85A 1RZUA 4GX5A 4C4XA 3EFOA 4I5IA 1Z8FA 2NTNA 4D4GA 2BH9A 3S27A 2ZJ5A 3OTOB 4XIYA 2AFVA 2VJMA 3FAKA 2OO3A 3WYFA 5MFPA 2VTVA 3GFGA 3V4VB 4RTNA 1Q19A 1Y5IA 2P2SA 3GELA 4JBHA 1E59A 1Y8RA 3C98A 1YZYA 1U6JA 3KDPA 4HTFB 1C3EA 3K5PA 4AX4A 1AG9A 3FD8A 1ABFA 1K2WA 3DMDA 5CA1A 1NXOA 1R18A 2PGAA 4G5SA 3O75A 4FT4A 1I6MA 2VTBB 3FJOA 3QBTA 6PFKA 3M0EA 2X1HA 3Q0TA 1SA0A 1PGJA 2D1RA 4QAJA 4LX0A 5D7NA 2OCAA 1EK2A 1A9QA 2FKNA 3MWKA 4KNWA 2BPOA 1E3SA 5C80A 3PFWO 4HZGA 1O5TA 3L0PA 2FFJA 3WL6A 2WD7A 4J0KA 1AHIA 4AIIA 4CKCA 3IPLA 1UAAA 3HB5X 4KLZA 3WGZA 3A1EA 3KUKA 3QFSA 4CMGA 4YY3B 1Q84A 2FFHA 4WMLA 4C08A 1JB9A 4I9GA 3K9NA 1FSSA 2IOYA 5DT2A 5FFFA 4GEGA 4URHA 5AW2A 5IG2A 3BKXA 2MINB 3QPDA 4P9NA 3BMQA 3O7MA 4FN5A 3MMPA 2PA3A 4H15A 4O4LF 2BGJA 4W5RA 1YDGA 1LJ8A 2GI4A 3KWFA 4DV1B 3MJTA 3V4OA 3PRJA 2P1ZA 3KV3O 1R16A 3ANLA 3BDAA 4MLCA 4V0SA 3CH7A 3OIUA 3PSAA 2Z3VA 4P32A 4XJXA 1VDZA 4IH9A 2GXUA 2ILVA 5JISA 9GPBA 4U6QA 1C4KA 3DCIA 4BV8A 4B4WA 1LPSA 3VPCA 1N3IA 2ADOA 3I32A 2B6NA 2EL7A 4HN2A 5HDBB 5EJ6A 5ITWA 1QO0A 4JR2A 4N82A 2IU0A 5LOVA 2FKAA 4PSUA 3D0RA 5EUCA 1W4BA 1G8YA 1LLCA 5IM5A 4DV2B 5ILOA 3C6ZA 3KYCA 4QDXA 2O5RA 5KNDA 1GAWA 1UJCA 3QKWA 1CE8B 3PFFA 4JCCA 4JJ7A 2R5FA 3GXBA 4B84A 1M73E 3QKRB 1SK8A 4A8JB 4CCWA 2P6MA 3DVQX 3R23A 1QAOA 4YAKA 1CD5A 1ZCFA 1O7JA 2BVNA 2XMRA 3DDNA 4GE0A 3C3MA 4HMQA 1T5BA 3AP3A 2KE5A 3UJBA 3V2GA 4GP9A 4R3NA 5K0FA 1MJHA 1G42A 3DMRA 4MQ4A 4HLQB 3NH9A 1USUA 1WTAA 2W70A 5J2TB 2C5LA 5D51S 4EW1A 5C7OO 4FWTA 1U7PA 3B1YA 4ZAGA 3SPXA 3CO0S 3WKDA 4X90A 1MH1A 2W8BA 2O9JA 3A1DA 2IBTA 1NATA 1I0ZA 1NLUA 3WL5A 3F8SA 3COVA 1P4AA 1VC2A 3I9FA 4MR8A 2ATEA 2R60A 2WIJA 3I6BA 3R5FA 4KP7A 1DHTA 2E49A 2QIPA 2VAXA 4GPBA 4MIOA 5HF9A 1H8HA 4GOLD 3AV0B 5LL6P 3HWX1 4QDTA 1G63A 1MX9A 2BFOA 2RIRA 5DGXA 2XPCA 2M9MA 3CH6A 5D8DA 1T3SA 4JQCA 4KGZA 4ZJYA 4D42A 4YCLA 1ZRNA 4QZVA 3HXMA 4RK4A 3UT6A 2IHKA 4OFBA 3AHFA 1NX9A 3MXOA 2V6MA 4GDFA 2DE0X 3QVWA 5FO1A 4G5XA 2M6RA 1FXUA 4CLRA 3L0ZA 3ZX5A 4WTOA 1R4NB 3T94A 2A86A 3GCWA 4TUYA 2GPYA 1U7HA 2QX4A 1IPEA 1ZH6A 6REQA 5KOJB 3B38A 3QG1A 4JWKA 5FT9A 4Z51A 3I2GA 5KAMA 3U4CA 2ZIUB 1BWPA 1RRPA 2X7HA 4QHSA 3P4XA 121PA 3W2HA 1DL5A 2FJ0A 2P9QA 2J5BA 3P4UA 1YI1A 3F3KA 4RNCA 3VJMA 4EJ2A 5DX1A 5F3WB 1JXAA 5K0GA 4W9MC 4EG8A 2P4EA 3CLRD 4FI3C 1YVPA 3DZJA 3GMDA 4RF4A 2DQZA 3CTPA 4WASA 4Z3OA 5AM1A 3GMIA 3HR8A 3OO1A 1QR6A 5F5NA 3BF8A 1TMOA 3G1UA 5EMLA 1UJ2A 1T6ZA 4KXNA 1T0HB 2BDEA 4OUDB 3GBPA 4Y2UA 4D82A 5H9VA 2V7XA 3TRHA 2D2IA 4P22A 1VSVA 1UDXA 2GKSA 3LLSA 5IBQA 3W5JA 1T5OA 7ABPA 3NJRA 4HUQB 1UT6A 1YR8A 2O2XA 4OGFA 2WR8A 4TTSA 3T1VA 4Q9DA 5EJ2A 4BCDA 3HN2A 4IR7A 2Q6OA 3SR3A 2QQ0A 3MG9A 2IYNA 13PKA 4NHEA 2P0EA 1OFVA 3ZZUA 4XDHA 5A71A 4P3YA 4HNTA 2OGTA 4KQ1A 3ZE1B 1EFRA 3FPJA 1G55A 1UKCA 2CL5A 2GM3A 1II9A 2FZEA 4FHGA 4KNVA 4WY5A 4ENWA 5LQDA 1T15A 3DMFA 3VC2A 3L4SO 1NVFA 3C41J 3LT1A 4DSAA 1V2GA 5SZJA 1L5OA 2L18A 2J4FA 3NC0C 3Q85A 1QVAA 4M37A 1V3TA 4C4ZA 1UXJA 3SQDA 1P5RA 1XTVA 4FHFA 2FN8A 2R1TB 3TSOA 4DN6A 1RBQA 3T4XA 1K68A 3AR5A 1X9HA 4AMBA 1C0LA 2PMBA 1YACA 3QLVA 5EIBD 2G8LA 3LUFA 4WCFA 4EY8A 2YNMA 1QONA 2PGDA 2QZ4A 4QDKA 1OU0A 4FNOA 4RF2A 4BQSA 4A2PA 4D2IA 3O93A 5A0FA 5BURA 4J0DA 3DAOA 1X7XB 1J90A 1T2NA 5GJVC 3AFMA 5I3CA 1FS5A 3O8NA 5DISB 3BFVA 3RHFA 1DE0A 1YVRA 3MRVA 1X1SA 4FHDA 1B76A 2OESA 2X6TA 2BE9A 3I12A 4MSUA 3O3MB 1E64A 1GFWA 1LLDA 4HUJA 4MB0A 1SOUA 1WZIA 3R5KA 1U99A 2JLAA 2XVXA 1IZ7A 2WJYA 5F2EA 4JI3B 5IFLA 3FMVA 4CMCA 5AUPB 3EXHC 1C14A 1CNMA 2OCGA 3G6KA 2Q2OA 3OETA 1G3IA 2VYQA 4N3BA 3TUIC 4QHTA 2OBXA 3AGPA 1TUBA 4Q3NA 4BQRA 3P0EA 2VYFA 4RK5A 2HNBA 1G8AA 4LRSB 4LZOA 1C9KA 4UBJA 2IYTA 2DJIA 3RWBA 3F47A 1UXHA 3U4AA 1OX5A 1TECE 4D7AA 1E2DA 1OPXA 1GUYA 1Z74A 1AKMA 3EXEA 3H2YA 3MC1A 2YNMC 3TRFA 5KKAA 1VPDA 4WCFC 4ZFNA 3WBKA 5JMTA 1IXKA 1T9GS 2OZVA 3JQ9A 4ETWA 1PWZA 3G7UA 1RAAA 1UINA 3MTAA 5HCNA 1GP2A 1N2JA 1NF2A 2ZDQA 4NNJA 4F5DA 1D07A 1GPMA 1C9JA 1I7LA 1FTGA 3NBYC 4MLDA 2EJVA 3KJGA 2FDXA 2QKYA 4XSHA 5EQTA 3V80A 3KM0A 4AG6A 5HOQA 4B3SB 3AVVA 2WWRA 1UPUA 2IZOA 4M7WA 2OAQ1 3D7SA 5DJ5A 5JRZA 3ACDA 3HR7A 2JLSA 5F1YA 4L74A 3U3RA 1UXOA 3DD5A 2HSJA 2QU7A 3UATA 4IRUB 5DBOA 1U7XA 5GOZA 2PCLA 1E8MA 1YRYE 4L51A 1SU7A 2ERCA 5KDLA 2EERA 3EEQA 3WB1A 3D7MA 1P7PA 3RAGA 3LHDA 1PK9A 1Y5RA 1C0IA 4G0MA 2XBMA 2N46A 2Q7XA 4YV1A 1E0DA 4KZPA 1UIMA 2OFPA 3IAS6 3HY6A 1Z0FA 1OREA 3C3BA 4PHHA 3RYFB 3WMWA 2Q2QA 3F67A 4BNWA 1XCJA 3H84A 3OCCA 3PNQA 4NR0A 4I1PA 5KVSA 4TKLA 3THYA 1A4UA 4PIMA 3TN7A 3HKBB 3OZVA 3O1IC 4DLXA 5TMPA 3H11B 4XGIA 5LYYA 3X3HA 4L95C 3TW6A 5JTUA 1N6NA 1X1QA 1WZNA 1C30B 2Z5GA 2HSGA 3FIUA 2I33A 4PYQA 3AXTA 4D25A 1ZYUA 2HDHA 3C70A 3O8OA 2BR3A 4X1OA 5CCDA 2YC2C 1MAWA 5B1DA 3HFRA 4NK5A 4UHBA 1COWA 3RUDA 3IEXA 1RPNA 1MT0A 3QU7A 2E37A 2EBWA 2F55A 4M46A 4MVJE 3E03A 1PL8A 3HACA 1FFDA 1MLDA 2C4UA 3FOWA 4JLUA 5BT8A 2AA3A 1IEWA 1KVUA 4GXTA 1Z2OX 4RGBA 5KYYB 5EJEA 1AQUA 2I62A 1CQJA 1FFXA 1Q57A 1QK5A 1QWSA 4RVUA 5J2UF 3DDOA 4MMYB 4N1AA 5JYBA 1M6YA 2A3RA 4RWEA 5LXTA 1S2NA 5EVCA 2YICA 2GD0A 3LK6A 2I66A 3SOZA 4EY3A 3NVAA 2B4RO 3I6ZA 3HB0A 2QL7A 3D8HA 4PVDA 3C0KA 4L2IB 4QTZA 1TFUA 1W36C 1UWCA 3NYRA 2D5CA 2QI9F 5I51A 1N0HA 3OFJA 3VBEA 1XD2B 4OJTA 1N7IA 2G6TA 2WJ6A 4IM7A 1PT5A 2PR7A 2H31A 4DDHA 1NGSA 1P2DA 4GWGA 5D6OA 4B3TB 3NNDA 4TSFD 2AS0A 4YXWD 2RARA 2D0IA 4A82A 3A7DA 3DDHA 4QU5A 3HLYA 4N0QA 4XFJA 3ZTYA 3ROQA 1JDPA 3GWGA 3ZQJA 1L7MA 3AC0A 3KR0A 2Q6LA 4I4TF 4IJVA 2F1RA 5JVDF 4KXXA 3HKDA 1S7CA 1UAGA 3UMRA 1P0QA 1SMKA 4BP8A 1M72A 5AD1A 4IBOA 1GWNA 4UAUA 2Y93A 4WGFA 5F4ZA 5FRDA 2RJ3A 4H7FA 2TMGA 1RS0A 2WHYA 2MMGA 5FLKA 1A8HA 4WSOA 5CLLA 5JQGF 5LQCA 2G1KA 1W0JD 4MKGA 5CRIA 2F3PA 4CDMA 1UUFA 1W9HA 5A7HA 3RTCA 2P2DA 1U0OC 4Q5IA 1DEOA 3N6XA 4Q4AB 2FJPA 2H4FA 1L1FA 3T3MB 4LFBB 5JTTA 1RKXA 5B3AA 2V59A 1Z62A 1WQ3A 1NJSA 1NXTA 1E0KA 1E2FA 2PPVA 2XVAA 5JZSA 1W0CA 2BDUA 3ZU3A 4Y6PA 4LJKA 3S2YA 4I9HA 4A03A 2WTAA 4OATA 1XVAA 1WETA 1Y7IA 1DWUA 2JGFA 3E8XA 4KK4A 5JNWA 4HN4B 2ADFA 3LTNC 1H9CA 1F2VA 2C0CA 4Y9DA 3S2ZA 1IMJA 3H0EA 1HDEA 1GCOA 4ER0A 2PMDA 3IBCA 4DYVA 1IJFA 1WBDA 2EVWX 2PGJA 3OOJA 1ZGHA 4JR0A 4KQGA 4LOKA 2XUPA 5HF8A 1PTJC 3ANMA 4Q4HA 4GMFA 3U26A 1HWYA 4K0RA 3ZQUA 1P17A 4ITVA 5K3OA 2EBUA 2QMUA 3I04A 3RUEA 4ZAXA 3EIXA 3O2JA 2QN8A 4GL2A 2JAXA 3VM6A 1YS2X 5FBQB 1W88A 3TZLA 4MW4A 2H00A 2O3RA 3D1VA 4I4TA 4LRUA 3ZD6A 1YZUA 3UPDA 3GLGA 4LE0A 5ER6A 1ZD1A 2HUNA 4KQIA 1YAJA 3ABIA 3HB7A 3SM3A 1Z6GA 4XIIA 4UBMA 1BCSA 1N5LA 1O95A 3MGCA 1DXOA 3B1VA 2BUBA 1Q1QA 2I2FA 2VT6A 2ZWIA 2QT9A 2DSTA 3B9RA 3FETA 3HJAA 1U4NA 3UNXA 5JXJA 4U2FA 3CSUA 1UPXA 3KYJB 3MTGA 1JHMA 3AY7A 3LRTA 3M6VA 4LZNA 4EY6A 1QLHA 1WR8A 2D62A 1HYEA 2O2EA 3D3EA 3P9XA 5GP1A 2RGXA 3U80A 3BGOS 4P54A 4NRDA 1ZM9A 2QX8A 3II6X 1XRLA 2VF4X 5SZHB 2FYTA 2HRBA 4HXFB 3SYRA 4D3XA 4ERNA 1L6RA 3ILSA 5EHQA 4EHAA 3KJNA 3M5DA 2WM9B 3OF5A 2ZWVA 2R7MA 3PQFA 5BVGA 1JSXA 2EU8A 2Y76A 2QYHA 3PFKA 5J4HA 3UAXA 4Z53A 1QHIA 1RXWA 1UZMA 1Y8RB 3FKSA 3THYB 3OLZA 1PLLA 3KQWA 1ZY2A 5LA6A 4OB8A 1GZUA 4CLXA 4MARA 2D0DA 3G7NA 3OPMA 5I7WA 4F97A 2QE7A 3UAWA 3H0KA 4AROA 4XR4A 3D3WB 3GLTA 4J91A 1MO3A 3V32A 3RS4A 1Q6ZA 3BH0A 1ULUA 3I2YX 3IQEA 1YVEI 5JR3A 2ZJOA 5CBKA 4C2TA 1NXVA 1NDQA 1TCBA 1WSAA 1QH1B 2XIQA 2ZUVA 5C8YF 1JKJA 1NXSA 1ESNA 1VLZA 3UG6A 5IC4A 5BOVA 3V5NA 5JASA 1LU9A 2OZEA 2QVCA 4Q15A 1LW7A 3ER6A 3KKOA 3OY2A 2A88A 4MRRA 2IHVA 1ZCZA 2BFDB 1IL0A 3EW7A 4HDMB 1PUXA 4LAFA 4LZJA 3WYGA 4OEHA 2H1IA 3Q8LA 3OCUA 1GAQA 2C8LA 4MGYR 4CMEA 5HCIA 4UVIA 1CR0A 2NVWA 4JU8A 3NJ4A 1NQXA 2AXNA 3GJ5A 4R8LA 1ABBA 4N7JA 4EJ0A 4CM8A 4NZYA 1RRFA 4DKXA 1XRJA 3CB4A 3BILA 1IRXA 1M34E 1NUPA 4URUR 2FWMX 2NLOA 3RSHA 5L4NA 1G59A 4KXVA 2A9RA 1RXYA 4DG9A 3ONVA 1XMVA 5LLDA 4AQ7A 5JUWA 1OAOC 3U44B 1VYHA 2BFCB 3PXAA 4FKBA 2R6HA 1K3TA 4M1EA 5PNTA 5JEEA 4BNJA 3H3JA 2NMVA 1FQOA 3Q9SA 4I8XA 5H3CA 5LZ9A 2ISSD 1V48A 1K7FB 2GN0A 3KZ1E 4JBLA 1FP7A 4WCVA 1TW2A 4A8JA 3N2GA 2B7CA 4OJMX 1KJNA 3DJFA 4ABYA 4EAQA 2VDOB 2BHRA 1OH5A 3RC8A 2XA1A 4EHBA 5CU7A 1ZK4A 1CX9B 1E79A 2A57A 2H2WA 2JFXA 4JJ4A 4Q82A 4BE4A 4YPVA 3A6HA 5L7WA 1C41A 3ZGVA 4C7JA 5C4IA 1OROA 3ICOA 2VK8A 3OPXA 4LYYA 5CLQA 4UHCA 3W7VA 2H6EA 3LQQA 9LDBA 1V3UA 4B33A 5BV1A 2J07A 3B2QA 4ZXPA 4G23A 1JFRA 3DDWA 4P86A 5LFAA 1THMA 4DE5A 1JSZA 5JADA 4NICA 1Q0SA 4QKQA 1NP7A 2QVYX 5CD9A 3I62A 1CFJA 3E15A 3N7TA 3FYTA 2DBRA 2QAGA 4QU8A 3W9SA 3R76A 3ZLBA 2GPNA 4CKEA 1BJTA 4BRUA 1WV1A 8GPBA 4AAYA 2XMDA 5GIPE 1NUTA 3F49S 3LHFA 1F8FA 1LJLA 1TAHA 2J5KA 3MWEB 1NVUQ 3VR5A 2XZTA 3E1SA 3R3YA 2J7PA 5E95A 1Z75A 4JQOA 5AOBA 5IKXA 3RRJA 2BEWA 3U13A 3BWEA 4XQEA 2FWAA 3B7GA 5F1PA 5JD4A 4C22A 1DOAA 2RB5A 2XSZD 3AETB 2B2XA 3D2CA 2XUIA 4ID3A 1T29A 2FAXA 3LFUA 2FP4B 3AEKB 4OBXA 4R7GA 5EUBA 2BGNA 2Z9DA 2WFMA 3WWCA 4C30A 4IYJA 3U31A 3HMQA 3SC2B 3BB4A 2WPDD 2AEEA 2CJXA 2J3JA 2BAGA 2M2IA 3AK4A 2C5BA 1PR0A 5D3MA 1DUIA 2IDMA 1KE2A 3VTFA 2NYUA 2ZCUA 3BZWA 2IF2A 4J2HA 1W34A 4IGKA 1U3WA 1ZICA 1M6VB 1NZJA 3NHPA 5DXFA 2EJTA 4N8SA 4AS2A 3O8RA 2ROQA 2UVPB 1SIUA 2ZTLA 2YCBA 3SJBA 2HMVA 3UJCA 2OCYC 4MX8A 3UYKA 4UTRA 4KMMA 1JFTA 3GVPA 3CX8A 4FX2A 3W79A 1JH9A 3QEOA 1V9LA 1GQOA 4MZXA 1MAHA 2B35A 4YWJA 4JJAA 4EF6A 5KWIA 3WA7A 1RKUA 2DBZA 3NT4A 4R1UA 1AJEA 1TK9A 4O02B 1E5QA 1EDZA 4LNHA 4JLKA 3G8CA 1ZW1A 2UVPA 3KO8A 4P38A 1VLLA 5IWCA 1BO6A 3DEKA 3B1ZA 4JH0A 3EYAA 3G0BA 3K8QA 4WD3A 5BSTA 4C21A 2IH4A 1OFTA 1P0CA 3AUXA 1VZ2A 4QJIA 4A8JC 4CQLA 4F4UA 2J48A 2VDNB 2VBGA 1EUDA 3PCRB 1KJ9A 2L69A 1QOZA 4IO0A 2BGMA 2ODWA 1PAUA 4DIBA 3FWKA 4HGQA 2HSDA 3AR6A 2OG1A 1O89A 4ATNA 1MIOA 2XOKD 3A8TA 3T3GA 4UE3S 2FZVA 4JI4B 1WMFA 5KHOC 5K1ZA 1UMBB 4ZVUA 1HGXA 5C7YA 2FEMA 5CDHA 2QTGA 4TYWA 1KRWA 1U02A 1O96B 2AZMA 3K5HA 3VSDA 4DMMA 1JIXA 1VIMA 1XLVA 4FXPA 4FM9A 5TS3A 3O3NB 4OQFA 4E88A 1DO0A 1WUYA 3Q3HA 4Q21A 4QFDA 3M6FA 3MFYA 2F9FA 3NEPX 2JI8A 5KQMA 1L5WA 2PGOA 3UT5A 1T3GA 4ENRA 1N1DA 3FCXA 3JCZA 2CLMB 5EMJA 1S1CA 2B21A 1E32A 2VHCA 3LT5A 3PGKA 4JEIA 2WKRA 5KNDH 3LC2O 4I5DA 3MGGA 4QYSA 1E60A 3RTGA 4E3ZA 5ALDA 1E1CB 2GHRA 3BKWA 1KZHA 2ZYVX 1GR0A 1XZ8A 3KUXA 1V3QE 3DZGA 4MQ5A 1EVKA 3QEMA 3UXYA 1O6ZA 4EGCB 2ZIEA 3VR3D 1A8SA 3WSWA 3F7OA 1D2HA 3F6RA 4K1XA 1DT3A 3OX4A 4KQHA 4Q6BA 5HKOA 4DJAA 2NXNA 4IIJB 1DOHA 2WJJA 4GMGA 3EIOA 4MR9B 2CJPA 3L8CA 2Q5QA 3CLVA 1DDGA 1LBTA 1TKAA 3JQBA 3JYLA 4HLUC 3FWYA 4LY3A 3WMXA 2Z2JA 1NBME 2YVUA 2CLDX 3SEQA 3UAGA 1OAOA 1YRHA 4JVOA 2XWQA 3EQ2A 4Y6RA 3IUJA 4D96A 1UFKA 3IAUA 1JJIA 4GKAA 5JT1A 4IV5A 3TXXA 3LQYA 4KI0A 4PV7A 2W42A 2YOHA 2V97A 1VPLA 4NCNA 1HQCA 2CW5A 5EVJA 3THXB 4RDHA 2XB9A 1TL7C 3GLIB 2MSLA 4K2HA 4TVKA 1MO6A 3KQLA 1WD7A 4PNPA 1BDMA 3W2EA 4W5NA 3VGPA 4EYOA 2HY7A 3WB0A 2V7WA 2V3VA 3ILHA 3G8DA 3KX2A 3P9IA 3PF9A 1L5FA 4X54A 5AIBA 8ABPA 1ZZGA 1SBZA 4JUCA 9LDTA 5DM1A 3CNLA 5EA2A 2AN5A 2Q4OA 2BEUB 2WT9A 3AZPA 3GAZA 3ZDDA 5A05A 1DG3A 5JH7B 2E6KA 1QPBA 1EIWA 1Z4QA 1AXEA 1SWWA 2PKYX 5T57A 3R6GA 3W5SA 5KNBD 4LF9B 2EHDA 1WY5A 4WZBA 3L46A 4NPCA 3PFBA 1MBZA 3DVAB 5IFKA 2OPHA 4AJ9A 4IV8A 4K86A 4EGFA 5CW1A 3HEMA 1R88A 1FX1A 1W1IA 2QTFA 3BULA 1IPFA 1KOLA 4Q1AA 4BMXA 2SKEA 3W2GA 3CH5A 1GYPA 1SIBE 4HEHA 4N12A 4YXFA 2QUIA 5CFQA 2JJYA 3HB4X 4Z4CA 3GPIA 4BE9A 4Q3DA 3J81A 1YR9A 3H65A 4O1MA 1W5FA 4RAQA 1YAHA 2GCIA 3TNLA 2YV3A 4F3TA 1A8IA 2MSDB 3DR3A 4TMFA 3E22B 5F2NA 3R09A 4X5OA 1CF4A 2PUBA 5F9FA 4BWGA 3I23A 3R1IA 1XCPA 4KIUA 3UANA 1IWPB 1KFJB 3RYTC 1GUDA 4DSNA 4CM7A 2DETA 3VPFA 4FEEA 5AFSA 3ZE8A 1Z7WA 4UREA 2HCRA 2VL7A 1G7RA 1L4NA 1NMEA 1GL9B 3NT2A 3S1AB 2FMUA 3OTIA 1BA2A 4D0GA 4CF7A 1K8QA 1ECFA 3K0BA 2GWRA 4TS4A 5LU9A 1KFKB 1V45E 4NPAA 5DHPA 5IBRA 2WU4A 3BE8A 3AWIA 4M21A 5AI9A 5CNJA 1LSSA 3M9WA 3ADOA 5IAAA 1DXYA 1GKUB 4F3KA 4ISCA 2JH9A 3CLKA 4G4IA 5CDFA 4D8XA 3KXDA 5FFMA 1EFKA 3AGQA 1OR8A 5AKXA 1HDZA 5BYJA 4ZV9A 1MCZA 5AI8A 3RVKA 3BZBA 4CDNA 1D5CA 1GZDA 1MVOA 2CLIB 4MWTA 1J9ZA 2EXXA 3KLMX 4D80A 4QUBA 4ZO7A 4KPEC 1O6CA 3RVLA 3TCNA 1E5XA 1MA3A 1COWD 3MELA 1WXQA 3S99A 2XT6A 4J0FA 4BBZA 1AKRA 4AZSA 4DSOA 4HWSA 3A1FA 4JOCA 1AF7A 3ZWVA 2IYQA 4QXMA 2I99A 1UANA 3GRUA 5DSZA 3KPYA 3JQ8B 1HI9A 5KNBA 3B6ZA 4JOSA 2CDAA 3F6SA 3I37X 4ERXA 3GP8A 1DJMA 1XMOB 2QN3A 1B2RA 3IQZA 4L0CA 3MS2A 5JAZA 4INJA 3DWIA 3ORSA 4I66A 4R9SA 5E8JA 1Y8QB 1DAEA 1JQEA 4GBGA 3WGMA 1LPAB 1ZISA 2GQ0A 3PC4A 4JJ6A 2OE2A 2YZGA 4JLVA 1W5TA 4LC0A 4MMXB 4LSGA 4RW0A 1SBTA 3QXSA 5K20A 1GKIA 2AD1A 3HV2A 2Z6VA 3CF4A 1Y0BA 1F5SA 1DBPA 1KS2A 1N6LA 1IRIA 3K0CC 4UOEA 5I4KA 3ENQA 4CQMA 4UMFA 4IH4A 2FW1A 2O20A 2VDRB 1SC3A 1I01A 4OQMA 1L5VA 2XDWA 4V0ME 1WU7A 2Q5EA 4B7UA 3H1TA 2BFCA 1SVKA 1L5NA 5JPIA 5IC6A 1BXRA 4P92A 3QFTA 4XUEA 5CLJA 1H0SA 1A5SB 1F0KA 3BJZA 3VI3B 3SIXA 1QS0A 1G20E 1NJ6A 1F6WA 2JLUA 2W11A 1XFDA 3UJ9A 2Q3MA 1N34B 2TECE 3AVQA 2GCNA 4G36A 4MPDA 3KLPX 3LU1A 3ZE6A 4BC1A 5IW8A 2HHLA 5CNMA 5F7JA 1QV9A 2Z58A 2ZULA 3BEDA 4L07A 4YV7A 2LPMA 4PSCA 5FA8A 1QGYA 4RYDA 1V35A 2CEKA 3DPUA 3HBJA 5I01A 1LK7A 1GGJA 3O82A 2HX1A 2V5UA 5LA6B 2VSFA 1LW6E 4IXNA 2JG3A 3Q15C 2H4YA 1H3NA 2QSYA 3LECA 1XEFA 4XYEA 2IDKA 2Z3ZA 3AY3A 1BQ4A 3BG5A 1GGMA 3G9QA 4LY9A 2R1TA 3CZAA 3G9ZA 3IPXA 2YCLA 1CJTC 3DZIA 4GKVA 3TTYA 2J1LA 4ZI2A 3THWA 1QMGA 3WYDA 4OQLA 4ZT5A 3VJRA 3K09A 1GFSA 1PKEA 3C2QA 1NP6A 3VO9A 4ALNA 5ITSA 2AE1A 3A28A 4Y9UA 5IJXA 2CDNA 5AKZA 1RBZA 4TKUA 1TM3E 2C2BA 2OCIA 2V7QA 2VQ3A 2BFBA 3DH0A 3RM3A 4EYEA 5I6DA 5JPDA 1X80B 3EZ6A 3RVPA 2GF0A 2JCVA 3PITA 3PKIA 2WU3A 5IARA 3HK2A 1HORA 4D5EA 3C87A 3LQRA 5IEJA 3C1AA 3EISA 1RC0A 2FWPA 2PM8A 5K0TA 3RJ5A 4CIBA 3GLSA 3ZUGA 1QYRA 3SQNA 4XSGA 3TQRA 1F7VA 1GRCA 4N0EA 3OEEA 2WF5A 2FTKE 3LMKA 1LDEA 5DEOA 4WBNF 1NVVQ 2OV2A 3AF5A 3OQ1A 3TB4A 1HT0A 2GNOA 3E4CA 3WLIA 1KZ6A 4IDAA 1OTXA 4G5QA 4TWRA 5ES4B 3L1KA 5JSZB 4E5SA 1E6UA 2FV8A 4G97A 3SXUA 4A0QA 5FPYA 4NYMR 2VDWB 1L4YA 3ETHA 3O4RA 5DXAA 3DNMA 3SM9A 4CL8A 4EUEA 4FQ7A 2VJAA 5B3JC 2IWHA 1JTFA 1EX6A 4GBMA 2XMPA 5CH3A 4AJIA 2HCBA 1YS6A 1XTQA 4UASA 3PNLA 2D2EA 1KAEA 3GDOA 1UQTA 3OLCX 2RFLA 3CMCO 3Q7EA 2RGEA 1AKQA 2EBHX 4QUAA 5TV2A 2ICAA 2HA6A 2WUWE 3SC3A 3CC8A 3NYIA 3WQHA 2PL3A 1E99A 1V5IA 1XDBA 1B4DA 4RJ2A 4KTTE 3ZQKA 2ZRDA 3BHIA 5IXYA 3OOSA 4HH0A 2APJA 4F4IA 3V7WA 4HZUB 3B82A 5DULA 3AU8A 2QP3A 4PFJA 5EZQA 4CN9A 5JRDS 4EELA 1L1EA 2QX9A 2Z5LA 3ENZA 3OF2A 2VPPA 3Q0IA 4KO2S 4MPRA 3REOA 3HTXA 3FA2A 4WL0A 1MAUA 2VWQA 1DKOA 2MJLA 2OM6A 2QE7D 3RDPA 4EKGA 1VJ5A 2RGNA 4B6QA 5EPOA 1U1GA 3SKVA 1KZ1A 4DC9A 1GZ4A 3VSAA 1UOQA 4TKMA 3FCOA 3EEYA 1A95A 4DAOA 3KUDA 3K70C 1OYVA 1WHTB 1TQ8A 3B1JA 4BE7B 4IFEA 4CIWA 2JIDA 1DQSA 3ERCA 1V8PA 1UMDB 1Z8HA 3Q3JB 1ZN9A 2R6DA 2R44A 4G41A 2YRXA 2A0WA 1KEVA 3DQPA 3C39A 3IESA 4PICA 4R84A 3ZV5A 1GQRA 4PAGA 2VP9A 3H42B 1S9DA 2W43A 3QV1A 1V95A 3UCEA 3HCWA 4O2BA 3BB1A 2O2JA 3A05A 3FYUA 3SXPA 5D5HA 1PK7A 1S2DA 4QOSA 2QUJA 1SJ9A 5L51A 5AKHA 3L6DA 4R2JA 4ECEA 2HJGA 3C3JA 4J49A 3AJRA 1ADYA 3QOFA 4EB6B 2WM3A 3MWGA 4GPTA 2X9NA 5CIWA 5A02A 3T3OA 1N2EA 4F2DA 4RSGA 1I4EB 2X6QA 3IULA 4TTVA 2BGIA 1L7EA 1VHQA 4DWWA 4TVSA 3BHMA 2BLNA 4RA6B 5LCXA 1N1GA 1JJAA 2BI8A 2IU6A 2VOJA 3PNMA 4DCGA 3QKIA 1BGVA 3LCCA 1C9EA 3VC1A 3WIEA 4LDNA 1BWSA 4PXAA 1D8AA 2W7TA 2I2WA 3DAYA 3PZBA 3KXIA 4G1FA 3KQHA 5B58T 3H8JA 3P5SA 4GOXA 4EMBA 1JEYA 4ZRNA 1E1YA 3F7TA 3FPAA 2P5SA 4JNKA 4UHHA 4AVYA 1JDVA 1VSBA 3IDOA 1G8JA 1OI3A 2GAJA 3BD8A 4GM1A 4GQIA 5FI1B 1O5IA 2ZJ0A 4P83A 3DB2A 3KAJA 1EP2B 3B9PA 5K01A 4KI7A 1Q77A 1GG8A 1ZM3A 1GNRA 1HG1A 2G25A 3H3FA 3L7JA 4UPVA 1G4HA 3FF4A 5BWLA 5KIAA 4LWQA 3PI7A 2GERA 2GN9A 2JFBA 2OVFA 2XGSA 1I3OA 4K9PA 1TFRA 3RU3A 1GV1A 4IEEA 1Z7EA 5JNUA 2YKGA 2H8KA 3K1AB 2E7ZA 1Z45A 1DUSA 2JL1A 3L0BA 4Y18A 3L01A 4QPNA 4O5AA 3BWDD 2PV7A 4NNOA 3L04A 5A06A 2I9KA 1N3YA 4Q03A 2IHUA 4ALJA 1MDFA 2IJGX 2UKDA 4RD2A 2MOKA 3WGKA 1VKHA 1ICEA 2Y99A 1G0NA 4GX2A 3VOBA 3WL8A 2V5AA 2XRMA 3C4VA 2PGNA 1RYFA 2ZB7A 1G18A 2HMSA 4BVEA 5KOHB 5IT9A 3C3EA 3NBXX 4K9DA 1Y3CE 3DO5A 1GPDG 4LMAA 4NZZA 4XLLA 1AO3A 4JUDX 1B3BA 3B8HA 3T4EA 2UAGA 3T61A 4D4JA 2PUCA 2OB1A 3JR7A 3U3KA 3CLSD 2P75A 1Z2NX 2EGUA 4UTNA 4EB3A 3PXBA 4DLNA 3H4TA 1RQRA 4X7PA 4NG5A 1TT5A 2HJ9A 3GEPA 1VL6A 3D6VA 1B6TA 1YJ5A 3DTVA 5DBGA 2JKVA 3TFWA 3A0UA 5B36A 3QPUA 1WNFA 2OP0A 2IKQA 3RC3A 1E3DA 3UMSA 3ZXYA 4CM4A 4G0VA 1D1TA 4A0GA 4E22A 1PSDA 2F3SA 4NG4A 3T7EA 3E22A 5JAIA 4IHKA 4DSUA 5JU6A 1MU0A 3OX1A 2RH8A 4EGAA 4YMGA 1DVRA 2H1CA 1DRVA 2AWNA 4RD6A 1HZZC 3I76A 2DZDA 3IGFA 4BVBA 1IN4A 3T0FA 2XQVA 3EMDA 4U7PB 3NHMA 2FUNB 5AKEA 2HT1A 3N7AA 1XRPA 2OAEA 3NEAA 2V6JA 3IBFA 1BE1A 4ZMBA 4LC1A 2C3MA 2QN2A 3K2QA 3D3NA 4GPZA 2VSQA 1Z17A 3ZDQA 3FIJA 1ECBA 3W6ZA 4OQYA 4PLVA 1BEEA 4G0NA 3QF7A 3VNQA 2G28A 1PFGA 1RQ2A 4MW2A 5HE9A 3T5GA 2V45A 2ZB3A 2YUTA 1ZMRA 1Y4DE 5FI5A 1YDEA 2EIXA 4UNSA 3PHIA 5H7XA 3C1UA 2QRKA 1XCGB 3IAM1 1YUNA 1MX1A 5EKXA 2FFQA 3H5VA 4FB5A 2OCDA 4X3CA 5GZ6A 2HPHA 1LDNA 5KYUB 1LQTA 1A1VA 5ERGB 4RKWA 3GT3A 3TLBA 5F7ZA 4AJEA 5IM4A 5JJCA 4RTJA 4YUXA 4OI4A 4W8GA 1EVIA 1OZ0A 2WAXA 1E2JA 3PK0A 5IHXA 1CEEA 1DC6A 1HNNA 4KW7A 2QSJA 1Y1PA 1Y4AE 3QXXA 1H85A 4AY4A 2RHBA 3CY6A 4N8EA 4R69A 1PJCA 3P0JA 3Q9UA 1DELA 3KAPA 4KXWA 4CW7A 3ETCA 5C9ZA 3TNFA 2MINA 1P7ZA 1Q44A 3LX5A 1YJBA 2FCRA 1QK4A 2CJWB 4E7PA 3PXEA 5GMOA 1TIPA 1J33A 5FTWA 3FTCA 3H4IA 1E18A 4L5BA 5CK4A 1BYIA 1R4MA 3NHAA 3NTQA 4HNGA 5BQXA 3WRVA 1F3LA 4RMJA 4B7AA 2J9GA 1KFEB 3DC2A 3T15A 4DDMA 4TMXA 1K5PA 3F5MA 4TSFA 1S8FA 1WKVA 3IAXA 4GFDA 4HYEA 4LSWA 3B12A 4UCWA 1JI3A 3G85A 4W7HA 2FWIA 3SMVA 2KHZA 2VHTA 1U2RA 4Q4LA 4RHXA 2O8DA 5BY2A 2Q4RA 1KO7A 2DPMA 2P30A 2DUNA 2FGKA 3IBYA 2W6OA 4N7MA 4O4HF 1TYBE 1Z33A 4X9XA 4WOPA 1MRSA 2IYSA 4WXHA 2J3EA 4E0BA 4TN1A 1S01A 2PXXA 4Q3AA 1G9TA 2A67A 1BE0A 1JBKA 1KYYA 4G86A 2Q41A 2WG2A 4DV3B 4ENTA 3FJYA 5B58C 3W5VA 2D6FA 1UMKA 4PQFA 2JHFA 1QF6A 1VOTA 5AICA 3PWTA 1L3BA 4ISBA 2R87A 3FAZA 1Z0UA 3VNSA 3DFMA 3OF3A 3L6EA 3SZUA 2XCSB 4QPDA 3K4HA 5ARCA 3WLAA 1L7XA 4V1CI 1CYEA 5AMXA 3L5KA 3OQ6A 3PJFA 2G1JA 4MS4B 4BKRA 2XKKA 6YASA 2C2HA 1YI0A 2Z2IA 4WLEA 2YJ4A 1KC3A 4CV0A 3EPLA 4HDRA 4FCVA 5GJWC 3ACBA 5TR9A 1GCAA 5HGXA 1T3ZA 2M6SA 4P34A 1PV4A 2PX6A 3W1EA 1E6MA 2HEGA 2O3UA 2ZOSA 4W99A 1FDUA 3DL2A 3SIPA 3M5PA 2VUTA 4X95A 2ST1A 4KQCA 1X42A 1ZGZA 2OUIA 3D3KA 2AFHA 4UJ5A 1N75A 5DTEA 7MHTA 1C1HA 1OFGA 5JD5A 1OWPA 4UHEA 1WSBA 4Q48A 1XZLA 4EA6A 2YFKA 5EE3A 4HDCA 1LDBA 3RAPR 1M8PA 4IIYA 1CW2B 2HJSA 4CLRB 3FCCA 3ZY3A 3A1TA 5BPFA 3OKAA 3CONA 4C3ZA 1Q14A 2X9LA 4ARBA 2DY1A 4JL8A 1AHNA 3I45A 1G60A 4MHSA 4YRJA 3AVUA 1ESCA 4JR1A 4OQEA 3TCKA 2X5JO 3GJYA 3Q8XB 5J58A 3CWQA 5FOTA 1CJKC 1ID8A 3BWMA 4EPTA 3OTWA 1RYHA 5B55A 5DDIP 3JQGA 3IXQA 5IVIA 3AG5A 1PFUA 4DOMA 1TUIA 1T43A 1NUAA 2CXXA 3HCFA 2CDBA 2JI4A 3GA5A 2DU8A 3TQHA 1R4MB 1P7CA 1ZOSA 1CC1S 3DFFA 3Q12A 3TJMA 4CL0A 5IN4A 2ATCA 4QTXA 1QF7A 3IT2A 3TO5A 1GT6A 2I71A 3KJEA 1GD1O 2ZT8A 2C29D 5KJCA 4OMUA 5DHRA 2AJBA 3E70C 1ADCA 4LW8A 1U8EA 3BX1A 2WV7A 3JZAA 4FE3A 5ALWA 2HDNB 3OQMA 2ZE8A 4C2UA 2ONKA 2OB2A 4PLCA 4ZTZB 1NW4A 5CDGA 2WV9A 3IUMA 5JMOA 3D0OA 1VG9B 3BXFA 1KO8A 1KERA 5TPZA 2ZDHA 1LCIA 1DRKA 5BYAA 2SCUA 1DCTA 1JB1A 1M9NA 2J3HA 4YYEA 2DB3A 4HBGA 3BPSA 1RYBA 4XX0B 2OENG 2GVDC 3WKAA 4HI0E 3RADC 1U2EA 3RUCA 3UV7A 1JMYA 1R12A 2GHIA 3TIGA 4DLSA 4XSVA 1VB5A 3VSCA 4RORA 3CR8A 3ZDCA 1H1DA 4BZZA 4ZHSA 5LKRA 3D54D 2ZYTX 1IWOA 5H8WA 5CVVA 3SR4A 3V3KA 4OB6A 1VGRA 4GUAA 3W5IA 5KUTA 2GPJA 4MKRA 4QE3A 1TEZA 4B6PA 1IBKB 5AJYA 1H8HD 3QHPA 4YO7A 1FLNA 1LA2A 1NNSA 2DPXA 2XWJI 3JARB 3R4VA 5K8JB 1VB3A 4IQ4A 2BELA 5DGIA 4Y2TA 3VZSA 4X64B 1HT3A 1E6KA 4M1KA 3AF3A 3BIOA 4EHNA 1TZ2A 1W46A 2W98A 2WD7B 3T5DA 5J43A 2FQWA 5LQNA 3K30A 4YK7A 1YZ3A 1Y42X 1ZC3A 2GAOA 3C4QA 3PX3A 4PLZA 4PZLA 3HBLA 5HZKA 3HJUA 3X1MA 5I7FA 4EEKA 1ZAKA 2OFFA 3FGOA 4D57A 4F1WA 5IDYA 4K6GA 4URZR 1ZDMA 2F90A 1RAHA 5EIOA 2QJWA 4DA7A 3CKLA 3DBIA 4GMHA 3ROEA 1YB7A 3WGOA 3GZNB 3W5UA 2XRFA 4IICA 1IPHA 4Y2YA 3MUOA 3PUYA 4AB1A 1SC6A 4QQNA 1U7TA 2I2XB 4PPYA 4JT2A 1ATZA 3KT8A 2H1LA 2WIFA 4GPAA 4E4RA 5B7GA 3ZHXA 2JFOA 2PWYA 1WY7A 2DWCA 3E61A 1VHLA 2A0KA 2XUQA 3OBBA 2EX1A 4PG5A 4ZJUA 4PLPA 2HB6A 1PT7A 3A0RB 3LL4A 4N8DA 2XE6A