3D2CA

Structure of 4d3, a thermostable mutant of bacillus subtilis lipase obtained through directed evolution
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
179
structure length
179
Chain Sequence
HNPVVMVHGIGGSSSNFEGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKYLDGGNKVANVVTLGGANRLTTDKAPPGTDPNQKILYTSIYSSDDMIVMNYLSRLDGARNVQIHGVGHMGLLYSSQVYSLIKEGLNGGGQNTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Thermostable Bacillus subtilis lipases: in vitro evolution and structural insight
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Lipase
total genus 72
structure length 179
sequence length 179
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2008-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3d2cA00
3IB3A 1EB9A 3I1YA 4AMZA 2ZYSA 4X6UA 2IIVA 4LYEA 3FBWA 3DEAA 1QTRA 2GYWA 2QR5A 5C8VA 4HS9A 4G9EA 1ZIYA 2ZSHA 4KAFA 2BCEA 5DNWA 1HLGA 4W1RA 1ZI9A 3C70A 1ZGBA 5DWDA 1XZBA 3WL5A 1XLUA 2WG0A 3FSGA 3T4UA 3BL8A 3TJMA 1Q0RA 2BUBA 2WJ6A 4FOLA 3SC2A 3R3ZA 2OG1A 3C87A 2C0PA 3F67A 5AK6A 5E4JA 4PQEA 3A70A 2Y6VA 4U2EA 2XMSA 3TGLA 1MAHA 3I2JA 3K9BA 4Y2VA 1UOOA 1QTIA 1DX4A 5DYTA 1EVQA 3MUOA 2NW6A 1O6GA 1CUVA 5ALSA 4BCDA 2PU7A 1MT3A 4F21A 3CXUA 1VE6A 1XZKA 1SC9A 1QZ3A 3RM3A 2HU8A 2WU4A 5ALJA 4EY7A 2C4HA 4K6KA 2FJ0A 1XKTA 5LZ7A 2DR0A 2GZRA 3G0IA 4CG2A 3H2HA 2Z3ZA 3GELA 5EGNA 5KWIA 1LNSA 2PSHA 4WY8A 5LZ2A 1CUCA 4LXGA 5HCUA 4BRZA 5FPQA 5HF8A 4UBKA 3WL8A 2PBLA 1BN6A 3HI4A 5AI9A 1YS1X 1IUNA 5AO9A 1CUSA 4XWGA 1LPPA 4DMCA 3DLTA 3HSSA 4H7DA 2E3JA 1CV2A 3G02A 2OQVA 1ZGCA 4GHWA 2PSDA 1F0PA 3WI7A 2CJPA 4LIPD 4L3WA 4FLMA 1CFJA 3JWEA 5ALZA 1LBTA 1P0IA 1MJ5A 1YAHA 4PW0A 1IUPA 3O4JA 3QYJA 1ZD3A 3WA6A 4Y2JA 5ALGA 3PDCA 1GPKA 1R4ZA 3C5VA 1OILA 4JH0A 2QXUA 1DWPA 4LYDA 5AK4A 2WU3A 5JASA 1LZKA 2DCMA 4KE6A 2XMGA 5ALLA 1XRPA 5JAHA 1UXOA 4WDQA 2OCLA 2WQZA 4H35A 3W2TA 4RE5A 1KEZA 2PSJA 4EY6A 1W1IA 1THGA 4GW3A 4B6GA 5ALKA 5I9IA 2ZVDA 4B83A 2JEYA 3QMVA 3A2NA 5HF5A 2CZQA 4C6HA 4A23A 3EIOA 2RHWA 4J0CA 3FSGD 1IZ8A 5EHZA 2HIHA 3WL6A 3H0CA 4CCYB 2R11A 4MEBA 2Y2VA 3VJLA 3WWOA 2ACKA 3AUKA 1GT6A 4U2FA 2WHQA 3ICVA 4MQMA 2VQ6A 5ALUA 4BC1A 4PSUA 5JZBA 3M82A 1GKKA 4QNNA 3B5EA 4KE8A 4I3FA 3I6ZA 2BFNA 4Q3KA 4ZGBA 1Q0ZA 4CCWA 3QPAA 5CH5A 5A6VA 2WHPB 4X90A 4FMPA 4DMHA 1AQLA 2GZSA 1E66A 5AKKA 1H2WA 4M0MA 4NMWA 4LXIA 3M83A 4QDUA 3TEJA 1CUDA 5BV7A 4J0DA 5HF6A 3M81A 3ANSA 4CG3A 2RI6A 3NWOA 3A6ZA 4RPCA 5KWJA 2HA5A 3I2HA 1W6RA 4G9GA 2OAEA 5A7HA 5ALDA 1YB7A 4FBLA 4N5HX 4N8DA 2XUKA 5HKBA 4EY8A 1JKMA 5FUMA 1JJIA 3FCYA 3M3DA 3EF3A 2WIGA 2FJPA 1E5TA 2Y2UA 2WG2A 4BVJA 1UOPA 1JJBA 3RLIA 2WUDA 3PF8A 3G9ZA 1WB5A 4IH9A 3DD5A 4MEAA 1ZOIA 2XUHA 3HRHA 4C89A 1ZICA 5IVDA 4Y9SA 3VJKA 3GUUA 3EQ9A 5AM5A 2DFPA 4OB8A 4ROTA 3WA7A 3GFFA 3D2AA 1SOMA 5T4HA 3QMWA 5T4FA 1CUZA 5ALMA 2D0DA 5FXMA 4DNFA 1ZJ4A 1JMYA 3R3VA 3D5EA 1UK7A 1P0MA 5I7UA 5K3EA 4Q34A 1BCRA 2OPHA 4GECA 2BJHA 2ROQA 2QMQA 5FDFA 5C8ZA 4HRXA 3DL7A 2ORYA 4WFIA 2C5FA 1HKHA 4EB0A 1F8UA 4C87A 4QDOA 1XQXA 4MWTA 5CT8A 2RAUA 2OCIA 2PM8A 2G63A 3P2MA 4OYYA 1ORWA 2C5GA 2BUCA 1MU0A 4UPDA 2WFLB 1AKNA 4U2BA 5AK3A 4KACA 2K2QB 2WLSA 3A2LA 4UBIA 3H1BA 2PL5A 4Z49A 1WOMA 4Y2XA 4XX1A 4JUIA 4DMKA 5ALIA 2VATA 3ED1A 4GWLA 5CRIA 3H1AA 4W9RA 1FSSA 3L1IA 3DYIA 3FOBA 1ISPA 3O4GA 1EDEA 1A8SA 2WUFA 5DNUA 4X85A 5BWCA 2PVSA 1AGYA 4U2GA 1MPXA 1XKLA 1G66A 5J3JA 3OPMA 3WIOA 4K6GA 3WK4A 1R88A 3QMMA 3RKSA 5AM4A 4BAZA 4J0GA 1MNQA 1JJFA 3I2IA 1AX9A 2HFJA 4KYVA 3WK8A 1XLWA 3C45A 2WKWA 4BTVA 1X70A 3I2GA 2YASA 4HXFB 1TK3A 5EHNA 3WK9A 1WB6A 1TIBA 1EHYA 1DQYA 2QS9A 5I8PA 2WFLA 2HA6A 1BRTA 4EHBA 1MAAA 2QUAA 1E8NA 3O9MA 1DINA 1C4XA 1CUUA 3V48A 4M0FA 5AP9A 4EZIA 3IBTA 4X95A 2H7XA 5KREA 4GEGA 2QM0A 3DOIA 5AI8A 2JGEA 3F97A 5AKIA 4L72A 3OM8A 4G8BA 1CUJA 4TGLA 2ZYHA 3QVMA 5ALTA 5AM0A 1XRLA 1U8EA 1LBSA 1QIJA 3KD2A 3DNMA 1Z68A 4AX4A 2WTMA 4DSAA 1AC5A 1BE0A 5DLPA 2XMQA 4JYPA 2VAXA 1XZGA 4B9EA 3NUZA 5C7YA 4CIBA 1XRRA 4G5XA 5AICA 5EIEA 5K3AA 4WJLA 4DNOA 5ALYA 4E15A 4ZV7A 4UBJA 4B80A 5JAPA 5AOAA 4QE3A 5LZ9A 3PICA 3LP5A 3G8YA 5JYCA 5DYWA 4W1SA 2O2HA 2XUJA 3E4DA 4UHDA 1FFCA 3R3XA 1MX9A 1H22A 1H2ZA 2WIDA 2XT0A 4H7KA 4AO8A 4BE9A 1T4MA 4B9AA 3U0VA 5IVKA 2HU5A 3QPCA 4X3CA 3MUNA 4OB7A 1K63A 2WSLA 1NU6A 2RHTA 4OCZA 3RK4A 4A16A 1U2EA 4N8SA 1VE7A 4LXHA 2C0QA 2HHAA 2XUPA 4F60A 3AILA 3LIIA 2XMBA 2HA0A 5D3KA 3WK7A 5HQ3B 1WHSA 3FYUB 4G8CA 4EY5A 3FNBA 4KJXA 3C8HA 3AFIA 4KR0A 2AJLI 3E3AA 3WK5A 1C7IA 5ALWA 5BOVA 4Y2TA 3AZQA 4INZA 2OCGA 5E4TA 5LZ5A 1TAHA 3STVA 5D7BA 2Z8XA 2HDWA 2QTBA 2H9YA 1BCSA 3E0XA 1QJ4A 4H0CA 1E8MA 2ACEA 5AJHA 5AI0A 1QONA 4QZVA 5IH7A 3HXKA 2PSEA 3G0BA 3C43A 1W76A 2CKMA 2B61A 1LGYA 3DKKA 2QZPA 3UUEA 4A5SA 3G9TA 1PJAA 3AZPA 2OGTA 4I4CA 5FOQA 4OSEA 2VJDA 3FCXA 5JD5A 3I6YA 1UKBA 1AZWA 5YASA 1OXMA 3O0DA 2OXEA 1MX1A 3SWWA 3ZI7A 2VJBA 3U1TA 3C6YA 1CUIA 3D2BA 4YPVA 4QEKA 1HQDA 2V96A 2QUBA 3H04A 5T4BA 4BCCA 4D9JA 5HZGA 2B20A 4B81A 1QIFA 1JI3A 1MTZA 4FNMA 1R1DA 5AKHA 1HDEA 1SCKA 3L1JA 4Q82A 4PV7A 5DTJA 3W9UA 2DQZA 3WZLA 3W04A 3WKEA 4G1FA 3HACA 2OQIA 4P93A 1J2EA 1DWOA 4PO3X 3HLKA 2QKYA 3NOXA 4UHBA 4E14A 3FAKA 3K2IA 2HA3A 2AJCA 3BXPA 3C8DA 3ESDA 4ZRDA 3WLAA 1N8SA 1XLVA 4QLOA 4AN1A 5AM2A 3SK0A 1CEXA 1VJ5A 1YSCA 2RIPA 5ALNA 5JAUA 1W4LA 2XI4A 1DWQA 3DOHA 4EY4A 1XQVA 2VAVA 2O7RA 4QDTA 4UBLA 4P08A 4EA6A 2XE4A 1QIKA 4IQ4A 1CUXA 3DCNA 1XROA 4KE7A 4HXGA 2XUQA 4ITVA 4FLFA 4QWMA 4ZV9A 3PUIA 2CB9A 5A62A 5AI6A 4BATA 3BIXA 2JGMA 3VXKA 3ICWA 2UZ0A 2PSFA 4MYDA 1DT5A 5K3FB 4CFSA 2WIFA 1YCDA 3OTQA 2W22A 4JNCA 4QDXA 4Y2SA 4RGYA 1L7QA 1R50A 1BEZA 5CH8A 4BP8A 2O2IA 7YASA 4DTCA 1BN7A 1LPOA 5H3HA 4S0XA 3HC7A 3PF9A 3QITA 1JFRA 2Q0XA 1B6GA 4YK7A 2CUTA 4AO7A 4ZREA 3G0CA 3C6XA 3MVEA 4HXEB 2RGUA 1QOZA 1VLQA 2QXTA 4C01A 5A71A 5EIHA 1XZFA 2Y6UA 1KU6A 4UHEA 2HL6A 1EDDA 3STUA 1P0QA 2BKLA 3C5WP 1UKAA 1XRNA 4NS4A 3WWDA 5ALEA 2HRQA 5AM1A 2XQFA 4WFJA 4JEIA 4IH4A 2QVBA 2I78A 3LLCA 1IZ7A 2XQGA 2YH2A 1QIEA 1YR2A 4FDMA 3STWA 3H17A 4ZXFA 4BDTA 3WKBA 3GA7A 4LKOA 1Q84A 4DM7A 3ZPXA 3Q0TA 3FYUC 1QE3A 1K8QA 4V2IA 1R3DA 3BF7A 5FLKA 4BE4A 1S8OA 4X6XA 3CCBA 1UZAA 4F0JA 1VZ2A 1J07A 2PX6A 1QO9A 1BS9A 4GLBA 1GZ7A 3QM1A 3X3HA 5CT5A 5JZ9A 2VTVA 5JANA 4KE9A 2V98A 4HRYA 4ETWA 4X92A 1VKHA 4RNCA 4TPKA 1WB4A 4B0PA 1VOTA 1UWCA 4FKBA 3S2ZA 4NZZA 2D5LA 4YX9A 1TRHA 3UUFA 5KBYA 5LKRA 4K2AA 3JYHA 3STXA 3V1NA 1QGED 2XLBA 2XMZA 4UFPA 1EVEA 4J7AA 1ZD2P 2XLCA 2G5TA 2O2GA 2DQYA 4IH1A 1EXWA 2HFKA 2VJCA 4Q3LA 3DDUA 1EI9A 5A7FA 1CPYA 3PI6A 5CURA 2WG1A 1A7UA 4FBMA 4E11A 1QIDA 4Y2QA 1GGVA 1RP1A 3OG9A 2HU7A 1Y7HA 1XZIA 2XUOA 5IVIA 2OGZA 3D0KA 4J0JA 2VJAA 1GKLA 1IMJA 5LZ8A 4K6HA 1XFDA 1L7AA 1EH5A 1PV1A 3IUNA 2Z8ZA 3WKCA 4ARBA 4X94A 1PFQA 2I3ZA 3I6MA 3AINA 5AKGA 3S8YA 5DYYA 4DMFA 5SYMA 1XZJA 1H2YA 2XDWA 1CUGA 4NVRA 1LZLA 1G5FA 4DGQA 3F9CA 5D6OA 3OC0A 1IUOA 3FLAA 3ZV7A 4UUQA 5AKEA 3R41A 5LKAA 4H7FA 4WCVA 3IUJA 2HA2A 3KWJA 2VT6A 3KDAA 1VXRA 1I6WA 1QFSA 4FLEA 1DX6A 4X6YA 3H19A 4F5ZA 2AJBA 4QA9A 1F6WA 3DQZA 1WPXA 1XZDA 5K3DA 5K3FA 1XZCA 1EINA 3EQ8A 3EQ7A 3D3NA 3N2ZB 1R9NA 2HA4A 3STTA 1YS2X 4EUSA 1O6FA 2X8BA 4X00A 1MN6A 3BDIA 2QRUA 4PF1A 4GBGA 3CN9A 2DSNA 3C6ZA 3EBLA 2CEKA 5HK9A 1G42A 2WILA 2PUJA 1LPBB 3PUHA 4MXDA 5DJ5A 5DTIA 5AHXA 2WJ4A 5D3ZA 5C81A 4M0EA 4JYMA 5E4YA 4CIAA 2VEOA 3ZLVA 5HFNA 1K6EA 4E46A 3Q8WA 3H18A 2XQKA 4LHEA 1HPLA 5CT4A 3GBSA 3RARA 3N0TA 4W1QA 1QO7A 5ALHA 5AOBA 5E2IA 2Z5GA 4DIUA 1ETHA 2GYVA 1FFAA 3KWFA 1W75A 2DHCA 1A88A 1ODTC 2V97A 1NX9A 5EHQA 3AIKA 3QZUA 4XJVA 1R9MA 3HYSA 1TCAA 1ZJ5A 1MNAA 3HEAA 2EDAA 3W05A 3VISA 2X5XA 5AIBA 2B9VA 3WWEA 2B4KA 1ZD5A 5LLSA 1JU3A 2WM2A 3FVTA 4P9NA 3F98A 4UHCA 1C7JA 1EK1A 3TRDA 1AMNA 1CQZA 3ZLTA 1QLWA 1SCQA 3H2KA 4KAJA 5JARA 1AURA 3VVLA 2ZJ6A 1U65A 2WFMA 4W63A 2XQJA 3G0GA 4CCYA 1GQSA 4X71A 4EBBA 4N8EA 5EIAA 3E1GA 4MWSA 3G7NA 5K3BA 1BEEA 3CN7A 1Y7IA 5AKZA 3I2KA 5T4EA 2EEPA 1CVLA 4BC0A 3D59A 2ZSIA 3OOSA 3CCCA 5CTAA 2WFZA 1Q83A 2IX9A 1N5MA 5AKLA 2JIDA 1B41A 4Y7DA 1VZ3A 2WHPA 1U4NA 3BF8A 3KOOA 3HABA 3I28A 4ZI5A 4BZWA 2PUHA 2OAGA 3WJ1A 1CUYA 4HAIA 3IDAA 4GXNA 3FWHA 3ESCA 4G4GA 5JAOA 5AM3A 5AKJA 2AXEA 3GZJA 4BB0A 1LPNA 4IHAA 3G9UA 3NGMA 3IULA 1XZMA 4CI9A 5HQ3A 1T2NA 2J4FA 1WCYA 5DNVA 2YYSA 1A8QA 2GBCA 2DHDA 3R3WA 2WIKA 3H2JA 1E8DA 1TCCA 5FPPA 5HK8A 4QLAA 4WFKA 3WYNA 1LPSA 2CBGA 1ODSA 2FX5A 1HL7A 3KXPA 1GXSA 4OU5A 2XMDA 4DSZA 4OYLA 1H23A 2H1IA 4C4YA 1GPLA 5ALRA 2HA7A 3UMJA 1QFMA 4J0HA 1EA5A 1YA8A 1DTEA 3JW8A 4HVTA 2HADA 3I2FA 3VKFA 5CMLA 2V9ZA 5LIPA 2ONCA 3WYDA 5FP0A 2XQIA 4UBMA 4FHZA 3FYUA 2ECFA 1E3QA 2YXPX 4CG1A 1XZEA 4BRSA 5JZSA 3PE6A 3HZOA 1CQWA 1L7RA 4O08A 4KRXA 4X93A 4BZZA 2JBWA 2GBGA 3WWPA 1X2BA 2QJWA 4KRYA 2JGLA 3IIIA 4J0IA 1D07A 2AJDA 5LP1A 3FVRA 2Z3WA 2PKYX 4AZ3A 5IKXA 4P92A 1YA4A 3IURA 4WY5A 2P8SA 5ESRA 3IA2A 4H77A 5CH3A 4AB1A 4C4XA 5C8XA 1VA5A 1A8UA 3FLEA 3C6BA 1MX5A 4DYHA 5EFZA 1EDBA 5A7GA 5EHXA 3SX4A 4BAGA 3DKRA 1CR6A 1ACLA 2O7VA 4UBOA 2ZYIA 5K3CA 5FV4A 4UFNA 3K6KA 4U2DA 1QIMA 2PPLA 5AKYA 5AOCA 4BDSA 1DT3A 1CIJA 1FJ2A 2G4LA 2C7BA 2JGFA 1UK9A 4GI1A 5F4ZA 5HFAA 4DNPA 2AJ8A 2XUDA 3WKDA 3WWCA 4X91A 2FUKA 2OLEA 5JADA 4BCBA 3LIPA 3O95A 3R40A 1TCBA 1CUFA 2OCKA 3QPDA 4OUKX 3VDXA 1WPRA 5JATA 1UK6A 3AJAA 2WUEA 4AMYA 3IUQA 4BVKA 1KU0A 3VVMA 1EK2A 2Y1KA 1UKCA 4Y2RA 2HRRA 1X2EA 3WQHA 4QWWA 3LS2A 3WIBA 4B7ZA 5ALFA 3YASA 3BE8A 5HKAA 4TVKA 5CBKA 1THTA 4Q1VA 2W6CX 5ALXA 3WL7A 1N5RA 1ACJA 3G9XA 2JGJA 4AN0A 5JIBA 2WTNA 1TQHA 4AQDA 4OU4A 3D4LA 2BAGA 1CUAA 3F96A 4KAAA 1YAJA 3AZOA 3WZMA 3BDVA 4B84A 4IO0A 1GPNA 4ZWNA 1JMKC 1SFRA 1ZI6A 1HBJA 3G0DA 3R3UA 3V1MA 4BVLA 4J3JA 2BUAA 4XIIA 2VSQA 2ZJ7A 1DU4A 1FFEA 2JEZA 3I1IA 2ZYRA 5CXUA 3PFBA 4BAUA 3D7RA 4J03A 1EB8A 3W9BA 1XQWA 4UHFA 3WJ2A 5AIAA 4H7JA 3BWXA 4GDMA 4I19A 4B82A 4MJ3A 2HM7A 1QIHA 1QIGA 2PU5A 1UK8A 1ZIXA 3O4IA 4AZ0A 3IVMA 4QDZA 4PNZA 2QOEA 1OCEA 2WIJA 1XZAA 4Q05A 2JGKA 3R0VA 3DJYA 2QJRA 1DQZA 4ARAA 1QIIA 3DYVA 3ZWQA 4Y2PA 3ANTA 5ALQA 4BP9A 3H2GA 2G5PA 1RYYA 3FYTA 1MO2A 5K5EA 3FLBA 3QH4A 2R8BA 5CXXA 1ORVA 2EDCA 2OGSA 3ESAA 4X7BA 1IVYA 2X76A 3W06A 1G4HA 3B3QA 4DLNA 4G8DA 1JT2A 2LIPA 1VA4A 5AKXA 4MQLA 1CUEA 1UFOA 1WHTA 1JU4A 2GYUA 1YB6A 2H7YA 1ODCA 4KEAA 1LLFA 6YASA 5IVHA 1UT6A 1BROA 1F0NA 1LPAB 2QT9A 2XUIA 4B0OA 3BJMA 1FFDA 3HJUA 1RWQA 2I03A 4MYSA 4N5IX 5AI5A 2CMFA 1EX9A 5FRDA 4BYMA 2XUGA 2JF0A 1M33A 3WMRA 4PSCA 2J3DA 4Y2UA 2WUGA 3DL4A 4H7HA 2BGNA 1CLEA 3WK6A 4L0CA 1ZI8A 1CUBA 4OB6A 4B85A 2JGIA 1Y37A 4G4IA 4DNQA 2VT7A 1FFBA 3V9AA 3AIMA 3BIWA 3VJMA 5CT9A 3H2IA 5JD4A 5BWBA 1USWA 1AUOA 2WJ3A 4AXBA 4BBZA 5AI4A 4C4ZA 2ZJFA 1XZHA 3STYA 5AH0A 4Y2YA 2XMRA 1J06A 1GQRA 1CUHA 1VXOA 3T52A 4XVCA 4U2CA 5AK5A 5ALOA 1K5PA 5LYYA 4X97A 4BTLA 3DS8A 4FFVA 3IUMA 4W1PA 5ISMA 2VF2A 2J4CA 4UHHA 1TKRA 3OURA 2VA9A 2H7CA 3ZLUA 2RONA 4H7IA 3R3YA 3A2MA 4FWBA 4OD0A 2GBIA 1ZD4A 3ESBA 4PSDA 2XB6A 2WHRA 3BJRA 4L9AA 4H18A 3L1HA 3V1LA 1UOQA 1CRLA 3WKAA 4FFWA 2BGRA 3ILSA 4J0KA 2XUFA 4H7EA 3PFCA 5ALVA 3B12A 2IITA 1WM1A 1XRMA 4K5QA 1YASA 1E89A 4HTAA 1XQYA 3V1KA 4UBNA 3O9VA 4RE6A 2XUAA 1XRQA 4G4JA 5CW2A 2C58A 4UFOA 1K4YA 1W52X 3D2CA 3O4HA 5SYNA 4HZGA 5LZ4A 5JD6A 4C88A 5ALPA 2J3QA 3MGAA 3AIOA 1LPMA 1BU8A 5CT6A 4FNGA 5A2GA 1H2XA 2XMCA 4AO6A 5HF9A 2DHEA 5JALA 3GROA 1CUWA 5FKJA 4YASA 4WDRA 5EI5A 3LCRA 2ES4A 1XZLA 4FTWA 4Q3OA 3KSRA 3QBJA 4OPMA 1N1MA 2I3DA 1P0PA 1SCIA 1NU8A 3F8SA 1J1IA 2GBFA
chains in the Genus database with same CATH superfamily
4BLSA 1E7WA 3DAOA 4KI7A 2AQKA 4EB6B 4ENQA 1XMJA 3OLZA 3ZLJA 2FG5A 3BMQA 3CFYA 3ZE1B 3HVJA 4UTZA 2EZTA 2IIVA 3UAGA 1I94B 3QKWA 2IPMA 3DM9B 2A2ZA 4CKBA 3AT1A 4L4YA 2H9AA 4Z8XA 3FBWA 3ZNOA 1IZZA 1XLTC 2J87A 5UKDA 2NVWA 3SX2A 2CNWA 4KYTA 3WRYA 2WKSA 4TQUS 2VPZA 3H8WA 4OXQA 1I9CA 2PX4A 3GNQA 4P7FA 4R2JA 2B7CA 3LHIA 1VL6A 1VRCA 3C3BA 3RRYA 4M1TA 1T9BA 1QKKA 2WMOB 3WB2A 4CF4A 2K7FA 2LUOA 3TK1A 1WUIS 3C3YA 5FQNA 2G1PA 4TSKA 1ZGBA 2LE0A 2VDLB 3D3QA 3TL2A 4YI5A 3AW8A 4YUYA 4XI9A 4ICIA 3E5HA 4WIAA 1QG2A 3KJEA 3KLNA 3OCXA 1UDRA 3PZBA 4J90A 1ZK0A 2E4WA 2FOIA 2FZWA 2H5IA 2IIPA 2WG0A 2ZIUB 1P6QA 2VCYA 1O77A 4LPKA 2EGUA 2IBMA 5IFKA 1NT4A 4UAJA 5HKOA 4KFTA 2X0EA 3OIFA 3DQPA 1Q20A 4AYXA 5C4GB 2Q5QA 1K0UA 2F17A 1QH1A 2NUPB 1UF9A 2FWRA 4FOLA 1D4OA 1Z88A 1QZTA 2I4IA 1BEUB 2DSTA 3N0XA 4B7UA 4MVJA 4RKQA 2NIPA 4RFSA 4PTZA 4F45A 2C0PA 1DBWA 3QW2A 2H07A 1TMGE 3A70A 4FFMA 2UXBB 3C24A 2QR3A 1Y8ZA 2QSYA 4JB2A 4PC7A 4V0OA 1KAGA 1Y3HA 1K89A 1R4NB 3BWYA 1J0XO 3EXAA 3K0CC 4IL5A 4XTRA 5I45A 5EZYF 2JI7A 3TGLA 3JWPA 3LC2O 3GD5A 4GMKA 4HQ6A 3GFQA 2FKAA 1LF5A 4Q3CA 4ROSA 1LJUA 2AR9A 4UTOA 5DYTA 4ENTA 4JLAA 2NW6A 3PL1A 4DLLA 2AKYA 1CUVA 2Y3IA 4LMRA 5KAMA 5ALSA 4IHJF 2IYWA 2XD9A 4Y1RB 5CYOA 5LDDC 5DN6A 4BCDA 5IBCA 4QAJA 1YZKA 3WP0A 2G0AA 3ZU3A 3C7CB 2OLJA 3B3GA 3QE0A 3LD9A 5LSAA 1GL9B 4YDRA 4IILA 3FTPA 1KO5A 5DRTA 3CXUA 4D3ZA 2JG3A 1XZKA 1XPRA 3J80A 1L4FA 3O91A 4CDMA 1KNXA 1M10A 1QZ3A 4M7RA 4JI1B 4DLBA 1BVYF 3G1UA 3U2QA 2NTYC 2DFTA 3NHWA 2PAAA 4URFA 4R1SA 5IM4F 4LCJA 4EY7A 2VH2A 3VAAA 2C4HA 1X38A 4EX7A 4R0MA 1Y1TA 3QELB 4PRZA 2GI4A 2FSSA 1ZMXA 3C6KA 2G83A 2K2WA 3GMDA 1XKTA 3X1XA 4K05A 4EQ6B 4ZP1A 1VG1A 3B13B 621PA 1M74A 3RTEA 4M1EA 3BFPA 5BV8A 4ASUA 2R44A 4KXFB 1E3MA 3BJIC 1RKQA 2OFXA 4V0MA 2ZLBA 1QGUB 2ZB7A 3MEQA 4NICA 4RACA 4RVHA 1QXSA 3LUPA 1F5SA 4DARA 1EM6A 1W0KA 3R9WA 5JJ5A 4IIXA 3T7DA 2QZJA 3K0BA 2BMEA 2F8MA 5E95A 2Y0PA 2FSGA 5KWIA 5CJ2A 4BS9A 4ZKDA 2GSWA 2W2LA 3OEHA 3OESA 1CUCA 3CLRC 2EQ5A 3ZX4A 4AKIA 3V1UA 1MO5A 1ZNXA 4IG4A 5HF8A 2MCFA 4CL2A 4U5QA 3ETLA 3G8AA 3L18A 3UK1A 2WRZA 2Z0MA 3EDCA 2C96A 4P36A 1BKYA 1U2SA 4J07A 3ZG6A 3K4HA 5E8JA 1JQBA 3OZVA 1N2CB 3R7LA 1FDVA 1BN6A 2JATA 2ZRNA 1KDYA 1AJEA 4GI2A 1FP7A 1IUNA 1BJRE 3KIPA 3A1NA 2FW1A 3NETA 5BYBA 1OT3A 4M9UA 2H29A 1WV1A 2QD2A 4CMEC 1I30A 2B1GA 3ZGZA 3MJVA 4QBIA 3QK7A 3ZW8A 2VG8A 1TVEA 4L9RA 4ZI2A 2M6SA 3JQPA 4Z7OB 4ZK2A 1QK5A 1RZ3A 4KV9A 2E3JA 1KDZA 1CV2A 3LOUA 4Z0NA 4K9LA 4EG0A 1G5PA 3CH6A 1NZFA 1Q7GA 2ZAMA 4L08A 2BKEA 3TMKA 4WGFA 2QL7A 2O7QA 3F3MA 3G6WA 4ZARA 5AYVA 3THSA 4B3FX 2DXIA 3ECCA 4IY1A 2HNBA 4PNEA 1S02A 4ENWA 3QKRA 2PQMA 1HLFA 1R12A 2HIAA 2RD2A 1U2DA 4KI0A 4FYVA 1W9HA 5JCPA 4FLMA 1O5IA 1V3UA 2W6IA 4QTXA 3TECE 2EERA 2HT6A 4NONA 1IQUA 3L1UA 4MJXA 3N5CA 1HDRA 1LBTA 3W7BA 5JPIA 1ZK3A 4NU5A 1OH8A 1YAHA 3ZGXA 3C1AA 2QTRA 3O4JA 3QYJA 4JL8A 1YJCA 3LC0A 4M8LA 4D4LA 1XTPA 3LKBA 1R0CA 2R86A 3LK6A 5EY5B 2PMBA 5JT1A 4ZU3A 3T5GA 3QEBZ 4GU5A 4S2EA 1R4ZA 4N12A 1OILA 1OZGA 2KS6A 3TOCA 2R8OA 3KK0A 1AS0A 4LF8B 5ENDA 1AD2A 5JI2E 2O3SA 1E2IA 2XTZA 5LVAA 5KPDA 2PUCA 2RCYA 5IDWA 4MUJA 4IDGA 4BWGA 3E6AA 1ABFA 4KDRA 2ZI3A 3K31A 4QASA 5AK4A 1JBEA 4LQ4A 1OIXA 4QFBA 2WU3A 5GTDA 1LZKA 4BHTA 4YAOA 3IT3A 4Y3UA 1RI2A 2R1VB 4ND3A 3UZUA 5TS3A 1TGVA 1XRPA 5JAHA 4QVIA 1M6HA 3MLEA 1FUUA 3AY0A 3OBBA 5HE8A 3RROA 3EEYA 2JD0A 3MOGA 3AR5A 2QG4A 1T36A 4M8KA 3BVPA 2CUZA 1QPGA 3RJ5A 4B3DA 3EEBA 2NO9A 4EJSA 1G60A 3R7WA 4EY6A 3FVQA 2YQ4A 2HCFA 2MTBA 2NSLA 1EVKA 3ZD8A 2P5SA 5C1OA 1OKKA 4Q16A 5I9IA 2PH1A 1VHDA 1RJWA 1P44A 1U3CA 4U02A 3A2NA 5HF5A 1SKMA 4J94A 3C6MA 3O9ZA 5HMMA 4Y1EA 4A23A 2QIOA 1TXGA 4TUYF 1PRYA 4IGKA 1RNLA 2ZPUA 3PNKA 3RRJA 1QUFA 1OBFO 1L5FA 1D2RA 1JMVA 3AETA 2GYYA 3B6ZA 1IZYA 4NYJR 5LP6F 16PKA 1MPTA 5L6MB 5K8JB 1IZ8A 3F78A 4UU1A 1EE9A 1UBEA 2J3MA 1L5HB 2PLWA 4EB3A 5HIAA 2HXGA 4U0KA 4KGXA 4C2AA 2FPUA 3EZFA 4D96A 1QQBA 2HIHA 1IN1A 3WL6A 2QPLA 2VT2A 1QH9A 4RSHA 1NMYA 3I9MA 4FYWA 3PNMA 4K9MA 2BBSA 1CZOA 2R11A 5CYFA 4CPDA 1A9SA 2H06A 1N2CE 1NRWA 4N3CA 4PFSA 4KPEC 3AVWA 2Y2VA 4IJUA 2Q5OA 5LXTF 4XRGA 5KJCA 5F9FA 1TF2A 2F3TA 4CDRA 1ZM2A 1OV4A 1CK4A 4JNKA 3GMIA 3KAPA 2J31A 5CVEA 4DIBA 1SU4A 3DHVA 4WW0A 3KVNA 4U2FA 1FRZA 2EFEB 1URPA 3OQJA 2WHQA 1INLA 5TQVA 1NQ5A 3CZ9A 1P72A 3HCDA 4PX5A 4CMGA 5JAMA 1HNZB 4OM7A 5E9QA 4BLWA 3M82A 1I2CA 3GZNA 1V71A 1U28A 2ZRAA 1IOLA 3AH8A 1CVRA 2C8JA 4LHWA 2F3SA 2IELA 4C7BA 1H9CA 3KXKA 2JD1A 4UVGA 1T5DX 4KPUA 3WIVA 5IJ0B 1AMUA 4Q3KA 3T9BA 1NMZA 1P2VA 5L4NA 2BI4A 2JRLA 5B2ZA 2XF2A 2QM7A 3QPAA 3IV7A 1C2YA 5H70A 1U1FA 1N9KA 2FMXA 1F6BA 3G2PA 4XGRA 1W36B 2ENWA 3IQZA 3QG5A 3QPWA 2D62A 4R1NA 1VMAA 5C35A 1E66A 4RZ3A 1YVDA 3C97A 3GNLA 4BMVA 3B7GA 3ZCPA 3VDNB 2E4ZA 1CCWA 1YZTA 4BUCA 2RH4A 1PJSA 3M83A 5DEOA 4XOIA 2ZE5A 1D4ZA 1QHIA 4O4HB 1Z0JA 3D6TB 2WM3A 4WCDA 1CR2A 4X62B 1V16A 3M81A 3R7DA 3QEJA 3C14C 4DR5B 2FN9A 3TH5A 2I54A 1T5LA 2P69A 3A6ZA 1AK9A 5AXBA 1QHHB 3I3SR 4HN2A 5EWLA 1F9EA 4ATNA 1KOFA 5EE1A 3SX0A 4RPCA 5KCMA 2WF5A 1JLKA 2P6RA 3S70A 1UJ4A 4YMHA 4KGVA 2NP7A 1OAAA 2GBPA 2CJFA 4AKTA 5KOJA 1Z75A 4IIDA 4NJOA 4KR9A 2DBZA 4PAQA 4G9GA 1CZUA 1PJLA 4RF5A 3TBKA 3V46A 5C5EA 5MDHA 4QXMA 3U5TA 4P4LA 5GJBA 5IKOA 3N7TA 5AJZA 2XUKA 1WZ2A 3AFGA 5HIIA 5HDBB 3CPEA 2PVPA 4TXMA 1M2FA 1PR0A 2F55A 3E9ZA 3GGGA 1CULC 1E5TA 2O8NA 1XEAA 5D01A 4AD8A 5EJ4A 1A4UA 3GCWA 4M1MA 4ZQIA 1IHYA 5BQ3A 3HJHA 3H2YA 1Y1QA 1QRAA 2WZCA 3II6X 1F6DA 3ITNA 3PF8A 4WOJA 4J8PA 1W9MA 4MW7A 5A5EA 3SJZA 5L45A 2B1IA 3MINB 3ZS8A 3BWMA 4DWOA 3SN6A 1BX3A 4MQEA 1XZPA 3MJRA 4QDJA 3UMGA 4FI3F 1JVBA 4C89A 4PTYA 5H9VA 1ZICA 4Y9SA 3VJKA 4KQGA 1H9BA 2C1XA 3VO1A 4KWEA 1IAVA 1Y7TA 3FM9A 1RPJA 2YFQA 4K1LA 2CT8A 4RZHA 3HG7A 4ROTA 1RD4A 3CWQA 3GFFA 4L27A 5BNFA 1SOMA 2AWOA 3GCXA 3KT0A 1A5AB 2ZBQA 3OT5A 1V11A 3TTSA 4BFLA 1D2EA 5T4FA 4KIUA 1C9JA 2AXPA 3EVNA 1TMOA 1CUZA 4L8VA 3RS5A 3ENZA 3HXPA 4P32A 2QL5A 5IT9A 1FQWA 3G79A 2RGGA 5ICGA 1R4AA 3FFWA 2B99A 4FGZA 4O25A 1DPFA 2JJ2D 5JOQA 3D5EA 3WQQA 4F71A 4CLEA 3J81k 3V80A 1ZY2A 2Y05A 1P77A 1ZQ1A 3B1ZA 1GADO 4GECA 2XNJA 1SUSA 3A6KA 3B6KA 3WV4A 4EJ6A 2I6XA 3WRXC 1GZ4A 2CBXA 2N42A 4YRRA 4YB8A 1G0OA 1MX3A 2BJHA 3ZV5A 4G8JA 2J0UB 3ABQB 3HCWA 5HCNA 3SQWA 5AW8A 4KPFC 3QFCA 2Q2VA 1A8IA 3SP1A 2ZYAA 5C8ZA 3DL7A 2EP8A 1N7GA 2JARA 3D02A 2G77B 4N18A 1EK0A 4HDRA 1HORA 3GEMA 2DVMA 3M5CA 4EJ0A 4CIYA 2BFFA 1KYWA 4UEWA 4W9NC 3BEOA 4D46A 3UG7A 2P5UA 2BBOA 3CLHA 1ZKDA 4QDOA 1XQXA 2BCJQ 4HCJA 2BZ0A 3LVQE 3ZCRA 2PD3A 1GM5A 4DR7B 2OAP1 1UPTA 3UOWA 1LXCA 1PQ4A 3EQ2A 4IOKA 4CKCA 2OCIA 4YJGB 3ANMA 4C4SA 1LTKA 1V8DA 1S2DA 4I0WB 2PUDA 1FX0A 3OLQA 4DV0B 4X6LA 3NTQA 4LV6A 2C5GA 4HAVA 1L4YA 3WBJA 4UPDA 2IDKA 4KVGA 4LJRA 1X15A 3UJDA 3DFZA 2WB4A 1N77A 1AKNA 2WPDA 4V0QA 2XHEA 5IZCC 4WESA 2JFHA 2AOUA 3AUYA 3F3KA 3GVIA 2K2QB 2WLSA 1C41A 1ZC4A 3MTIA 2ZT6A 3UKOA 5C5IA 4XVRA 2ZUEA 4CF7A 1XE3A 2BEWB 2IH5A 1NJ1A 1T2FA 5GQSA 3ER8A 4JK3A 3CISA 4OUDA 3KJXA 4MTLA 3EE6A 4Z49A 4C1BA 4US0R 3B36A 3LBYA 4CQLB 1GOTA 1XA0A 1WZCA 3OX2A 3L7BA 4JUIA 4FEAA 3OT1B 4YYEA 1EKXA 1MJGA 4BUJA 4DMKA 4AY2A 2VATA 2HRZA 3D6UA 3PXGA 3IE1A 2CCGA 2ZJ2A 2D7JA 3H1AA 1DRUA 2YY5A 2BGTA 3IKVA 4P7BA 4PIVA 3H42B 4GDFA 1FSSA 1DDOA 3CR7A 4DY6A 3FOBA 3O4GA 5HOEA 3QI2A 3FN4A 4JKOA 4JWTA 4LE2A 1JAIA 1XKXA 2REBA 4JQYA 3FZEA 3SQMA 1M83A 4XQ0A 5HS6A 3G1WA 2GKGA 4UVDA 3RJ9A 3S2SA 3P5SA 2DERA 1C3OA 4U2GA 1YRLA 1U5CA 3I72A 1L5KA 2W7TA 3PFNA 4UUAA 1R4MA 4LNHA 5JJBA 2C4NA 4YUVA 2Y92A 1SU8A 3R4CA 5J3JA 3H5RA 2CNLA 4K26A 2OXRA 3WK4A 1BYUA 1N3BA 1X86B 1HLPA 3RKSA 1AKYA 1REQA 2G04A 1PWYE 1BA2A 1Z16A 4J0GA 4JYBA 3CZAA 4HWGA 3GLIE 2EX1A 3EGOA 3I2IA 1MFZA 2P5YA 5EKXA 1G21A 3W8DA 3V8RA 5JNTA 2PWAA 2ID4A 3IMKA 4D9HA 4QUGA 2ZM6B 2IQ5A 4XWOA 1USKA 3QVJA 2W8BB 4JA2A 1PDWA 4C7JA 2PUBA 4KYVA 1DAFA 3WK8A 1TEZA 2WY2D 1MLDA 1IN6A 1WNFA 1DLIA 3C45A 3KJIA 2Q7XA 4K0KB 2P9EA 2VTKA 4BTVA 4KBGA 4UC0A 1IRXA 2XZLA 4A2PA 3I2GA 4RKYA 1EFDN 1OXVA 2AFHA 2MMCA 1NF9A 4JI3B 1DBIA 2QT1A 5EHNA 3OEEA 4LCBA 1P2SA 3CLUD 2HTEA 1O08A 2IYXA 1C14A 1GZVA 4OJMX 3JXEA 3KQYA 1C8VB 3B9RA 5DBIA 1EP9A 4PZLA 3FR7A 1I4LD 2QS9A 2WZBA 5BXYA 3WLPA 1YK0A 4ZT3A 5ESDA 1J8FA 1CQIA 3B1FA 1NY5A 3KQWA 1D2MA 3ZTWA 1MAAA 4XM1A 1NBHA 3IQFA 2AWNA 2QUAA 4Q1AA 4KTVE 4RF4A 3UANA 2GPAA 4HNUA 1M72A 1DO0A 1NA5A 4Y7CA 1DINA 4F85A 1C4XA 3ZCSA 4CLRA 3KETA 1T1IA 2V4UA 3P4XA 4LG1A 2CMDA 3BFKA 4LZWA 4ZOLB 3L4BA 1S1CA 3QUQA 5PGMA 2YYAA 2Z6QA 4MR8B 1YB2A 1ZCJA 3UK6A 4D26A 2EWVA 4X95A 2H7XA 5KREA 2NU9B 1SVIA 1SPXA 2ZB8A 1M1NB 3LXRA 1H1LA 2I7TA 3OLYA 3EMVA 3VNRA 4ZJZA 4IXMA 3F97A 4D0RA 3VYWA 4TWZA 5CYGA 4XXHA 1P5ZB 1X7GA 3UA4A 2JCYA 2Z09A 2ZYHA 1HDOA 2DCUA 3Q7EA 3QBTA 4V39A 3PA8A 4G24A 3QVMA 4HWSA 4WQMA 1GAQA 4DGSA 1FFWA 1T6BY 2PWPA 1DKRA 3IR5A 1ISMA 2I4LA 3SDSA 2OGUA 2J9ZB 1U8EA 1LBSA 4MP8A 1IHUA 2ZT8A 2EHDA 3P2YA 2AE1A 3SNHA 2ZTHA 3FYDA 4WNYA 2WTUA 2VJNA 3FPLA 3S2UA 1C80A 3LRTA 1V5FA 3EVEA 2AHRA 5F9HA 4W82A 1R4MB 1PD1A 3DBOB 3A37A 3W6NA 1RI5A 1NVXQ 2I2XB 2WTMA 4DSAA 1AC5A 2DPXA 4TMXA 3T1HB 3WMWA 2C9BA 4HVCA 1L4BA 2CZCA 1GAEO 1I6MA 1A04A 4C21A 4FOSA 3SZGA 1QANA 2R9VA 2OD2A 3ETHA 3GFGA 4O2AF 3IJEB 4JYPA 3MZ0A 4IIYA 4UMEA 4XOUA 4LF5B 5CBPB 2LRHA 4WX2B 3E35A 5EIFA 3K5WA 1NW9B 5ER6A 5BPFA 4TT3A 1L7XA 2ZJYA 1XRRA 3EHDA 4CL8A 4QICA 3QG1A 3IRVA 1D1SA 4NECA 3FRJA 4OHRA 2GUGA 4RHYA 4WJLA 3FBGA 3JQEA 4DNOA 2QW8A 1Y6QA 4ZV7A 3AKZA 5TQ2A 3AI2A 2G76A 4JEHA 2R0QC 4UEOA 4LX8A 1ISRA 1YZHA 2NU7B 1BJTA 2EJBA 1GA6A 2QX7A 5AOAA 5D3MA 5H16A 4C0BA 3PICA 3D0OA 2CXHA 3ZJ4A 1KZ7B 5DHUA 3Q72A 5DTQA 1BXRB 1LY1A 1U3UA 1W8DA 2JZCA 3OUZA 4LI3X 1PJ8A 4NL4H 4MLDA 3GRPA 5KVAA 5BMVB 1ZJZA 3KT6A 3FCUB 1CLUA 2AZMA 1K68A 3JAWA 2ZRFA 3QY9A 1NQWA 4KMMA 3N86A 2ZRMA 3OCYA 2JI9A 3R3XA 2Z1NA 5EN4A 3DMNA 5SY6A 4YXWD 3ZDYB 2YIDA 3VM6A 2D7CA 5D85A 1OHHD 2ZR0A 1U28C 4AP5A 3PBKA 2RHBA 3ANXA 1UBFA 2GN8A 3AF1A 4PCAA 1N7HA 2O2CA 1T4MA 3PHLA 3QHQA 4GPEA 4I6JA 1Z0FA 4AJEA 5ARDA 2QI9F 1DIOB 2HU5A 3AESB 1L3IA 4MKFA 5FB3A 1PP4A 4CLXA 1WTCA 2OBMA 1JA1A 2Q6TA 4HEA6 4LWPA 4OB7A 1TQ4A 3FWPA 4QBFA 4CKCB 4HDNA 5K6TA 2JLZA 1K63A 2VEDA 1TL7C 4Z4HA 4OCZA 4Y8VA 4LWOA 3RT9A 1SC1A 4BN0A 4GPBA 1PK7A 4ISBA 4LXHA 3SFVA 4YACA 4TMKA 1P9LA 4Z4IA 2HHAA 4JI2B 1GPH1 4YRQA 2OV1A 1AQJA 5C1BA 4L3OA 4NV1A 1KOLA 1II8A 1JXAA 1OX4A 1ZYUA 4GQAA 2BN4A 3KSMA 4Z4EA 4AMGA 2ZR7A 4YAUA 3SZUA 3AM1A 1ZK1A 3WGIA 1R6TA 2J0SA 2A9FA 1ZUHA 1KK2A 2HA0A 2WNSA 2GPBA 2OVBA 2WYHA 3BGDA 3MW8A 1G8JA 1KAQA 2Q0HA 2ZIGA 4RK5A 4EG1A 4F3CA 2Z2YA 2C61A 1WHSA 4M60A 5K0BA 3TTVA 4G8CA 1CY6A 4KITB 5D2CA 3ONEA 1E63A 4OHXA 3IAM6 4FZVA 1YDFA 4J29A 4KJXA 5AJVB 5DF1A 2FSPA 1QHYA 1WEKA 4Y0VA 5LMUB 3RTCA 3BSFA 2AD5A 3TLKA 5H83A 2ERYA 2VR1A 2OHOA 2IQIA 2YHIB 3WK5A 5F21A 3PJFA 2ZJAA 5ALWA 1TUBB 4PGHA 4Y2TA 1L7VC 3AZQA 4BMOB 4INZA 4AJ4A 4CQNA 1E3IA 3WDMA 4ALLA 1HDZA 4FYYA 1KKLA 2H51A 3G5LA 1Y1LA 3HADA 1Z0SA 2O6LA 1JYEA 3ZHSA 1TAHA 3STVA 1HOXA 4QPDA 2EGHA 2WJIA 3T8YA 2I91A 4TWAA 2Z8XA 3N05A 4NSNA 4C20A 1NNEA 1E96A 5KB3A 3EFEA 1XI2A 2Q21A 2QTBA 2Z3VA 3KEFA 3TQRA 4L8GA 1V8BA 1Z5VA 3G8DA 1M66A 2WHYA 4G0UA 4M87A 4QOFA 5KYTA 1DJNA 4S12A 2F64A 1D5WA 4WOKA 4X7RA 2ACEA 2IYRA 4R9UC 5AJHA 2XX3A 4KO8A 1DAHA 5EKTA 3U0BA 4IJ5A 3R7AA 2DFKB 1CQJA 1ZR4A 1RYDA 2OY0A 1O57A 2C54A 3RPEA 5L6LB 2WZDA 3HXKA 1Z6XA 2CXTA 1W76A 4J49A 1YRHA 3C4QA 5ECWA 3INNA 1J25A 3UJHA 2B61A 3RR2A 4BO9A 3CPHA 1LGYA 3DKKA 2AEJA 1DDGA 3OWXA 2IF2A 4LDQA 1X7XA 1NBWB 2QTAA 4UUNA 5DHFA 3OICA 3RVDA 5KTMA 4KBFA 3R3SA 4R1QA 2R1ZA 5TGZA 3WGMA 4A5SA 4W5WA 3BRSA 3N58A 4FHEA 3RWBA 1U0NA 2AW3A 3C7AA 3UAVA 3JQFC 4E51A 1R5JA 1B16A 4OQZA 1RFLA 1OLXA 1JU9A 5EFOA 4Q5IA 2VJDA 3FCXA 3GJQA 5JD5A 3HBJA 3D8BA 4GD3Q 4IRUB 3RRFA 2H4WA 4YJ3A 1UKBA 4L95C 5F73A 4BGVA 3UJCA 1RTKA 3QXXA 5LUBA 5IDYA 5IF3A 4LUCA 3SWWA 4AG3A 1BH6A 2DP4E 3ZI7A 4WECA 4OEHA 4V0KA 1M54A 3AV0B 1VSBA 3KZNA 1VIYA 3C6YA 3UC5A 3HXMA 4P3YA 1F48A 2FPKA 4YPVA 3ER9A 4NJMA 3HBFA 3E1KA 3P9KA 4QEKA 3OF3A 3OIDA 4C43A 4LGCA 1CDDA 1WSWA 1L9XA 3OM1A 3I9OA 4ZIRA 3AVYA 1OZ0A 5KX5F 1H1DA 1O0BA 3KQQA 3DWGA 5HZGA 3TS1A 3VPGA 4DDWA 2WA2A 5LQUA 4Q66C 2PH7A 4RNDB 2A84A 1GJRA 2A1TR 4ZVVA 2CLDX 3GFBA 1W4AA 2HPAA 1OLUB 3JD0A 1ZXBA 3HY3A 4J43A 1MTZA 1LBIA 1PX0A 4JVOA 3TSAA 3SIPA 2FX3A 2OC9A 4UCXA 1R1DA 5BSMA 1T5BA 4WA7A 4O0LA 1XWIA 3RI3A 5JCJA 4BXOA 1FDTA 4QPZA 4FGLA 1BMFD 5LWQA 3OMXA 4HDKA 3OIYA 1U7UA 4BIIA 4AC9A 4DLPA 1VDMA 3T1OA 4ED9A 4ITUA 4Q37A 3TVTA 4QJ4A 3N9IA 5JH7B 2G08A 2RHMA 4XVHA 2ZWIA 5K0LA 2DQZA 1PKXA 2R8ZA 2IGBA 1WXDA 2R25B 3S2IA 1QAMA 4G1FA 4NP6A 4N0PA 3K1AA 2QGNA 1TPZA 3F4BA 1RAAA 2BCGY 1ZM3A 4OJQA 3TF5A 1XJ0A 2WD9A 4X45A 4YV7A 4CEHB 1IEXA 1K5DA 4MCJA 3HACA 4EI2A 5HVNA 3A3KA 2VDUE 1S8NA 2R6JA 2Z4RA 3Q3EA 2DY1A 1J2EA 2Q8QA 3P52A 1H2AS 1M8PA 3DMHA 3GLFB 2BFBA 3TRKA 1G3UA 3H83A 3NH6A 3NOXA 1A9TA 3DXZA 5LQMA 5KKAA 2X0IA 1GSIA 2ZCVA 4UJ3A 1IN5A 1FDRA 2FR8A 3QFHA 4ZAVA 2FUCA 1YNOA 3HWSA 3LUBA 4WXYB 1D7OA 1DMRA 1Y9AA 2D2XA 3DBRA 5G3ZA 5LXTB 5EVCA 4O02B 4L50A 3B8HA 4G1BA 3NUGA 3FDJA 3M6MD 4RM2A 5EHGA 1ICEA 1EFVA 1SUIA 4JUDX 3HHPA 1XK7A 3RGGA 4ZRDA 2WT9A 5K0JA 2IDJA 1M2JA 1KSHA 3NASA 2N46A 1A95A 5M2QA 3IPLA 3KBOA 1SKYB 3R8FA 1KGSA 2IYSA 2ZYUX 3PZRA 3SZMA 3ZX5A 4RTNA 2O2JA 3QNWA 1YZ3A 3BCSA 2BGUA 1CEXA 5COQA 4HDSB 2IPOA 2RIPA 5ALNA 1EDZA 4Y1FA 4EY4A 4JI0B 1KAEA 2CXQA 1JVNA 1CB0A 3FB1A 3GHYA 3A1CA 5KQPA 4KP7A 2BZSA 3IAFA 1ZN2A 3JQAD 2JW5A 1OI7A 3DTNA 5DN6D 2VWQA 1PTKA 3FB4A 4UBLA 3B9QA 4G2NA 4QPJC 1JDBC 4TKZA 4EA6A 7MHTA 1SVNA 3E3LA 2BGLA 1DFGA 2Q6VA 3AHJA 1HKUA 1M2GA 1CUXA 1NVMB 3DCNA 2OHJA 3IKMB 3AI7A 1WMAA 3A9VA 3Q9UA 3LYHA 1N0WA 1T5TA 2O7NA 2P6OA 3QBEA 5BSUA 4KE7A 4L5CA 3NPAA 1WW8A 1YDHA 4HTFB 3ENKA 4HF7A 4HXGA 4NDNE 4F2WA 3NRJA 4GM0A 2NQTA 3IBCA 4ZV9A 1JG3A 2VDRB 2V5VA 4MZXA 2YICA 5GJWC 4MP3A 1U9IA 4TV9B 3GRFA 5AI6A 5CBPA 4EFMA 1E32A 1V1JA 1VL1A 1KJ9A 4DG5A 1Y9JA 3RNLA 1CS0B 5FYQA 2RGXA 2NXEA 3OD1A 2KW5A 4WN9A 1B8VA 1EFCA 3LUJA 3B82A 3MCTA 5ENZA 1QF7A 4GR4A 3SZRA 4EEKA 4MYDA 1O4VA 1DT5A 3RJTA 3AOEC 5K3FB 4CFSA 4OHKA 3X44A 3KPYA 1RQ7A 3FGPA 2N0SA 2G8LA 5L3SB 1YKFA 4JNCA 4ME6A 4S3MA 3MYRA 3BE5A 5B12A 3PXBA 4R2KA 2GRAA 4RD4A 1QSGA 2I3GA 4IG9A 2XVMA 4Q1CA 5CCBA 3X2EA 2QDXA 1QHSA 3JPYA 2R66A 2J3EA 3BMCA 2QUIA 3K3PA 1ZOPA 2PGNA 3M1AA 3W90A 4JBYA 1VL8A 3P4UA 7YASA 1BJKA 2RB4A 3S1SA 1LPOA 3HCBA 3OFVA 4HFNA 2JANA 4RGQA 3S81A 4MGYR 2F8SA 4LTNA 3LQRA 5IAEA 3WX0A 1N7IA 1RXVA 2XKKA 4B3GA 2Q0XA 4EGCB 2FMUA 3N6XA 2OLKA 4A91A 2R1UA 3GPCA 4S04A 2IHKA 1Z7WA 2NVBA 2BFFB 4RQTA 4RX1A 1CNEA 5J58A 3EZXA 3IJPA 2GZ2A 2YIVX 1TQ6A 1OTHA 1TRKA 2RI0A 3H5TA 3P9CA 3Q3GE 2CUTA 4KQ6A 5LOVB 1XIVA 4ZEWA 4AO7A 4HAUA 3AMVA 4ZREA 1TZBA 4L6AA 3M6AA 4REMA 3FDFA 1U0EA 4PO8A 1Z0ZA 1NAIA 3MT0A 2WJZB 1ZD8A 3OJLA 5KTYA 2RGUA 1ZSYA 1QOZA 1QX3A 1YZYA 3NVKI 1VLQA 1W5BA 2XCLA 1ISIA 3U3OA 4DMUB 4EPVA 1Q1GA 2DU8A 5LLTA 2WQ6A 3BTSA 3F3YA 3I09A 4TKVB 2EBFX 2ZBVA 3HYRA 5FA6A 3K6RA 1XZFA 4YWHA 2I9PA 1HY3A 2OCYC 2C2BA 5BQ5A 3BRCA 4WOBA 4GVLA 3NC4A 1FP4B 4O4LF 1WVIA 5TGTA 4HBZA 1QZZA 3Q11A 4UHEA 4OK5A 5EP2A 4D0GA 1EDDA 4E5DA 1K3FA 5LQCA 1U7PA 1FUEA 5C4IA 5LWHA 4L78A 1N2SA 2QLJA 4PLYA 1GSOA 2SICE 2B94A 1XRNA 3A6EA 4IXDA 8ABPA 1JNXX 1VYHA 2ZWAA 1WQ1R 5KSOA 1JH9A 4BY9E 1SEVA 4PRKA 5AM1A 1I4WA 2OHHA 3H87A 4JLOA 4JT4A 4WFJA 4YONB 3U61B 2Y27A 1NW5A 4IH4A 3TNFA 4LBVA 4JBWA 1GTVA 4YYZA 3LLCA 3L05A 4RY2A 1VG9B 4WVLA 4C7OA 2XQGA 4HQOA 2P27A 3ADKA 5FWYA 2V6GA 1P4HA 2DZDA 3U48A 3H5LA 1GL6A 2VYQA 4Q4AA 4DLZA 1KRXA 1AKVA 1CJMA 4MQEB 3TQTA 4J1QA 5F7ZA 1GG8A 1LEHA 1EFPB 1ESDA 4L02A 3RS9A 3UGJA 4EKNB 3PX3A 2IOFK 1K6IA 4V38A 3RV4A 3ZE9A 1Z4OA 4U63A 1KSJA 3DHWC 2LKDA 2QY9A 3ET4A 3U3ZA 1LVHA 5M29A 1WXEA 3BWEA 4FZ3A 1JF8A 3NJ8A 5KYYB 3PQFA 4MPPA 3BF7A 1W48A 5GVRA 2QRVB 2HBZA 1L5NA 5D00A 4AMVA 2CXOA 5ITZA 4PHFA 5M34A 3BMCB 3ANYB 4WTOA 1E2FA 1JAZA 3CCBA 3QBVA 2O23A 3DZKA 1UZAA 4KXUA 2RJ3A 4F0JA 5KS2A 1GAWA 3HKCA 2NU8A 3ZGVA 2ZTMA 4RD0A 3HKDB 2PX6A 4XCXA 1UDWA 1Z56C 4QOSA 5B2FA 1QB7A 2PD4A 1KEEA 1RZRD 2G06A 1IQ0A 2HQOA 1PHPA 2FV8A 4Y6QA 1GZ7A 2ZJ1A 3MS4A 5KU7A 5K1ZA 2HHCA 3UG6A 4RAOA 4MIOA 1HG0A 1SHKA 3DPIA 3DTVB 4FK8A 4JOSA 2ZKLA 2QQ5A 5DTMA 1D0VA 1X7YB 4ZRNA 5BN5A 5TQ2B 4Q3DA 5LP6B 3MILA 1BX1A 3B6MA 3WMFA 1ZO8A 1VKHA 3L46A 1XU4A 1EE2A 4D8YA 5KSPA 4FKBA 4PIMA 3LUKA 1ATIA 3J7AC 1A4XA 4X65B 1PWEA 4BJHB 5LD2B 3LLVA 5BR7A 3EXFA 4LXUA 1IXKA 5JQGA 1DL5A 2X9LA 1QO0A 3JYHA 4LZAA 1Y89A 4PAWA 3CX6A 3OPYB 2IUUA 2J85A 2QQGA 3BG5A 5JS7A 1Y8QB 1RZRA 5KIAA 2E55A 2EU8A 1Q2XA 3NHBA 1GFSA 1UH5A 4LDRA 2JDIA 1XDGA 4UZFA 5LYJB 4UFPA 3N2LA 1M6VA 3GVHA 3FUXA 3K8ZA 1EVEA 4NCHA 4Y6SA 5F3RA 4ZEVA 4AJIA 4IV8A 4JT9A 3FFTA 1XX6A 4HLQB 1PLKA 4DCNA 1OA0A 2G5TA 5B3KA 3ESYA 3SJ7A 3OX1A 2C20A 2DPGA 2QN8A 4YV0A 1MIOA 1S8AA 2VRWA 1EVYA 1PSWA 3I8XA 4D56A 3COJA 3LCVB 2DQYA 2ORWA 1S2MA 2J6BA 3GZ4A 1W30A 1GTG1 1RJDA 4O2LA 1I51A 2NWQA 3L0CA 4J4TA 3DDUA 1EI9A 1DCTA 5CVJA 3KKEA 1PSZA 2CJYA 4CKWA 4LVCA 2NT3A 1OF1A 3A4YA 4DDTA 3I04A 2OL4A 2YIMA 3NU1A 4FIDA 5EP3A 3D43A 2ZG6A 2A6PA 4FBMA 4F2HA 1VMDA 4E11A 2XODA 3PC6A 3U7HB 3Q40A 3OG9A 3JQGB 4XD2A 1Y7HA 1Q1ZA 2HCBA 2IV2X 2IEIA 2XUOA 1EEXB 4RTQA 2P3QA 5SZKB 4YCSA 4AKGA 1TO6A 4BO4A 2E9SA 2XR1A 2Q3JA 5HS4A 3NLLA 2QXYA 6LDHA 1KO4A 1CQIB 4KK3A 3ZWBA 1H2RS 3G17A 3M0EA 1W5EA 3FOFC 1FMTA 1EH5A 4R2WA 3IUNA 4W5OA 2EFHB 4QFDA 2VP4A 4EH1A 3QOXA 4ARBA 4GSKA 5LP6C 2O8BA 3F7MA 4KFUA 1S2IA 3TFWA 1Q2UA 4P6VF 4QOGA 4N5MA 3KQKA 4JENA 1U0SY 5TXGA 1C1DB 1W29A 1DTSA 1UKVY 2BR5A 4BV9A 2JEOA 2QRQA 2BD0A 3F74A 1P2BA 4DKXA 1JIXA 4D57A 3EB9A 3CZPA 4N1AA 1QF9A 2FF7A 4NVRA 4ECEA 2W42A 1ML3A 1NSTA 2PUVA 2QUJA 4ZI7B 3HNRA 3KHSA 4DGQA 4HAWA 1KI2A 3F9CA 4ZI7F 2V5AA 4OBBA 2DULA 5D6OA 4CT4B 2GCPA 4DV3B 1IUOA 1IWOA 1XTIA 2WABA 5DSXA 1GYQA 2KJQA 3OZAA 3QEKA 3R41A 4M2LA 3U09A 3L6RA 2L0XA 1L7BA 3AHEA 4WI1A 3S27A 1KMIY 5DNEA 1UJ2A 1Y81A 1FJXA 3WV5A 4LZLA 4TLAA 2YV5A 1MB4A 5KHLB 4LJ7A 4ZGWA 2OD9A 1PZFA 5FTKA 1Z6TA 4RMGA 1I6WA 1QFSA 2DFNA 1Q3KA 4KLZA 5E6SA 3EHEA 2D7DA 1Z6GA 1XQ1A 1WOYA 3MCVA 4Q4DA 1OSNA 2C4VA 2HWXA 4QQNA 4F5ZA 1JECA 1CIVA 2VJMB 4GKAA 3W8RA 2I62A 3ZJYA 1XZDA 5J2TF 4EVIA 1KFJB 3ELDA 5FA8A 3AEQA 4FVTA 4TQ9A 2HMYB 3F6EX 5C80A 1EINA 2AMLA 5TIIA 4KKXB 1O97D 2BEUB 1VC2A 2YY7A 3N2ZB 2ZI9A 4O2BA 2JFUA 2CVZA 1R9NA 2FG6C 2R2AA 2J8ZA 4RZUA 1MJHA 3HWWA 3ECAA 4CL0A 4CR8A 3NGXA 4G4SO 3RVJA 1TKCA 3FE2A 4LFCB 3THYA 2HK6A 2A1UB 2W11A 5JE8A 3WBBA 3GDFA 3TLJA 2Q6IA 2ZETA 3M6IA 2MMGA 1RWPA 2X9QA 4PF1A 4GVPA 3HCAA 2YY6A 4RKWA 5F52A 5EUCA 3EBLA 3LPDA 4MARA 5E1DA 1KL7A 2VDWA 3UAWA 3IKLA 4LYGA 4U3JB 5HK9A 1JQEA 2WILA 1LPBB 3W5VA 2HUPA 3PFHA 1OFTA 4KOAA 3RC2A 4DCOA 1FNCA 1KY2A 3GEBA 1W47A 4MWCA 2E1PA 4QL3A 4PHGA 1FU4A 5DTIA 5FNVA 4UKDA 5CCDA 3AF3A 4CU5A 1LK7A 2YL2A 1NKTA 5AHXA 3QI7A 1FX0B 5B53A 3W4KA 4D0NA 2Q3DA 3U49A 3NJ4A 5BQXA 4PC3A 3SOPA 3UPUA 2HB6A 3NCTA 1IQRA 1SK8A 2C97A 3ADBA 1WV0A 2FFJA 1N3LA 2I9KA 1ZXLA 2DH6A 4YN3A 5IUJC 1UMBB 5L7WA 1K6EA 4LNUA 2YCBA 4H2DA 4KO4S 1U8ZA 4URXR 2ZCJA 3S3TA 1P81A 1TMYA 3EPKA 1G5QA 5EMLA 1SD1A 4U9UA 4RH1A 3MJDA 1UBJS 4H15A 4R71A 1MHTA 1ONNA 1P7PA 3R0IA 3QX3A 5CT4A 1Y6FA 3GBSA 3ISVA 3MJTA 3QVGA 5GIOE 5B1EA 3N0TA 4TS9A 3UJBA 4XGIA 1PR3A 4M37A 4YP5A 3DVLA 4A73A 5JXWA 1S2OA 1QO7A 2VL7A 3IJRA 4W1QA 4A3SA 5AOBA 1E69A 2WOOA 1EU1A 5E2IA 1ELOA 3HO8A 3QUBA 1Z47A 4HSGA 3AUUA 2RK4A 4OXXA 2O2DA 4ALIA 2DECA 1WABA 1K66A 4HLDA 4IMPA 4B3RB 1SOUA 2ZUCA 1UBCA 2DHCA 2IYOA 2V97A 1OFIA 5BUZA 4MQ4A 4PWZA 3EZ2A 3GEDA 1W5AA 2QTTA 4D41A 4DCCA 3TI9A 1AQUA 1ITZA 1OAKA 3CLSD 1UJ5A 1W73A 1R9MA 1MEJA 2XNSA 1TCAA 4UQOA 4WXEA 1ZJ5A 1F2UA 4JLDA 1MNAA 4RYDA 4WT7A 1HT2E 2X3FA 3D8TA 4BQPA 4NOLA 4MITA 1BU5A 1I3MA 3HCPA 5A4IS 2GAIA 4IDHA 3MCUA 3VISA 5EKDA 3L6EA 5G3YA 3N8KA 5EZYB 2X5XA 3CKKA 2OYCA 4BBJA 2RHGB 4DVGA 5CDHA 3PD0A 2B9VA 3COYA 4M88A 5K0TA 4J7CA 1H9AA 1IBRA 3SFZA 1TW2A 2B4KA 1JEAA 3BZBA 2OYRA 5IASA 2XCSB 2FI1A 4TKUB 3VNQA 1XMIA 4MV1A 4BZQA 4DV7B 1HM5A 1HA3A 1UKYA 1V8FA 1JDJA 4FR2A 2XCUA 1UDCA 2B8NA 3KVVA 3OWHA 4MV6A 3OD5A 4RW0A 1C7JA 4NOMA 4Y0NA 4YJFB 2J6HA 3RIYA 1R0WA 2CNDA 1KYTA 2ZS7A 2J6IA 2P11A 2VYNA 3TRDA 4NPCA 1S01A 1SCQA 3GT0A 3L1VA 1B8UA 2EARA 2Z04A 3B48A 2QJOA 1ORHA 1J2JA 1NMSA 2PJZA 4TLCA 3X1MA 1IXRC 1NVKA 2FUEA 2QRPA 4YLEA 2BIFA 2V8BA 4LDJA 3SPXA 3JPWA 4K28A 2A9RA 3VVLA 1U65A 4LYFA 1BMDA 3SYKA 3TW8A 1NWCA 2QX8A 2XQJA 1KRWA 3W6ZA 2W4IA 3H8SA 1JHOA 1KYZA 2G7MC 1PL8A 1GQSA 4YRLA 4BO6A 2VF7A 4MRRA 4NAVA 5EIAA 2B69A 4FEGA 1YFKA 1I2BA 4Q4HB 1Y0BA 1OI4A 5E2BA 1PFGA 5TSDA 2I2AA 4KSBA 3I2KA 4RPIA 3B2NA 5C8DA 1I32A 5KVVA 2ESRA 1HGXA 3GDHA 2F9LA 2CNNA 4OMDA 3S0JA 5AUQA 2ZSIA 9LDTA 1OUMA 1UMBA 2B25A 4BZXA 2E5LB 4KIJA 3HFSA 1GL7A 3EWSA 3AP2A 1Q83A 3K5IA 2ZB2A 4E2YA 4HADA 2GEVA 2IX9A 2FMTA 1KI4A 1N5MA 2H1FA 2R96A 3EPRA 1G7RA 4Y7DA 1VZ3A 1IEVA 4ND7A 3BMQB 5KI6A 5EXDA 3DLIA 4EB6A 1ILWA 2N75A 6Q21A 2JFOA 2V7BA 3KV1A 4BNVA 4E33A 2AYXA 3HABA 2YN4A 1SWVA 3X2FA 4JSRA 1MAVA 2Q45A 3QYPA 4LS3A 4RVUA 4L5YA 1HX7A 4IIJA 3QMPA 3ZH9B 5CXQA 1CUYA 1E60A 4MRSA 1W36C 1WUJS 3DWIA 4GGOA 4YJHA 1ZVQA 2YWFA 1L1FA 3IIMA 1WUYA 5JS2A 1JYFA 2FEAA 4TM8A 5JAOA 2VJPA 4TT8A 4U3JA 2W83A 3T4EA 2CV1A 3UHAA 5AVTA 3JWGA 4ARZA 3SOZA 2XD4A 3TZLA 1PE0A 1RRFA 1P6XA 2WYWA 1EPUA 1EDOA 1YQEA 2X1HA 2ZRJA 3DPSA 5A9TA 1P7YA 2VDNB 3USZA 3RC8A 1IIRA 2EF0A 1PTJA 2AXEA 4DWJA 4HP8A 1A9XA 4MS1A 4PZAA 1OOEA 3SE0A 4BB0A 1LPNA 4DLSA 4YRTA 2ZXEA 3KYBA 4H60A 1X1TA 3P45A 3GOHA 4K86A 4LSMA 4Q15A 2IXTA 4MKIA 1GQOA 1NBIA 4TTSA 1AXGA 3V34A 3S7ZA 1JEDA 2G09A 2R8EA 4D6XA 3PIDA 4D9KA 1E2PA 5HQ3A 3L8GA 2C82A 1LTHR 4FQ5A 4BMCA 10MHA 4RV5A 2RIRA 5FD8A 2AB0A 2ZUFA 3VPXA 3Q6IA 2X14A 3K15A 1OU0A 5EJAA 1A8QA 1AKWA 4I9FA 1OH6A 2EYQA 3MRTA 2DUJA 5DGHA 1P33A 1FDUA 1BE1A 3KTFA 2AA3A 1NUAA 2HJHA 4MVJF 3VQTA 1KC3A 2XQVA 1KMMA 2F90A 5EQDA 4C7VA 3EW7A 3EIWA 3FG9A 3OE4A 5EJ2A 1E8DA 4ZJUA 3UWMA 4IGIA 1GP2A 4U7TB 1FRFS 3H2BA 1L4EA 5ABPA 1ZISA 3BD9A 3TCKA 2QGFA 3BB3A 4KN5A 5CW1A 1OJLA 2C2OA 4LZOA 3L7NA 3H9UA 3ZWOA 1R8XA 1XEXB 1J0BA 5JUWA 2BSQA 3ND9A 4IFBA 2AC2A 3LGAA 3AF4A 2PUWA 4DFDA 5EJ9A 5JEDA 2RGDA 2CDNA 1RVDA 2BLLA 2VSFA 2VYND 3B9PA 3LDAA 3ZK8A 3DE7X 1E7YA 5LBIA 2B8EA 2GBLC 3DBVO 4LJ4A 4OYLA 4TX1A 5J1TB 1CERA 1J8VA 1OGJA 3OF5A 3ZH2A 3DUFB 4RK1A 1YL6A 1E9DA 3CSDA 3IOBA 4AECA 2Y1LA 1E9BA 1E7SA 3PUKA 2D8AA 4HYTA 3EC2A 1D2GA 4IZHA 5EWJA 5FWNA 4MROA 4WERA 4BNHA 2WE8A 4CLDA 1S9DA 3H05A 4IVNA 2KSQA 3H1EA 4BEBA 3GEPA 3LG2A 3DE0X 4DS3A 3GDWA 3I2FA 4GWKA 4UD6A 1IEQA 4EL5A 1TGYA 1WR8A 1YH3A 2ZDGA 1GZHB 1ULUA 2FEXA 1NOIA 1ZM7A 3RYCB 5L7TA 1R18A 4HX5A 3WB1A 4FD2A 5JTUA 1E9CA 2FRDA 2GJ8A 3DV0B 3SHOA 1BWRA 2I6GA 3W77A 5HTKA 4EEZA 4RUKA 3S2FA 4IX9A 2PUFA 4O4IB 1EA7A 4ND1A 4KW7A 4Q3NA 1QYVA 2QD4A 4TWRA 2C99A 3JASA 3JVVA 3KDPA 5CK4A 4BRSA 4PFJA 2Q7OE 5I7EA 1Z2NX 4GZ5A 4N9QA 4O4JF 5JZSA 2I2DA 3N7UA 2HJGA 3UJ3X 3IMCA 4ZQGA 1UJCA 4GQBA 1QZUA 4KRXA 2CFIA 4WPGA 5E7MA 1A5BB 1DJQA 1Y8QA 3OFND 2ZIWB 4IDAA 4PRLA 4BQOA 5AVUA 4FDTA 1T6YA 1LUAA 2ALJA 4BVEA 3NYRA 3CLSC 4TTQA 4KRYA 3OI7A 1DIAA 5JR3A 3GVCA 1ONPA 2JS7A 1PR2A 2QTCA 3MCAA 3U7RA 1QR6A 3A1VA 3NKVA 1BMTA 1LV8A 1P2UA 1RYEA 4HUQA 4C29A 4J0IA 3RODA 4ILKA 4JQCA 4E4YA 5DM1A 2AJDA 3VTFA 2Q4DA 3K0SA 2VZ8A 1WQ4A 2Z98A 3FVRA 1OZFA 2Z3WA 1CTQA 1ZIDA 2DAPA 3D7SA 3PFKA 5IW8A 3W9YA 3DTVA 1PJQA 2IYPA 3DDCA 4ZO9A 3BN3A 5IKXA 5CD1A 3AQ4A 1WSAA 4EHDA 4OG2A 2X7JA 2E0IA 3GN1A 3NP9A 4BMZA 3UJNA 4OUDB 4U6NA 3VOAA 3H1GA 1PWHA 5BQFA 1FMFA 1OFVA 4NZNA 2F9FA 3HLTA 4RVFA 3ADPA 4PYJA 1CE8B 1KZYC 3C74A 4GLLA 3ONWA 4EGAA 4C4XA 3BICA 3K32A 2PWBA 3EF1A 1FZQA 2HMAA 1KQFA 2II6A 3C6BA 3ROTA 2CWDA 3L7MA 4QT0A 5B3JA 1TT7A 5A7GA 3A7EA 3F6YA 4C0AC 1RABA 3LKZA 2AKAB 4TXHA 2EKZA 3FX2A 3BXXA 2EC5A 3K0FA 4MQ5A 4R1LA 4B3HA 4BQIA 5C8YF 3BYZA 1WSDA 4BKQA 1A50B 4D8WA 1UMDA 2QRVA 3NM4A 4AULA 4EW6A 1M2OB 2BSXA 3B3JA 1ZGJA 3FYSA 3LZ6A 3NPMA 2GXUA 1U1IA 4C4AA 1V11B 1QIMA 2XVXA 3M33A 5FL3A 4EGFA 1FXSA 1KEEB 1RAEA 2W6ZA 3CX3A 3GXBA 4F8JA 3E0QA 2A59A 1TJYA 3I6BA 1ULBA 3OJWA 3RK1A 4PU0A 4LVOA 5KCZA 1DT3A 1G8PA 1VLVA 1TJ5A 1U5AA 3LZDA 4C07A 4QYWA 1FJ2A 3CLKA 4E5YA 1W34A 4YUWA 1WY5A 1A4RA 4PZ0A 1F1JA 4GI1A 4XVUA 5D5QA 4R2MA 1AY0A 4IWXA 5HFAA 1TZMA 2PS9A 2PV7A 2XH8A 3MINA 3PFFA 3P71T 4G23A 4NFYA 3RKUA 1I2ZA 1PJ3A 3W7AA 1GUDA 1OWLA 3EGIA 1T9KA 1TU3A 1PEDA 2GJ4A 4E5NA 4X91A 4CE6A 2QSUA 2FUKA 5JADA 2QT0A 2RKBA 2BYTA 4MUMA 1HXHA 3LIPA 3O95A 4INAA 1JHPA 1TCBA 3BM5A 4UEKA 2OCKA 2A7XA 2UXCB 1QDLB 4RU1A 4RZIA 5JATA 1Q0TA 2FPRA 1UK6A 4TTPA 6ABPA 1Z13A 4F2DA 4NAHA 1R0YA 2XNCA 4LY9A 5DXJA 5KTNA 3JY6A 4JKIA 1G21E 4BQQA 4RY9A 4ACBA 1NX6A 4H6PA 3KR1A 4PZDA 4HQLA 1TA9A 4B6SA 2J59A 1M2EA 2C2WA 2P9FA 4DTIA 3B78A 5EJFA 4AS3A 1J9EA 4F46A 5ENVA 4YR9A 4QWWA 3LS2A 4P3KA 2R6ZA 4II7A 1QVVA 4RL4A 4TV8B 2B4YA 1H65A 2GZ1A 4ALNA 3BE8A 1UC9A 1YRAA 5AJYA 2VBGA 4KWHA 4ER3A 3NT5A 4TMYA 3ZHTA 4A8JA 5CBKA 2Y1FA 3UOGA 4ZAWA 3I62A 1PU2A 3K1TA 5CU7A 3RU2A 4TRMA 2NZJA 3K0FB 2UZ1B 3ACDA 4M0KA 2RG1A 5TMDA 2QSZA 3N2YA 3QA3E 4E12A 2IYYA 2H1LA 1TJ4A 2CXSA 1IAQA 4R8KA 2BAGA 3DAYA 5A02A 4JXXA 3AR8A 4IEIA 2R6R1 3HN7A 3FHJA 4MRNA 3WZMA 4YY3B 3F0TA 3BDVA 1VECA 5EVJA 3I1FA 2IWRA 2WDZA 4B84A 4IO0A 4AP9A 1NONA 3OCUA 3GJTA 4IVQA 4ZWNA 2NTJA 4BFYA 5AW7A 2YN0A 4U9IS 1V1MB 2PRYA 5LBTA 4UW9A 2GM3A 1ZH0A 3G0DA 1Z2AA 3R3UA 4OJYA 2E49A 2GCOB 3IQXA 3DV9A 3M9WA 4GC5A 1A2QA 1GN8A 3UCEA 4BVLA 5KYXB 1NYTA 3EVBA 2O19A 3O8RA 1E3SA 2VSQA 2ZJ7A 3JALA 2XOKD 1BXZA 2J33A 2YXDA 4EO7A 2JEZA 4EUKA 1AKMA 1FYEA 4F4FA 5HILA 1DEAA 1NVEA 3CB2A 4IDPA 2IE8A 3PFBA 4F5YA 4QOHA 1ZJJA 4X0EA 4FCTA 1QPBA 3ZQ6A 4EMTA 4I1UA 4J03A 1F2DA 4NCJA 4F6RB 4MW1A 4RK7A 4DQVA 3KKNA 4EF5A 3R23A 4PAGA 3UA3A 1Q7EA 3GP8A 1YUBA 3FPGA 4GNKA 4D97A 2D1YA 2R4QA 1FUKA 2D2VA 5IULC 4WXPA 1T1JA 1XWWA 4O3MA 1P7WA 4ZO7A 4FP9A 2N47A 3CMCO 4RVSA 3GRZA 3O8QA 4RWZA 4ZJYA 4UHFA 1YR8A 3BSSA 3LFHA 3A0RB 2H1RA 1OTYA 3HP7A 3DBHA 5G0TA 3D1LA 3OZDA 1B2RA 3AUSA 1GUBA 2JNWA 3GUCA 1QIHA 2C8VA 5DLEA 4Z5XA 1ZIXA 5KYWB 4DPKA 1TZKA 2F7SA 4QDZA 1L5HA 3FHLA 1I4TD 2C0CA 1T2UA 2G9NA 3H7IA 3DDSA 1PV2A 3QFSA 3HM9A 3BCRA 1XMSA 2VUSA 2QOEA 3GJXC 3WXMA 5B5SA 3FNFA 1MMFB 1TIKA 4FFLA 1V6CA 5A1JA 2O4CA 4CFYA 3FFAA 1XZAA 4B74A 1OBOA 1CP2A 3Q3VA 3M3PA 4QARA 5B1SA 2VQFB 4HPXB 3TDKA 3H11B 2QL6A 1FYXA 1GDDA 2YMPA 4UTXA 1DQZA 1RQLA 4ARAA 2OESA 2NSHA 3JD2A 4P7GA 5JDIC 3R7WB 4ZV4A 4HLNA 2BKVA 2VXYA 5E1OA 1JA0A 3UHJA 3ZHCA 1M6YA 3ZWQA 5GGYA 2K5UA 4PZ9A 3U7JA 2P78A 1MDFA 1P5FA 2W71A 1YF3A 4B73A 4BP9A 3DSRA 3TNLA 3PJGA 4HEHA 3GD7A 3FNHA 3SEQA 1RYYA 3H3JA 1I13A 3PGKA 4LZZA 1JFTA 1G1MA 3RUHA 3ZUGA 2NM0A 4E09A 5I9NA 1MO2A 1TADA 3WLRA 3IUSA 3QH4A 1XHLA 5EPUA 2EDCA 2QVYX 9ABPA 1GWNA 3PQCA 5FPKA 2LKCA 5L95A 1IVYA 1GFWA 2C5HA 3LI2A 2QAJA 3FMIA 4JOCA 3CMMA 5E6UA 3WGTA 5CDUA 5IN4A 2XITA 3B3QA 4RD6A 3UAXA 4ZU6X 2WVAA 5ESWA 1VA4A 4OFWA 4YH1A 4PSAA 1EX6A 3P0RA 1KAOA 2O20A 2VYCA 4GYYA 5LXTA 1UFOA 2AFHE 4TV8F 3GLHE 2ZRHA 5DHAA 2JIBA 3L7KA 3EX7C 1T1SA 3F6RA 2GTPA 5IEJA 2KHZA 4JBGA 3EVZA 4RVNA 3A9CA 5ILQA 1T5HX 2UYOA 1QP8A 3L0PA 4KEAA 1T0PA 5FBQB 1T3LA 1UJMA 1NRJB 2GJ9A 3L07A 6YASA 9GPBA 3RFXA 1LRLA 1RC1A 2A5FA 1F0NA 3H1TA 1FTSA 1D04A 1UMCB 3GRKA 4MWDA 2OHGA 2VSOA 4H1HA 2WWVD 1AV6A 2NYAA 1CRWG 4FXPA 1GIAA 2HZ7A 4MMZB 3GPBA 1D5CA 1RWQA 2PJDA 3H6KA 4DLVA 1W0KD 4YWJA 1D2CA 1Z0KA 3WTCA 1Q1BA 3IOEA 4TOIA 3U4QA 1A5ZA 1DJOA 2QVLA 4N5IX 2VIIA 5FPHA 4EFLA 3ICQB 4RA9B 3RSQA 2SCUB 1UKEA 4BYMA 4A0QA 1QFZA 1YCHA 2XUGA 4FHDA 2JF0A 2G25A 1QRDA 1TAGA 1UIMA 5IZCA 4AL4A 3K0EA 4AX8A 4YBRA 4G0YA 1K6JA 1K97A 1JJ7A 4WKPA 4D4HA 5IANA 1N1DA 4Q9DA 2P1DA 2W6JD 3DL4A 3DW1X 3GJ0A 3GFOA 2R6AA 2PZLA 2WP0A 5CIWA 3OE1A 1B8PA 5KJ6A 2RJOA 4OB6A 1JVSA 2P4SA 2ZJZA 3HGQA 3IXLA 3TNDA 3VNSA 4DNQA 4KQEA 3WAGA 3B7WA 4KSYA 1B8NA 3U37A 3VJMA 1SAYA 1XDZA 1KH1A 1JKJA 3SXUB 3TLMA 1A72A 3MWJA 4HPWA 2IGTA 2YCLA 4GZMA 1XC7A 1LLQA 2AXQA 4WLOA 3HVRA 1IBMB 3WGUA 5MGNA 3H2IA 2JLYA 1NMQA 2QAIA 2IU6A 1QRTA 1IN8A 3RRXA 4F4DA 5DU2A 1YDEA 1AUOA 1XFAA 1COWA 3RRBA 1HEUA 4AXBA 4WZBA 4GKBA 3IMFA 1KA9H 5GZ6A 4EHKA 2W9XA 4KO3S 4NBKA 2G9RA 3JALB 5DGDA 4BBZA 4C4ZA 3HKDA 4BVBA 1SUDA 5BR8B 2WF6A 4DMRA 4U7JA 1T13A 4IUYA 3VR5H 1EBFA 1XZHA 4P0QB 1FDOA 1V8ZA 3U5ZB 1QHNA 4FWTA 4TMVA 3PE3A 3WRYC 3PHJA 3QNUA 1CUHA 4A2WA 4AU1A 1AB6A 1AKQA 2W6OA 1PWZA 3I64A 5EXEA 4ARIA 2AN5A 2EIHA 5AK5A 5ALOA 4ESOA 2QN6A 3VZPA 4CT5A 4GOJA 1ORTA 2QORA 1T4BA 2J4CA 1W1WA 4KGDA 2VA9A 4BQNA 1KFKB 2X8JA 1LS6A 2IU3A 4H7IA 3IXQA 3OLCX 5DE3A 1WKBA 1KP3A 3LO8A 4EQZA 2GO1A 2FAXA 4JCOA 1C30B 1KJZA 3OIUA 2B92A 3R3YA 2WYOA 3S99A 1DBVO 1OFHA 4HJXA 4CODB 1ZONA 4HWPA 4MDYA 4CBVA 1FP2A 2UUPA 1KMHA 5B6JA 1UPXA 3MIZA 3VTAA 2PX5A 2NNLD 2O0JA 3MAJA 4LQCA 2W2OA 2C8KA 4NOJA 4LV8B 1J9ZA 1KDPA 4PSDA 3MLAA 1WDMA 5IVPA 3MUFA 4TV8A 2HJSA 1II9A 1WBDA 1IJEA 4H18A 3MERA 4INOA 1G2QA 5HUHA 3D3JA 4QVGA 3TQHA 4GI5A 1B1AA 3WKAA 3DMRA 2X5KO 5IKPA 2QU7A 1Y1KE 1RMYA 4OX9B 2BGRA 4PYRA 2ZKIA 1MDBA 1ZGHA 3I4CA 5CD9A 4HKTA 2XUFA 4DMLA 3PCTA 1U7WA 4H7EA 4LYJA 4BN4A 5HXAA 4QO7A 4XQGA 3AGPA 2CFCA 3U17A 5ALVA 4PM4A 4WLFA 4X7PA 2X0DA 1JDPA 1WM1A 3TUIC 4I5GA 1P4RA 3CW8X 4URUR 5AW3A 2YYYA 2EX0A 4MVCA 1OXTA 4HTAA 3RYTC 3R5JA 1YR7A 4U7PB 1SG9A 1BZYA 1PBNA 2H2GA 1OPXA 5ERXA 3SFTA 3KEQA 3GOQA 3TIVA 5I51A 1UODA 4DBVO 2R8XA 1PT6A 2L69A 4UBNA 4HMPA 2YJ6A 5FPYA 4L4UA 3VR6H 1LVUA 3S6JA 1TJ3A 5SYAA 3O9VA 2SBTA 3LGXA 1P5HA 3KKOA 1JJVA 1UBGA 2OV8A 2DHQA 3ZDQA 3LNTA 3RS4A 2F3UA 1SOAA 1XRQA 2B0JA 2XUAA 5JSHA 2O5RA 2FCAA 4P58A 4UFOA 4DLAA 1PHRA 3DONA 3X1ZA 1K4YA 1U0FA 1W52X 3HH8A 1G18A 1N2BA 3ON5A 5TF4A 3KQSA 2HSWA 5SYNA 3Q3HA 1Q1NA 2PTGA 2X40A 5BT8A 1Q6YA 1P2GA 3AR3A 4YAWA 1NLMA 1WXXA 5H0IA 4R98A 1V2GA 5I7RA 2GK4A 3EVAA 3FETA 5I4KA 3S5JA 1K9SA 3U4AA 3IP6A 4DCMA 2OC4A 3R76A 2P68A 4BO5A 3I05A 4K8RB 3B85A 2I6TA 3OCWA 1E59A 1LPMA 3C39A 3BDAA 5EE5B 1OI2A 1HOTA 5TS2A 1HFEL 3U7EB 3W2EA 3PE4A 1L7MA 3DH0A