3D33A

Crystal structure of a duf3244 family protein with an immunoglobulin-like beta-sandwich fold (bvu_0276) from bacteroides vulgatus atcc 8482 at 1.70 a resolution
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
101
structure length
94
Chain Sequence
PVKDVELDGRWDDNCPITVFTDGYLLTLKNASPDRDMTIRITDMAKGGVVYENDIPEVQSAYITISIANFPAEEYKLEITGTPSGHLTGYFTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Domain of Unknown Function with an Immunoglobulin-like Beta-
publication title Crystal structure of Domain of Unknown Function with an Immunoglobulin-like Beta-sandwich Fold (YP_001297618.1) from Bacteroides vulgatus ATCC 8482 at 1.70 A resolution
rcsb
source organism Bacteroides vulgatus atcc 8482
molecule tags Unknown function
total genus 16
structure length 94
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11589 DUF3244 Domain of unknown function (DUF3244)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3d33A00
3SD2A 3D33A 4G5AA
chains in the Genus database with same CATH superfamily
2VC2L 3WLWC 3ILQC 1KY6A 1NC2B 1OTSC 1E40A 2MKLC 2O6EA 4S1SL 5DJDB 1AZUA 1SNRA 3QQ9C 4JZJC 4OLYH 1N0LB 4IYKA 3TP4A 1A4AA 3L3GA 5JORA 2GJZB 2NXYD 3ARZA 3CK0L 4KDVA 5FM8A 3ARTA 1CFTA 1IGYB 3ZT5A 3A67H 3G6JE 3WAKA 5E0FA 5KZCD 3VDBA 1JI2A 2J8UE 5CJQH 4Z3EA 3GK8L 3Q6GH 3VFSB 4YAQA 1KJMA 3FB7A 4NT6B 3QDJB 3WEXA 1YMHA 3S9DB 5H35B 1B3IA 1X5FA 1VFBB 2X6UA 1WAAF 2YARA 1UD2A 3NIGF 2ZT9C 4TNVF 4ELDA 4X4YA 1J1PL 3NZSA 4Z3JA 3PDOB 5IEHB 3CNKA 3NZHH 5EUOF 3S35L 3DSNA 1KPRA 3MRQB 2QVMA 4KKBD 2ADGB 3VSTA 5I0ZA 1G7IB 1PD1A 4BRVA 1FVCB 4Y4FA 3G9VA 2AQ2A 4G9FD 2BVYA 4ELKA 4G6KL 2G4GA 4ZO9A 2VISB 4Z95L 4QXTA 2PCYA 1UZGA 2X09A 4HGWA 2BIMA 5LAXA 5JXEC 3CZFB 2X70A 5MP6L 3C60D 5I1AA 3ULVF 1U93A 2RCSL 3K6DA 1NEUA 2IWEA 3NCJL 4XNAA 5DQ9A 5GSVB 5SWSD 1I3RA 5DUPH 4P2RB 4W9DC 3KPTA 3JTTA 1T4KB 3LRMA 5ETUB 1I9IL 2D7TH 1BVNP 3GM8A 2MHAB 2R2EB 5DDHB 4F37F 4F7TA 3PL6C 1JS4A 2X87A 3P77A 1YSOA 3PWLB 5C7XL 3L3JA 2K9UA 1ZLUH 1VESA 2XTJD 2GSGB 3WDHA 1LQBC 3K7UA 3QXTA 1E4XI 4CVZA 4UWQB 1B2WH 5DRNA 1S7TB 3IDIB 4IKKA 2BWIA 4JM2A 1L9SA 1YEEL 2NSQA 5HGHA 5A43C 2XFXA 1KLFA 2VZUA 1JFQL 1H0DA 2XTSA 4UCFA 1A7BA 1MCWW 2E47A 3QCVH 1D7CA 1ZD6A 4PGCA 3BZ4B 5CP7A 1QNZH 5BO1L 2DWEA 1I8AA 4AGMA 5IM7A 1LO3H 2K4AA 2Y4SA 4NWTH 2TRHA 4KZEL 4Z7WF 1SVCP 1BG1A 2NZ9D 3O9WC 3Q8EA 1KLUB 2WZ5A 4CL7A 2WK2A 3ARGB 4UTCA 3FUIA 4XP9L 4HQQL 3TN0B 4G5AA 1H19A 1HILA 4HIIA 2BCKB 3WNNA 4X7TB 1JZDC 3L4TA 3EDJA 5DJ8B 4PRBB 1TPXB 4QNPF 1OAXH 4HDIA 4AKPA 3PP4L 5E70A 1YEFH 3DROA 2WLLA 2BHZA 2IADA 2YD5A 3O8XC 3IWUA 1E9PB 4D8OA 2P8MB 2ITCA 3GSVA 3PIQA 1JCKA 4ZD3L 3BAEH 4KX8A 4Y19D 3QJHB 4GI6A 5MERB 2YKLH 4HV8A 3K2KA 4L29A 3KGSA 4ZI8A 5DVLA 3APMA 4ZUWA 3BSZL 1JK8B 5DQDL 1ZDSA 3BHBA 3E6FB 4JFDE 2XV0A 3AXHA 3EDEA 1IC5H 4G1MB 1LXMA 2WMPA 3CX5J 3F7VB 4O51A 2DWYA 4H8WL 3U7WH 4TSAH 4K9EH 5KYXB 3TF7C 4V1DA 5E6ID 5AYTA 3NBNA 4Q9CA 3MA7B 3BDYH 3BKCL 1T0NA 3O2WL 5D7LB 1FL6B 3IJHB 5D1XB 3T6WA 3EJYD 2Q3XA 3UEZA 3CXHJ 2OTUA 1ZHBB 1GZHA 1MCHA 4Q58C 4PJHA 4MJHA 4QT5A 1FYTE 4Q74A 5D9SB 2JJVA 3S36X 3CN3A 3GMMB 4O02B 4XXDA 4Y2NA 4N8UA 1TZGL 4LSUL 3BP5A 5HSFA 4XO4A 1E27B 1N19A 5IBTH 4DAGH 4NEHB 5E9DB 4DH2A 5I19L 3BLPX 4TLTA 5TDNA 4N8PA 4BWTA 4CBPA 4FQQB 3F3HA 1HXKA 1FZKB 5DRXA 4F2MA 5L6YL 2MTAA 5JPNB 1V3JA 4PVBA 1M6OB 1RIUH 4LSSH 3SPVA 3V6OE 2GJ6A 3QHZH 2VSMB 4Y16B 2PF6A 2I9TA 4OFYD 3RNQA 5DZAA 4QRPD 3VUAA 3X13B 2Z8VC 4NGHH 2NY1C 1GMEA 4KMTL 3ULUD 3SKUD 2NUTB 5FYLD 1KCKA 1XF5A 3CFCH 3MLTB 5JZ7C 4JFZH 3SE3A 1T5WA 1AKJA 1XF2B 4QCIA 1K8IA 2JSFA 1HQ4B 1GL4B 3C2AH 4FQIH 1BQ5A 1BEXA 4L9LB 2XN9D 2R9HC 2OSYA 3KXFD 3NQKA 4F93B 2Q6WA 3HUJB 3TWCL 4XNQA 3RWCA 1WJ3A 4ZMOA 2CKBA 3ASWA 3BPLB 3PQYB 3T04D 2VC2H 2H6PA 1N6UA 3OZLA 3QFDB 3UX9B 4WKZB 4MJJA 5AOIA 3RPKA 2JCCF 4CU7A 4XBPA 3OSVA 3GTNA 32C2B 2Y72A 3U6RB 4EDXB 2P5EB 3D3VE 1NIEA 5I8EB 1FZMB 3CN1A 3CK0H 3IBEA 1FV1B 3US9A 2OSXA 4P4KA 1V55B 1KPUA 3GEWB 2VLJB 4ZO6A 1SHWA 3AW5A 3OXRA 3EGDB 2M1KA 2DQHH 5F21B 2OSWA 3EYVB 2PR9A 3GK8H 3NFSL 1LO5A 3ECVA 3N1QC 2EE6A 2EEFA 3MYJA 1F3DH 1E6OH 1ERNA 5FKPA 3WIFB 3D25B 3GZPA 4LLDB 4OM0L 2QZQA 3WFEH 4IBSA 5PAZA 1M2VB 1XF3B 5C09D 4O00A 3E7JA 3F7YA 3BQUC 1F4HA 3D39A 2QPDB 5JIMA 2XPGB 3VXQB 3OKEA 1Q9OB 3TLRA 4CILA 2C34A 3GRBA 4HUWB 1T21B 1LP9B 3GIVB 1KCUH 3KYNA 4UQ9A 5B21A 1JXDA 2VSDA 5EU3B 2BSEA 2HRHA 5EF0A 2DIAA 5MP6H 2EILB 5I1LB 1MHHB 1Q0YL 2YR3A 1P7QA 3QEUB 2RCSH 2BHYA 2ZKWA 3NCJH 4F37K 3AG3B 1WISA 2AXGB 1MI5B 1VACB 4FFZA 4ILDA 1USQA 5EZOH 4E9RA 1PNCA 1FL5A 2CD0A 3IDYC 4NZRL 1S9XA 3DO3A 5HPMB 5LNGA 3EYSL 2A9NL 3MLVL 4BZ2L 4PSPA 1I9IH 5I16A 1YG9A 1SMAA 3ML9A 4MA1B 3VXSA 3GSQA 1U3HD 1U58B 3T2PA 3ULSB 4F8LA 3MLZL 3GRWH 4KI5E 4HS3B 4JFXA 1ZV9A 1M3JA 2DF3A 1BVOA 3MRJA 1YEEH 4U1GB 4ZAKC 1JZ4A 2EACA 1VADA 4ZJ9A 1I9JH 3ILPB 3D4CA 1GSMA 4HZLB 5DUJA 2EZ0D 4X9GA 3CU1A 1YEDB 3O3AA 3V55A 5BO1H 4EN2A 2CH8A 3N5AA 1JYWA 1I3GH 1S9VB 5HHPB 1YJDC 1F86A 2FLMA 2APSA 1MLCB 2PETA 4KKZA 3EGSA 3H9ZA 5FYKH 5CCGE 4HQQH 5AD0A 3LZLA 4HOXA 4FXGC 1XFPA 4MXQC 4HAKA 2ZYIA 1XGPB 5HHMB 5KWYC 4JFEA 3O3UN 4AM0Q 5F9JB 2L7UA 1CG9B 3RIKA 3V9FA 5I66A 1LHZA 2YA0A 1A4BA 4RSYA 1RQ5A 4YE4L 3CBJB 4P2OD 2OMTB 1C5DB 2LR4A 2ICEC 5GSRA 3PP4H 5KVFE 3B7YA 3CZGA 1IEBA 2NY0C 4PJIA 4AQ1C 3VXOB 3GRGA 3EDFA 3MGOA 2Y7MA 4N2DA 3MX0A 5EV7A 2AXFB 3RWHA 4ZD3H 2P3YA 5CJBA 3IGLA 1MFBL 2IGTA 3L4XA 1REIA 1LO4H 4PJ7E 5C0IA 3O4LE 4J3OC 1QI4A 1WAPA 3ARYA 3QO1A 4OKDA 4APXA 1A6WH 3U48A 4MJIB 3LRGA 4ZSOB 4AEFA 2NPLX 4TXVB 5DQDH 3LH8A 2AEIT 3QJOA 2AQNA 3ESPA 4OSUH 1A4CA 1YRKA 4L3ED 1CGVA 4H8WH 5HYSG 2KZ1B 2APFA 4RDQG 1BFTA 1H3TA 5AW0B 3TTYA 3BKCH 1B4TA 1FORL 1O6SA 3F05A 2R2CA 3GXDA 3C75A 3MV8D 1JXGA 2N01B 1E42A 4O9HL 3B2UC 3FN0L 2OMZA 2YGOA 4IJ3C 3IF1A 1ZVSA 3GF8A 2A6DB 4W9GC 3WGUB 2YSTA 4B41A 2G0KA 1TZGH 4LSUH 4QAMB 4YBLC 2F19L 5EC1B 3VFNA 4ATWA 1FZOB 3QDMD 1ZLSL 5L6YH 1DVFC 2RR3A 2BNRD 2R69A 1YEJL 2FYVA 4L8BA 2F61A 4YH6A 3ECUA 3NH7L 1IQDA 2YSSA 4WHTA 3NSDA 4X6DA 2XWBB 4K9JA 5KYWB 1CLCA 3N1GC 5B1KA 3QS3A 2Z92B 3D08A 4M7LL 4RISH 1HHKA 4LGSB 4U1MB 2IMNA 4ZUVB 1U8IA 4CU8A 2KZBA 4IOIA 1W72A 5I0DA 3F5WA 3MYZA 1YY8A 3IGUA 4H0IA 3BVNB 4JL2A 4UDUB 2O26U 1FFQA 4NUPA 5C0AD 6TAAA 3VRIB 1G7JB 2WQUA 4J1UB 4Y5YC 4ZMQA 3UPCA 4QWWC 5EIVA 3X12A 4UQ3A 4MQTB 1LO2L 3WLBA 2Q8AL 3HE7A 1A9BB 3MLWH 3KDPB 1JWMB 1CD0A 3C5ZA 3KWXA 3WG7B 4MX7A 3WHE1 3I6GA 1G6RB 4A2EA 2FO4A 1F3JA 1F42A 1WFOA 1NCWL 3AZUA 2QPFA 1MLBB 2Z93A 5DK0B 1WBZA 2CDEA 4TV3A 1U8OA 2EXWD 3P4NA 2VDPL 1B0WA 1EVTC 2IAMD 5KBMA 2Z7UA 2PCPA 3I02A 3RZCB 1ZHKB 4MQ7B 1SBBA 1FGNL 1IFGA 1OIOA 1KTLB 5I8OL 4WJKB 1ZT1B 2WZPD 4XRCA 4F7KA 4DUXA 3VI4F 3CVHL 3RX9A 1OE2A 2QGDA 5FIEA 2H32A 4PSRA 1ZLWK 4YMPA 4UT9A 1MQ8A 2VNCA 2MNWA 1KJVA 1Y7VA 1MHPH 3GD1C 3MRNB 4XP5L 4UM8B 4YPJA 3ZQWA 3KLQA 4M3JA 3GBEA 2FWSA 4YX2L 3FT2A 4Z5RA 4WW2F 3GSWB 3PP3H 1U2YA 2XQYA 3X14B 1NMCB 3MRMB 2O1AA 3WGVB 1BYNA 1DQTA 4EOWL 2WW8A 2FH6A 2ADJB 2CM6A 1Q0YH 2UZPA 3BAKA 2NXYC 4XCFH 4UAHA 1OKEA 3SPHA 2HTLC 5CP3H 3HI1B 2HJKB 3AXLA 1WCBB 4NZRH 4YVNA 4P2QD 4Z1PA 3DXAA 2A9NH 1DDTA 4PIBA 3HE6A 3MLVH 4BZ2H 2D03L 3L3HA 2PLTA 3IJSB 5TD4A 4MTMA 5DEFB 5KSVA 1T66C 4N0UB 4PGDB 4NRXB 4HLEA 2D7NA 3PHOA 1XHHA 3MLZH 2HZHA 3HR6A 4G8FB 1E67A 1KCBA 3ESMA 5LNEA 1S5IL 3TIEA 5I0YA 3N41F 3MRKB 4OCRL 3ULUF 2QELA 3JV4B 1GC1C 4LBAA 5ES4B 3OAZH 2EYRA 4NO2A 5D96B 5DSCA 1F97A 3FQRA 4B27A 2BY2A 5CCKL 4X6CF 1I85C 3PJNA 1ACYL 4WI4A 1XSIA 2ZXEB 1PY9A 1IKNA 4GRLA 3RFRA 3MUHL 5IQ9A 5GGSY 4YSTA 2ZQKA 1AR1C 3HMWL 4JFHE 3RVVD 2ZWKA 5E0QA 1ZV5A 1G9NC 4PJ8C 1V54B 4MQSB 1M05B 3AC0A 3H7LA 4N6QA 1Q38A 4ZUSA 4FL4C 1T83C 4JJ5A 5BPPA 1QHQA 2QKIB 4PUBL 3M1BB 3QEQB 3QDHA 4ZUTB 4FADA 4GXUM 1BBJA 1X7TA 4JN2A 1EXGA 4HFWA 4HWEH 1S8DB 3WIHA 3F65A 3C8DA 3ARBD 4UMGA 3WYRA 2ENQA 3MRDB 3PAZA 4M93B 15C8L 2CRIA 1NUFA 3ZUCA 3QA3B 1O7DC 5CLXA 1ET7A 3HS9A 4ZMWA 1IM9A 2NY4B 3KBEA 4R84A 1CD1B 4N9GA 1N2RB 5EZJA 5HY9A 5MHSE 3B3IA 1NCOA 2AV7B 3L3KA 1LO0H 1KYUA 4MMZB 4HUUA 1NEPA 2LU4A 4L3FA 1JYNA 2VQ1A 3BFWA 1PZDA 4V1DE 3H7BB 5IJKC 4DVBB 1FORH 2J6WA 3ZLQC 4ZO8A 1PZAA 4FXKB 3NSJA 1ZANL 1M9WA 4O9HH 1S7RB 1UWGL 4NQSA 3C6LA 2FB4L 5C3TA 3D0VB 5DCCA 2FEDC 4ODWB 4PJHE 4JZOA 3VGEA 3DTDA 5ISZB 3DJZA 3V5DA 3ARFC 4EKXA 4Y5VB 4HYTB 4N90D 1SXBA 3HNTH 3LV3A 3F64A 1W0WB 4UQDA 5HI3C 3WJLC 3PU7A 3MNZA 1U8CB 2F19H 1NCHA 4GMSL 4IKJA 3FTUA 1RXLA 1N59B 4AEIH 5F3HA 2FD6L 4EQ2A 4YJZL 2YPLD 2O5XL 3H42L 4PWGA 4XN5A 2C9QA 5EB9A 4F2ME 1ND0A 3GI8L 2VMCA 2UY7B 4BUHA 2GJ6E 4HK3N 3G5YB 1BJ8A 3F84A 4PTUB 1KBWA 4HW6A 3CVDA 2QTEA 2VABA 3QG6B 3F58L 4H4NA 4JBSA 2CGZA 4WW1A 4M7LH 3VWKA 1WFTA 1UTDA 1XGQB 4OZHA 4JHZA 3K72B 4F8OA 3VO0A 2E9IA 2BWQA 3X3GL 3S3JA 5DC2A 5IFAL 5CZKA 2HH0L 5E8NA 4IBQA 2AHIA 5ITFB 5IB5A 4IRZA 5C0DB 4PRDB 1MCKA 2FWLB 4JZNB 4YZFF 2CLVA 4TPRL 4YHPA 1KYAA 4FE9A 4BRJA 1LO2H 2Q8AH 2R56L 4ZYKA 3FU5A 2R1WB 4PR5B 3WO3B 3IE4A 3MGTA 1T7VA 2OSLB 2KDGA 3RWFA 1E7VA 1F6FB 3DPBB 3T2LA 3FT9A 3MTRA 4OU3A 3W5NA 3TZVD 4OD2A 3M45A 5E23A 5H94A 4NCC1 3HJEA 4Q9QL 5CJXC 2WGXA 4X4XA 3UROR 2VDPH 3SDDB 2WBJB 4XZUA 3K3QA 5KVFL 3BPCA 4JB9H 1DJGA 2NQCA 4NI3A 4F57L 1FGNH 4S1QH 3TA4D 4JQIL 4WKXA 3CUPB 4K8RC 1KXVC 4PCKA 5I8OH 3LDBC 4PFEA 2IV9A 3LX9A 3VRLF 5TE4L 4O58L 4PBDA 5IT2L 1P9MC 3J8F7 5JHAA 4JQXA 4F15B 5IUCA 2FSEB 3IWVA 1E2ZA 3QQDA 4IHOA 5EH1A 2AQPA 4WHYH 5F1NB 3VGAC 4ZDHB 5E7FA 3S37H 1I7ZB 4JLRB 3VSUA 1A66A 3LIUA 3D39E 3QP3A 5F0LB 5GQBA 1IGJB 4P5KB 2IH3A 4DEPC 5IVZA 2VAAB 4QHLA 1WTLA 1CI5A 5JHDA 3OB0H 4BV1A 1MCJA 4YX2H 1KTDA 1SLVA 5E1QA 5L0QB 2A77L 1H3VA 3B2VH 3EJUA 3I2CL 4LSQH 5JIDA 4HK0B 3CG8A 5T1LB 4D7BA 3QULA 1E4WH 2QSQA 3SDXB 5A3ID 5FF6A 4EOWH 4N4YB 4FQPA 5AG9A 4NWUL 3I9IA 5I76A 5AZEL 1R5WB 4Q6IC 4WJG3 1QTPA 2I26N 1YY9C 4TNGA 1N8OE 3KNBA 4HSQA 1MW3A 5DD5L 5F44A 1S7VB 4J6RL 5LNDA 1ID5I 3T0WA 1RK1A 2D03H 3M6DA 4L4TB 1Q9WA 3FRUA 1S6NA 1B4JL 1EAQA 2L7JA 5AKRA 3VXSE 2V6HA 3FU3A 2P8LA 3NSXA 1B0RA 3GSUB 3PWPA 4E0RB 5E9NA 2K6ZA 3UBHA 1IGCL 4HUKB 4OCRH 3CHOA 1SUHA 5B39G 1NEZG 1PD6A 3AT0A 3LRSA 1JXJA 1P53A 1MRCL 3LN5B 3Q2LA 5E5MA 1SJEA 1HIML 5TE6H 1WZ1H 3DJSA 1ACYH 3QUYA 2QADC 3D9AL 1G7MB 4RGNC 2EH8H 3IDGB 1BREA 4KKPA 4KK8C 8FABB 3O6FA 3LXBA 1LM8V 3SYCA 1VEMA 3HMWH 1JPST 1Z9SA 1C1EH 4KUZL 1CFQA 3CSBA 2CHNA 4RA3A 3TO2A 3WD5L 1CURA 4P5MB 4JFEE 2BSDA 3GXTA 1AGEB 4PP1D 3BD3A 1J7VR 1KC5L 2ZP8A 4RMTA 5EOCJ 4DCQA 5GS1B 4IS6A 3CZKA 3ARDA 3MPCA 3NJGA 4JFFD 5JOFB 3LKRA 3MCLL 2YQ3A 4JAMB 1U3HC 2KBGA 4PJIE 4QD2E 1SOQA 4GUPB 3DGGA 1WE5A 4TUJA 1A5FL 3NOIA 5IEKA 2BVPA 1J9RA 3TA3C 2K6YA 4D2NA 1A3ZA 3GJFK 4Z76A 2CDGA 3EUUA 3W38A 1YEKL 4NKOB 5K1JA 2EZ0C 2APBA 3VG0L 3WE6A 2XNAA 3GHPA 4XTRC 3N85L 2Q86B 3KWWA 1FLRH 4QPEA 4Z0BL 4UOW0 5ILTH 1HOCA 3JTSA 5CJ5A 5ID0A 4M3HA 1XTLA 3Q1SL 5H2BB 1UH2A 4N2IA 2VL5B 1GAFL 2NQ3A 4R0LC 1E28B 3UYOD 2YWZA 1CTNA 2FRGP 2P5WB 5HDRA 3AQZA 3VXRD 2NT1A 3SD5A 1ZANH 1WDAA 4NQEB 1UWGH 4M7ZB 2FB4H 4IRJD 1MCPL 3EFOB 1D3CA 5C2BH 2FT6A 1NCTA 4FG0A 5EFIA 1UD5A 2FJGB 4R96B 3C09C 3DHPA 7FABL 2B3IA 1GTFA 4JANA 5HDWA 2FH8A 4FP8L 3SBQA 1IFHL 2NR6C 5IFHL 4NAQA 2GB2A 2AJ3B 1G1KA 1GIGH 4GMSH 5DLLA 3ZPDA 3T0ED 2DYSB 5FKAB 3ZDYB 2FD6H 3ECWA 4R7LA 1F4WL 4WO4A 2WWNA 4OZFH 3QIWC 4RMSA 1MFEL 4Z7OF 3VI3A 2VRAA 3DUUB 3L3IB 3U9UB 2BZDA 2WXNA 5C07B 1EDQA 4OD3H 5TQ2L 5DRZB 4X6DE 2DKSA 2BDNL 3F58H 4XN4A 2XV6B 3OAYH 3U7YH 1E4HA 3K46A 5T3XL 3UYPA 4XMTA 3RVXC 3P3RA 5JR1L 3OKNB 4GG8A 3QI9B 2DQTL 2K8MA 3BPOC 2YMXH 3FTZA 3RA7H 5CEZD 2HH0H 3GUFA 3VFUA 4U3CA 5CN3A 2L8AA 4DZ8B 5IB1B 5E6UB 3ZL1A 2Y3AA 4TPRH 4TUOB 2XV3A 4KV5F 4XNZB 5D7EA 2YXWA 4IW4C 2A0LD 2E9GA 2GITB 5DUBB 2XZQL 2NW2A 5CS7A 3T8XB 2AK4B 2IAAC 2A9BA 3HW7A 5D2NC 4U3SA 4UOQA 5IB4B 3B9EA 1J8HB 4XGZB 3KPQA 1KLGA 4MS8D 5F1IA 2NYZA 4I18C 4NQDD 1A7NL 5EC2B 3ZGHA 4Q9QH 2R8SH 4KQ4L 4XN8A 2VLRD 3HI6L 3VFTA 2KS0A 4E41D 1XTMA 2H3XC 2CO7A 4FQXA 1OZTG 3AREC 5KYYA 1G4MA 4F57H 1S3RA 1G0DA 5GRUH 3VE0A 4JQIH 1EUUA 3FB5B 2WQWA 1SMOA 3A5VA 1OM3L 2J5LB 2CRZA 2OKMA 3FT3A 1QLRA 2CHZA 5IT2H 3FQWB 3VMNA 2ZUXA 3HB3B 4GRWE 1PU0A 2NNXA 4U1JA 1T2QL 3G04A 1BF8A 3B5GA 3BLBA 2Z91A 4Y2DA 2ZXAA 3P0YL 4S1RL 4LO9A 4PRHB 2OYLA 2V0AA 4FZEL 4PJ5A 4FTVB 4HWBL 1N0XH 3RRQA 2C7FA 3NPSC 1VGKA 2WYTA 3N1MC 1IV8A 1NFKA 2A77H 1EAOA 2R59A 5EZLB 4C4UA 5LKNA 3KM2A 2OXGA 4E9YA 4N6RB 4HD5A 3LKNB 4MJ6B 5MEND 1E4XL 2YPKA 1L7IL 2P80D 4UANA 1N6VA 1E50A 3C9NA 4WFGE 4XMLH 2EXWC 4LEEA 2EICA 4NWUH 3ORJA 2PYEB 2XX1A 2PO6B 1W8EA 1XMEB 5AZEH 2XKNB 4YDJB 2X2YA 5JO5B 1NFDB 1OGAD 4H26B 1PZUB 2VW6A 4LIQL 5B1AB 5D1QA 5DD5H 3DXAE 3MR9A 2XIBA 3C6SA 1I7RB 5DWUL 3V5HB 3F12A 4R5TA 2MNJB 3CFBA 5KANI 1R3JA 3BMWA 2CCLA 3PAYA 4FG6D 3UGEA 1CTMA 1AGDA 5I5JA 2HA1A 4HS6B 1ONQB 5INCA 4L8DB 1GGCL 3L9RA 1F90H 1MFDH 4QHNB 4C56A 5HYIA 1IGCH 3Q43A 3G6JB 2R7EB 1AC0A 1RZQA 4WI9A 5AOZA 1MRCH 2WNGA 1XT5A 2NXZC 3BSGA 3DBSA 2YMTA 4BFIB 2H2SD 3UTPD 4KZ0A 5DHYA 1RD6A 5EOTA 4WU7A 5DU7A 3HIZA 2GW5A 3FH5A 2A6IA 2BSTB 3QR2A 4M3KB 3ZL4H 4F1SA 2G5BA 2CO3A 1XH3A 3NIFF 2ZOLB 1E5AA 3O3EA 1JNHA 2Z31A 3HZMB 4MWFA 3T4YB 3WD5H 4WUUB 3OR7A 2MKWA 4CMMA 2FR4B 4Y4KD 4FLOA 5CSZA 1KELH 4PVMA 1U8LB 2OR9H 2BNQD 4QJ5B 2W59A 1HWHB 3OB8A 1EJOH 2YD2A 4JY6B 1PSKL 1NINA 5IKCB 1VKXB 3D85D 3MCLH 3L5WB 1LEIB 3IK2A 4YHYC 3OAWA 4P9MH 3DRTA 1I1YA 4GW4B 1A5FH 4P3WA 4G71B 2VMJA 1A1NB 1YEKH 5ICYB 4UT7L 3BVWA 3VG0H 3TURA 2CPCA 2FGZA 4KBPA 4F2FA 4HUVB 1KXHA 2E9WA 4MAYB 4G8IA 1CK0L 2O6CA 4Z0BH 5I28A 1D2PA 1YAIA 1ZTXL 3KVQA 2Q3AA 4KXCA 4XCCL 2WAHA 4AL8C 1PAZA 2VKWA 3WE1A 2H1PL 1GAFH 4O5LH 2FSDA 4HCRL 2F15A 4N2FA 4QI3A 3TVMB 1G5GA 3SODB 4DETA 1KEGL 4WI7A 1NC2D 5AAWC 3MUY1 4DGWC 1J0KA 1MOEA 2ED6A 4A6YA 5I6NA 2OZ4L 4IRSB 5ESAB 3T4AA 2DV6A 3VX0A 2JB6A 1BA9A 2X4RB 3JQOB 2JIXB 4FP8H 1DJXA 1IFHH 5FW6A 3ARBC 2YIHA 3BEVB 4K3DL 4F7CA 4ELMB 3HS0B 4L8SA 3MUJA 5CN1A 1IGFH 1WBXA 1F4WH 1U91B 4HHAA 3LKOA 3BLKA 1NDGA 3QDJD 3RVUD 2VDPB 4OGAC 1AZRA 1NWPA 1J0IA 4U1KA 5TQ2H 3SPGA 1CF8L 3K4DA 1K4CB 2BDNH 3SE4A 5BQ7A 5T3XH 1DYZA 1F6AA 4Q8BA 4DNLA 5JIPA 1AXIB 1UWXK 2DI9A 3GKWL 1XR9B 4OZHE 3G08B 2DQTH 4G8EB 4Y1SA 5JR1H 1HNGA 2WTRA 3PAVA 3QZLA 3CVHB 5EIIA 4XR8C 3PWVA 4JY5L 1UVQA 4DF9A 4PJGA 5EG6C 2ISDA 1E9QB 3BVTA 4QGTA 1JV5B 1KBPA 3MA9L 2D4FA 2NSMA 3IRCA 4U2ZA 2E74C 4LLYB 1CC3A 3FZUC 4JFDB 1JV2B 2X4NA 5C97A 4IMKC 4XVSL 4L5FL 2XZQH 4XHQA 5D55A 3FT4A 1YNLL 4GW1A 1H5BB 5KAQF 4O2EB 4PYGA 1S5HA 4UIKL 4ONFL 1RZ8A 4UOJA 1A7NH 3H3PL 4KQ4H 3GSRA 5FUOL 3B56A 1FCGA 3H2WA 5ESVA 2EXYC 2FIKA 4PJAA 4UTAL 3Q2CA 1VCAA 3HHSB 5J8OA 4G9DB 5FO2A 3V0WL 3OXSB 1SFDA 1G0XA 4OZ4B 3QZWB 4H0HB 4L4JA 1HSAB 1O9ZA 1OM3H 1WTGT 4IDLA 3L3OB 4X6EA 2A6KA 3BZFA 5JMRA 5EO9A 3MRGB 4OCMC 4OF0A 2OW7A 3TJHC 1T2QH 3ELAT 2FHFA 1W0VA 2YGPA 2ESVD 2X6CA 4S1RH 4DJMA 1XIWA 4LLAA 4FZEH 1ORSA 3VWJA 2MQ0A 5ACZB 4HWBH 4YXHL 1SY6A 5FUCE 1BVKB 3ARGD 5JHDE 2V8LA 1MY5A 1XQ4A 3K1DA 4PJFA 2A4CA 4OCXL 1XAUA 3TN0D 4MZIA 4Z7NE 3TWYA 3U0TB 1LL1A 1OCWL 3GXIA 3I9PA 3VFWB 3MC0A 2AW2A 3S5LA 1BOGA 1E4XH 1XEUA 2CUHA 1L7IH 4XAKD 5I74B 3TPUB 4QO1A 3RL2A 4R5XA 2OA9A 4KJWC 3VM7A 2XXGA 1TT6A 4ZNCD 2JCWA 2XRAL 3FNKA 4L23A 3TCLA 3DIFB 3TT1L 2J88H 2DMBA 4QTFA 3M7OA 4LIQH 2EQDA 2PNDA 3A4FA 1SXSA 3O2DL 4AEEA 2BOCB 1YJDL 2MH4A 2FUTA 2VWEE 3HBZA 4U1NB 4HAGA 5D7IA 4K5PA 4BQCA 3D3VB 2ZUQB 1GGYA 3CH1A 4CJ1A 5KSAC 4ZQKA 2OX5A 1U3NA 3FRPA 3HG1A 4WI8A 3PWPE 1J5HA 3VD7A 4G5ZL 1L3NA 4D0BA 1X5KA 1F1GA 5GS0C 2BFGA 5IHWA 1T1XB 3E3QE 5C08B 2WXJA 4AMWA 4G43A 4CADB 4I0KA 5D1XD 1X5XA 1P1ZB 2IXQB 1JF1B 4Z0XA 3EYQD 3J7HA 4FNLL 1CDUA 3BZEB 2YA1A 4YS4A 2A74B 1BZOA 4H0GA 4OLWL 1NUNB 5DYFA 2Z1KA 1LEKB 5JA9A 2ADYA 4WNJA 3VRJB 1NOAA 3FSZA 4LRNH 1HC1A 4WFEE 2V7HA 1Z0NA 2F74A 4PH8A 3TH3T 5E9DD 5GZND 2Q2LA 5HHVL 3HFML 4NRZB 1HHGB 1WC7B 4PREB 2IQAA 2NY6C 2F2HA 4OY9A 4UBDD 2FWOA 2XA3A 2NX5B 2ZX6A 5AOKA 1HJBC 2DLFH 3UZVB 1PSKH 12E8L 3OMNB 4XVUC 1Z5LB 4Y16D 4P5SA 1WZKA 3LRHA 4X98A 4LAQL 3RGVA 2AQ3A 2V8MA 4X5LA 4XPGL 1XVSA 1EANA 3SCMC 1CXIA 3H6JA 2E8YA 2XZCH 4OZFB 1HXYA 3B6SA 2AC0A 3QC5X 3CQPA 1RPUA 3MBEC 1N6QL 1GKOA 1CK0H 2EE9A 3G5VB 4O2FB 2LVCA 1ZTXH 1SOXA 2Q5BA 4R8WL 4XCCH 2K4WA 3OHXA 2QT6A 2JF1A 1IGML 3NFNA 1ODAA 4CGUB 2BSRA 3T3ME 3TBTA 3MRHB 4Z7VF 3PQYD 4HCRH 2PYFA 2VDOL 1KEGH 1EERB 2CK0H 1WVZA 2GTZA 3BVVA 5F7DB 3NESA 2OZ4H 4AIZA 2GTQA 2V9TA 2P5ED 2H3NB 2XQYG 5IG7B 1C16A 3BXNA 2DLGA 1FC2D 1FQ9C 4LQFL 2VLJD 4RAUB 3SYOA 4XO8A 4K3DH 5CEYA 4WWPA 2GAZA 2EIDA 5ENWB 4XBEL 5EOCL 1JTTA 1N12A 3DRQB 4FCHA 2P49B 4N2OA 2V3DA 3M1OA 2KQNA 5BMFH 3OKMB 2KL6A 5GRJL 4N86A 1CE1L 3DI2B 3FQTA 2NY2B 3VI3E 4L1TA 3WTXA 5F9AC 3G5ZB 2B15A 4P23C 5T1MA 1N7MH 4G7YL 3LYRA 3PV7A 5GGUA 4MD4A 4C57C 1P4BL 1YDPB 2ZCKH 3OKOB 3O45B 4OD1L 2TSAA 4X7CC 3S35X 1IEHA 1CICA 4XWGL 3U82B 4Y9EA 2YEQA 2DD8L 3ALXA 4J3TA 3GKWH 3MFFB 1AQDA 1Q0XL 4ZBJA 5D93C 3LEYL 3PREA 4PJ7B 5HDBF 4U31A 4PJDA 3KGTA 3O4LB 4K3EL 5J13C 4JY5H 1UXWA 3T3PE 1T7WA 2RH0A 3QARA 4XVJL 4XPFL 5CU5A 3CSFA 5E2WL 3MA9H 3LHPL 4HIHB 3D18A 5SWQA 1MI5D 2FE0A 5FDWB 4XVSH 4L5FH 1JTOA 3NZ8B 2CLRB 4FULA 3SKNB 1RH8A 3LVTA 1BEYL 1YNLH 4MXWL 1QBAA 3EIFA 2XV2A 1K6QL 4ONFH 1QO3A 4UIKH 5BW7C 4KXDA 5I1KL 1AS6A 3FO2A 1FHNA 2FTAA 3H3PH 1LD9A 1R1CA 3AG1B 4KX9A 1UWEL 1YEHL 4A39A 2UUDK 3MOBL 2WN2A 2WQVA 4ZG1A 4UTAH 3TONA 2HLEB 4WEUD 3V0WH 4ZFZA 1BIHA 2KHAA 2COVD 2QHLA 3PJLA 1XGZA 2CBQA 3APNA 2ZAGA 2P5PA 2VZ3A 2ZKXA 2FGWL 3ALPA 4M4PA 2ZYHA 5BZWA 3WJJC 1ANUA 3RDTC 1EO5A 3CSYA 1WEJL 3ECBA 3S8FB 3OZKA 4YK4B 1A8JH 4PJ5E 3HAEA 2DYPB 4V2CB 4N0FA 4UDTB 1JGEA 5D2LA 5EDXA 2D7PA 4OCXH 4F9LC 1YYLH 2ZUUA 1H6UA 3VQMA 3BAJA 4G7QB 4JFPB 4BIKA 4QTHB 2QDVA 1PJWA 5IMLA 3SQBB 4XN9A 4F7MB 2R2HA 5FX3A 1OAZH 4PGBA 4PJBA 4XAWL 1IAOA 1HESA 5JTWA 2ODIA 1FNGA 2EKSA 1I1FB 2XRAH 5EULV 2XN0A 3QFJB 4DKEL 1UENA 5GS2H 1RSYA 5J56B 3NJIA 4TKWA 1A7RH 1IAKB 1Q90A 4N1HB 5D1QE 4DSYA 3O2DH 4LKXA 1QABA 2PN5A 4IGBB 2DTML 5AW6B 3BC9A 1BQUA 1HL9A 1YJDH 3ZDXF 5AZ2L 5HJDA 3BAYA 3VGBA 3WY3A 3K6IA 4MJID 3KD4A 3L3GB 3VCLA 5JORB 1G9NL 1J8RA 3SY6A 3INUL 3LKQB 5DZLA 3ZO0A 3HC3H 4A7SA 1I8KA 1CFTB 2FT8A 4G5ZH 1DQDH 3NFPB 4C56E 4G7VH 4HJ1A 3DMMA 2C3WA 3CMOL 4ZMNA 3ARXA 3FQUB 4HKBA 5D72L 1U8JA 2CXKA 4BFBD 5ACMA 2F5BH 4YAQB 3WNJA 5TJWK 3FB7B 5GGRA 5I6XC 2D3JA 2O61B 3WEXB 1YMHB 2PP7A 5D7JC 3ZDWA 1NMBL 4FNLH 4ZXBC 2YAFA 1OSEA 2YGVA 4OLWH 1QBMH 4DGYL 1PCSA 3MKGA 5CEXA 3Q8FA 2WUBH 1WT5A 4J3OH 3GHBH 3DOHA 4EN3C 2ENSA 1FP5A 3FTGA 3DSNB 2H0FA 1KPRB 1L9TA 2JQZA 4UYQA 4PVNA 4NUGH 4I5BB 5DD6A 3OTTA 3HFMH 1ZSDA 1IT9L 4OUUA 4Q89A 1MRFH 4Y4FB 5DC4B 5EN2B 2BVOB 4ETQA 1S7QA 4NDMB 2QV2A 3TT3L 4MA8L 5HD8D 1WAAA 5LAXB 4U3HA 4WTQA 4G6MH 5I1AB 1U93B 5E08L 1TU2A 4LAQH 1K5WA 5DQ9B 3WSQL 1FVEA 4JUSA 4K3HA 4XPGH 4Z7UF 4NN6B 5EUOA 2DMKA 1DUZA 3D06A 2WCSA 3RWEB 2HJLA 1HYSC 3OJ2C 2UXFA 3GYRA 3VAEA 2AFNA 2ZYRA 4MCZA 4QIRA 4F7TB 1N6QH 5C8JB 4MMXA 3P77B 2OR8A 4R8WH 4YC2C 1DCEA 2Z6FA 4GQ9H 1QW9A 3VXMA 4CVZB 5MEOA 5DRNB 5AVWB 3BAWA 2VDOH 5HGHB 4KJYA 1XSOA 1RKRA 5B4MD 2XFXB 1KLFB 1YNKL 2X9YA 1X5GA 2EDKA 1P7HL 2JH2A 2DWEB 2EDQA 5IM7B 3N55A 3SDCC 4HETA 1HCYA 1XZWA 3WTYA 1CBVL 3AUWB 1TJHL 2V2TA 2J71A 3DURA 4LQFH 5DK3A 2AERT 5T33H 1DDHA 1U30A 2F1EA 5EOCH 3L4UA 5T5NG 2IV8A 3STZA 2VKXA 1JXKA 4ERSL 3BN9C 5GRJH 1CE1H 3APFA 2XDHA 4FHJA 3FQXA 1G5AA 1NCCL 3OJDA 4G7YH 4HDIB 4Z7WA 4LCWD 4UT6L 3DROB 4W70A 6PAZA 2WLLB 2IADB 1II4E 4XWGH 5F89A 3X3FL 4PB0L 3B7SA 2DD8H 3ETTA 3T2QA 1XBRA 5J9PA 3KYOA 2JB5L 1Q0XH 2ITCB 3L7EB 3GSVB 3FFCD 3PIQB 2R29L 3LEYH 1AHWB 5LWYH 1R47A 4JW3A 3EYUL 2OYKA 1EMTL 4PJGE 4K8RL 1WIUA 4L29B 4W4OA 1X5ZA 1BG9A 4IMLA 2OPCA 4XPFH 4H25A 4XVJH 4E9QA 5HYJA 1R24A 3SE9L 4YHZH 3L16A 4A37A 3BHBB 3LHPH 1RHHB 3ROLB 2DEWX 3EYOB 4GLRI 1D6VL 2WMPB 4JPIA 1GKEA 2AEQL 4WHCA 3PL6B 1C5BL 3CU7A 2C4XA 1VFOA 4V1DB 1BEYH 4H0LC 4MXWH 5DHXB 1LNUA 3FCSA 1K6QH 1T0NB 1RPQA 5I1KH 1LYQA 2G5RA 3LCYA 4QR7A 1UWEH 1YEHH 2Y5TA 3DIVA 4QT5B 4PJHB 1ZA6A 3MOBH 3U2SA 4HCGA 1RUQL 3ZIYA 4PJAE 3QE5A 1AG6A 4TSCH 5DJYB 2WJ5A 4XXDB 3I6LE 5F71A 4V33A 1Z9PA 3BP5B 4HZ1A 3MNMA 5E4AA 3VTAA 2X9XA 3D07A 3NACL 4E5XA 1QLFB 4BH7A 2YLHA 1V3MA 2FGWH 5TDNB 3LNEA 4I0PD 1B3JA 3B2MA 5DRXB 3GBLA 4AXWA 3DJRA 3T8VA 1WEJH 2DM4A 3SPVB 5JOPD 3NCBB 2W38A 3A6CL 4KZCA 4ECNA 2CMRL 2Y06H 1JPSL 2AI0L 3L1EA 1WO2A 2I9TB 4J4PD 4Y8DC 5B38A 3WTWA 3RNQB 3E6HB 1KNOA 3B9KC 2QHRL 3HUJF 4QRUB 5EO0B 2YD9A 4PJFE 4U1LA 5JW4R 3QJFA 3V6FA 2X6BA 2VJ8A 1XF5B 1S7XA 5CKGA 2R2BA 2Y6SD 2O93L 1PY0A 3OF6D 1T5WB 4QRRB 3QIBD 5SWZB 3O8XB 3QEQD 1NGWB 4XAWH 4G6FB 1GC1H 4UINL 5T1DL 6PCYA 1QRKA 2CJTA 1RV6X 3QZNA 4JHWL 4LHUG 4JO8A 2Q6WB 2XXMB 3RWCB 2CKBB 2DICA 3K8LA 3VNZA 3ZMRA 2EIZA 2X0VA 3CDYA 2XU9A 3RWDA 2DTMH 4LPTA 5EF3A 1OF2B 3L5IA 4FFWD 4XBPB 1J1OL 5DS8B 5D7IE 1MZZA 1AZBA 2ED9A 2E86A 1Y18A 5IROC 3R0MA 5KUKA 1G9NH 1CR9L 1OTUD 2WTOA 2Z35B 3BWUC 3MKKA 4P4KB 3QJSB 4ANVA 2R1YA 2ZOTA 3HG1E 2F54A 1KPUB 1IE5A 4LLVB 1NFIB 1RZ7L 4M1GL 4UU9A 5CJOH 3CMOH 1QRND 1Q0EA 3ARGC 1LWHA 5D72H 3W11D 4BSVA 1A6ZA 3V4LA 4Y5XC 2JCCA 4PW9A 5CGTA 2PXYA 3VTMA 4GG6F 1KENH 1NMBH 2VOTA 2IPTH 1EEYA 3C12A 2LFEA 3H85A 3ME0B 5ISZD 1IC0A 3BRFA 1KBKA 1PLCA 5AVXB 4DGYH 1BPVA 4XNUL 4LOFA 1CO1A 1TPXC 5TH2A 3D39B 3GMPA 1BXVA 5D8JL 1IUZA 5J3HD 4F8TA 3OKEB 1JZFA 3UZQB 2E7CA 1I1AA 3RJQB 2GT9B 4WHYG 1T7XA 1KJ2A 3FOLA 4ZOEA 1IT9H 1MPAL 5E2TL 1E6JL 5KG9A 1BAFL 3PRZA 5AAMC 4JCLA 3TT3H 3KYNB 3RY6A 4OFQA 3MRFB 4KKAD 5LDSA 3SDAD 4MA8H 2P46B 2C4FT 4OTXL 3L17A 5I1DB 2DQGH 2H0PA 1CGXA 1GH7A 3NRFA 4FG2A 2B1AL 3AACA 3WOVA 1FL5B 3RY5A 3RTQD 1S9XB 2VH5L 4EXPX 1FBIL 5DJCA 4AQEA 4OCNC 2YAOA 3WL9A 1CMOA 5HTSA 4HALA 4OGQC 4P2CG 3ZQXA 3B4NA 5D1XC 3ZOAA 5I16B 4JFYA 3SIKA 5LAPA 4FYRA 4U1IA 5I9QB 1F1AA 1IVTA 4TVPH 4TN9A 2GBTA 5KVEE 4H8HA 3VXSB 1AR2A 4H2CA 5HYEA 5FOBA 3UTZA 3QHFL 3WHXA 3IDXL 2PTTA 4ZPVB 1E3ZA 3MRJB 1VADB 2UZIH 1M42A 1ETZB 3UAJD 1YNKH 1INEL 4OBRA 2ZONA 4PY8I 3O3AB 1BD2A 3EADA 5JPNC 2EJ1A 4OR1A 1A7QL 3SDDD 3GS4A 4ZTOL 3IU3B 1DVTA 1CBVH 2WBJD 2ZG2A 2BNUB 2BP3A 3EO1A 1ITBB 1JZ3A 3RWJB 4JO1L 1IJNA 1SDDA 2YXMA 3EGSB 1EJ6A 3T2NL 2CCWA 2XKSA 1PNDA 4DP7X 4N9OB 5GRVK 2WQ8A 3MO1A 3TBYB 3U9WA 2B20A 4W9ZA 3VSVA 2W60B 4HKZA 6FABL 3P0GB 2GFBA 5KS9F 4TUKL 3JVFC 3N0AA 5I66B 5D5MB 1N67A 3CE1A 1NCCH 5C0CD 3GZQA 4G70B 1NKRA 5CAYB 3AQYA 1CGWA 2OMUA 4LQ1A 4UT6H 4L9LC 4PJIB 3X3FH 4OI7A 4PB0H 2GJPA 3PWUA 1OGTA 3MGOB 3MX0B 2JB5H 2G60L 3VFPA 2EVJA 4XMUA 2R29H 3R19A 4Q7DA 4R7DA 2XHNA 5KOVC 5C0IB 5T1LD 3EYUH 4PJDE 4X8GA 1BQHA 4APXB 1EMTH 2Q7AA 1BCIA 3FB6A 5ESQA 4K8RH 3NSFA 3IDYB 2WLMA 1W0YT 2Z65C 1GYCA 3SE9H 3VXTA 4OFIA 1XCQA 2YWYA 1DL7L 2A83A 2ICWI 4L0PB 3B5HA 1UJ3A 1D6VH 4W81A 3GS7A 1IGTB 1C5BH 2B16A 3QSKB 1AGBA 2ZSWA 3MXWL 4RQQA 1O6SB 2LT9A 4L2LA 3ARRA 3TF4A 3PLYA 2OMZB 3IF1B 4EE2A 1C12A 1ZVSB 3BWAA 1RUQH 4PRPE 5T3ZL 4I48A 4AJVA 3RVTD 1XAKA 3AAZA 1SYVA 4GOSA 5DMKA 1JVLA 3FK3A 3PFUA 5FECB 3QDGB 4K73A 2BP8A 1D9KD 3E2HB 3X1BA 1WAEA 1RJLB 3VFNB 4B0MB 2K8QA 1R17A 4G9FA 5EORL 1S9YA 1HH6A 5A2BA 4EUPA 3WO4B 4EIZC 3NCCB 4L8BB 2ATPB 3GO1L 5HGDA 1KIQB 3A6CH 3SPJA 3EF7A 3V4PA 4FXGB 4AV4A 2CMRH 5I15L 1H3XA 3DX3A 4XPHH 3C60A 1E4KC 1JPSH 2AI0H 4XI5D 5MENE 2YSSB 4WHTB 4ZTEA 4HKXA 4X6DB 5LBVA 5SWSA 1ZJBA 3VYNA 4HVBA 2BC4A 2OXHB 1NDTA 2ZOOA 5D2LE 1AIFA 7PCYA 4DO6A 2HG0A 2KMWA 5JHMA 1IL1A 3PNRB 1KBVA 3R7RA 3SQOH 4MXVE 4JKMA 1W72B 2AJSL 3F5WB 2PTUA 4I2XB 4AQ1B 1NUGA 4OCLC 1UD4A 4PRIB 4HFUL 3VFMA 4WENB 1CU4H 4PJBE 4UINH 1INDL 1QYGL 1LMKA 2P8PA 5E1AA 3X12B 3K6SA 4JHWH 4Z3FA 2DJUA 2YAHA 5DS1A 4AT6A 4JFTA 5SV4A 2XWDA 3HE7B 4KFZC 1EIBA 3C5ZB 1NAML 4X7FC 4WGVB 3BP7A 4MX7B 4DEUA 1QFHA 1K5NB 3KYKL 1NC4D 2AAAA 2FO4B 4U1GC 5DHVH 3UDWA 4CN1A 1XB6A 2X6MA 3L5HA 3QXUA 1A47A 5F8RC 1U8OB 4Y2LA 3P4NB 4G6AD 5E00B 4P5TC 1KYDA 4XXWA 2AQSA 1O75A 5LN8A 3FCTA 1RZ7H 2PCPB 3I02B 2X1QA 4BSWA 3L45A 3SDYH 5I0WA 5CHNA 3P54A 3QWOA 3IGAB 2P5WD 3NTCL 3DV4A 3UPRA 3CFQA 3GLEA 1TNMA 5AB9A 4OM1H 4NQED 4YBLB 3M17A 4J12A 3H55A 5EIIG 4NI6A 2VDLB 4KNUA 4UZGA 4XNUH 3CFKA 5D8JH 3MN8A 1OB1B 3BMVA 2Y9RT 3FOMA 4X6FB 4JDZA 3WBDA 1P7BA 3TNNA 4LKCB 2VDOB 3FT2B 2NDFA 5JIHA 4Z5RB 1MPAH 5J89A 1E6JH 3KPLB 3U4AA 4DERA 4Y19A 1BAFH 3VI4A 2R0KL 2J1XA 2OMVA 2XFGB 4LRIC 1RJYA 3IGFA 3MUZ1 4NKQB 1KULA 4LPWA 1X6LA 3ARUA 3GPEA 1WAAE 2E0PA 4LCUA 1FA4A 2XY1A 4JRXD 5C07D 3NIGE 2DMGA 5D6DC 4BFFA 4F33A 2VQUA 4QHUA 5DTFB 1KB5H 2B1AH 4WFHD 3NJNA 3AXLB 4HPYL 2VDNL 5EUOE 1SQ2N 5FGBC 1KXTA 5E6IA 1KCVH 2O5ZL 1S9KC 1JGDA 1FBIH 3DXAB 1TTGA 4XMPL 4Y5YB 1NBZA 3QI9D 4WW2A 4WWKD 4HOWA 4W9LC 1MCQA 3L3HB 5F7LB 2OP4L 4YSQA 1SN2A 3B34A 4OJYA 3RUGF 3S36L 4BK8A 1CLZL 4PJ9C 4S1DD 5KSVB 3JWNC 4NNXA 1UXSA 3PHOB 4JL1A 1BZQK 3ULVE 4HIQA 3QHFH 3P2TA 1FH2A 3BD4A 4LDEB 3VXME 2F08A 5A40E 3FU8A 3IDXH 3DECA 3TIEB 1G9HA 1ZS8A 4BWWA 4NO2B 2EYRB 3TFKD 2IBBA 3C08L 3UC0L 4EIGB 5DSCB 43CAA 1GGIL 4PBWD 2I69A 3UADA 4QJ4B 4LVOB 4KXZI 2XVLA 3V4VA 4OJFL 3K6OA 4P48A 1A7QH 2XCMC 3ZDZF 5IQ9B 5HD8C 3V8CA 2YQBA 4EQ3A 2OJEA 4OFYA 4MNGA 4JO1H 4QRPA 3A3YB 3EJPA 3L13A 3UBXG 3WNMA 4M03A 3OJVC 1MAML 1LEGA 4DW2H 3D33A 1SOKA 4TQPA 1P5VB 4X6CA 4ADGA 4OIAA 3DTXA 4JJ5B 4TUKH 1DVUA 4KUCD 1RY7B 4JN2B 2JKNA 2WSKA 3REVA 4TRPL 2I5YH 3BCDA 2H1LM 4LLMA 1SFHA 1TO5A 4FTVD 2XN9A 4Z7WE 2GEQA 3KXFA 1EH9A 5EN3A 2DQEL 2MNUA 4AVKA 1C7SA 4KNSA 4YE0A 1GOFA 4HC1A 5ANMB 2Z7YA 3KLKA 4GKNA 4PG9A 4BJLA 3ZHLA 4HJUA 1IM9B 4NX0A 4N9GB 3KBPA 5HY9B 5HYJE 1HSBA 3B3IB 5KN5A 4QNPE 2DLIA 4R4NC 4ZMAT 2MPAH 3L3KB 4FQCL 4N0CD 1ZLVK 3V0JA 2PYED 5B1BB 2G0LA 2N59A 1U3YA 3L6FA 5IREA 4HISA 3RZCC 1J8SA 4OIIL 3MXWH 4LHJB 1J0YA 3TBVA 3BGMA 1UD3A 2Y5QA 3WN6A 4GSUA 1JWUA 1ZVNA 1YNTF 4NQSB 1JZIA 1HL8A 4S11A 4JZOB 5EHFA 2XZAL 5T3ZH 4OLZL 4NZUL 3CDGA 5C09A 3N06B 5DVOA 1PDKA 1T0OA 5C0EB 2ZP0T 3LV3B 3QYNA 2R1XB 4FI6A 1SEQH 2UZYB 4YPGA 2EEBA 3FQNA 3WN5A 1M56B 2IWKA 4GINA 4N8VA 1D5XA 2K9FB 3CBRA 4PN6A 1LWJA 1XSKA 2CHWA 2LU7A 4FFVC 4G1EB 1JWSA 2FZ3A 2I32A 4BZ1L 5TF0A 2AS5M 5F3HB 4HKJA 4BFKA 5D4IA 5EORH 1HHJB 1ND0B 2E6QA 8CGTA 1NMCC 1T20A 3OMAB 4X5XA 3PHSA 5I15H 2ZXCA 3DVNA 2XG5A 4CKQA 2IDTA 5DJ6A 3O6LL 1ORQA 3QJXA 5DMGD 4WW1B 2VABB 4PLNC 2A1WL 3VWKB 2ERJB 7TAAA 1B0IA 4WUUD 1NOFA 3AT9A 2AJSH 2GUOB 4F80A 2DM7A 1ECZA 1THCA 5E8NB 3WS6A 4DESA 2OQJB 5IB5B 2NY7H 3SOTA 4JHBA 1NICA 1BFSA 5GS0L 2J20A 9CGTA 1QYGH 2IOMA 5DVKA 1U3HA 4HMCA 2CLVB 4YHPB 1TETL 3W9DA 4KRMB 1MHCB 1NAMH 3P4OA 3MGTB 1ZKAA 1G84A 3KYKH 3RWFB 2A9CA 1ZLUK 4HLJA 4MA7L 1FL3A 1KTRL 3VYPA 1MKFA 2D8KA 5D96C 1XXDC 4TULL 5H94B 5LCVA 4UTBA 1CZ8L 4NQXA 4FTDA 4X4XB 4L3CB 4MAYD 4P46D 2HTKD 3CSTA 4XZUB 2F54E 3EJZC 3I3DA 1UM4L 2XWCA 2V4LA 2F53D 4J4PC 4DK5A 1Z32X 5IGXL 4DP0X 1AHMA 4APQC 3NTCH 1OM9A 2A73B 1J88A 3TVMD 2JCCE 1KB5A 2WXGA 4GMTH 1T22A 3EO0A 4IHOB 1DJIA 3SDXF 4JKKA 2M83A 2QKIC 2R4SL 3QUZC 4XMKH 2R0WL 4P2OA 2NY3D 2XQBL 3BD5A 1AGFA 2IOOA 3MJ9L 4NUQA 3B8SA 2IH3B 4A2LA 5IVZB 4QHLB 2DN7A 1EJ8A 5E2VL 5JHDB 2BP0A 3DDFA 4ONGH 4HU8A 1KTDB 2GK0A 2FDBP 3EBIA 2P7TA 2HFGH 1CFBA 2LU3A 5T5FL 4Z7NB 5KVDH 4R4FL 5A16A 4GW5A 4AL8H 1C7TA 1ECYA 3GM0A 3KL0A 2R0KH 4L1HA 1U2HA 1I7UB 3QULB 2IG2H 1O5PA 2FECL 2NY4C 2XWZA 3LPWA 1CXEA 1BYOA 2Q87A 2E27H 4DZBA 2ICWJ 1G7QA 5I76B 1UG9A 2WXRA 1D2OA 3KLDA 2X2UA 4FC3E 4L3EA 4HPYH 2VDNH 4B60A 1R9FA 1J8KA 2O5ZH 3H2QA 2ETWA 3KPRD 1KZQA 4KJQC 4XMPH 1YPZB 3M46A 1UUSA 1TTAA 1RK1B 3MV8A 1GCFA 1Q9WB 5BOPA 3FRUB 4YQXL 1DVQA 4FXKC 5BJTB 1B0GA 3S36H 3S5YA 1Q9LB 4M6NL 2LLLA 4I1PA 5KVMC 1GZPA 2ZXDA 1O6TA 3G5WA 2IANB 4UQ2A 2P8LB 2F1AA 1X44A 4Y5VC 1DSFL 1B0RB 3PWPB 3FO1B 3AT8A 3N0PB 4FFYA 3HAEG 2P1YA 3LRSB 4OI8A 1GW6A 3B8YA 3I6KB 5E5MB 3UC0H 3QDMA 1GGIH 2KPNA 3O6ML 3QUYB 1HXMA 2EVFA 3PNWA 1L4IA 1BD2E 4OJFH 4RNRA 1ZE3C 2K1MA 3O6FB 2WIIB 1HCFX 3HS8A 3HN8A 5DA4A 1UFGA 4F3FA 5DZPA 1HHHB 1MAMH 2QDWA 3C87A 3FQYA 4F1ZA 1A6AB 1ZAGA 3EJSA 3P73A 1WS7A 3L81A 5EDSA 3EH5B 2QMKA 1JOIA 2E7LA 5C0AA 5D71L 4TF4A 3VG9B 2IC2A 3ARDB 4TRPH 5HHOB 1AP2A 2BXZA 1EO7A 1UWFA 1GXEA 3LKRB 5I5MA 3PWNB 1J05A 3PUCA 4MA3B 3HOGA 1WFIA 2ITEA 5J6HB 2BVQA 3UYRL 3OLDA 4K07A 3DGGB 3MJ8A 4TUJB 2BVPB 4KO9A 3RL1A 2CDGB 5I1HL 3LH9A 4UIMA 3UAJC 2H7WA 2XNAB 2CJUL 4Y8AA 4LLWA 1ZLDA 3KWWB 4N2HA 4FQCH 4G42A 4PS4H 2IAMA 1HOCB 1BJ1J 3GSNH 1DQQA 1FHGA 5CMAB 2EDLA 4XVTL 3ENEA 4IIQC 3T3MB 3HNSH 2CE6A 1IIIA 1LVEA 2WXLA 4OIIH 1ILUA 4FJ6A 2WZPA 4L2YA 4GS7C 5KBNC 3Q8BA 2UYLA 3PWJA 3FKUS 3ETBF 1KDIA 4F15C 4U6VL 4OV6F 3N91A 4OLZH 4GT7A 5EFIB 2Q8BL 1NGQL 3IXTB 4R4BA 4WK4B 5BV7L 2BPBA 1A3RL 4RGNB 2LAAA 2C8NA 5DMYA 4GT0A 4BZ1H 3ZRSA 5TDOA 1NUDA 1IQWL 2ED8A 4CBZA 4HX1B 3FUFA 4U0QB 5C08D 5L0QC 4WO4B 1A7PL 4G9FE 4LNRA 2Y7SA 2V7NB 4XCYA 2J6EA 1JNLL 1OARL 4F7EB 5AUMA 2YBRA 1BW8A 2DPKA 5EBGA 4HGKC 1EGJA 3ZW3A 4IDJH 1QG3A 3A47A 3SGKC 3O6LH 4GNKB 2FX8L 3L9EA 4YSAA 3BH8B 5SWSE 1WD9A 4BCYA 2A1WH 5FO8B 1PZCA 3UYPB 5CIPH 5IJVB 3ZZQA 2DQUH 5HVHC 4GG8B 4GXFA 2MMXA 3ZT6A 3CPLA 4QYOA 5F70A 4Z7IA 5CCHE 2W1NA 1T03L 1CYGA 5JXAH 2NX5D 4LMQE 4FG4A 5E5RB 2VDML 3T3PB 2V9UA 2HMIC 1P5UA 5J5EA 3WIAA 1YLBB 1MQKL 1UCBL 3TA3B 2XTJE 2VZOA 3QEGL 2VUOA 5J1AB 1TETH 5DFVD 1JZGA 2FHCA 2NW2B 2WXPA 5EU6D 3ZBMA 4HOMA 2FX9L 3DC0A 4X9YA 2H9GA 2XIIA 1U95B 4MA7H 3CSPA 4U3SB 4KFMA 2XQYK 4KOBA 2WVSA 5GJSH 3MODH 5F1IB 2ZPKL 4F20A 2Y0SA 1CZ8H 4KUCF 1JD7A 4GO9A 1TVBA 3IKCA 4H1LH 4I87A 3VFTB 5FO7A 1JGIA 2PPDA 5IW1A 1DANU 5EBWA 1TG8A 4FQXB 3TBBA 1J0ZA 5C0FA 2XOTA 2VZVA 3BVXA 1NBVL 2BIHA 3AM8C 3VE0B 2YOCA 3W2DL 5IGXH 2ID5A 4JREB 4ZO7A 1OPOA 1A1MB 2H45A 1U8HA 2WWMC 3FT3B 1C5CH 1LK3L 1QLRB 4MVBC 1AAJA 3C09B 1OHQA 4NKDB 4KRNA 4HSCX 5AYQA 2X0WA 4JKNA 1MCNA 1CF1A 3G04B 4URKA 2R4SH 3RI5F 2HRGA 2Y7LA 2Z91B 3ET9F 4HLZG 4Y2DB 3MRIB 2R0WH 4QHMA 2XQBH 4KROB 3MJ9H 5GXBB 4K0OA 1XXFC 5CGBA 3QIWB 4AK1A 4WI0A 2XWEA 3FO9B 5E2VH 2ZF8A 3EYFA 3I6SA 4NRYA 3C8KA 3FN3A 1ACXA 4EVNA 5T5FH 2ZCLL 4KAQL 4Q2ZA 2AEOA 4Y19E 3VI4E 2V5MA 3DX9A 5TQ0L 1RZFL 1PBYA 1V5JA 3H53A 2YPKB 2L4OA 5TF1L 4RCAA 3ATEA 1T1YA 4DUVA 1KIRA 3MJ6A 1OE3A 2A9ML 4HH8A 3RHWF 3HC2A 5DT1L 2JLLA 1YQVL 5I5IA 1BBDH 1PKQA 2AP2A 5J57B 5ITBL 5D1QB 1OXYA 5EA0H 5LBSA 3MR9B 2WXHA 1NDMA 3QORD 2A6JB 5T1KD 5I18L 4YQXH 5DYOB 3FUEA 4G8GB 2AJXL 5IR1A 3MV7B 4MCYA 4W4NA 4M6NH 4P3CL 4R3SA 5GGVY 3CFBB 3NN8A 1R3JB 5D2NB 3MLXL 3JZYA 2VERN 2CR0A 2VM9A 5INCB 1DSFH 2AQQA 4LFHG 4I18B 2BHUA 2SEBB 4LT7A 1AANA 1CXHA 4X6BB 4YL9A 4LVNC 4J3BA 1JPFB 5B38G 1WFMA 3UO8B 3AREB 2YPLA 4YXKH 4DPBX 5GGTL 2V5SA 3ISYA 2X44D 3O6MH 4QKXB 5I6KA 4L0YA 1TTCA 2BFVH 1BYPA 1E8WA 5EOTB 3LNHA 3GZOA 3S5ZA 1QFPA 1IEAA 5AW3B 1EFXD 2Z0UA 4MNGE 1GSKA 1F3RB 4PWHA 4QRPE 1MIEL 2IPKA 1MJ7L 1M71A 2EO7A 4W9EC 3BW9B 9PCYA 3ULUE 3O3EB 4K94L 2Z31B 4MWFB 5FYLE 1QW8A 4RWYL 4QY8A 4X6CE 4CMMB 1QSZA 1A6PA 4Y4HD 3NPSB 4K5OA 3HG0A 2HFFB 2VLKA 3OBAA 4ORZC 4P04A 4R2GB 5CUSL 5CZXC 4BQ6A 1X5HA 3BKML 1CVRA 1KB3A 4BQ8A 5E6YA 4DOHB 2O4EA 3GLDA 3KS0H 1A4JB 2XN9E 4FNRA 1K9TA 3KXFE 3V7MA 1VFUA 4LASL 4X5PA 3T1WA 3DRTB 4HJJL 3UYRH 1EAJA 1HL5A 3LNIA 1HDMA 1NIBA 1FSKB 2X88A 1A4KA 3TZVA 3MTXA 3TFKC 1DJZA 5L2JA 4NJAL 3SPIA 3UCRA 1MIML 5FAAA 2XWTA 2F7OA 2J55A 2W9EH 3BH9A 3QFJD 4XVTH 2GSIA 1PZBA 3JWOL 3AS2A 4B3VA 4ELMF 1O7SA 2EEAA 2WYIA 1URLA 3R7QA 2VR3A 4IGBD 1D5BB 3OPUA 5DEGA 4GSRA 2ZSVA 1TZ8A 1I8UA 4U6VH 1MN4A 3HB3C 4FOMA 4R9HA 4TQEL 2LVEA 2XN1A 4YDZA 3T4AB 2DLHA 2EE0A 5C09E 2Q8BH 2JB6B 4LK4A 1L9PA 1JCVA 1NGQH 3AQDA 3DIDA 4TTDC 3HC4L 4F7CB 1NAMB 4G59C 4L8SB 5C3LD 1LK2A 3KVPA 1HZLA 2CXGA 2YXFA 1WBXB 2PKDA 4RAVB 3RU8L 1A7PH 4HHAB 1U41A 1W6WA 3LKOB 1NDGB 4DUWA 2FX7L 3N04A 3B7RL 3KDMB 4MNHA 4BDVA 1JNLH 1MDAA 1OARH 2JJTA 1CFSB 1X3DA 4YHOL 4HXAL 4YHNA 3PP3K 4P07A 2JKIS 2OMWA 4U1KB 3QAZB 4J3SA 4LCCA 2FX8H 1HN1A 4N0CC 1DFBL 1NBYA 2PO6C 4TLSA 1IMHC 5F6HI 2CGRL 4YR6A 1F6AB 2E4FA 1WP6A 1MFVA 4K3GA 3VA2C 3BN3B 4TNWK 5I1GL 2WTRB 4I85A 5EIIB 4B6ZA 3WUWA 3PWVB 4FD0A 1UVQB 3CVCA 4PJGB 3IFPB 2VDMH 3LKPB 4PV1C 2XETA 4XPAH 3UBGA 4X7SH 3IMVA 4N5EC 1UCBH 2J2ZA 3D52A 2FQFA 4NIYE 4BH8A 3QEGH 3X11A 2X4NB 3KVDD 4YFDB 1N68A 2FX9H 4WWID 2V9RA 4GW1B 4KC3B 3HZKB 4N1EA 1JPGA 1RZ8B 1A3QA 1XL6A 2ZPKH 3Q1EA 3UTQA 3BRDA 3Q6FA 5HHQA 3R06A 3GSRB 3JBG7 3OAZK 3WLWD 5ESVB 3WNIA 4YZFE 2NT0A 3PHQA 2FIKB 3ILQD 4YLQT 2WXKA 5F0PB 5I30L 1OTSD 3WFCL 1VFAB 1NBVH 3MNWA 3W2DH 3QAQA 2VUKA 1KPVA 3QQ9D 2FBJL 3RI5K 2YZ1A 4GIOA 3PGDA 4K71B 4JRFA 4LPYA 5T3XD 1ZHLB 4BKLA 4J3XA 5EO9B 3BISA 3T6ZA 1U8PB 3RPIA 4WV1C 3S48A 4U6YB 4MD5B 1S78C 1T7ZA 4W9JC 1PG7W 3LB6C 1W0VB 2VXQL 1DQKA 1W2KT 3DA0A 5HDOA 1QI5A 1T3FB 1BQHG 1ORSB 3VWJB 2VM3A 4ZS6D 1JPTH 4G83A 1RIHL 2AJZA 3L7FA 1Y0LA 4JFHD 1HEZA 3RHWK 4PJFB 4H8VA 3N43B 4XNDA 3VRLE 4KAQH 1UH4A 1GRWA 3H9HA 3BUBA 4I1NB 2KI6A 1PX4A 5TQ0H 3S5LB 2Q7YA 2EE3A 5SV3A 4LF3A 4QO1B 1CLOL 5TF1H 3RL2B 2P45B 2A9MH 4EXKA 2NZ1A 3PDDA 3M8OL 4MAYC 5DT1H 3WNOA 5B1JA 1YQVH 4LEXL 3W5MA 1GZQB 3DYMA 3TCLB 2YD4A 4L3EE 3ZXAC 5DD3L 4U6TA 3QVAA 5G55A 3BSHA 5BS0D 5ITBH 3MLRL 4HT1H 4UI2A 4PLJC 5JXED 1Z9NA 5I18H 5FV2A 3MV8E 1DE4A 3HFFA 5IHBA 3K2UL 3P0VH 4HPOL 4HBQA 5DRWA 2AJXH 5D7IB 4IRJA 2VR4A 4NQCB 1F11B 4P3CH 1NH6A 5I1IL 3NRPA 4M5YL 1ADQL 3MLXH 4KK6D 1MF2L 1IX2A 4IRSC 4JY4A 2OX5B 3IS0X 3ARPA 3TIDA 4EUPG 3FRPB 2IFFH 3HG1B 1FO0L 3X2QB 1K3IA 5K39B 4D0BB 2B9BA 3PL6D 3DHMA 4IEFB 3T0EA 3FU9A 3HS0C 2D3NA 5IWLC 1BFVH 4G43B 3QDME 5HYSA 1FJ1A 3B3BA 5GGTH 2JQAA 1IAMA 2FEEL 3T08A 5I23A 3RFZC 1N9PA 4Z0XB 2APVA 1HNFA 3CC5A 2QR0A 4JKLA 2NSXA 3U0PA 1X7QA 4R90L 3K2MC 3RIFF 5F1OB 1E5CA 1G7LB 1VFMA 2VMFA 2J25A 2FCBA 4M7LT 3K8KA 3L1OH 1MIEH 3A22A 3WTTA 1F2QA 1MJ7H 4ZX5A 3ZE2F 3H56A 2V7HB 3WMPA 2L7EA 2VDRB 4M7KL 4NO3A 4X5WB 5FV1L 4RWYH 2YFOA 4YDMA 3ZYJA 1CFNB 2BS8A 3O9WD 4GLRH 5CUSH 2FWOB 3L4CA 3AB0B 3BKMH 1QAWA 1HHIA 2X53A 5GISL 5FO9A 5C0AE 4RZCA 3LIZH 1OP4A 5CLTA 4QOKD 1EHXA 1NLDL 4XPBL 3QXDA 5TK4A 4X98B 4YSUA 3H0TA 1ULVA 3IFLL 4LASH 3RGVB 2XICA 3U9PH 4HJJH 3PXHA 4W9CC 2AQRA 2AJUL 3LN4A 5B7EA 1JHKL 3DO7A 3JT0A 4NBXB 1H5BC 2BO0A 3DYOA 4QRRD 4QTIL 1QSEB 5SWZD 4NQDA 1LDPH 2D2OA 3O8XD 1N64H 4YIQA 1MIMH 2VLRA 3CJJA 3IDMA 1TVDA 5K9QI 4E41A 2JKJA 3H9SB 3KBHE 2NTFA 2UWEF 4DKFL 3OHXB 4AYMC 3HG5A 2CO4A 2H26A 4A2FA 3NFNB 1AZNA 4HBCL 2GC4C 2DTSA 1ED3A 1OK0A 4WWNA 1NSNH 1LLAA 4IK6A 1UYWL 2GTZB 4HJSA 4X8XA 3VU1A 4ZFOL 2X4SA 4BK5A 1AMXA 4AIZB 1ICTA 2ZCHL 2C9UA 3NGBB 4CAGA 5BVPL 2OMYA 4HJ0C 5B3SB 1C16B 3HKZA 2KPWA 3DJTA 3BXNB 4P4KD 4PJEF 3BCFA 3V6OC 2KLTA 2X05A 3EJJX 5K9JL 4AG4L 4I7ZC 4P05A 3X17A 4CC1A 1BIIA 1OVZA 3HC4H 4I89A 3T09A 4W1TA 1OGPA 3CWGA 3NABL 2D0GA 2GAZB 5CEYB 4Z7VA 1H3GA 2WO2B 4PEEA 5E1IA 1ZLWH 1JZJA 3UTOA 4NIKB 1JP5A 1I8MA 1GHFH 5MENA 2FX7H 3OB0K 2LTQB 3R4RA 2JTDA 5F7YC 3FQTB 2JKTM 1FNAA 3P11L 4CVWA 2P80A 2PWDA 4KKCC 5LGJA 4I3RL 3ZRFC 1HQRB 4FQHB 5T1MB 1B9KA 3C5JA 3PJSA 5GGUB 3HVDA 1DFBH 1ZT7B 3GKZA 3L9BA 4UZSA 4TOYL 5C0JB 1OGAA 4OFDA 2EYSA 3T65A 4KTYA 3S7GA 3DWTA 2VR6A 4UUJA 5C70A 1DBAL 1AQDB 3V5KA 3B2XA 3TESA 4JPSA 3E1ZA 3GSOA 3GMRA 4JDTL 4ABVA 4PJDB 4ABWA 4Y2OA 1ZS2A 2NY1D 3GJEB 4XX5A 5TPWL 3TH4T 5JZ7D 3SPCA 2EDDA 3TNMA 2WQRA 3CH8A 3UAAA 1OTTC 2FLBT 2VRQA 1FDLH 5J1TC 4AQ8C 3IE9A 1A2YB 1A1OA 1E5YA 4WNQA 3LKSA 4E9VA 2R9HD 3O0RL 2Z4QB 1NGPL 4DIXA 1LD9B 1JE6A 1TTRA 2A3TA 3IM1A 4HJEA 3QIUC 5GGVH 4DO4A 1MCBA 3V0FA 1WA2X 4OF5A 4PRPB 1N26A 5I30H 2A74C 4ZFZB 1B9ZA 1CB4A 3WFCH 1IM3D 4KV5E 2WXIA 1TR7A 5FM4A 5F1KC 4RFNB 2FBJH 2Q76A 3IPEA 2C9VA 3LZRA 3MOQA 3NPZB 1BP3B 4KDTA 3CCHA 4NQVA 4M43L 3BVUA 1EZUA 4Y4KA 2X28A 5BZWB 1CWVA 4FA7B 5CLWA 2V17L 3P30L 4DP1X 2DIJA 1PIGA 2APWA 3QQ4B 3OMIB 3KBFA 2VXQH 2BNQA 3CSYB 2D73A 4WGWB 3RWIA 1T1ZB 2JK5A 3U2JA 1XCXA 1OP9A 3D85A 3DBXA 3HAEB 3TBCA 4CN6A 3ZTDC 2D4DA 1RJZB 4N0FB 4GBXC 4O4YH 2B59A 1DEDA 1JGEB 5D2LB 4JFVA 5JHLL 5DFVC 4X4MA 4CC0A 3KLHC 1RZKC 2YJLA 4ZFQA 3WXVL 4POYA 4P23B 4U3XA 3BQUD 2J7LA 5IMLB 4Z7QF 1NCBL 3WCYA 3V6ZA 3JUZA 1CLOH 1XEDA 4LEOB 1I8LC 3QUML 1IBYA 3M8OH 5LGHH 1DSWA 3S4SA 2WO3B 3D7PA 5D93B 4LEXH 1OB0A 2EADA 5E24E 1PKQE 2LFGA 3UJTL 3UERA 2VM4A 5CFHA 4HUXA 3O41A 4B9GA 4KI5C 3V6BR 4Y1AA 1MHEB 4LKXB 3V7AE 4NCC2 3K2UH 4HPOH 1NC2A 4C83B 5CD5C 4PM1A 1CD9B 4RVBA 2DAVA 2ZWSA 4OZGF 4M5YH 5DZNA 1ADQH 1FFPA 2CZNA 2VYRE 1E9OA 1MF2H 4N90E 3LQAC 4U7SA 3M86A 1GPOL 2NCMA 3U1QA 2DWDA 1IGYA 4OQ1A 2GI0A 4BCXA 3QNXA 3DMMB 3QNFA 3S0PA 1RP8A 3QUXC 1QEXA 4B9ZA 4HKBB 2WOYA 2C7UA 5IQ7L 4J2XA 3VFSA 4EJ1C 2J21A 4QRSB 2YPLE 4I77H 5GGRB 3UGUA 1ZPUA 3QDJA 2PPAA 1MUJB 2G2PA 2NY2C 1RULL 5EU4A 3UABA 4ZAKD 1MNNA 3QJUB 2P28B 1G6RL 2BHFA 4YHKL 5GS2D 3FH7A 3S97C 5CEXB 1J5CA 3RDTB 5IEHA 2EDFA 2GHWB 2ZJSL 3FTGB 3QDGD 3F6IA 4LGPB 3OZ9L 1HFUA 4PJXF 4M7KH 5F6HJ 5DD6B 3QPXH 3QNZA 1HVXA 4OUUB 2GTWA 1DQIA 4HOZA 4ETQB 1MCOH 1S7QB 2VLKE 3OAYK 2IBZX 3AUVA 2QQKL 3TX4A 5GISH 2YD8A 3EOAA 3QCTL 2WLNA 3Q44A 2MRYA 5LB1A 5A2CA 4MXQD 5K9KA 3NIGB 1NLDH 4XPBH 4Y88A 1M7DB 1P4UA 5GIRB 5BV7B 1FVEB 3NIFE 2IALA 3GXUB 5EUOB 1QWUA 1BQSA 4XO5A 2AJUH 1GTNA 1JHKH 4ZPTB 2HJLB 4F58L 4U1SA 1T4KA 4QTIH 2NY0D 4MCZB 3PE9A 3FB8A 4M7JL 4YSOA 4HG4K 3WMSA 5JQ6H 4PRID 4Y9GA 4Z9KB 4MMXB 2FL5A 3PWLA 2EUXA 3EJTA 1E65A 4HBCH 4J3OD 1IILE 4LSPL 4Z7UA 5MEOB 2VW7A 1WIOA 1A9VA 5C6TL 4MRCA 5HJ3A 5JW4M 4KJYB 1S3KL 1UYWH 5PCYA 2CDFA 3AU1A 4NHCH 2EYTB 5HDQL 2ZCHH 3LXAA 2EC9U 4O2CB 5BVPH 1JN6A 1PYWB 2VDMB 3U4BL 1XCTA 3LOWA 5FYJE 2ESVA 4H88L 2ZYSA 1FG2A 4J2QA 3VXNA 5I6XB 3SJVD 3RIAF 3B2UD 1DDHB 3GXFA 3NABH 1OALA 3STZB 2CU9A 3TN0A 4XNBA 3VQ1C 1NCDL 2BCKA 5AWNL 1DUYB 4X9IA 3P11H 4QHKI 5EBMA 3CFEA 4EN3B 4I9WD 4X7TA 1UACL 3B2DC 1N4XH 5DJXB 3FQXB 5CR8A 5CZRA 1NA8A 5KBDA 4ODXB 3TM6A 2L3BA 2CA3A 2CO6A 1T89A 4EAEA 4J5VA 4TOYH 2JKXA 1BVZA 5F89B 2QBWA 1AD9A 3TU6A 1DBAH 3BE1L 5E6RB 1BJ1H 5IVOA 4JDTH 5MERA 1GS7A 5I8CA 5DJ2A 4IMLB 5EOQL 5BRZD 2DJMA 5HYJB 4GXUN 5LLIC 4F9PA 3HC0A 3IMWA 1OT4A 5ALCL 4ONHA 4JPIB 1GOGA 1QSFB 3F7VA 1EDHA 1NJ9A 3MRCA 2DIBA 3MU3A 2DMCA 1KXQA 4KTDH 3FCSB 4NUJB 1RVFH 4OQTA 5F88B 1FL6A 5GHWL 5K59F 4QWWD 3IJHA 3EG9A 5MEQB 3O0RH 4S2SB 1NGPH 4L37B 5J1SC 2IDSA 3LN9A 3UL4A 5JW3L 1XR8B 4PI0A 4IKLA 5LQBL 4FLSA 4A55A 5BRQA 1EXUB 1BJMA 5D9SA 3MOAL 2PWHA 3GMMA 4O02A 5I2IA 4ACPA 1WK0A 1RZGA 1Y6KR 1E27A 4Q97A 3OC5A 4E5XB 4WZ9A 5L4JA 4M43H 1BM7A 5GZNA 2OW6A 4BH7B 4NLAA 5EWIL 5JLZA 3ZKXC 2CJSA 2V17H 2BIQA 1FZKA 1SZNA 3BKJL 3P30H 4N26A 3C8HA 4QXGL 4WFFD 4N8CL 4Y4FC 4AXWB 1M6OA 2G3XA 2LAGB 4PHXA 1JZ7A 2HP4A 4Y16A 5IHUL 1JDDA 3GEFA 3B9VA 3EHBB 4CVXB 1BF2A 3X13A 5JHLH 1XB8A 3MV11 3JWNH 3NJHA 1S7XB 1FH5H 5TE7L 1PX3A 3A0OA 1NCBH 3SB3A 2E4TA 4N2LA 1WFNA 2DLTA 3EXLA 2Z34A 2O30A 3UJTH 4IBTA 1T6WA 5IMKB 3HUJA 3NIDF 4KXZH 2OCFD 3PQYA 2EIZB 1RUML 2QLVB 4WKZA 3RWDB 3N2JA 1ZOXA 4E2OA 1S2EA 4JM2C 1MH5A 2AV1A 5HVGB 2HTLD 3GMNA 3VDCA 2YC1A 2ZOUA 1ZV2A 3U6RA 1OSZA 4EDXA 5HHXH 1N10A 1Y18B 1FZMA 3HMXL 1QA9A 1NGYA 3QFGA 1WCQA 3RB7A 1TEFA 1TF4A 1PTZA 1GPOH 4M61A 4YGVA 2VLJA 2R23A 4ZS6C 1V8HA 2PW1A 2Q7NA 2UZXA 4YN3A 4FF9A 3T0EE 4PRAA 2W0KA 4BSVB 1T66D 4ATTA 5IQ7H 1A6ZB 4Z18A 2D3LA 2MQ3A 3STLB 1J48A 2JCCB 2J5WA 4Z7AA 1A64A 1T2JA 2WZAA 4H44C 2N4IA 4LVHC 1RHFA 3QQNA 3NCEB 3WIFA 2WCGA 1EEYB 2WTPA 4J8QA 5A2FA 1RULH 1M2VA 2B1HH 1WPCA 1XF3A 5L2KA 1EFQA 5DJZA 4AKQA 2RIKA 1F02I 1G6RH 4YHKH 5TH2B 3SKOB 3GMPB 4JPVL 2XPGA 4OLVL 5LO7A 3GS0A 1KN2L 1NOLA 4M5ZL 1I1AB 1YYML 3OZ9H 4LLUA 2IDUA 4OCYH 4LARH 4P57A 3WDIA 3FOLB 4N2GA 4HUWA 3MRRB 3T0AA 5CEZE 4TLKA 5KG9B 1AR1D 4GG6A 3GIVA 1KJ3L 2VB5A 1AHWC 4NLHA 3B9KB 2EVHA 4MMYB 1MJJB 4QUOA 4PJ8D 4IBYA 1SVBA 4KK6C 1CLYL 4B5EA 5I1CL 2AXGA 1MI5A 1VACA 4X83A 1WSST 3ML8A 1CN4A 1OAYL 5HPMA 3DDGA 3VWKD 1XGYL 1KFGA 4NPYA 2OFQA 5DJCB 4AQEB 4F58H 4QF1B 1QBLL 1MEXL 4KK9C 2ROXA 3A24A 4LCYA 3WL9B 5K9OA 1BF5A 4NQDE 4M7JH 3CFMA 4JFYB 4MBOA 4U1IB 2AITA 1WA0X 4HWNA 2VLRE 4UNIA 4XHJD 4E41E 5D6CA 1GZHC 1G7HA 1PZ5B 3UTZB 1EAPA 2F7RA 1LILA 3WHXB 3LXUX 4LSPH 4W6XB 3UZEA 5CZVH 3VXUB 1L0QA 2IWFA 4HZLA 4JFQB 3RIAK 5CXPA 2I7SA 5H37H 4ALAL 3U4BH 4UNUA 5D5MF 3ZE1F 3HPJA 4Y5XB 2OULB 4GSDL 1A3LL 1S9VA 3MLSL 3EO1B 3ATFA 2EDHA 5HGGS 4Z7VE 1SDDB 3D09A 2WUCL 3QQ3A 2FEDD 4RH4A 5KEZA 2HKFL 4FMKA 1T1WB 4Z6AT 2C3VA 3JVGA 1KIUB 3ARFD 4L1SA 4AV5A 3MO1B 1IKFL 3MMEB 1AOZA 4ZZFA 1CL7I 1EEZB 1F6LL 1NCDH 1QP1A 2R27A 3KHOA 5AWNH 4HKZB 4A66A 5F9JA 4CSZA 5HI3D 2GFBB 3SE3C 3V7AG 2WY3B 4XB7A 4GUQA 1UACH 3RURA 1F4AA 1YEGH 4TVPD 4QLRA 3CXFA 4Q0XL 5DHEA 1AC6A 1C5DA 3QO0B 3TBWB 1JGLL 5CBEA 3ZTJH 5LUMA 4D8PA 2CRMA 3HVNA 5AKTA 4D7PA 1OGAE 3VXOA 5ICZB 3NCMA 4FA8A 3NEEA 5AVZB 1R46A 4XWOD 4NERA 3BE1H 5JPMA 2EDYA 1G7PA 2AXFA 4RMVA 4EBQL 1UASA 1FGVL 3VW3L 5KS9A 2H0EA 4NPKA 5ESQB 2R0LH 4RETB 5EOQH 4MJIA 4ZSOA 3SQRA 1DBML 4Q9RL 3VXTB 2FK9A 2CO1A 3VGHA 2XC8A 2A83B 3ATBA 4LOUC 5E94A 3RX7A 4P4KC 3HBPA 5ALCH 5F9OL 1BMGA 3QH3B 1J9QA 5KZCB 1MWAL 3L95B 3SGEI 3SZ6A 1XV8A 1AGBB 2ZSWB 3UO1L 2C1PA 4DKDC 4YFEA 4JQVC 5GHWH 4L1BA 1E3XA 3IMRA 2EIKB 1PQZA 5HDBE 3UTPE 2ZX8A 4YDVA 3NRQA 5JW3H 4CGTA 1VGEL 2Y2YA 5LQBH 1OLLA 4WLCA 4X99A 5I26A 2HLFC 3BWAB 4LSTL 1SHXA 3II3A 4RA0C 3MOAH 2A6DA 4ANWA 1ILSA 1IVLA 2IAND 1UT2A 3AAZB 3LXCA 1SYVB 4KXAA 1MFCH 5FFLA 2P42B 4OLXL 1NCAL 2P48B 5DMKB 3QWRA 1FZJB 2BP8B 2IBGA 1TQBC 3MLUL 5EC1A 5B1CA 3BO8A 3BKJH 4QXGH 4WU5B 1S9YB 1HH6B 4N8CH 2OL3L 4EUPB 5J4MA 2BNQE 4K8RD 2NNAA 4QRQA 5HGDB 3OKLA 2H6UA 5EZIH 5IHUH 3NK3A 4X80L 3C60B 4PWKA 1XBDA 1XF4B 2H1XA 3AY4A 1FO0B 1Z3GL 3VVVA 5T1JA 1QWNA 4AGLA 4B9CA 4J3OF 3CXDH 3ILEA 1Q8MA 1O9VA 4WFED 4X4ME 3JSSA 4U1MA 5DO8A 2YZ8A 2F9BT 3DOSB 5IVXF 5TE7H 4KNQA 2VR5A 4H5SB 2DDQH 4W9IC 1M7IA 4HAFA 2WSPA 3VFMB 1AO7A 5DVPA 2WO4A 5I9QC 5FYJL 3EFDL 1D5RA 4J1UA 4PS8A 5HHOD 2ZWNA 5E1AB 2IFGA 1DEEB 2YUZA 1GYVA 4HP5A 3K6SB 5DJ0A 4S1SH 4AT6B 1A9BA 1D5MA 1MCLA 3HLAB 1RUMH 4Y1AE 3BP7B 4L8CB 1ZE3H 2CCVA 1M7UA 1T2XA 2ICWB 3L3DA 1KT2B 3CQQA 4EZMA