3D33A

Crystal structure of a duf3244 family protein with an immunoglobulin-like beta-sandwich fold (bvu_0276) from bacteroides vulgatus atcc 8482 at 1.70 a resolution
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
101
structure length
94
Chain Sequence
b'PVKDVELDGRWDDNCPITVFTDGYLLTLKNASPDRDMTIRITDMAKGGVVYENDIPEVQSAYITISIANFPAEEYKLEITGTPSGHLTGYFTKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Domain of Unknown Function with an Immunoglobulin-like Beta-
publication title Crystal structure of Domain of Unknown Function with an Immunoglobulin-like Beta-sandwich Fold (YP_001297618.1) from Bacteroides vulgatus ATCC 8482 at 1.70 A resolution
rcsb
source organism Bacteroides vulgatus atcc 8482
molecule tags Unknown function
total genus 16
structure length 94
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11589 DUF3244 Domain of unknown function (DUF3244)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3d33A00
3SD2A 4G5AA 3D33A
chains in the Genus database with same CATH superfamily
1EMTL 3H3BC 5AKRA 5AW1B 5DZAA 2K8MA 2EINB 5IW6B 5B8CA 3E1ZA 5H35A 1XB8A 1ZA6A 2A0LC 4LEEA 1HSBB 3WU1A 4PB9H 2PR4L 3PWVA 4FG6C 4L8SA 3RPKA 4XO8A 1VERA 4L3ED 3TVMA 3FTWA 2X4UB 4Z7WA 4XNDA 2WKOA 1DZ0A 2CKBB 1NTDA 5MEOB 3QUXC 3VQLA 4F57L 3I02A 4ABWA 4OKDA 2ERJC 4HKXA 1IM3D 3SO3C 3U1QA 2PETA 3ZO9A 3JVFC 3FBKA 3LHPH 3GMNA 1L3NA 3LZLA 4OFDA 4YDMA 3NTCH 3U6RA 3ZYJA 4IKIA 1MFCL 5LUMA 4WFHD 4HLZG 5F3BA 2YGNA 3AG4B 4OGYL 3ZGHA 4CUCA 3G7TA 2AXJA 4YEEA 2GJRA 1EZVY 1NGPL 2HTKC 1ZEAH 3DJRA 5AKVA 3EFOA 3IS0X 3K6SB 1DQLH 2H2PC 3JQOB 3L4YA 5C0FB 5E2WH 3QH3A 3KPSE 4FG0A 4YFLF 4LARH 4N1EA 3AQZA 1INDH 3IDGA 3WLBA 2ZSVA 5EZPA 1JUFB 1O0VA 3LD8B 4LCCA 4W68A 3EJJX 4S0TD 4OCWH 1VFAB 4XTRC 2XWTB 2DQFB 3SYAA 3OSKA 4XMKH 3WOVA 1H3VA 1RZJH 4WJKB 4ZAKB 2CO6B 4KH2A 1E8XA 3V6ZB 4K9EL 1QLFB 1OPGH 1ET7A 2VDNB 3DVGB 5C0BA 4J6RL 1WAEA 1FZOA 4TF4A 1MREL 4UWQB 4MRCA 2FLBT 1MW0A 2J8UB 4P2QE 1Y0LA 4EI5D 2DMKA 4BH7B 3LN4B 4N0CD 3ZYOA 5J57B 4QNPE 5LN8A 5IJCC 1NMBL 2OJZH 2QQKH 4KTDL 4MA7L 4ZT1A 1X5LA 3NYKA 3V52L 5CWSB 5TDNA 4ALAC 1XF4A 2CKNA 3IJEA 3SGEI 3HZKA 4YGVB 4LVOB 2D7QA 3WTTA 3V4VA 3IMWA 1IAIH 3LD8C 3FSAA 3ARTA 5ICUA 3OGCA 4NNXA 2EC9U 3O8XA 1ET5A 2J43A 1XGUA 4ZAKC 1AQKL 5IW3A 4FKEA 5CEXA 3EHBD 4KKQA 4AGQA 4JFXA 2XC8A 5KVDE 4MCZA 5DHYB 5C09B 3FN0L 4N1CA 4KUZH 4N86A 3RVVD 4EDXB 12E8L 1YMME 3NCYP 5ESVA 5LDSA 4OD3L 3PWLB 1DBKL 4S1QL 3TZVB 3WY2A 2W91A 1SYVB 3UPRB 3MRBA 3W9DA 4TUOB 3X13A 3VFSB 3WKQA 4MAZA 4R7VA 5MP6H 1I7UB 2ZX8A 3TJEH 1F5WA 1FWXA 1TVBB 4LVOC 1LEKB 1TPXB 4UT9H 1V3KA 1FGVH 4PJIF 4MQ7B 3U0PA 4OCLC 3Q2CA 4ZSOA 5B22A 3VWKB 2BC4B 3QORB 2ZUVA 2K6ZA 4QRRB 4OFYA 3NN8A 3BAEL 1C08A 3FYIB 2EEFA 3V5DB 1S7VA 5BVPL 3VXRE 4HEPA 2ADGB 5KG9B 2GJZB 3H9HA 4LAQL 4EN3D 2EDLA 3P0YL 3W5NA 2W9EH 5KSUB 4F5CE 4GO6B 1UASA 3BAXA 4OCYL 3HJ0A 2FO4B 2Y69B 3APCA 3TZVC 2X6CA 4PLKD 2JELL 1C9SA 2KLSA 4P06A 1JBJA 1X6NA 1YG9A 1SEBB 1FVEA 4K8RD 4U7SA 4EPSA 3T2PA 3I9AA 5FGCB 5A16A 4RGNE 2GY5A 5F7KC 3MLRH 4MYWB 3NRFA 1TPXC 3IJHA 3KXFB 2C26A 3FB8A 1I75A 3IFOB 4NUPA 2NY0B 1HHGA 5I24A 1RMFL 3VWKC 1SPDA 3QORC 1N5YH 3MRLB 4ZO9A 5C0CE 4YHLL 2VMJA 1Y18A 5ADOH 3RUGE 4QRFA 5J5EA 4H2CA 3GSVB 4WHYG 5BRZE 5CJXA 1MIEL 1IARB 1HHHA 5JHDD 5JW5B 3TF7C 1A14L 1ADWA 1WWWX 4AMKL 2BDNL 1BIHA 2FBJL 3HMWL 5BPPA 3L9EA 4CJ1A 1LWHA 2Y7MA 1DBMH 2H0JA 2BP8A 1NFDE 4AK2A 4RMSA 3QWQB 3QZLA 5C0JB 5CEZE 5KSAA 4RMRA 4LE8A 1UTDA 3UL4A 3ILQC 4M9PA 5JXEA 2PR4H 1SY6A 2KBGA 3FT3A 3FZUC 5GJSL 5BCAA 3QHFL 5DQ9A 3KYKH 2QSCH 3LKQA 2GW5A 3X2QB 2NY0C 1NBZA 3BWAA 4BSVB 2A3TA 4WGWB 3VFRA 4K3EL 2X41A 3EGXA 3IMUA 1CGXA 2F6AA 4IW4C 3VFWB 4WNSA 2OL3L 4MA3B 1FG2B 3L95A 1CE6A 4UILL 4EDWH 3ORJA 1PKQA 3MHZA 3SCMB 1CE1L 1PG7W 3HE6D 2Q8BL 4OGYH 4R5VA 2I85A 3L48A 3FO0L 4QXGH 1AZZC 1BSIA 5J7CC 5D7SL 5B4MD 5IMMA 5EDXA 2ORBL 3W39B 1IX2A 4PJ7A 1L0XA 4CC0A 4PJ6A 1U8OA 2Y5TA 1ED3B 1QLRB 3GXFA 1TNNA 2JJSC 2V2WA 2O6EA 3M1BB 4L18A 2F54D 3HC4L 3P4NA 5CZXD 4MHHI 1D5IH 4U0RB 4FERA 3JWDC 1KCLA 4X8XA 4OZHE 1UZ6F 1O9VA 4NO0B 1DJWA 2GHZA 3ARDB 2F74A 3F58H 4KI5C 3H1ZA 1Z0NA 3ULAB 5FM5O 5IF0A 1KXVC 3G5YA 4XNBA 5BZXA 4K9EH 5GSRB 1SJMA 2DQDL 1BG9A 1MRDL 2MKWA 1BOYA 2MNJB 1SDYA 3SCMC 3CFEA 3QCVL 3ZL4H 2VN7A 3RIAK 3INUL 4WAFA 2BIQA 5C0AB 2R2CA 5JIPA 3HC2A 4UQ9A 4KNTA 4XNZB 2X5PA 3OKYA 3S5LA 1FQ9C 2VZVA 1U8KB 3RTQD 3B9EA 2DWYA 3WGUB 3P73B 4DUWA 4LDCA 5DUML 2RQ8A 4QLRA 3AABA 4I7ZC 1A6UH 5B1JA 4QTHB 5D5MB 2QGEA 4WZ9A 4U0RC 1H9DA 3K74B 2VLKE 3JTTB 3SO5A 2BNRB 4EE2A 2D31B 3ARDC 3DOSB 5C08B 5FGSA 2DLTA 3D0VA 1Y7VA 3DX8A 5DJ8A 3S3DB 2BY3A 3MCLL 3TH4T 4P2AA 3MUHL 5D1XB 1OWWA 4QYOB 1OWRM 3DIFA 3D9AL 3DUSB 4U3HA 3BO8B 4NQDE 4PGJA 4UYQA 3N85H 3GMPB 2X38A 3FN0H 3LS4H 3ECQA 1IZKA 2XQ0A 1NGWB 3D4GA 4FLHA 1DBKH 1B3IA 4YUEL 5AUMB 4C8XA 4HPYL 3IMBA 3GINA 2VZUA 4XNZC 1KYDA 1KCBA 4J8RB 3K2MC 2FO1A 1BMGA 4Z5RA 2DS4A 3RWFB 4J4PC 5DDHB 1CI3M 1KIRB 1DFBH 4HG4K 1KNOA 5DO2C 4DGIL 4X5XB 2CHNA 1WJ3A 5SWSE 5HXMA 2ITDA 4NQEB 2FHBA 2D9CA 1YMMA 3PWJB 1VKXA 1E0OB 1W15A 3GZKA 1TQWA 5FCUL 5LNDA 1GXEA 1XF5B 1G7MB 2CUAA 4PG2A 3ZE2F 2JXMB 1YPZE 3GLEA 5D2LA 1XZ0B 3NEEA 5D1XC 1FHGA 5F7NC 4PSRA 2WIIA 1G7IB 4IHOB 2K8QA 5KOVC 4ZNCD 5ABZA 2V7NB 3LKOB 4GOSA 4K3DL 3SBWC 3IYLW 4FZEH 4D9LH 1BQUA 3ZIMA 1CICA 3M8OL 1RERA 1MLCB 3QZWA 4OCYH 3TNMB 3UYPA 4OLWL 3WNNA 1THAA 4ETYA 5JW3L 5JMRA 3FAWA 2IDTA 3QIBB 3SD2A 4J8QA 1D3CA 1BVZA 3T2NH 2ZYIA 4G6AD 1YRKA 3N42B 1MFDH 2IOMA 1JVOA 2WNXA 4FP8L 5DHDA 1AH1A 4YHMH 4L3EA 5MHSD 5EWIL 5GS1A 1GMEA 1RLWA 1GOFA 3R18A 4FQXD 1KEGL 4GQQA 2A6DB 3AGWA 1OZTG 1NOAA 4R7DA 4D3CH 2AERT 3PAUA 7PAZA 2YZ1A 4RISL 1QA9A 1IM3A 4PRAA 4LDOB 4OLZH 4ODSH 4YHLH 4PJ8D 4OZIE 3BP6B 3PRZA 4NM4L 3RVXC 4TN9A 3ABGA 2R59A 4G9FD 3EGDA 4R6UA 4P5MB 1A14H 4BDVA 1I4FA 2JIXB 1PX4A 1MCOL 3HMWH 4R90L 2VDKB 4MDJB 2LFGA 1DTUA 2B4CC 1S7SA 4CADB 1ZDQA 4JR9L 1QABA 5CINL 5DLML 5KYXB 4JHWL 4URTB 3EDFA 3QIBC 3T1WA 5BO1L 4ADJA 3HMXA 3A47A 3VGAC 5B38B 1J18A 5D4QA 4JPIB 4A68A 3ARED 4L1SA 3RY6C 2AEIT 2JSFA 2VQ1B 5FV2A 3VD2A 1DLFL 1T5KA 4JKPL 3CVIH 1F4AA 5JPNB 1MH5B 4X8JB 4AGOA 4BFOA 4NM8L 5L2KD 5IVXB 4LSVH 1LQSR 4B50A 1P4UA 3L9BA 1RIVL 3S4SB 2DMGA 4OGAC 4QHUB 4UT7L 2UWEB 2D2CC 5FA3B 5IEKB 2HAZA 5F1SA 3O6FD 4TQPA 5AKTA 1CE1H 3O6ML 3IGAA 3AVEA 4NJ9L 5GGUA 4ZS6D 3C6SA 3SODB 3T8XA 1OGPA 3MV9E 4CVZA 1QAWA 4LB8A 3RE0A 5I1IH 1ZHLB 2NPLX 3GSXB 3WKML 1RPUA 3E8UL 4GFTB 3SDAB 2E0PA 3HE7D 2FNBA 5I8KH 1IC5L 4Z7NE 4P49A 3DSFL 4WW2F 1JMZA 1O6VA 1RULL 1T20B 3FRUB 3K3QA 1RZGB 5JPNC 3LTVA 5SX4H 5BZZA 3UXFA 1VGKB 5JOEA 1R1CA 3J07A 4FD0A 1I7RB 1OB0A 3NFSH 1RUMH 4YSUA 1OXYA 4KPHH 5GRZA 5HD8D 3HNSH 1BG1A 4GKZB 4NP9A 2DZEA 2ZAGA 4P2OD 4X9BA 4K23H 2EECA 2AEPL 1JZDC 3PWUA 2ZWYA 5KYUA 4R84A 1NIEA 4HUWB 5IHHA 3QCVH 3MXVH 1EJFA 4DCQB 2CU9A 4JANB 5G4NA 5C9JB 4BD4A 3CU7A 4NO2B 3MRIA 4UOJA 4B5EA 1U3ZA 4JFSA 1SOKA 3U0WL 4PJAF 3SDAC 4YN3A 1UFGA 5I6NA 4CMMB 3IMRA 1LK3L 2X6UA 2P49B 2WLYA 4FMVA 4PJHB 4AQAA 4OLVH 4C57C 4IBZA 5DUMH 3AWGA 4N0FA 4JK0D 1NH6A 4NRZA 5KJ7E 3NMEA 4Y4FA 3ILPB 1CLVA 4QMEA 3EH2A 5I0XA 4I9WE 3TBSA 4PJDE 2P46B 5D93B 2P5EA 2WK2A 4O2FA 5DJCB 1EAQA 4PS4L 1BM3H 2XN0A 4KH9A 4NQCD 2A6JB 2J73A 1X5IA 2WJ7A 4QHNA 4UCFA 4AM0A 3HB3D 4XWGL 4EN3A 1AC6A 1IIIA 3D9AH 1TJHH 1G1OA 5K39A 4ZTOL 1A6TA 1ASQA 4BYHA 1CU4H 3RGVD 4HPYH 1QI3A 1JAEA 2AJZB 1PG7X 5FYJU 5HGAB 1F6LL 3MV8D 3VU1A 3FRPA 3WHE0 3OB0K 8PAZA 1BX2B 2JB5H 5CJ5A 4PHXA 4NQDA 3JWOH 3S9DB 1OO2A 1SLVA 4M62H 5E7BA 4K94L 1J87A 3OKEB 1H5BA 1DSFL 4XP5L 2QV2A 5D93C 3GBLA 3OG4B 4G7VH 4JDVA 1HX0A 4GP4B 1W80A 1GZQB 4JN1H 2WXFA 5IQMA 3PUUA 5JHDA 1S9XB 4LEOB 5I6MA 4YHPA 3SGDI 1NDMA 1MCNA 1A1NA 4D0DA 5SWSA 4WU5B 3HI5H 3GJFA 1E4KC 3TNNB 4YLCA 1U4FA 2OMTA 3MLUL 3TBWB 3TS8A 4NQUA 5JW3H 1M7IA 5CM1A 1IL1A 1SLXA 2GBVA 4QHKJ 2LR4A 1ZTXE 2XVBA 2E59A 2X2JA 4OF0A 1NC4B 5DZLA 1AKPA 2DM2A 4Y4KD 4ZFFB 3IFPB 4ZUUB 5CUSH 2NXYD 4D9QE 2K4AA 1IMHC 5HHPA 3D3VD 3ULVE 3FK3A 1KV3A 3T77B 1AD0B 4LNRB 4LSSL 4RISH 1CDJA 4LMQE 5DMIH 3EYOB 3UGXA 1BIIA 4NM4H 5CFAA 4FQCL 1ACCA 3MLYL 5C1MB 3RL1B 1IE4A 2V9RA 4PRDB 4ZMYA 5IIEB 5EIIB 3VGGA 5BQ7A 4K7FB 3PV6B 4P05A 3RDJA 1F6AA 3UBXA 2WW8A 1GIGH 2ROYA 4R90H 5DTFA 3JTSB 3SE3A 4WUUE 3IFLL 1JPFA 5CINH 4U1IB 5DLMH 3ISRA 1XCTB 4JHWH 3DX0A 1WCBA 4LSQH 1N2RB 2AHIA 1GZPA 4Z7VE 2FATH 3EG9A 3FB5B 4HKZA 5LJYH 2F54A 2LW3A 3FU9A 3QUZB 3VI4E 5BJTB 2J6WA 5BQDA 5FDYA 4Y9GA 3SY0B 2B59B 1NJ9A 3QIUD 2NX5A 3F6IA 4UTBA 5H37A 4NM8H 3P3RA 2FUTA 1YEDB 4JHUA 4DPCX 6PCYA 5JXAL 3DX6A 4UT7H 2AXFB 5FHBL 3T4YA 4IIQA 4TV3A 3U1SL 4RMQA 4UNIA 3B2VH 2HLFC 3T0BA 2YR3A 3S36X 5LNGA 1ULVA 5AAMC 4JJHA 4L9LB 3UTZA 5IVZB 1R46A 1O5DT 3ATAA 3MRKB 5CNHA 3RIFK 4HHAA 3C09B 1RZFH 1HXYA 1ACXA 2GCYB 2VXQL 5KBKA 4F2FA 3WKMH 4Q8BA 4NGHL 4WI4A 4CKVX 4KQ4L 7FABH 1UGKA 1JRHH 4C56B 1AO7E 1DEEA 1PAMA 1IC5H 1Z9LA 3QUZC 4R4ND 4ELME 1QZ1A 2R1WB 1RULH 3HNVH 2OMYA 2WWMC 1MLBA 5CCKH 4F33B 5JIQA 3GMOA 4MKMA 2PMZA 3F85A 1F2QA 5HYIA 2L3BA 4OTXH 4XPBH 5TK2A 4I4WA 1JPTL 4X6EA 4H1LB 3MFFB 4KKLC 5GS2H 1O9WA 3ZBMA 2YPLB 4N28A 4L9LC 4Z0XA 3BDYL 2DJUA 3C09C 2QBWA 1CTMA 4JM4L 4B3EA 2X4NB 5DMGD 2CA4A 1KGJA 2BW4A 3SSGA 2B3RA 1TTGA 4EMZA 5F0LB 4E42B 3DROB 3L2MA 2YAHA 3VACA 4Z3TA 4JO3H 3FMGH 3BAWA 3BAJA 4WCYL 4K71B 3EH5B 3B2XA 3CZSA 3BYTA 4JY5L 4X99A 1IGTB 1A4KB 3Q9PA 4FS0A 5CF3A 1O75A 3O2DH 4YE0A 1Q4NX 1IC4L 3CLWA 1WHOA 4N2IA 4NZJA 5I18L 2FBOJ 5BMFH 3QFJB 1CR9L 1UFUA 4YL9A 4Y2OA 4G9DA 3MUUA 1U58B 3ALWA 3MNMA 1ZE3C 3ZUNC 4ZTOH 3VH8G 4D8PA 3CD4A 4C83A 5BZWA 3OLGA 4PY7A 2V5YA 1JJUA 1T7ZA 2UY7B 1VAHA 4JQIA 4PJDA 3S3CB 5FYKU 1P1ZB 2X9XA 2EDKA 2IPUG 2DLIA 4JB9L 4O9HL 4WNQA 3K6OA 4TVUA 4YHOH 2WM0A 3CN0A 2BY2A 3VAEA 4MJ6B 2WLKA 2FK9A 4K71C 2XQYA 1IBBA 1P4IH 3QEQD 4FQXA 4PJ5E 3ARVA 1TTFA 3UO8B 4Z7QE 4NN6B 3JWNE 2H3XC 1YEGL 3GSWB 1OGTB 3B34A 3KWWA 4K94H 3C60A 1W8EA 3ZRSA 3A4DA 2Z4TA 5EEWA 4XP5H 4LCIH 4W9EC 4PJ8A 3BH4A 4MA8H 5H35B 3VFVB 4ZMAT 1C8PA 3MRJA 4MJHA 4G9FA 1KCVL 3R4RA 1CXIA 1OKEA 3TVMB 2KYIA 3UAJC 5F88B 2Q5BA 2R4RH 4OLXL 5FPIA 4Z7WB 2XBDA 5EORL 2Q20A 1S7WB 4D7BA 4IBWA 5TE6H 3A6CL 1CZ8L 4F20A 4JRYD 3I02B 1AGFA 2JCCE 4HKXB 4JY4B 2DLEA 4PP2A 3DO3A 4LSUL 3S98A 3GMNB 2G2NA 5I76A 4GRLB 3R8QA 5GS0H 3U6RB 2X4TA 2G2RB 3KAAA 2Y4SA 1QYGH 1JERA 1E4XL 2PYEA 5F3BB 1M3JA 4HJIA 4Y5VA 1AR2A 1MI5D 2RA1A 3QIWD 1PZSA 4BJLA 4I0CC 4I85A 5FKPA 3B7UX 4NN6C 3QCTL 3CTTA 3EFOB 4FL4B 2YQ3A 2J6EA 1FL3A 1A9EB 3QH3B 1DE4B 4HGWA 4ZS7H 3BUPA 3FTGA 2ZSVB 4PRHD 3UROR 3O6FA 3TVMC 5IBLC 3DBXA 1KJVB 3V55A 3UJJL 4LCCB 1OTSC 3US1A 1HI6B 2IOIA 3ZTNL 1KFGA 4JKNA 2ADIA 2ZQKA 2O1AA 4G42A 4N0UE 2XKSA 4XNMA 2NT0A 4U7MA 1U41A 4GRLC 1A9BA 3FH7A 3QWRD 2V2TA 1CBVL 4FNRA 5L6YH 3X3FL 1U8HB 5C0BB 2CRYA 4P9MH 1FZOB 1SJHA 2CCLA 3VQ2C 2LFEA 5DRXA 1Y0LB 3OAUH 1WAPA 2YBGA 4FL4C 4DGYH 2VOTA 4OI8A 1T5WA 1PTZA 4E9TA 4LOUC 5TDNB 4AX3A 3IRZA 4JPVL 5HDQH 2UUDK 3HZKB 3T3ME 1ESOA 3FQXA 2DDQL 3IKKA 4FZ8H 3U1SH 3U4BL 3QEGL 4KROB 4LCCC 2VTFA 3OGCB 4NWUL 1F4WL 4PTTA 3BZDA 3I6LE 4XCNA 1T03L 4ORGB 3O8XB 5CD5D 4X7SL 3V4PA 1JZ5A 3QC6X 1XGUB 2V5MA 4WIQA 2Q76A 5E9AA 4GKNA 5JHAA 2XCMC 1UH3A 5CEXB 1F8TL 3AQDA 4KQ4H 5D7LE 4DERA 3O6KL 5KZCB 4MCZB 1H8SA 3AM8A 2AQ2A 2MCMA 5ESVB 3GSQB 2KC0A 3ESUF 3UP1A 4LOEA 4D7PA 1HZHH 2ESVE 1YNTA 3P3TA 4TUJA 3OLDA 5HHXL 5IMOA 5BOPA 2HTLC 2VR4A 4NZTL 2F5BL 1F90L 3MRBB 5DT1L 3W9DB 1EZLA 3B83A 5E94B 3X13B 4BE5A 4NQCA 1UCBL 2C3XA 2Z0BA 3QUMH 1MUJA 4X83A 3P11L 3I2CL 3DUUB 4OW6A 3CXHJ 2P8LA 2YKKA 1WWCA 1ZDSA 4RSYA 2HRPH 4AG4H 3TU6A 1JGLH 4KROC 1JPTH 5ES4B 3K0YA 2GB2A 4OB5L 3U0PB 1TO5A 4ZSOB 3DJZA 3O8XC 4OD1H 3NN8B 3GNMH 1C08B 3RWGA 1XWVA 1UB6B 2EIDA 1MKFA 1AJ7L 1AG6A 1RKRA 2GSGA 1W0YT 3BKJH 1Y6MR 3EYSH 3ZE1E 4CC1A 4Y2DD 4IRSA 4FHJA 4AYDC 2EVJA 3L2LA 5DFWH 1CGUA 1X5HA 4EEEA 3FUFA 4DP1X 4QRPE 1MHPH 4N68A 4RIRA 5CJOL 2XWEA 1PY0A 1DQJB 3TURA 1LM8V 5A16B 3FUKA 2PLTA 3JZYA 3UZQA 3PLYA 4PWGA 1RUQL 2HT3D 3FCUB 1ZLVK 4C47A 1J1PH 4OCSH 4NQXB 4M00A 5CN2A 4C59B 2MFNA 4A2MA 3IJHB 2FH6A 1JWMA 1S7TA 1OCRB 5I17A 4PQXA 5HSFA 1WA0X 3MX0B 1LP9F 1HHGB 3CX2A 4OI9A 4PJBE 3WLWC 4AIZA 4JQVA 4PRIE 2XN9D 3BE1L 4U33A 1LO4L 1QMUA 1NBYA 1V05A 3TA3D 3U6XA 3QP3A 2XT1B 4A38A 2ED7A 4BQ6A 4NCC2 4Y4KA 5AVWB 3MVSA 4F93B 3D3VA 1JZHA 4F37F 1NSNH 2EC8A 1AACA 2EYSA 1T3FA 1EQWA 1YEGH 4Y5XB 5HI3C 5IESL 4KKPA 5KSBF 1ZK5A 4G2AA 4JFDD 1ZLDA 3RHWF 4PJFE 2ZP9A 1KCVH 2H0PA 5EG6C 4OCMC 3RWJA 4UQAA 4QF1B 5DQ9B 3UCQA 3QO1A 4RAVB 3BDBA 3P30H 3LB6C 3LKQB 5EORH 1MXDA 2W9DL 4IRJD 4KMLB 4XHJC 1CZ8H 3U7WL 5F89A 2V0AA 3QUKA 5JW4M 3T0EB 3EGXB 1OK8A 4W9ZA 1CLZL 2H5UA 5CJXC 3GTNA 4N1HB 2DL9A 3L95B 3PP4L 5DEGA 1PS3A 1UHVA 3LRHA 4AY0A 5C92A 4XBGA 1PKQB 4N2KA 3MOQA 3CDYA 2JCWA 1BEXA 1CYWA 2BSRB 2OMUA 4A67A 5EA0L 4KV5E 5IMMB 3QCTH 3Q48A 2WJ5A 3U7YL 3WNOA 2JCCA 3GPSA 4Y5XC 4M6NL 1ILSA 2CXGA 4PJ7B 2DIJA 1MFEH 3F64A 3NJMA 2B7DT 3NSDA 1U8OB 2Y5TB 4I3RL 1FCGA 4UINL 5I6PA 1ZVSA 2F2HA 1CG9A 4ZUVB 5JXEC 1URIA 2Y9RT 2JKTM 2FQDA 2HVKA 3QG6A 3QNYA 3NIGF 1KULA 1A9VA 4POYA 3SYOA 1R0AH 3T0EC 5C0GB 3FU7A 3BD4A 3ELQA 2KUTA 1FG9C 3G5YB 1GJWA 5IM7A 3KPSB 4FTVD 3TEWA 2CO7A 3P9LA 3DHPA 3CFEB 5IHWA 4K5OA 4P57B 3LN9A 5EUOA 1TTRA 1SF3A 1ID5I 4KJQD 2P4AB 4DJMA 3HG0A 5F97E 1VEPA 4G5AA 4P3CH 3S5LB 3VM5A 2KH2B 4WTXA 4ZG1A 1SXBA 4ZYKA 1LGVA 2DDQH 4QTIH 1Q9OA 3VGFA 2XIDA 3QEGH 3U4BH 1U93A 4KTEH 2A6KA 4NWUH 2WLZA 3G6AB 2DJMA 2N7SA 4X7SH 3D0VB 5DXWA 4HT1H 1Z0MA 3LEVH 1IKFL 5DJ8B 4HWBH 3Q7JA 3FUEA 5D7JB 2LHAA 1OE2A 4KKBD 4UQCA 1I7ZA 2OW6A 4YSTA 1BAGA 2XLLA 4QDGA 5I16A 4TQ8A 4XE5B 2NY2D 2ZG2A 5DD3L 3CH8A 1JNHA 1NGYA 1MCLA 5IZ7A 3H2WA 1I9RL 2WBJD 5JUEL 3LZQA 1F90H 3GBMH 2QLVB 4Z5RB 4FLSA 1MEXL 1KIUA 2MCPH 5EU7C 1KNOB 2OCCB 3FO1A 1RI8A 4HCRH 3RNQA 1KBKA 3U4AA 3WD5L 2JJVA 1WA2X 1YMMB 3SJVD 1BMZA 2ZUYA 3C5XA 3DDFA 1N6UA 4GG8A 3FHAA 1C7SA 2ESVA 5D2LB 1BQHA 3Q3GA 5I23A 1BMWA 2P26A 2AJVL 2CDEA 2CHDA 3KDPB 1NLBL 3BH9A 4I1PA 4LSTL 4QY8A 4AKPA 5KVEE 1HZKA 1J10A 5KTEH 2CCWA 1JG9A 5LB1A 2F8IA 1I1AA 2UUDH 7PCYA 3DX9A 3LRMA 3NJXA 5FGBA 4K15A 3VXUE 5CJOH 3FT2A 1DZBA 5IG7A 4I13B 4M1GL 4YHZH 1CI5A 2A6IB 3B9KD 3NPSB 1KXQE 1RUQH 2R29H 4UV4H 5GS1B 1XD1A 4FFVD 3VQ1C 2YIHA 4CW1A 4GRWH 5B1BB 1E3FA 1CGWA 4R7DB 3PWPA 2R2HA 1E6JL 1QA9B 1T80A 4PRAB 2ZKHL 5DFAA 3QQ3B 3NDYE 1U92A 1K5NA 1LO4H 2J72A 4OZFB 1TSRA 4RGNB 5DD5L 1KTBA 3UTQB 3EGDB 4FXGA 3MROA 2BVQA 3MREA 3QIWA 2JH2A 3I50L 4DK5A 4FX5A 2V2XA 1JTTA 4NI3A 3TH2T 5CD3B 1BD2A 1AE6L 1S7SB 1TXKA 2R8SL 1QOKA 2MCAA 1VHPA 5AOMA 4F24A 2NW2A 4ZBJA 1CURA 4S1RL 3BIKB 4XXDA 3RUGB 5BRZB 3M46A 4U31A 5JQ6L 4PRHA 2DBLL 3NPSC 1FAIH 3MLZL 1M2OA 5F1IA 5GS1C 3T08A 5F96L 3EJYC 3MNVA 5DJXA 2GIXA 5GS2D 2GEEA 4HFUH 4EZKA 3DA0A 4M93B 1NFDB 5DCCA 5E2TL 1F56A 3UYOD 4ELKA 3QPQD 1EH9A 4RGNC 3UP6A 1SFHA 3FFDA 2DICA 4P59L 4DKDC 5FC9A 3U2JA 2ZUXA 2IBZY 2C5DC 3IPFA 4LHUA 1JVKA 2Q2LA 5GGUB 2H0EA 3C6SB 4XPHL 3FQRA 1WUZA 4Y9CA 5EA0H 1ZLVH 2VDQL 3KPRE 4FLQA 2XY2A 2RQEA 2H3KA 3IKCA 3II1A 3DX7A 5DD6A 3LS5L 4JFPB 1BAFL 2AF2A 4DKEH 5DS8B 3UTOA 3VXMD 3BVVA 4I3RH 4UINH 2KQMA 2GPZA 2NY7L 2FECI 1ZAGA 1QATA 2ZKMX 5I1EH 1U95A 2BWQA 1HSAA 2K6WA 3RBSA 4GH7B 1JGUL 4M93C 1S5IL 1E4WL 2CDGA 4WTZA 5D4HA 4Z1PA 3QJTB 3EHBB 1CF8L 1OCCB 4AGNA 3C87A 4GG6E 5IREA 2GUOA 1PVHA 1HWWA 2I24N 2MHAB 3PWUB 3J2PA 5JPMB 1HCVA 5KYUB 2FL5A 1B2YA 3KL0A 3RA7L 1P5UA 4PJGE 3WCYA 4OZHB 5GGQL 2VRAA 3LYRA 4BH8A 4N8UA 2MMXA 3U9UA 1MRCL 4XNUL 2MPAL 5HYQA 5FFLA 5BW7A 1UA3A 4OUUB 4I5BA 4A6YL 4AQAB 2L8AA 2GTZB 1A8JH 5HDWA 3SKOA 3EXLA 4FNSA 4Y4FB 1H6UA 5ICXA 2YA0A 4KMQA 3FCBA 1IFHL 2P5EB 3ATBA 4O2FB 1ZS8A 3DYPA 1DQDH 2AEQL 3HFML 4X6BB 1IKFH 4GPVA 5IMKA 3EHBC 3SDYH 4LCYA 3WL9B 1XCWA 3V6FA 4ICWA 5JPMC 4Y19E 2I60H 5F3HA 2XG4B 2WMPB 1W0VA 2BSSB 3DO4A 1A6TB 1A6ZA 1UM6H 3L9RA 5T3ZL 2XFGB 4YSEA 1A25A 3BZ5A 5DD3H 5E2JA 4OM1L 4MS8D 3K0WA 2VMDA 3BEWA 3M1OA 1P7QD 3UC0L 1WISA 1ZHBA 2AK4E 4WGKA 5JUEH 5LGJA 1KB9K 3FRPB 4RSVA 3F04A 3FTZA 1MEXH 4CU6A 3QHZL 4NQDB 2F1EA 4RVBA 3M07A 4Y4FC 4L37A 4JFZL 1IAII 1E2WA 1EZSA 2WLJA 1SBBA 2J1YA 2DIEA 3GDBA 2HKHL 5EH1A 1NCWH 4JDVB 2VDPH 4BKLB 2XOTA 1XL6A 2AI0L 2APBA 4DUVA 2R83A 3TA3A 1L0QA 2M1KA 2OMBA 5GRVL 1EK3A 4NKOA 4AKQA 2B15A 3X17A 1IGJA 1NDMB 1P69B 3GSRB 1A1NB 1PD6A 3FT1A 5SWSB 3GKZA 3RWIA 4D0DB 2OSYA 3TONA 2OMTB 4LRNH 4DP2X 4QKTA 4OCXH 4F8QA 1M7IB 2VDMB 1EDQA 4UU9A 3FUDA 4W9HC 5IB3B 1ID2A 3ASOB 1HL5A 2ATAA 4JFDA 4BHUA 5BOZG 3Q5YA 4KTYA 2DQUH 2IPTL 4UNVA 1NFIA 4JFEE 2E3VA 1CTNA 2GTQA 5IB2A 3S8GB 9PCYA 3GK8L 4HIPA 4IRJA 1IGML 1IAMA 1HKLH 4BWUA 2YS4A 2J44A 3T8MA 2WKGA 3ESVF 4G8GE 1T2QH 2CKBL 3C6EA 2BSCA 2XETA 2JK5A 3VFNB 1A3RH 1XIWA 5I9QB 1WZLA 4XVJH 5TQ2L 4WTQA 3B1UA 2NY3B 3JV6A 5DD5H 5HGBA 2EO7A 1H8NA 5IHUL 3AU0A 1Q94A 4HKBA 3WNJA 1UKTA 4JFFD 5BQ7B 5ID0A 1HDMA 4XN4A 1F6AB 3UBXB 1P2CB 4WY7L 5BS0A 1BVLA 4JEGB 1F4YH 4TNVF 3WUZA 3IAGC 4M7KH 4F80A 3SYQA 1JPFB 2YA2A 1X7TA 1YY9C 5DC4B 2N7AA 1KPRA 1WCBB 3KYOA 5AAWA 4OZIB 2D3LA 1GZPB 3CVHH 1CGSL 3EG9B 1N10A 4HKZB 5JQ6H 4ALAL 4B0MM 1SHXA 1YN7A 3DIDA 3EOBB 2A1WL 2FD6H 1UWGL 1SEQL 2AVGA 3KM1A 1DYZA 5F96H 2NX5B 3TN0D 2GG1A 1RCYA 3A4AA 5E2TH 1N0LA 4Q6KA 5AFAA 5I9QC 3DX6B 4XAKD 4FFWD 4FTVA 4PEEA 4YHNB 3VMOA 2NY3C 3T4YB 3RDTD 4P59H 5EN3A 4Z0BL 1T1XA 4HYTB 2YXWA 2C3VB 2BZDA 2Q3ZA 4LLUA 2YD6A 1EO7A 4YDJA 2VYRE 3UTZB 4OM0H 4XPHH 3DVIA 3SE3C 1HXYB 3HS0B 5HDBB 3N42F 2VDQH 3H9YA 3FU3A 4AV5A 5D7KD 3MRFA 4DN3L 4DW2H 3LS5H 1DEEB 2AK1L 2R9HD 4NZRL 5GGTH 5INCA 2YMTA 1VEMA 2JVUA 5KANG 4ONGH 1L9OA 3I6KA 2XWJA 5CZXC 3ZJAA 4E9VA 1HYSC 3U1PA 1WLHA 1M2VA 3QJFA 1DCEA 1M9SA 3JVGA 4XMTA 3V0HA 1U3HD 3GMOB 1P5VB 1JGUH 4L3AA 3R7QA 3P4OA 3VG0L 4E9WA 3VFTA 1XZWA 3Q2VA 4EKXA 1CF8H 2ID5A 4XNQA 3HA0A 5C6WH 3L3DB 3VFUA 1ZXKA 4Z7NB 5BV7B 2O6FA 3SY6A 3RA7H 3LH2L 1QX1A 1G6RH 4GKSA 3HS0C 3PU7A 1XBDA 2WBJA 3O45A 4UQIM 3RVUC 4N90E 1AHMA 2ENYA 2AQ3A 2FO8A 2FHFA 4M3KB 4HC1L 5T3XL 3MSPA 3Q13A 4A6YH 4GG6A 1QSVA 4TPRL 1KB5H 4H4NA 5IVXF 4ACPA 2R7EB 4JY6A 3NFNA 4Y1AE 3SJVA 3TA4D 4X99B 3D2TA 3RJOA 3EOAA 4CVWA 1UENA 1IFHH 4LP8A 4NZDA 1D5ZA 1Q72H 1PJWA 3L7FA 1PZUB 4DZ8A 2YUXA 1VB9A 3HFMH 5KUMA 2HCZX 1OZUA 2VZ1A 4M1DL 3VWJB 4EJ1C 2HN7A 3CLEH 1OT2A 3IM1A 2FBRA 5BV7C 3S6CA 2GHWB 2XDHA 2HFFB 3KYNA 5J3HC 2ZP8A 4C83B 3AAZB 4WEEA 5BZWB 4JAMA 2DQTH 4HJSA 4PY7B 4D8PB 4F7EA 4O4YL 4G72B 4PJDB 1SMAA 2PXYD 4BV1A 2F53D 4AZ8B 1BVOA 1BZOA 1JNJA 3UC0H 1QW8A 1XFPA 4KFZC 4FE9A 2MNWA 1UWXK 5K5YA 4XMPL 4LQFH 1II4E 3QHZH 1F00I 2HRLA 1YN6B 3DPDA 4WENB 3WMPA 4JFZH 1GGIL 3P0GB 3CN1A 1B3JA 3KWWB 4EBQL 5IROD 3C60B 1SVCP 1FAKT 5GGVL 1X7QA 2HKHH 2HJFA 3U4KA 4PJ8B 4P3DA 1NDGA 3ARGA 3KPTA 3MRJB 1OPOA 2D0FA 2EXWC 4NQVA 4ODUA 4NLAA 3VWJC 4JG5A 3GMLA 3CPLA 4UTCA 4E41E 5FECA 1JZFA 3TT3L 2AJUL 4TTGA 2WQXA 5IW1B 1AGFB 1BZ9B 3SBQA 4B60A 1I8AA 4GT0A 4QYAA 4C4KO 1JYNA 4PJHF 5TDOA 4FF9A 5I76B 1F1GA 1QFWM 3U4EB 1WFNA 4W4OC 2X4TB 5DHVB 2PYEB 3Q8CA 2PWEA 4FI7A 2QHRL 4Y5VB 2IPTH 4HPOH 3BLPX 4MXVE 5DK2A 2FX8H 4JGJA 1NCCL 1EERB 1MPAL 3GK8H 4P3WA 3D39D 2J5LB 4P2YA 3KVQA 1SBSH 2IDUA 3C60C 4GQ9L 4XVOA 1PZ5A 3JWDL 1FL3B 2C9XA 1F18A 3FQNA 4PJ8C 4OJEH 4XN5A 1SRDA 4GAJH 1J5OH 1VF5C 3DETC 4X5RA 3NSYA 4HGWB 4UMGA 5AW4B 5E9DD 1ZT4A 3FU8A 2X0UA 3D08A 4IOSA 1IVLA 4Y16D 4IOFC 4JFEA 5IHUH 5IHZA 2K1MA 3PNWB 4OGZA 1N68A 2J3SA 2ADIB 4OT1L 1JFQH 1FRGH 1OSPL 4N2FA 2G0LA 4NENA 3LEXA 3O2DA 5IFAH 3SQBB 4KGLA 1A9BB 2YKLH 1WTLA 3BRDA 2CSPA 3FPYA 3VXMA 5JYLA 2ZG1A 1W72H 1CGSH 2HRHA 4Y5VC 1ZSHA 1SJHB 3KLDA 2AABL 4ALAH 3PGDA 5DRXB 3SIKA 3WDHA 1OW0A 3QDGE 2J5LC 2JLPA 4WUUB 3S88L 3MOAH 1T5WB 3N9GH 3D85B 4LEXL 4U4IA 4Z7VB 3SQOH 4ECNA 3FQXB 1RZKC 2E74C 3BVNA 3WY3A 2VDNH 4YVNA 1WBZA 3LPGA 4XCNB 4ZD3L 4YMPA 3D0AA 3HZYA 5CO1A 4JPKH 4FXLA 4RQQA 2FX7L 1XDTT 4Q9QL 1XCXA 1KENL 2Q76B 4O02B 4GKNB 5JHMA 1D5MA 1AGCA 5EEXA 1X5XA 1HILB 3BQUD 1RPKA 3WJJC 5HP5A 5B3JE 2VLRD 1IGCH 4DKTA 4AEHL 3IETA 2RACA 1YDPA 2Y06L 2Y2YA 3C12A 1XD0A 4LGPB 4RESB 4MX7A 1YNTB 2C7UA 1I1YA 4TUJB 5B7EA 3CVCA 1N8ZA 3GS4A 3LKRB 3O4LD 4XZ4A 4X4YA 4A63A 3DMMB 4CMHC 3A67H 3LSOA 2E7HA 3MBED 1SN5A 3ZQ9A 5KVGL 4XMZA 2ZJSL 4H8VA 5LWYH 4BFFA 5H4ZA 4ZUWA 4ELMB 2ETWA 1ECYA 4KVCH 4TUKL 4S1SH 3VD1A 3IGKA 1P7QA 4GLRH 3RWGB 1A8ZA 4PCYA 4HSCX 2A4CA 4P04A 4Z78A 4X5QA 4KDWA 4RWYL 4XOCA 2A4ZA 4AT6B 1ADQH 1HNFA 3BKCL 1UVQB 2X53A 4UV7L 1RSYA 4IRSB 4HC1H 4LOFA 2R23B 5GIRA 3VM7A 1PX3A 4IGBD 4TQEH 3U36A 5EOTB 5KYWB 2R4SL 5I19L 3QJZA 5EDSA 3B3IA 5SX4I 1H3XA 4K73A 4OLYH 3R06A 4RIRB 5E8NB 4Z3HA 3PDOA 1TU2A 5F72S 3S3JA 4PVNA 3DMMC 2X3CA 3UZQB 4IS6A 5E4AA 4TSCL 2A5UA 4UM9A 1JHLL 2L04A 3LNEA 4YSQA 4WW1A 1NKOA 1JWMB 1S7TB 1UEYA 4S0SD 1IM9D 3MN8A 5I6OA 4Y1AA 4XMXA 4AIZB 3HZMA 5DJZA 3HC3H 5A3ID 4UB0L 4MZ3A 1V3MA 4B96A 2NNXA 3GRBA 1GHFH 2BFVL 4HMEA 1QO3A 4KQ3L 2B1AL 2NDFA 5EC2A 1N6QL 4N8CL 3RZCB 2B4CL 3GZQA 3DX1A 2G60H 4IKNA 4D9RD 4LLYA 1BF5A 4IRSC 1KN4H 4XMPH 4LSRL 4N3UA 4AE0A 4BFRA 4EUPH 2IPKA 3X3GH 1TQCC 2J21A 1L0YA 2EYSB 1GGIH 1T3FB 3W82A 2YRPA 3TT1L 1RZJC 5D7IA 3V4LA 2CM6A 2TRYA 1FA4A 1TG8A 1JHKL 4N0RA 3SPVB 1J0HA 3BOVA 5CEYA 2P9RA 5AYQA 3RWCA 2Z7ZA 1D2PA 2CR0A 1U8QA 3RWHB 3QO1B 4M3JA 5JHLH 1ZVHA 2Z1PA 3NZUA 1PF3A 3NP3A 5FA4A 4W9KC 4Z7QB 5F89B 2CH8A 1Q0YH 3QUKB 1H6FA 1ET8A 3U2SB 2VDKL 3ZZQA 4WHDA 3RZCC 3ESNA 3ZE0E 2VKXA 3FU0A 2CXKA 1BZ8A 3HCVA 3EOYG 2UX6A 2GI7A 1EO5A 1BBJB 1FZKA 3PV7A 3QUMA 2FUQA 2QHRH 3OR6A 4JM2A 4GAGL 1KTLB 2EADA 2TRHA 1OAQL 4J5VA 2NLJA 1MPAH 1PD1A 5E5RB 2JCCB 1J0ZA 3E1F1 3JWDH 4ZMWA 1KACB 2CO3A 5FFGA 4DP4X 3SE9H 1G7PB 5ACLA 1OALA 3I3EA 4XHQA 1ZVSB 1CB4A 3RDTA 1CG9B 3RU8H 2Q8AL 3W0WD 1DDHB 1WFIA 2HVKB 3QNYB 2JKWA 2VR9A 4FMFA 4GO8A 3GMMA 4PTUA 3VYOA 2VXTH 4TUUA 5IQLA 2VERN 3FUHA 1QEWB 3JWNC 4JDTL 1KCWA 1KGCD 3KH3A 1HKFA 1UWXH 3I6SA 4BFGA 5GZOD 5FUCE 3FU7B 1B0RB 3DI2B 3ILEA 1AKJD 3X12A 3GXDA 5IM7B 4N2BA 1JK8A 2FIKA 2G30A 2P52A 3QFGA 3FNKA 2CO7B 2C9UA 3P9LB 1P53A 5FDWA 3ME0B 1JF6A 2EO1A 3QFDA 1SUHA 5GZNC 2HKFL 1JOIA 3ZU8A 1ES0A 4X4ZA 2YAMA 1M9WA 2FB4L 3CWGA 4N0UB 4XMLH 4J3OF 3VXSA 4Z7WF 2WKOF 2Y07L 2VXUL 5AZEH 1BM7A 4ZYKB 3BPLB 4TLSA 3EKCA 4F3FA 4IBLT 4HXBL 1Q9OB 1W0WA 4OD2A 2VLME 3GBNL 1U93B 4GI9A 4KDTA 4MD4B 1T2JA 3PREA 2A6KB 4DP6X 3AT9A 4NOFA 4ZD3H 5DMYA 2ATPA 2RCSH 3HHRB 1A2YB 4NSKA 5A2KH 4PI2A 4Q9QH 1FBIH 1WDAA 5GISH 4PWJA 1CD8A 2OYPA 4Z8FL 3T3MB 1O9ZA 1UJ3A 5J1TC 4R4NC 1RZIA 1N4XL 1NAKH 5I16B 2ADFL 2WXGA 3IDXH 4DOHE 5J9PA 1FFRA 1JNHB 1NGYB 2A83A 2B2XH 4YPGA 4FFZH 2C4FU 1OCWL 5SWZE 5FOBA 4A7TA 1CLYL 4UDTA 4Q9RL 5DQDL 5T8IA 4L0ZA 2WLLA 3PFUA 1ZXQA 5E5LA 1TUPA 3ZUCA 1AI1H 2NOYA 3CXDH 3CFQA 4X50A 1KIUB 2P5WD 3CHRA 4JKKA 3BPLC 3LZFH 3W81A 3L1GA 2C3WA 3RNQB 4RA0C 4R5XA 3ZDZF 3N41B 5EU6E 4GG8B 1ETA1 4NBXB 3BFQG 2ESVB 3QJHA 3QNZA 2CGZA 5F1OB 4HZLA 1BQHB 3BVWA 2CLRB 2ARWA 5DMGC 1ACYH 5LAPA 2BJMH 3NFPA 3ARSA 1A3LL 5A2BA 3A22A 5J6GB 3BKCH 4QY8B 5LXVA 4F7CA 3VU2A 1GY1A 2LABA 4PR5A 4L4TE 4KRPB 1NCAL 3VD0A 1UA7A 5K9JL 1I1AB 1JPST 5I19H 1L3WA 1C12B 5IROA 1HWGB 3L3HB 3DX9B 5GRYA 1RZ8A 1FZMA 3ALXA 1OTUD 1YZZA 4JRXA 4PRPA 4YLQT 4ABVA 2ENQA 5C9KA 3OWRA 3HLKA 4F1SA 2ZZUT 2A9CA 2R0LH 3FT9A 3FS9A 5AW9B 1EHKB 4TSCH 3ZE1B 4N2NA 3UO1H 1IU1A 4PJEE 1A66A 3MO1A 2FTAA 4HWZB 4H0HB 3S97C 3ZHDA 3PWPB 2R2HB 1JNNH 2EIMB 4UB0H 2JKSA 2W81C 1R3KA 3QDMA 3NA4A 1U92B 2B1AH 3AW5A 3ZKQD 1K5NB 2B4CH 1YEHH 2J25A 3A6OA 3U6XS 1CFVL 3MRGA 3P69A 4XI5D 4FXGB 3MROB 4KK5D 2BVQB 1WICA 1UACL 4Z3EA 4KGJA 1MRFL 1I8IA 2EKSA 5LO7A 1OF2A 4NUJA 5FO9B 4LSRH 2V2XB 4FEMA 4KRPC 4R96A 1EEZA 1BD2B 2Y3NA 1I1AC 3D39A 3W1ZA 4PJBB 3N0AA 4G6KH 4XP9H 3MV8E 3L5XH 4DP0X 3STZA 1BXXA 5C2UB 1QPXA 3D87B 1HHJB 1ZT1A 3LPOA 1DQIA 4MASA 2ZXWB 4XCFH 4DTGL 4HWBA 4ESKA 1JHKH 2QPSA 2EACA 5E9DA 5FO7A 4HULB 4YXLL 4Y16A 1CO1A 3BFWA 2Y5QA 3F12A 3MAWA 3K4DA 5F1IB 1KC5H 1DQML 2CD0A 5HHOD 5C3IA 1VACA 3L08A 5DJXB 5GSVA 5AD0A 2VERA 1IGIL 1S9VA 1SXNA 4BSJA 3QXUA 2FLMA 3AT8A 4JQXC 2LOEA 3RL2B 1JFHA 2XTJE 2VDKH 4ELKB 3FN9A 1U6AL 3DXAE 3CDFA 4FXGC 4J6IA 5ILTL 3BJLA 4G5ZL 5FLVA 1RUKH 3FQTA 4I0PB 2VLLA 4LHUB 4HCRA 1C5DA 3FQRB 1E67A 3IDNA 3WNPA 4PGZA 1E5ZA 2X4QA 4FC3E 1WP6A 3S35L 2ZE0A 1XEDA 4KMTL 4FNQA 1S7RA 3ZLQC 2EYRA 2HT2D 5CZVH 5KVFE 1SQ2N 4OFVA 1W6LA 4L2YA 5EZOL 5F9JB 5D1QD 1G43A 4KHXL 4L0YA 4MSWB 3QR1A 4JFQA 4JDTH 3GHBL 1JDAA 5T3ZD 5I1JL 1FVDA 3CZLA 4NP4L 4MCMA 2CDGB 2DMCA 1KCSH 2IVFC 5AVQB 2HXAA 3CHOA 4IMKC 3EJRA 4PV9A 2GUOB 2VUOA 3EZ8A 3CZEA 2VLRA 3ULUE 2OK0L 2FL5B 3J7HA 2FVNA 4I0PC 4EZMA 2R29A 4U1LB 4FYRA 5A2CA 2IF7A 2A0LD 4HOWA 2HKFH 4BH8B 2ZWSA 4J3BA 3TBVA 1RK7A 3U9UB 2YK1L 2Y7SA 3O4LA 5HYQB 2XWXA 3DI3B 2NYYC 1OSZA 2QZQA 3HUJA 4JGMA 1AFVH 4I5BB 2ICWA 2EIJB 3MBEA 2EDYA 3QUXD 1RD6A 3PHSA 2VXUH 3RWDA 1R3HB 4P5RA 1YQVL 3QDJD 3DYMA 1DUYA 4D0BB 2XA8H 3V2AR 4F8LA 4A7SA 1A3ZA 1ZS8B 4U1KA 3LNHA 4XZUB 4HUNB 4DEUA 4CSZA 1FFOB 3E3QE 3DRTB 3MACH 2HTKD 5IMKB 1OGSA 5A2IH 3IJ8A 1HHIA 5CSGA 3V6FB 2H2PD 5F3HB 3CZNA 1W0VB 4W9IC 4IGBA 3L9RB 4PJ7F 2BLFA 2DLFH 2VITB 2OR7A 4MJIA 4OIFA 1WBXA 4XP4L 2AJSH 2QT6A 1SN0A 3LKSB 4L4VE 1FIGL 1JGIA 1EJ6A 1OOWA 3RPBA 4YR6A 3JV4B 5LGJB 2BO0A 2LT9A 2J12B 2VZTA 4OAWB 3MKKA 2LAAA 4XTRD 3MXWL 3GKWL 1GSKA 3AS2A 1EHNA 3ZPDA 4L37B 3QSKB 2ED9A 1P7BA 3VRLE 4OFKA 3IJSB 2AV1A 1JPEA 5SWZA 4N6RA 4W6XB 2G3XA 3HVDA 4NKOB 1ANUA 2YD1A 1NKRA 5BOJA 4NNYA 1HAWA 2XWZA 4PIBA 3M7FB 4FFYH 3ZSSA 4WI3A 2FSEA 1UM4L 3CC5B 3CN4A 3ARFB 3ZYZA 3G5VA 4Z95L 5DSCB 1DJIA 2MCG1 1RAMA 2ITCA 4HIQA 5JW4R 3TASA 4R7XA 1MCDA 1P4LA 1NFIB 2BVPB 2J57A 3FO2A 4YPJA 3BPCB 5IB2B 2KERA 4J3VA 4HJJH 3QXDA 2MOVA 4KK9C 4NWTH 4FADA 5EU3A 4IMLA 4MQXC 5CD3A 2WZ6A 2IG2H 4YDKL 4X7TB 1MCCA 4CU8A 2JK5B 4K3JL 1XIWB 5IVOA 1AS8A 3MLXH 1RH8A 4RLDA 2NNCA 1CFVH 2OTWB 5HGBB 2BFGA 1UACH 1YYML 1PZCA 25C8L 3BN9C 3OXRA 1XH0A 1HDMB 5JHBA 3PHAA 3QDAA 3VFGL 3A5VA 3H9SA 1EZVX 5BS0B 1BVLB 3RFZA 2ZTBA 1TJGH 2A73A 3UADA 3ARFC 1D7CA 1KPRB 3QAZB 2N59A 5TK4A 3ES6B 4MRBA 4M6OH 1A7OL 2B08A 1YEIH 1YN7B 4YXLH 4OJYA 3DPBB 1SXZA 1NGXB 3D5OF 2V33A 5D2LF 5JIKA 2VLJD 1J8KA 4K2UH 5HHNA 2EIZB 3QAQA 2W60B 3B7SA 5D9SA 1IGIH 5C09D 5GZOA 1Z1WA 4WFGD 2N56A 2IMNA 4KRLB 1N0LB 1XIWC 5I1CL 2F7QA 4NO5B 3TZVD 1KN2L 2EEXA 4TNWK 2WNKA 4HS6B 3QUYB 1PQZB 4U1NA 4U1HA 5T3XD 4YDJB 5HPOA 4ZUSA 3NG5A 4EN2A 1MNUH 3K2UH 3F7LA 2H0FA 5AAWC 3C5SA 4L1TA 3QAZC 3MRFB 5KS9E 3DVFA 4EI0A 1BJ1J 3VWKD 2PP7A 4MNQE 4PVMA 4Q97A 4FQJL 4QRRD 1QNZH 5FO8A 3I6KB 4URKA 1OAZL 2BP3A 5EZOH 1PIGA 3QJFB 3RVWD 3V4VL 2Z8VC 1D9KD 2WLNA 2DJ4A 3KPRB 3VFPB 3P4OB 3GHBH 5I1JH 1VFMA 3VFTB 2WOYA 1KPVA 1U33A 2XNAB 4XNQB 4CKQA 4WDIA 5DZPA 1F13A 4P8QA 5F8QC 3RJQB 3QUYC 3NSFA 1INEH 2BSTA 3JWOC 3CX5K 3T3PE 4CRPA 1A1MA 3INOA 4NHCL 4GKSB 2BS71 4O5LH 5DJ0B 2I7OA 2P8MB 3DOIA 4YQXL 3FZUD 1YEKL 2IADA 2NR6A 2VRQA 3ATDA 4KHTL 5KOMC 3WN5A 4Z77A 4ZFGH 1MQKH 1KG0A 1NL0L 2NY0D 1YNKH 3SKNA 1A4JA 1HEZA 4GG6B 2VZSA 3FTYA 3OKMA 4HH9A 4M7JL 1EFXB 2BOBB 3L4ZA 2BS9A 3BT2L 5B1KA 4DNLA 4ODTH 3NFNB 3RG1C 4G6MH 4WWNA 5FM5M 4PGCA 3SJVB 1YQVH 4DO4A 1IVTA 3C08H 2XI9A 2XXFA 4H1LH 1D5ZB 2YOAA 5DJDA 5IV2B 4K5PA 1DL7H 2OZ4H 3L7FB 4DZ8B 1WAAE 1RJLA 3K46A 4EVNB 1I9EA 2LV4A 3DRQA 3S3BB 3CVHA 5HTSA 5D4JA 3CXHK 2HN7B 2CRZA 3FFCA 3X1BA 1EUUA 2ICEA 2BIMA 3HG1A 1VGEL 5FM8A 1JGVL 3MOBL 4Y5YA 4JAMB 3S96A 1N59B 3WFCH 1JXDA 4GP8B 1RIUL 2A9NH 1AIFB 4UMSA 3ZT6A 1ZKAA 3BCFA 4LPXA 1TZHA 4TVPL 4XH2B 2DWSA 4KI5D 1AMYA 3GKWH 4M48L 5DQJB 4NKMA 1L9PA 5AL8A 1S9KC 3PIQA 1I8UA 3TBTA 3PJSA 2HPOA 5C0IB 5KANI 3NCBB 4JW3A 3CXFA 3EOTL 4NS0A 5ISZE 1X7QB 1C1EL 4RFEA 5AVTB 3SCMD 3MRCA 2Z35A 4P3DB 1NDGB 1A7QH 3ARGB 1DUZA 1FF5A 1WZ1H 2AK4B 3CBJB 4ODUB 4NQVB 1HCZA 2X4OB 1U21A 2E46A 3CPLB 3GMLB 4GAAA 5FECB 4OJFL 4QD2E 3K6DA 1OAYH 2N0KA 3ETTA 5GGTA 5ID1A 5AALA 1EA9C 3RWEA 4JKLA 4KVNH 3U30B 4WFED 3UZEA 3W11C 2I9LA 3JTBA 3LQAH 5E6SB 1KLFA 3PJNA 2IXQA 4YDLB 1I9JL 2GT9A 3ARDD 5FUZH 3P2TA 5DK2B 4S10A 3SKUD 4G3YH 4N22A 1J12A 1N67A 2IFFL 4WJ5A 1SY6L 4NRXA 1G6RA 1PZ5B 2LE9A 1YC7A 2YMXL 3FQNB 4LBEA 3ARGC 5EBLA 4J2QA 1NGZA 2ED6A 3CLFH 5B38G 5D7HA 4AI7A 2GQHA 1T21A 5E99H 5I0VA 1B2WL 1L6XA 4E9RA 4JFEB 3T6VA 4A6YA 1Z9MA 4FQIL 5IHZB 1YYMH 2XN9E 1KB5A 2ZXCA 5I5JA 3U30C 1YAIA 3VFGH 4J4PD 4E9XA 3F05A 5E24E 5D70L 1H15A 1CFQA 5DO2D 4NENB 3V5HA 3LEXB 4K7PY 2GYSA 1UQSB 3S7GA 3S4SG 4ZFOB 1AGEB 3NZHH 3BP4A 4HIIA 3VXMB 1Z9PA 4YDLC 4P23A 5HYSA 2HFEA 2XVKA 5HHME 5C08D 4U1GB 5MENA 2JE8A 5D1QA 2VH5H 5E2VH 1Q9KA 5D1XD 4ETQB 1RL1A 3IJYB 1AQDA 2EE9A 3BUBA 1ZT7A 1A5FH 1I85A 3PP3K 4BK8A 2IV8A 4UQEA 2ICWI 4ZUTA 2QMJA 3W37A 1KN2H 4UDUB 1TZGL 3KEDA 3BVNB 3I6GA 2XWRA 3SOTA 1SZNA 1WBZB 1BXUA 4FFTA 1G1CA 3HZYB 4HCIA 1T83C 2JKRM 4RQQB 3D34A 1T1YA 5GRUL 2M8XA 1E90A 2G4GA 3ARBB 4M1CC 1D5MB 2DQIH 3O3BA 4NQED 5HY9B 3V6BR 5EF0A 1G4MA 2V8MA 4NN5B 1M7DB 4XBEL 4U1GC 3IETB 4YSCA 1YDPB 1Y1DA 4H8QA 1OW0C 3QDJA 3RVXD 4LLWA 3LKPA 2NUTB 1I1YB 2AQPA 4X9YA 4ENEC 4R8WL 3QGVA 4Z6AT 1N8ZB 2PTTB 1B4JL 5F9OL 1FORL 9CGTA 2ZUTA 3C2AH 5AVVB 1XGQA 2VR5A 1JZGA 1N5AA 3GXTA 3ZR6A 5LXGH 3DV4A 3QIBD 4ZUWB 1ZPUA 2WQAA 5IW6A 2D7TH 2EDMA 2ENPA 3PHQA 4NX0A 5DS1A 4GMSH 4X6DA 2J1ZA 1ZJBA 3C6LA 4BFNA 4UYPA 4N26A 1ORQA 1P7QB 4APQB 1SLWA 3ARBC 2X4UA 2XPGB 5AG8A 2AV7A 1EZUA 2XG5A 3LV3B 6PAZA 1HL9A 2Q7YB 3T2LA 1OSEA 2F5AL 5I5IA 4H0IA 1NL0H 4NN5C 3RAJH 3O6LH 2YO3A 5GIRB 2XA3A 1G0DA 4M7JH 3U36B 1Q0XH 4YXHL 3GXMA 4OGAD 4F37K 5EC1B 5C2BL 3B3IB 2B20A 2G5BA 2XWBB 3L1EA 3PDOB 3EUDA 1TU2B 5E95B 4Q74A 1ETZA 3MGOA 1KB3A 3KPQB 5E2UL 1IBFA 3NA9L 5F1KC 3RQ3A 3UZVA 2JIXD 1H9VA 3WXWL 3EJPA 2X1OA 4TQIA 1UZ8B 4JZOB 3RHWK 5GS0C 1C16A 3CVBA 4UM9B 3K6SA 1SHMA 4L5FL 2YFNA 3KR3L 1IEHA 4G6JL 3BPNB 1L6PA 1W72A 2YAQA 2Q9OA 4DP9X 5HDBF 4G8IA 3L3GA 4Y1AB 4FQQA 2BNQD 1VGEH 3HZMB 4NPJA 3L3KB 3A23A 4OR1A 4P48A 3MOBH 2DOCA 5JOPD 1VZIA 1QO3B 4YX2H 4APQC 4DP5X 4WSJA 1RIUH 3PQYE 1KYOK 1MDTA 5EOQL 1ZGLP 2G5RA 2XWTA 4TVPH 3FB6A 3AJ7A 3EO0A 3MODL 1QBBA 2WD0A 2WLMA 4M48H 2IPKB 2IWEA 1P7HL 4EXPX 4AYBA 3HN8A 5C07E 4HUMB 3DVGA 1BVNT 2KDGA 2TAAA 3AS3A 3SBPA 3IGLA 1BLIA 1WO2A 5D7IB 2J8UA 1MXGA 4BH7A 3LN4A 1LE5A 4PB0H 4KXDA 4RAHA 1SJEB 1E8ZA 1IT9H 1WYJA 2WUBH 3RWCB 4G7QB 1FL6A 1SHWA 3BPNC 1VFBB 2UXTA 4HAKA 4OV6F 4IDJH 4XPGH 4ILDA 3SDAD 3Q6GH 4EI6B 1YCSA 3UYRH 2GJ6D 3K4ZA 1BQLH 4AENB 1QTPA 3NJKA 1U36A 2A4EA 1BXVA 4H7VA 3D69A 2PP8A 3HC0B 3SQRA 2OYLA 3EO9L 3HCVB 3LMJL 3HI6L 3QUMB 4LNVA 1FZKB 3HMXL 5K9KA 4E41B 1I9JH 2EAEA 3OR6B 4JM2B 4X2UA 2VLJA 1QD0A 5EIIG 2IFFH 1KUMA 1MW2A 3CH1A 5T1DH 2GSMB 5DHYA 1BP3B 2P80A 5C09A 5IOKA 4EDXA 1YEFH 5AZ2L 5E23A 4I9XA 1G7JA 3PWLA 4JZJA 4PJIE 3TZVA 5L8JB 1ADQA 2F15A 1SYVA 4BK5A 3UPRA 3WIHL 3HNTL 3OTTA 1KJ3L 3G6DH 3MLTA 3GMMB 3KBFA 4HC1A 4JVWA 4TUOA 4AYID 4NNPH 5EPMA 2O61A 1NUDA 2R15A 4WWOA 1CQYA 2VGLM 4Y9EA 1TVBA 5E51A 3NACH 4LLVA 2XZCL 5D6CA 4KAQL 1WEJH 5AEAA 3RTLA 2XYCA 5G55A 3UGEA 4XP1L 4MQ7A 1JK8B 2FIKB 3A6BH 1IQWH 3NRQA 3KPNA 1FO0H 1KXTB 3EZJB 5FDWB 4CILA 1WK0A 4JM2C 3V5DA 1GGUA 1ASOA 1XH2A 3QFDB 2ADGA 1IB5A 5MEQA 3KWUA 3QUHA 1D9KA 4JG0L 4MD5A 1C5CH 3PPEA 4U6XA 3MMEA 5KBDA 4GSUA 1BJ1H 3VXSB 4L3FA 4O58L 2IANA 2YD4A 4BCYA 3UIZA 4OD2B 4BFEA 4J3UA 2YLHA 3KGRA 1BZ7A 2I25N 4DT2A 4BXVA 2YFOA 2D8KA 4EUPA 3EYQC 1S7QA 3S5ZA 5DC9B 3VI3A 2ATPB 2IALB 1GJUA 4NSKB 4QO1A 2BW5A 2YD5A 2Y1ZA 5FEBA 2MQGA 1Z9SB 5BUPA 4PH8A 4RFOL 3IFOA 4Z7OF 3UTPE 1NEZA 1QTSA 1OM3L 2C3GA 2XV2A 1UJ3B 1UURA 2ZYRA 4Z23A 4GUQA 1RZIB 3F01A 3W3BA 3MLSL 4WTWA 5E6IA 2CG9X 4XBEH 3V8CA 4H1LG 2DB8A 3GGWA 5J9PB 5DGRA 5AOLA 2PWDA 5JHLA 4U49A 2Z9TA 1GTNA 4U3SA 1YYLH 3SN6N 3UG4A 5FOBB 5FKAA 3A4EA 1B4JH 5F9OH 3UJIL 4Y9BA 1I1FB 1Q8MA 3Q01A 4Y2LA 1UD4A 2P47B 3MCKB 1S2EA 4LHQB 3BKYH 4DHLA 1J1OH 5C0JA 2EDOA 3L3JB 2PO6A 3QJHB 1NC4D 4HZLB 2QELA 1F58L 2QGBA 2AZAA 3W2DH 2I07A 3NFPB 3GO1L 4DIXA 3HVNA 4BSVA 3NJLA 1FVCA 2QTVA 1UJ3C 3VXTB 4F7CB 5CIPH 2OJEA 3APNA 1KXVA 3FL7A 1E5AA 3GSNB 2J20A 2BMKB 3PP3H 1QFUL 3VFMA 5KVDH 3GI8H 4XVUC 2J71A 1PIFA 2ZNWA 1FZMB 4ODHH 4TSBH 2HLFD 4JRXB 4PRPB 2DD8L 3P3YA 3OJ2C 4GXVH 1G9MH 2IQ9L 3WXWH 2WAHA 4GBXD 1UZ6E 2BHZA 5AZUA 3ABLB 3MO1B 2WXMA 3SBRA 3GRWH 4WNJA 1ED3A 1QLRA 4UAHA 1TNMA 5F7MC 2O6DA 3QUZD 2COQA 1R3KB 3K5SA 3QDMB 2TSAA 3PL6A 2JI2A 4W9FC 5AOIA 3D33A 5EFIA 5EU5B 1MAML 5IBTL 3MRGB 2VDML 2F19L 2WWMD 3ABMB 3MLVL 5DMKA 4DK3A 1IFRA 1AZVA 1WGVA 1YNTF 1I8IB 3HAEB 2X89D 2X4PB 4JGUA 1CCZA 2EKSB 5IGXL 1OF2B 2APFA 4NUJB 3V8OA 2ZCLH 4TLUA 1EEZB 1FNGA 3D39B 5GSRA 4ZTPL 4S2SB 2YXMA 2AJXL 1LD9A 2PCPA 4UZGA 4DZBA 3STZB 4P9HC 4KKLD 1ZT1B 4JHAL 2WCSA 5E9DB 5FO7B 5J6HA 2WWKO 4Y16B 4CN4A 4LZKA 1G9NH 4OZFH 4H2AA 1U8KA 2V4LA 1NCTA 4MJ5A 4J4PA 4C56D 1S9VB 1M57B 1BFTA 3UBGA 1CWVA 4FFZA 5D5MA 5IB5B 5BUAA 4H26B 2OR9L 3DTDA 2W94A 2D31A 2IBBA 4FYTA 1UA6H 2ZCHH 3NABL 5E4IA 5KBLA 5DF0A 1FNHA 4JE0A 1PLGH 2PYFA 2HH0H 5C08A 3SYCA 4X7CC 2VLLB 4HH8A 3U0TA 2CBPA 5IQ9A 4DQOL 4PWEA 5I1HH 1GC1H 1LQBC 2X4QB 3BO8A 1Q1PA 1KELL 4PLJC 2WQRA 2JTDA 2VE6B 3GMPA 5AYUH 1EHLL 4UTBL 2EYRB 4I77H 4KVPA 3ZE0B 1NGWA 5EUKA 2YPLD 5TPWL 3II3A 4Y16C 4DN4H 4JG9A 3ZE2E 5A40E 4M9OA 8CGTA 5I30H 5CEZH 2F1BA 3WIHH 1ZV5A 4U0QB 3WO4B 2WQ8A 1FFPA 5DDHA 1KIRA 1Z3RA 3KBPA 4JFQB 5DJYA 1FVDB 4IBUA 4GQPH 4CC4A 1FYTE 1R5WB 1X9RA 3HTLX 3PWJA 4KAQH 4L4JA 2VSKB 4PV9B 1P6AB 1YA5A 1U8JA 1XF5A 1G7MA 2DY2A 4TNFA 2VQ4A 2H1PH 2JXMA 4NZUL 3DGDA 2BSDA 2PF6A 2XPZA 5C0EB 1XZ0A 3IGFA 4BCZA 2FEDD 4GRWB 1S3KH 1G7IA 3BVXA 4ACTA 3QFJD 3TBVB 1BCIA 1XHHA 2C1OA 4XBPA 3GIZL 3UAJD 3LKOA 3O4LB 5KYYB 1A4BA 1YNLH 1OSZB 3K8LA 2DQHL 1IIKA 5I1KL 3E0GA 3V0VA 3RWDB 4XVTL 1YLBB 2DPKA 2NZIA 2Z65C 3H3KA 1PG7L 3MBWB 4DGVH 2X42A 1B0WA 1DUYB 3JUZA 5BV7L 2WUCH 2FQEA 4XAKE 1I8LA 2MQ3A 1NDTA 3QXVA 3PFQA 2Y36L 5DWPA 1HHIB 3GEFA 3MLWH 3PG2A 1OM3H 3GB7A 1CFMA 2JCCF 3VJ6B 1QSEE 3QYCA 4GXUM 4IGBB 3V0WL 2WZPD 3O9WB 4G6FB 4MJIB 2F18A 1JPSL 1UH2A 1WBXB 4J3XA 4MZIA 2XZAL 4N3TA 5DEZA 4IRZH 3G6JE 3HBGA 5IBLD 5FYKH 1OTSD 2JIXA 3BMWA 4TRPH 4YR6B 5F7FA 2E8ZA 3PGFH 4MDJA 4CADA 1X4ZA 3BYYA 3H3PH 4HEPG 3UJIH 3DHUA 3F84A 3G08A 4OIBA 5KYXA 3QT2A 4AIOA 1RFDH 1MZYA 2BNQA 4GRLD 2WIMA 4DOHB 1XVSA 1QHQA 1U3NA 3FYEB 3VFOA 5IJKC 2VQ1A 2AV1B 5SWZB 2PKDA 1SVBA 3P9WB 4N6RB 3GM8A 2BK8A 1QPKA 3MUJA 3KPLA 5EUOF 3N44B 4X8JA 2NSXA 2AW2A 1F3JB 1T89A 2VDLB 4AGLA 2IIJA 4HETA 5EULV 3S4SA 4IGBC 4LOUD 3EFDL 3FCSA 1EAOA 2C9PA 5EU6B 2PPAA 3O9WC 2FSEB 5DYFA 1QFUH 4TNVK 2BP0A 4HGKC 1DBJL 3G5VB 4MZ2A 4WI6A 5JW4Q 1AS6A 1E6OL 2SODB 1UT2A 1K8IA 2ITCB 2BRRL 2HT4C 3ECBB 5FYLH 4GRMA 1P4LB 4JE4B 5AVZB 3SPHA 3T0WA 1ZHLA 3FO2B 1QEXA 4XOAA 3O3AB 4UAOB 4XPAL 1XAUA 2L7EA 5IQ7L 3QXDB 2L4OA 4L4TB 1MWOA 5EU3B 1CDHA 4IMLB 1LJMA 2GJ6A 3C75A 1MCQA 2UZXB 3ESPA 4YVUA 5C0BD 4AEFA 4RMBA 2XWCA 5HJ3A 1RZGA 3FXIC 3UGUA 1PZDA 2N0MA 5GRJL 5IBTH 1VGKA 2VDMH 1QWHA 2F19H 1BDYA 3MLVH 4QIRA 4AUYA 2HYMA 2ZYHA 3OXRB 5IGXH 1AZRA 4UOW1 3H9SB 4N2LA 2F53E 5HDOA 3C5JB 4UIKL 3RFZB 4PJAE 2QDWA 1AGDA 1MAKA 1OP3K 4KROD 3DHMA 1ECZA 4TTDC 3S36L 4HS8L 2I32A 1DJXA 4OLUH 2B5IB 3H4FA 5LG6A 1TTUA 3O8XD 1PMYA 3RI5K 3ZKMC 5C9JA 2EZ0C 4NO2A 2HFGH 3DGGA 3DWTA 4RAUA 4BK4A 3WKYA 1S7UA 4UAOC 5J56B 3CDZA 2QQLL 5CP7B 5HHNB 3PDDA 4Y7MA 3QRLA 1RZKL 4UOW0 1BPLB 3FQUA 5D9SB 5B1AB 4R26L 4LASL 4WLCA 4YC2B 2WLHA 3ILPA 2WXLA 3VNYA 4HUKB 1Z3GH 3ARPA 1I8MA 4NN7B 3NABH 2AFNA 5I8EA 4DQAA 2VJ0A 4U1HB 4U1NB 1AXSA 1LMIA 4UANA 1QACA 2A6JA 2DH2A 3RFZC 1CFNA 4RGOL 1MF2H 5C7ZA 5G4OA 1G0XA 1OD7A 3D4CA 1KELH 3FSOA 3GPEA 1VDGA 3JBG7 1YMHA 2XTJB 2VDPB 5L4MA 1E4KA 4NUMA 3WLWD 2B5IC 2X3AA 3DXAB 2WO4A 5J0BA 2GFBA 2Q0ZX 5FO8B 1OSYA 4NBYB 3I74A 4HF5L 4JFOB 2LVCA 3ERXA 3N0PB 3Q1EA 4FFYA 2ZX9A 2BVYA 4TSAL 5CJBA 1AOHA 3H85A 4YC2C 4XPFH 2QDVA 3TPUA 3S5LG 1EGJL 1UZGA 4O02L 3OKEA 4HUUB 4NN7C 3LRLA 3TWCL 1KYUA 4TS6A 5HI3D 4TVPD 1QSZA 4LCWE 1GZQA 5IT2H 3CDCA 1A1MB 3QARA 3K71A 4E9QA 2OM5A 3AZUA 4H13C 2QFRA 4CSSA 3UPAA 3WN5B 4I2XE 2XTJC 1KG0B 3LB6D 2CIIA 2X05A 2DQHH 4XHJD 1WIPA 1A4JB 1HEZB 3CMGA 3EJUA 5SX5K 3OKMB 1HH9B 3AUWB 4G1EA 4KK6C 3NTCL 2J8HA 3QQXA 3T5WA 1D2OA 3ARRA 3IRCA 5EO0A 2FGZA 2V3DA 4MYPA 5BV7H 3WJMA 2BY1A 3IFPA 5DJDB 1JZJA 3OC8A 1ZEAL 4N2OA 3CFDA 3TYFB 4QPEA 4BELD 2AEOA 1I1CA 1DQLL 3DRQB 2BOCB 3CVHB 4Z3FA 3FFCB 3OSVA 1GPOL 5E2WL 3T0XA 3HG1B 2AKRB 3K80A 4NBZB 4XXCA 3V0WH 3NCJH 4D0CB 3S96B 3FT4A 3RL1A 3E80A 5JXED 1JP5A 4PRDA 3WN5C 1TFPA 2NR6C 4OCWL 3QJQB 3US9A 5AAMA 2WP3T 1G6VK 4GBXA 1RZJL 2CLZB 4FKKA 3T0ED 3ULUC 4Q4IA 1XCTA 2C9VA 1L7TL 4NKMB 1OPGL 3PIQB 3TBTB 2A9MH 2VXSL 3OKNB 4NYLB 4MAYA 4HBCH 1GYAA 3FB5A 3MGAA 3V4UL 3F6LA 3QUZA 3G6JA 3MRCB 1TENA 2WZAA 3U82B 1MCBA 2PCXA 2OJZL 1ZLUK 4ZPVA 2HPTA 2PABA 1XSJA 5AB9A 2BNUA 3X14A 4QXVA 3HR6A 3D48R 2UYLA 3CZGA 4DVRL 3VX0A 4JJ5B 3WMSA 2I9LB 1DBJH 4MGXA 2L7JA 3CCHB 2DM4A 3D06A 4GSRA 4U1JB 4I89A 2P28B 1TMCB 1N0XH 4L9LA 2IXQB 4OZFG 4JO8A 3ZKSD 3SE8H 4ES9A 2GT9B 3QUGA 4OZ4A 2GCYA 4J12A 4WRLA 1HJBC 3B7RL 3POCA 5K9OA 2YMOA 4W9DC 5H4YA 1WBYB 4OV5A 3LPPA 1A3QA 3KPSD 2JKXA 1QSFE 5AWNH 4K4KA 2YSSA 4NRXB 4R3SB 3BEVB 1G6RB 4JHVA 1R3LB 2WGXA 3VTMA 4LBEB 5F6IB 4JO4H 2R1WA 4WW2A 5G4MA 4B9IA 3L4UA 1T21B 5GRJH 4F33A 5AB0A 3QZOA 4OIAA 4E0RB 4PWFA 4AYEC 5JIIA 5F1NB 4KY1H 1KB5B 1EPFA 5MERA 1Y6NR 3TJEL 2WXIA 3FU6A 2D3VA 4ZQTA 2R51A 2B1OA 1CFQB 1H15B 4UT9L 3VRJB 4H1LA 1FGVL 2ITEA 2CO2A 3QO0B 3CQQA 2YPLA 2OZ4A 2YD9A 4HIIB 4P23B 2XQBL 5J11B 5HYSB 3ZDWA 5EBGA 2HFEB 1U8LA 4LVNB 3PF2A 5MENB 5JIMA 5D7JD 1ZTXH 4XNXH 1E28A 4E42A 1AQDB 3NCCB 1RZKH 2W9EL 4PJAA 1ZT7B 2VIRA 5E0FA 3P1VA 4B41A 2Z91A 3K1KC 5L88H 5F6IC 3LDBB 3ULVH 4ZUTB 4HXAH 4LU5H 1O7DE 1OCOB 3VG9B 1OK0A 2IMMA 2EXYC 5T1LB 4B0MB 3GTVA 1T1WB 1Z9NA 3CFIC 3GS0A 4N25A 5E1IA 1K8DA 3I6GB 3TO2A 2O5ZH 4Q9BA 3QWOA 2Y1VA 3MLRL 1AR1B 3QFJA 1A7NH 1K6QH 4YIQA 4MA1B 3UAJA 4GT7A 4C54A 2IDFA 2GC7C 2QJDA 3MJ6A 3K8MA 3TWYA 1YMMD 4MDIB 2X88A 4KUCD 1FNAA 4P4RB 4P23C 5J11C 3MFGB 4AOFA 2ZAHA 4LVNC 5JIHA 4X9FA 3VSUA 2OI9B 1QBLL 1VSCA 2NUPA 4G71B 2BCMA 5H2BA 3EGSA 3NEOA 4MJ6A 1Y6KR 2QZ5A 2SEBB 2CK2A 3LDBC 2MPVA 1FJ1A 1S9WB 3W0WE 5SV3A 5KS9B 2XTLA 4F8OA 1N5AB 3GSWA 2E7DA 3VG9C 1EGJH 4O02H 4MNQB 3FO9B 3OR7B 3WENA 3DV4B 3TWCH 2YUWA 1OP3H 3NBNA 2WZPA 3PHQB 5HDRA 2VN4A 3VFVA 2JQAA 2LU3A 3C6LB 1AR1C 4JBSA 4X6DB 3SDXE 3LY6A 1ORQB 1QZNA 4MA1C 4KX8A 4GSDL 2Y3AA 5F88A 1Q1JH 3KYKL 2QSCL 2AV7B 5K59F 2XG5B 1S7WA 3CBKB 3EJYD 4MJJA 5EBMB 4JY4A 2DQJH 3WTWA 1AY1H 3NT0A 1RHFA 1A65A 4GRLA 4XMWA 2OI9C 4EDWL 4X4ME 3T3PB 1MVFA 2X1PA 2G2RA 3I9PA 2G5BB 4RGND 2VL4A 1G0YR 1WFJA 5IVNA 4I3SL 4H5SA 1KJMA 3GXIA 1ETZB 3MGOB 4Z7UA 4JPWL 2J7LA 5TGBB 1G7HA 3UZVB 2ZICA 3FHQA 1N7MH 4QXGL 3LNGA 3AS1A 1AC0A 4IM8A 32C2A 2NT1A 1C16B 3ZYIA 3FRPG 2XXMB 1H6TA 1A9EA 1GPOH 1W72B 3HG5A 1RZ7H 1R5IB 2ICES 4G8IB 1DE4A 3F3HA 3L3GB 4FQQB 2H6UA 5BRZD 3C6LC 3MZTA 4P0DA 3BPOB 1KJVA 3IGUA 1D5IL 5E4EB 4ZW3A 1XGTA 4UOQA 1HI6A 3BISA 3FSZA 3F58L 3ASWA 3EIFA 4C55A 3FB6B 3EO0B 2DQMA 1JZ8A 2VAJA 1ZANH 1HU8A 1L7TH 3BSZH 4XC3L 4G8AC 1T7WA 4MCYA 5CEZD 1UGNA 3P54A 4OVUA 1U8HA 2VXSH 4DP8X 2CPUA 5LGHL 3ZL4L 3V4UH 2P5WE 5FYJE 2K70A 3KLHC 1D6EA 4M5ZH 3RX8A 1LO3L 4DWHA 2OMVB 3E6HA 3PNRB 3QQDB 2IH1A 1AOZA 1LE5B 2DM7A 4WHTB 1FL6B 5HHVH 5I1GH 1A6AA 5A2FA 4O2CB 4QGYA 5TF1H 2R2EA 4PBWD 1CBJA 2VSDA 3QISA 5C8JB 2GIYA 4DVRH 1A6UL 1I8KA 3BPOC 5T3XE 2CJUH 5SX5H 1TJMA 3BP5A 4GG6F 2EDQA 5E4EC 3D69B 3QI9D 3VB9A 4ORGA 4QT5B 4BINA 5K9KB 2GUYA 2PWGA 3PGCB 2LLGA 5C6TH 2EIEA 2VLJB 3V6OE 1BQRA 4ZO8A 3AG1B 3EO1A 3CH1B 1D6VH 2BWDA 2AAAA 3UBXG 4R2GD 3N85L 1ETB1 4HIHA 3LS4L 1CDBA 2DQCH 1HCYA 3GSQA 1G7JB 1T5XA 4ZPTA 1GKOA 1JF5A 1EAJA 3JWNH 4JZJB 3ZDXF 3QULA 4LPVA 4BXSV 1L9SA 4V1DE 3QW9A 1JN6A 5ENWB 4BBWA 4HEME 3MLTB 2EDDA 2ZX7A 3EJZC 3MV01 4LGRB 5DURB 5E94A 5EPMB 4G7SB 2O61B 2IBZX 2ED8A 1XGPA 1DFBL 3DUUA 1FFNB 1WHPA 2N1TE 4LLVB 5D6CB 1WFUA 5H37G 4Y4FD 1CC3A 3WFDL 5JIDA 3NAAL 4WKXA 3FQYA 3KPNB 4KZCA 2P5ED 2XQBH 5DUBA 3KJ6L 2W8CA 5FWQA 3N1FC 1UB6A 5MEQB 1VPOH 2WYHA 3M6DA 2VAAA 4IEFA 1ZLUH 1D9KB 3IDJB 4MD5B 4FZEL 4D9LL 4U6XB 4S1DC 3MMEB 4QOKE 1ZV2A 5HJBA 1RUAH 4PP1C 2ZKXA 4JZJC 4RNRB 2DWXA 2IANB 3PAZA 4BK5C 1WIUA 3T2NL 3IU3B 5HHMB 1DQJA 1IBGH 1SJXA 1BZ7B 1T7YA 3NH7H 2AJ3B 1BF2A 1MFDL 2H6PB 4EUPB 4YHML 3NIFB 1S7QB 4N8VA 4NQXA 3VI3B 1E30A 3MYJA 4QO1B 4NQDD 4MTMA 1KEML 5CGYC 4LK4A 4D3CL 3MX0A 2C9RA 4HWEH 1C8QA 2VJXA 1NEZB 4LPWA 3L3OA 1BFVL 4I3GA 3OPZH 4KNQA 4OLZL 1V7MH 4ODSL 2UY6A 5ANME 5E6IB 1Q9WB 3KWXA 4YSRA 4ZFQA 3RVWC 3GGWB 5KSBE 1QBLH 2CO1A 2DYRB 4O00A 4U3SB 3NCYS 4UZSA 2BIIA 1D9KC 4KFMA 5D4IA 5FKAB 2YPKB 1IJNA 1IQDA 3ESOA 2JJTC 1KTCA 5SWSD 3ZVVA 5DR5H 3AITA 5BRQA 4Y5XA 1YY9D 3GT6A 5ELIA 1OP5K 1B90A 1ITCA 3PCYA 3AY2A 2PO6B 2MQCA 4AK1A 1N18A 4GUOA 3CZUB 4WEBL 2VSMB 3CVIL 2J56A 1V8HA 4X5WA 4GSDH 4QF1A 4HLJA 4GQZA 3MRMB 4RAVA 3SE4A 2I07B 2GK0A 5BO0D 1SMOA 5KBPA 3L4TA 4LSVL 1DO6A 1FVCB 4E2OA 4CU7A 3L8QA 3T0EA 5E6IC 2OJEB 1TETL 1J5IA 3WFHA 1L0PA 4AEEA 1MWAH 4HG4J 5CR1A 4MQTB 1ZS2A 3VFMB 1E9QB 1WPCA 1E8YA 3BZEA 2PP9A 2NY3D 1FZJA 2F9BT 3SDXA 3CSBA 2AGJL 4OCNC 3T8VA 5C0RH 2VXVH 4I3SH 3MNZA 2BSRA 4JPWH 1XH1A 3NIGE 3ZMRA 5I1IL 2AJYH 1JCVA 5TDPA 5AQ0A 4WGVB 4XX5A 1FO0A 2FHCA 3IAPA 3MUZ1 1OGAE 5I8KL 1YECH 2XQYG 2WCGA 5EOCH 3ZN6A 2PO6C 5F7LB 2Y6TE 3KPMB 4ZUVA 3SE6A 5AG9A 2ZKYA 3GS7A 3PL6B 1HYSD 4YSAA 4AVHA 5EFIB 5LLIC 2VDRB 1LWRA 4TNEA 5DMKB 3IU4H 2NX5D 4NDMB 3NFSL 5HI5C 1IAOB 1RUML 2X4RB 4YL4A 4KPHL 5F7AA 5C0GA 3HNSL 3CZFA 1FNGB 1ITBB 1HC1A 3KPSA 4K23L 4XC3H 5AVYB 1LD9B 2E86A 2PCPB 3LHAA 4CVUA 2ZF9A 5LGHH 2VISA 4DZBB 5A2AA 3MXVL 1GL4B 4M8UA 4P57A 5FYKE 3CFNA 5T1KA 3PQYB 1OM9A 4U1MB 2DLHA 5ETUA 2RHEA 1LO3H 5J6HB 3B2DC 5E8OA 1FGNL 2E56A 2FEEL 3RVUD 1J0IA 3CQFA 4MJ5B 4CDGC 3LZNA 3WTUA 3KLAB 4OLVL 1KSRA 3MNDA 1OQOA 2W65B 1CIUA 4Z9KB 2K9UA 4RZCA 3IK2A 3PL6C 4GY4A 4P2QA 5H8DA