3D33A

Crystal structure of a duf3244 family protein with an immunoglobulin-like beta-sandwich fold (bvu_0276) from bacteroides vulgatus atcc 8482 at 1.70 a resolution
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
101
structure length
94
Chain Sequence
PVKDVELDGRWDDNCPITVFTDGYLLTLKNASPDRDMTIRITDMAKGGVVYENDIPEVQSAYITISIANFPAEEYKLEITGTPSGHLTGYFTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Domain of Unknown Function with an Immunoglobulin-like Beta-sandwich Fold (YP_001297618.1) from Bacteroides vulgatus ATCC 8482 at 1.70 A resolution
rcsb
source organism Bacteroides vulgatus atcc 8482
molecule tags Unknown function
molecule keywords Domain of Unknown Function with an Immunoglobulin-like Beta-
total genus 16
structure length 94
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11589 DUF3244 Domain of unknown function (DUF3244)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3d33A00
3SD2A 3D33A 4G5AA
chains in the Genus database with same CATH superfamily
1TZOA 1H8OA 1MHCB 4H44C 5DJ8B 1FNEB 3QQDB 1RHHA 3MRGB 1QBBA 4POZC 4MJIA 4YPGB 4B9CA 1FRGL 4I88A 1DLFL 2GW5A 3OQ3B 5T1DH 1BIHA 1DSFH 5FKPB 4H8WH 3UPRB 5AZUA 3PGCA 3ARDA 4RMQA 5DRXB 3NJNA 4XP4L 8CGTA 1CR9H 1OAXL 4POZD 1EGJH 4W9GC 2X6UA 4UM9B 2P5WB 4KK5D 5K9KA 3DYMA 3QNFA 5FYJU 5DEJA 1SXSA 5E4EB 2KQMA 3BUIA 3OAWA 2WWMD 4RFOL 1KN4L 1Q72L 3QIUC 2XWEA 3K0WA 2F0CA 4K5MA 5HHME 3OKDB 3K81A 4PJGE 3V6FA 4F3FA 1KLUB 1WD9A 4ZO6A 1YN6A 3QQ3A 3QIWB 4XE0A 4RA0C 1TVHB 1EO7A 1FYTD 2WWMC 1PZ3A 2MTPA 3BD5A 3GO1L 2ZCHL 2DJUA 2P8MA 2C3XA 5EU7E 4HBCH 4C56D 4X8XA 1FBIL 3D87B 1MCFA 4Q0XL 5C0GA 1YAZA 4L48A 2DQJL 4OI8A 4UDUA 4YBHA 4ODUB 1EDQA 3MBWA 4FG0A 1UA3A 1XH2A 2DMCA 2B15A 4Y9EA 1A1NA 1NCTA 3OPZH 2VDPL 2H2PC 1LMIA 1T3FA 3F7VB 4LKCA 3ARFA 1X5GA 3WNJA 1OB0A 5L9DH 5ICXA 2DLFL 2PWDA 1MRDH 2GUYA 3I2CH 5MEOA 5CD3B 1CLOH 2KS0A 3CFNA 2ED9A 3L5XH 3QFDB 5HJ3A 3OKOA 4TYUA 4IBVA 1J0HA 3L7FA 4HUWB 1MFAL 4A63A 1EPFA 5E6IA 1EHNA 3L08A 3U2SA 3SKOA 2NYYC 2AQPA 2F53A 2OMVA 2O61A 2J88H 3U1QA 25C8L 1E9QB 4Y88A 2C7FA 2CGRH 3BE1L 1TLKA 2HG5B 3FQXA 4J4PC 4FXLA 3SDAB 3NCJL 1KENL 1NKGA 4QRPA 2F15A 3N44F 5FPIA 5GZNC 3LKRB 3OF6A 2XTJC 3MRKB 2PETA 4QGYA 5I1HH 1U58B 2E59A 3LKQA 4DP5X 2BNQB 4N6RB 1CICA 2O93L 4YDJA 3LKPA 3CHOA 5D1QA 4PRPB 5DTFB 1ORQA 1YUHB 4LP5A 3VW3L 2ZKYA 2V3DA 2BC4A 4N6RA 4QRRB 1TPXC 1PMYA 3VG9C 3LQAH 4GI6A 1W8NA 5IF0B 5DLML 4BHUI 1JG9A 3MRQA 1EV2E 4BK8A 2X6CA 1DJSA 4JB9H 3TBWB 4J8QA 3FRPG 4RFEA 4XWOC 4AJWA 4QNPE 1Z2KA 3F7PC 3SDAA 3ARDC 4ABWA 1C8QA 1ONQA 2BW4A 1PZBA 3DX8B 5C08A 3WE6A 5L2KD 2CXKA 3HPLA 1GGUA 1ZA3A 3LYRA 1ZVNA 2QR0A 5D6DA 1GJIA 3GIZL 1JXFA 1BIIA 2E9BA 4FFZA 3K1KC 2C3HA 3V5DB 2X9WA 2EDYA 3A22A 1AIZA 1TQVA 3L5WA 3MRPB 4OGAD 3FKUS 1MCHA 3Q5TA 3RBGA 3DETD 5B39A 3QFJD 1NGWB 4LLMB 3KBFA 1RJZB 3QULB 1IFHH 2FLRT 4BQBA 4JY4A 1MAJA 1ZHKB 3PXJA 4WY7L 4DK5A 4OFYD 3MBWB 1YRKA 2NYKA 1DN0A 1JTTA 1IRAY 1ZVSA 3IBEA 4HUMB 4KY1L 4OFVA 3QWRA 2H47C 4XZ4A 2K7PA 3EKCA 3B2VH 4AE1A 4L5FH 2HT3D 1W9XA 2HFFB 4NO5B 2WB1A 4AEIH 2WWKO 3ASWA 1FFQA 3V0IA 3MCG1 2F08A 3ZKMD 4KV5E 4QHNA 2COQA 4JE4B 3AS0A 3O9WA 4MMXC 4S0SD 4Y5XB 5KS9E 2VXSL 3SBQA 3EJTA 5I0YA 3EGXA 2IANE 1IGIH 2QSQA 1P4LA 3K71A 2EIDA 2VUYA 3QXVA 2EEDA 1T1ZA 2N01B 2V3FA 3GBNH 3M46A 3U9PL 3SPIA 4EN3C 3MV7D 5KYNA 2DMHA 1TTBA 2UXFA 3ME0A 3VD4A 2CPUA 3LRKA 3VDBA 1S7RB 3EFOA 5DMGD 5HD8C 3GUTA 3TBBA 1QA9A 4WF7A 4TOYH 1HWHB 5KOVC 4G5ZL 3U7WH 4LRNL 3S9DB 4PBDA 4MLIA 4ZAKB 2CDFA 4B7IA 1ZHLB 4XNUL 2ZP0T 1DJZA 2KH2B 4MJIB 5KANI 1EO8H 4MDIA 4O2CB 3BPLC 5IROC 1MCQA 1JFQL 3FTGA 5H35A 3L5IA 5D5MB 2EJ1A 1JWMB 4G11A 5C2BL 1MJUL 2A77L 4W9FC 4N9GA 2FL5A 1ZLVK 4MA7L 1AKJA 1OP4A 1O0VA 1M42A 1J1PL 2P47B 5HHMB 3UYRL 4BZ1H 2BWIA 2NY7L 2X7LB 3K4DA 4V1DD 3BGAA 2ADJA 4ETYA 4NENB 3VA2C 1DUYA 2ZUTA 1MVYA 3BXNB 4GXUN 2IV8A 4N8VB 4JQIL 3WFBL 1NBQA 5ID0A 1T4KB 2EO1A 2NY6D 1A5FL 2EYTA 4OCYL 1SF3A 1HZLA 1UWEL 2B16A 3KPMA 5HYIA 3WDHA 1HKLH 1I9RH 1EMTL 2HXAA 2CIIA 4KMTL 4P46B 5D93C 4C83A 4OV5A 2W9DH 4AYFB 3EHBB 2JK5B 4YDVA 4MJID 3LB6D 1A66A 4LAQL 1BYOA 5EN3A 3TJHC 4J3UA 1NIBA 5J3HD 4S1QL 2NRDA 3IMSA 2H32B 3BPCA 3RVWD 5IP4A 4JFDD 4YHZL 4BD4A 1KTCA 2D3JA 4KRPD 1U3HD 3MLVH 3L3HA 1T4WA 4HUVA 4FLQA 4AUYA 4WW1A 3GRGA 2YPKA 4NHUB 4OBSA 3UROR 1HOCA 6PCYA 3Q2CA 5D7IE 1UATA 3LD8C 3MLZH 4TLKA 4HA1A 4U33A 5I0ZA 3TYGL 3EJYC 2AW2A 3GKWL 4L9LC 3QUXC 5EZLA 5I1EL 2XVBA 4NKDA 5HDBE 2YARA 4X8JB 5F9OL 5BZDB 1UD3A 4P2CG 1X9RA 2P80D 2YOAA 4E42A 3ARYA 4PJ5E 2KC0A 4FXTA 4YC2C 4Z3EA 3KPPA 3TF7C 4LLYB 5HY9A 2MQ0A 2VH5H 4DEPB 1FHGA 4EE2A 3O2WL 3IDIB 1YEDB 4FL4C 4H20L 4MYWB 4K4KA 1GIGL 3QXDA 2VDQH 2B8OT 4L3EA 1PQZA 5JPMC 2XN0A 4JPKH 5DWUH 3SODB 1L4IA 4LEXL 2UWEB 5FYJE 3GZPA 4UQ9A 1IGCH 1X5FA 2ZJSL 1ETA1 1DYZA 4KK6D 2NY4B 2ZX7A 1FE8L 1IIKA 1Q9KB 4NPJA 1M1XB 2FSDA 1U9KA 1F6AB 2P26A 3M86A 1XGTA 5GJSL 1IVTA 1L9QA 5L8JB 3P4OB 3BN3B 3KNBB 3HPJB 3SDXA 2VITB 5D7SH 1WS7A 4P5TC 4YSUA 1MKFA 4BZ2A 1K8DB 1T2QH 2FEDD 4N68A 1Q38A 1G1OA 4KNTA 3CFKA 4OJFH 2EYSA 3X14B 2V5YA 1T2XA 4KTGA 2GBUA 2BINA 3KDPB 3IS1X 5FGCB 1KV7A 1WFMA 2Y36H 2GSIB 1QX1A 2QQKH 2A9NL 4FFYL 2XICA 4TNVK 3V4PA 4DESA 1VPOH 5BS0D 3TU6A 1PSKH 3IS0X 4JUTA 5DHVA 1B90A 3VO0A 1PD1A 4MKMA 1GOHA 4YHIB 4KJQD 3J7HA 4RAVA 1E2ZA 3KW7A 4TNEA 1ZV2A 1ICTA 4X8CA 1AQ8A 3O2VH 4WCYL 3S34H 1MY7A 5DC2A 4ZJ9A 4JLRB 1D5BB 2MQ3A 4J3OD 2QFRA 4KJQC 4NYLA 1IX2A 1RK0A 2AAVA 1IEAB 1XF3A 2B1AH 4O9HL 3WFEH 5J7CC 3S3BB 2AQ1A 2DBJA 2ENSA 1FG2B 3DECA 1MCIA 1GPOL 1AJ7H 1G7JA 1Z3RA 3JV6B 5IVOA 1IAKA 1CFQA 2JB6B 3TYFA 3NFSL 4ZMZA 3GM0A 4P99A 4HIHA 2HT2D 4GAGH 3EOBA 3O4OC 1JGUH 4AVHA 4AY0A 4BK5A 1OP3K 1JTOA 3L8QA 5F9WB 1JZ2A 4PY8I 3B2PA 1JZDC 3BP5A 5AYUH 1WUNT 3BH9A 2KI6A 3O6FC 4EZMA 4NO2B 1PLAA 4WGKA 3KGSA 2XJKA 3LH2H 2RIKA 5HYQA 4MHHG 5EOQH 2ATPB 4QXVA 3BQUA 4YJZL 3GI9H 5C97A 4LASL 3QPXH 4PV8B 3UPAA 5C0IA 3F2LA 1W72L 2GIXA 1MFCL 4JCLA 4AMKL 5C2BH 3GJFH 2IQAB 2A77H 2AJZA 4XPFL 2AMUA 3STLA 5IUSA 2FO4A 2J1ZA 5D2NA 3PPSA 5BMFL 1OF2B 2E6JA 4B96A 5J1AA 1E6OL 1KTJA 1A7PL 2BOCA 2BVEA 4FJYA 4J23A 2IAMB 1MH5B 4UZUA 3ARVA 2VLLB 5EOCH 4RGOL 4M8UA 3PL6B 3C5ZC 3RDTD 3CHRA 5TQ0H 4BJLA 3ILDA 5I8KH 1IGYA 2GJ6B 2N3JA 2X4OB 4YDLB 5GZOC 1ND0B 5CEYA 4XN7A 4PWGA 4B41A 1EZVY 1UOWA 3T0WA 2A9AA 4ESKA 1BVOA 3T4YA 5F89A 1LP9E 1KTRL 2E7MA 5DQ9A 4M1DH 1I9RL 3D07A 2ADFL 4CVZA 2VC2L 2GBTA 1MFMA 4OZHB 2YAOA 3D0AA 3H9SB 1MWAA 3P0VL 1RFDL 2PW1B 3AXLA 2QGDA 4G8EB 3IU3B 4PHZA 2YO3A 4P2QA 5IBTH 2VAAB 5LXGH 4HKJB 3LIZA 1VGKB 5MERB 1DVFA 3FRUA 3X2QB 1PAMA 4OGYL 2UZYB 43C9B 4PUBL 4HUXB 2F6AA 1BEYL 4JZJA 3LN5A 2F9BT 1OHQA 5EH1A 3I50H 3IDNA 1FCCA 3EGDB 4KFMA 3MXVL 3GBLA 1ZT7A 4QRSA 2MSPA 5ELIA 1J0ZA 5FOBA 1F4YH 3ELAT 4YPJA 2Y3NA 4X5XA 4YE4L 4XP6H 5C0JB 2H1PH 1RULL 4NBZB 4B0MB 2GK2A 1IARB 3B2UC 4QO1A 2DQUL 1KCWA 4Q97A 1G9NH 1NAKH 2HRLA 5I17B 2WBJD 4D0BB 2OQJA 3MRHB 1HOEA 1LO5A 4KJYA 2EYRA 4DPCX 1OAQL 3QO1A 2YXWA 3QUZC 4C47A 1Y7VA 4RRPM 5H94B 2Z6FA 3UBFA 5KBDA 4MX7B 4AEHH 4K7PY 1N59B 2WTRB 3P77B 2Y72A 2DICA 1BWWA 4UQCA 1N6QL 2UWEE 3HOGA 1EWHA 5M95B 1AP2B 4JM4H 5E6RB 1GIGH 4PJ7B 4WI6A 3DIDA 1WE5A 2WXJA 2FWSA 2XXGA 4QTIL 2A4EA 4NAMA 3MBXL 1IGCL 5E8DH 4EIUA 3AT0A 4X80L 3HB3B 2W5PA 3MRDA 4MNGA 3WAJA 4H8VA 3ETBJ 1N4XL 1NCWH 3HI5H 5A2IH 2PYEB 1RUKL 1RZQA 5DYFA 4OD1L 1H6UA 2F74B 5C08D 4GRMA 4AH2B 2OM5A 1ZLSL 1NH6A 5EIIG 3TCLB 1BFSA 2JJWA 3FFCB 4KRPB 2V5MA 1CXLA 4JFFD 2EIZA 4PD4J 3V7AG 1G6RB 1S7WB 4DVRL 3LX9A 1TTAA 4Y4KC 3EJRA 2CHDA 3C5JA 1CFVH 1QRNE 2Z8SA 1NCCH 1OVZA 1R6VA 5HHXH 1NCUA 4J28A 2ZWZA 4FHKA 4GSRA 1UCBL 4ZPTA 4IK6A 3U4BL 2BFVH 2BSTB 4MCNA 4KAQH 4AIZB 1LL1A 4GBXA 1SEQL 1WA0X 3RWEB 4S1DD 3I85A 3VXME 3NIFF 2PP8A 4DO5A 2W0FB 5CN2A 4DKTA 3BD3A 3GSWB 4BQ9A 4OY9A 2IGTA 1TU2B 1ECYA 2EE3A 3GLDA 3SYAA 5C0JA 3IDGB 1WAEA 2OMTA 1T22A 2AQQA 5CGMA 1ZT7B 4TVPH 4Y1SA 4PLJC 4F27A 4K94C 5DHEA 4AW4A 1OLLA 3QH3B 4FMVA 3WS6A 1ZHBB 2ZUQC 2DJ4A 1TZGL 2H6OA 3KR3H 1XBDA 5IROD 4P2QB 3FQYA 4JVUA 3TZVB 3NH7H 3D4GA 2D73A 3DI3B 4BCZA 3A4FA 3MKGA 3N41F 2E74C 3GBEA 4Y5YB 3RPKA 2PPDA 4FQJH 3GHBH 1MCKA 3NIDF 5TQ2L 1X5LA 4OGQC 1R4XA 5IV2A 5CEXA 2OYMA 4NNPL 5GJTL 1EDHA 4I0PC 3WEBA 1T1YB 5F7WC 3X1NA 1KTDA 3QORC 2FDBP 1D9KC 3C08H 2VXQA 5DS8A 4H8PA 5E6YA 3C2AH 1MW0A 1WFJA 3KBPA 4EKJA 1EEYB 2BZ7A 2RCSL 4R8WH 3EYFA 2WUBL 3ZO9A 3IMRA 5EOCL 1FGNH 3GSRB 8FABA 2C3WA 4PTTB 1XEDA 4AVIA 4KDVA 2YFNA 3WFHA 1M6UA 2I24N 3IXAA 3NZUA 2OX5B 3LQZB 1S5IH 4XMUA 1INQB 5IMLB 4TLTA 3PDGA 4JPVH 4GRWB 1HHHB 4JRXA 1AOZA 5B38A 1X6LA 1FO0A 5C0AB 3R7QA 4XNDA 2IH9A 1KJ2B 4UUJA 1GJWA 2AI0H 3CSTA 5B1JA 1CE1H 3BVDB 2L4OA 1TUPA 4K2UH 5DD1L 1Q0XL 1MFDH 5E9DA 1RZ8B 4HT1L 1YN7B 1V3KA 2XPZA 4X7TA 3ARBC 1A0QL 1IAKB 2JB6A 3OJVC 1JI1A 1GVIA 4HUNB 3TYFB 7PCYA 4M4RB 4PFEA 1GRWA 4P9MH 1BEYH 5SX5K 1YYLL 3CV5A 4I18A 5IHZA 4JM2F 1W6WA 1IQWH 4OIIL 2Y4SA 2XC8A 4Z3TA 2F2HA 3DGGA 2VL4A 3EH5B 2EE2A 3SD5A 5D4HA 2BO0A 4UQBA 3ZL1A 5DUJA 1D5XA 1EA9C 5KWYC 3OMIB 3FT3A 3DRQB 4P3DB 2IV9A 1XH3A 3QVAA 5GRWA 1GR7A 3O3AA 1QBLH 2E8ZA 1C9SA 1W8EA 5FGSA 4M4RA 5E8OA 1YSOA 2I07A 1RAMA 5DHVB 4AQZA 3BWZA 4LLUB 3VSTA 5EU6A 1JNHB 3X3GL 1MHPL 4Q6KA 3INOA 2D4FA 4ZOBA 5GS2H 4DW2H 1IZKA 1MI5B 1YEKL 1REIA 3P2DA 1HFUA 3LXBA 3M88A 4NN6B 4PGCA 3ZTCC 2OMUB 3RURA 1MCWW 5IMLA 3QUXB 4ORGA 1T03H 3ISYA 3NMEA 3REWA 4CU7A 1Q4NX 4RA3A 4K8RH 3T65A 5AW5B 1NAMA 4D9LH 2F7IA 4Z7VF 1TTFA 4OJEH 3QUZA 3EYFB 4ZUTA 4QYOA 5G2NA 5C6TL 3VFTB 1HILB 4OD1H 2JXMA 3PQYE 5CHNB 2UWEA 4IRJD 3MOBH 3G5ZB 4L1HA 4Q4EA 5C07E 2DRUA 2ARWA 4FQCL 1E9OA 5FECB 4X9BA 5CCHE 4H2AA 3RAJH 3W0WA 3EYQD 5IV2B 3GZKA 3WGUB 1YEDA 2XZCL 3FQRB 3TNNB 1EBPA 1M1SA 4Y5YA 4XC3H 3VXMA 4WRLA 2H2SC 4JO3L 3C5ZA 4LU5H 3SDYL 1BQHG 2MH4A 3T3PF 1FA4A 1ZWIA 2J6EH 2R1YA 15C8L 1AY1H 1LEKB 3U0PA 5GGQH 2ZCZA 2HLFC 3EO0B 3WEOA 2F1BA 4LCUA 1NZRA 4G5AA 1UB5A 1NBYB 4A7VA 1SQMA 3RGHA 2BJML 2FHBA 1XF5A 3II3A 5BRZE 3CGTA 1NMBL 3WL9B 3G04B 4N0UE 3HW7A 4HQQL 2AJ3B 4WI9A 1RVFH 3NCYS 5I6PA 3AB0B 5D70H 1CZ8H 5TDNB 3O6FD 4Q9QH 1F3JA 5BW7A 1XCQB 4OBRA 2FQGA 1XBRA 1BQLH 2PTTA 1HDMA 1NBZA 3QI9B 4OUUB 1G5GA 5DK0B 5L6YH 4GMTL 1T20B 5HHPA 2CIKB 4LEEA 2XJLA 2AVGA 2BRRH 2HTLD 3CDZB 3KJ6H 4XPBL 4D9RE 3ZYOA 1U8HA 4PJ8A 3HHRB 1RPQA 3RDTB 4GO8A 4PV9B 4X9HA 4EI6A 3VXRB 1L9NA 5CKGA 5I6XB 4GBXD 1LM8V 4F2FA 1JHKL 3SBWC 4Z3FA 1I3GL 1CQKA 5T3ZH 2NCMA 3VCLA 3O3EA 3EJQA 3TCLA 4YHNA 3SY6A 4H25A 4NENA 4XWGH 1ZIAA 3CFCH 5FB8A 2H45A 3FTZA 3HN3A 1UWYA 2HFGL 2BY3A 1WUZA 3S37X 4PS4L 5JLZA 4G8AC 1JUFB 4U1NB 1NUGA 1V3JA 3S4SG 5EOCJ 4LHUG 4NZ8A 3MYJA 1Z5LB 2OMBA 3TONA 4G1MA 4ZRGA 3X12A 2NLJB 1F86A 1AGCB 1MXGA 4HK0A 1SLVA 1SFHA 4OB5H 5EWIL 5HGDB 3S36H 4DCQA 4LO9A 2OP4L 1A6PA 1ZY9A 5EUOF 2VE6B 3CXDL 1OGTA 1RIUL 2DIEA 2F7RA 4LVOC 4OZGB 5EUOA 2WZPA 3SJVE 4B50A 1DSWA 5EULV 5E8NA 2AJXL 2F5AL 4J2XA 5IQ7L 5JQHC 3APDA 3P4MA 1UT9A 5FYJH 2ZNWA 4YDLC 1XZ0A 2CG9X 4H88L 2XFXA 3UGUA 3LJ3A 3S48A 3T8XB 3JV4B 1IAII 1E30A 4JCMA 1KC5H 1SXBA 1S7TA 3KPRA 4XVUD 4HULB 4FA7B 1B0GA 5M94B 4E36A 5J8OA 2FUTA 1U91B 2FX8H 4JFPB 3SPVA 1DBJH 4XP9H 4I1PA 3T0EE 1BVKB 2GABA 3BH4A 3MCKB 3OKNA 4IIQA 4R26H 4YH6A 5A6LA 5KSVA 2WBJA 4HPOL 4N0CC 3SYQA 2XKNA 2G3NA 3Q3GA 1OSPH 3ETSA 5C86A 4KDTA 3IU4H 5ESAB 3B7YA 3IU3A 2ZF8A 4BUGA 5HDBF 1M05A 4K07A 3OLEA 5DK2B 5F1SA 1BZQK 1D7CA 2VN7A 4P2QE 5HYFA 1HC1A 1CFSA 2QSVA 3SE8L 4GRLA 2DAVA 1LEIA 1BFOA 4DN3H 2WLNA 1XIWB 3RTLA 3UZVB 1Q9WB 3DIFA 3HN8A 5IJKA 5IB5B 2CBQA 1IE5A 1CDHA 4AEFA 1SBSL 3ZE2B 1C5CH 4P59L 2VLJB 1AXTL 5CLTA 3RGBA 2ORBH 3E2HB 3PHOA 2P4AB 4Z7UF 4LEOB 3RY6C 4JHAL 3HHSA 4R90H 3RYMA 3U82B 3WIHH 3H1ZA 3L4TA 3RE0A 1KIQB 5JXED 1OB1A 3L81A 4GT7A 4R96B 4Z7UA 4KKLD 4C58B 1ZPUA 5KJRL 2QTEA 1DO6A 2ENPA 5DTFA 3QEHA 5F44A 5CEZD 1HX0A 1NC4A 4G3YL 1YQVH 5SWZE 4EDWL 3LKPB 1DQVA 2AJUH 3FHEA 3SPHA 4BKTC 1SMAA 5JXEC 2WBKA 2Z91B 4FLHA 5DMGC 4YBLB 4R9HA 4PRAA 1U6AH 4K5OA 3N3EA 3NQKA 1N8ZA 4XHJC 4L0ZA 1WQVT 4Z18A 1R0AH 2AK4E 3I6GA 1E2WA 2G2RB 4JPIA 2J6EL 1ADQL 3MRMA 3L3GB 4WHTB 1NOFA 4N5EC 5CUSH 3UYOD 1BQSA 3IF1A 4PJBA 3FQ4A 1FNGA 2HSIA 4XVSL 3P0YL 1W0VB 1A9VA 3RWFB 1RMFH 2CXGA 4JFHD 4XHJD 3VD2A 4N3TA 3VG0H 2IOMA 1T7YA 1WIOA 3IDJB 1C7TA 1U8OB 4FS0A 5IBUB 2E27L 1TNMA 3WTVA 2R29L 5I1JH 2YPLE 1M7DA 3KLAB 5IVNA 3SDCD 4UANA 2DL2A 1D5BA 3ECVA 3FU7A 1INDH 4FFWD 1LO4L 5BJTB 1OD9A 3N1MC 1CS6A 5D70L 5I74C 4JFFB 4J3SA 4AI7A 1R9FA 3HS0B 3LRSA 2DYPB 5DZNA 5GGTH 4XNBA 3B7TA 4MAYC 4QF1B 5AB0A 2X6MA 4DP9X 5K9QI 4U6VL 1AE6H 1UCTA 3JV5A 3IGLA 1AIFA 4G8FA 3LNEA 3RIFF 1R5VA 4YHLH 3PABB 2GC4C 4MQXD 4MQ7A 1R47A 3LMJH 3QIWA 3H3KA 5EBMB 3B3IA 5KS9A 2CRYA 4LIQH 4MMXA 1DEEB 1I3GH 5FYKU 5T3ZL 3D48R 1LE5B 2FAUA 4YK4C 2BNRA 2SEBA 2ZXAA 4NKMA 1SY6H 3VFOB 5SV4A 1EFXD 1SM3L 5KYWB 1A14H 4XWGL 1I7ZB 1SJEB 3FQ2A 3MNVA 4KU1A 4P49A 3H56A 3H9HA 1YPZE 1RK1B 2Y5QA 3IJYB 5HGHA 3AM8A 5E1QA 2J8UE 5DZLA 1M1XA 3AQZA 1WK0A 1Q9KA 2XHNA 1VACA 4OJCA 3HVNA 1J8HB 1EJ6A 2OKMA 3MC0A 5H2BA 4J7RA 4ZTEA 2ZX8A 4MCZA 2YGPA 7TAAA 1FLRH 1B2WL 1RSYA 2XIBA 2DTML 3R06B 5GS0D 5T1JA 2XZAL 4R4FL 1CFTA 4PJCF 4R4NC 1NEUA 3JSSA 3MRGA 3W38A 3RY5A 4B6ZA 3QXDB 2FECL 4OCNC 5DR5H 4K71C 2VJ0A 1TFPA 3CLWA 1L0QA 3JWNC 1T0MB 5CAYB 5GS0C 5L4IA 3CVDA 2VMCA 4G43A 4IOIA 3ZY7A 3O3UN 4LLAA 4PRPE 2ERJC 3IEAA 1XD0A 2YPLD 3GS7A 3AQDA 3O4LE 3ROOA 4NKDB 3GSXB 4WFED 2O26U 1GKOA 3AC0A 5TE4H 4H88H 3WLWD 1MW2A 4LK4A 4RESB 1B4LA 3IRPX 4E41B 2MQCA 3FU0A 5C92A 1JD7A 3IFNL 3SDXF 4QRQA 1E9PB 1HOCB 3DTUB 4XBEL 4P23C 3BCFA 1NM9A 3JWNG 1YECL 1BVLB 4URTB 5ADPL 5CEZL 4HPHA 3GNMH 5CILL 4YSSA 4U1LA 5I6OA 4K5NA 5IVXB 2M2DA 1MQ8A 2BS8A 2QDVA 2WC7A 3OR7A 4UT6L 3FCTA 4M43L 3L3KA 5L88H 4AYFA 4M93C 1OAKL 5C9JB 4TRPL 1G7HA 3T9WA 2XRAH 5AYTA 2HLAA 1WBYA 2WZPD 4L8DB 4X9YA 2X2UA 1SYVB 5KYWA 4U31A 4FAAB 3VRIB 5D1ZD 2DWXA 1A4CA 2SEBB 4HIQA 2BNRB 4XXCC 4KXBA 4AQ1A 1PGRB 3CBKB 2KHAA 3B3IB 1ED3B 2IDUA 3HE7A 1HHJB 4OZIF 1XL6A 3CCHB 1Q94A 4XCFH 1W15A 1JBJA 3Q8EA 1KXQA 3OKMA 4K3EL 5DJDA 1ET5A 4FQQA 5K9JH 4ZS7L 3MOQA 2HX9A 3PAZA 2FL5B 2FATL 4LVEA 3QNYA 1OGAE 2BNQD 3HAEH 4KQ3H 5CGYC 5EC1A 1VFUA 2VN4A 2SODB 3FO1B 5HGAA 5JW4R 4IU3A 2YUXA 1V10A 1YQVL 2TSBA 3F05A 3VSQA 2IGFH 4EBQH 3HMXH 4AL8H 1ZMYA 3RVTD 4ZSOE 1LEGB 2CDFB 3FU7B 4ZAKA 3SOBH 4L1TA 2CO6A 3PWUB 1KJ2L 3WTYA 5D1XD 2GEEA 4YQXH 3WTXA 2XV0A 3ZYZA 2MNJB 4KNSA 3C5ZD 4NQTA 5MI0B 1IC4L 3FQNA 4LHUB 4E9LA 3S4SB 2F7OA 4ICXA 1Y18A 2D0FA 3RWFA 4HJJL 2AK1H 2APFA 4NNXB 4I0KA 1YQ2A 1FYTE 4TUOA 3DV4B 1R3KA 1KEML 1N67A 3GBDA 3MJ8A 3MZGB 1DQML 3H4HA 3I6GB 3WI9A 5LN8A 1IGFL 4K55A 4MMXB 5BUPA 1BZEA 1CGUA 1OEZW 3ML8A 5AW8B 1LE5A 1YNTB 1T7XA 2ZCKH 1OALA 5GS0L 2Z8VC 3VXQB 2QHRL 2ESVD 4WU5A 3BKJL 1YLBB 3FT4A 1IGMH 5LO7A 2H2PD 2YAQA 4WHDA 2CAKA 4RDQG 1A6WL 4UT7L 2BNRD 3EBGA 1FI8C 3UJIH 4GBXC 4K7FA 1AE6L 4HSCX 3F01A 4K73A 4JY4B 2R0ZL 3HHSB 2V6HA 4QRFA 4EXPX 4D9RD 1E5UI 1MF2H 4FKKA 4JM2C 4KZCA 2VW4A 4X50A 4OSUH 3G08A 1IC7L 4HGWB 3OAUL 3ZOAA 4I5BA 4HUKB 3BH8B 4KKAC 3D52A 1HE8A 1I75A 1U8OA 2XUWA 1BIIB 4N90E 2PO6B 1XIWA 3LKSA 3MCLL 3TEXA 3UZVA 4A39A 1GGYA 4P46C 5CCJA 2D7NA 3FU9A 4HKXA 3KLHC 4QTHB 3EHBC 3QJUB 2IH8A 3WNOA 3WE6B 3S35H 4N22A 4FADA 4Y8AA 4JPIB 4F7CB 5CZKA 1J7VR 2WNKA 2YC1A 5EIQA 1NL0H 3W0WE 2Y9RT 1FLRL 5FC9A 1LP9F 4KJPC 3C60D 3F6LA 4KVNL 1QYGL 4G6JL 1IT9L 4M7JH 5FO9A 4IGBA 3ESOA 3T0EB 4LQFH 4PRPA 1Z9SA 3S3JA 1EH9A 1Z9SB 5INDB 1HE7A 3GRBA 3P3SA 3JWOC 4MQSB 1S7TB 3DJRA 3KPRB 4PRIE 2P5ED 4L9LB 3DROB 3FB6B 4EI0A 3G6JA 3VQLA 3QZMA 4JANA 4QXGH 3T0AA 2PPEA 4QRUB 2XBDA 1JL8A 2DWEA 1HJCA 1IM3A 1RUMH 3ARGA 4PH8A 1NANI 1GZHA 1NIAA 1R19A 3GUFA 5F1KC 2EDWA 4NKOB 5FK9B 4YXHH 4MZRA 5MENA 2OJZL 4N24A 1WTGT 2C1OB 5TE4L 2HUHA 4Y4KD 2OBGA 5HI4D 4CU6A 1HVXA 3LIZH 1BJMA 2F5BH 3FSWA 1A9BA 1S7VB 3SKUD 2G5BB 3HLAA 1YC7A 3TIEA 4YHKH 4DGYL 4XPGL 4L8BA 2ZUVA 4XZUA 4JHVA 3K91A 2XA3A 5ICXB 2IALB 4ZS6C 4WTWA 5I1CL 2AFNA 1Q9LA 2AQTA 5ADPH 2GHZA 4KK9C 1I1YB 4S1DC 3F85A 4NNYA 2YR3A 5ESAA 3C87A 4N20A 5LWYH 4K7FB 2J1XA 4HMDA 3QUYD 5F7FA 5C0GB 5L88L 1UFGA 5IMKA 3CK0L 5GRVK 3VXPA 4F7PA 4HWZA 4WQOA 4L8SA 3V0WL 5JXAL 1DDHB 1KXQE 3RX5A 1KLUA 2AEPL 2Y5TA 1RK7A 3JV4A 5B39G 4WAFA 1G7PA 3UDWC 2FRGP 3NP3A 1VJSA 4DKDC 3S3PA 4N28A 4L5FE 3O4LB 2EECA 3IFLL 4AQ8A 4N8CL 5E8NB 3IJEB 4ZMWA 1UJ3B 4XCFL 3MGTB 2J8UF 3NCBB 2GTQA 3FAXA 3QJXA 2VDLB 4NJAH 3CVBA 5FWQA 2Z4TA 1HNGA 2DQJH 1T20A 3I3EA 3LKNA 5HHPB 1ZLUK 1J88A 1JZGA 1KJ3L 1LJMA 3DX9B 3ROLB 4ALAC 2RAMA 4B97A 2BP5M 2QLYA 2CZNA 4N5ED 5JO5B 3GBMH 3MLXL 2IGFL 3MYJB 4EBQL 1WAAF 2HX7A 3HKZA 1OANA 4NUGH 1CD0A 4IU3B 4ODVH 1VEOA 1JUFA 4U1NA 5IJVB 1U8IA 1GYCA 3JWDL 3FT2B 2YLKA 1A7RH 1S8DB 2EH8L 4JM0A 3K6DA 2DLGA 5D2LE 2ZOKA 3E2HC 3VFGL 4MS8D 1WA1X 2R29A 2HKFH 2ZUYA 3R7RA 3BFOA 3B9AA 4G7SB 2KPNA 4HJJH 4FFWC 3DJTA 2I25N 3CDGB 2XYBA 3U0PB 1HHJA 4BA8A 1W72A 2AQNA 4FCHA 5HP5A 1F4XL 2JKJA 2QZQA 3T0DA 4XI5D 3LEXA 1U92A 5LBSL 3HI6L 4JG0L 2GCYB 5IEHB 5IJDC 1U30A 5F7HA 3UGXA 1SYVA 5H8DA 4F9PC 4EI6B 2UZPA 4YO0B 4LPVA 1FAKT 2VDKB 4ZDHA 3BUYB 1HSBB 2EIKB 1CB4A 1E9OB 2J72A 4V11A 4ANWA 2VXTL 2VKWA 5HI5D 1FIGH 4NM8L 2WLYA 2PYFB 4CSPA 5ES4B 1E5AA 4LXFA 2DF3A 2NY2D 1HILA 4GW1A 4JB9L 2Y3AA 5JPNA 4XVOA 1ZLWH 1NEZB 3R1GL 3QSKB 2XX0A 3EJYD 5ANME 2BHFA 1JDDA 1G7IB 4ZUTB 2V0AA 2OR9H 1A3LL 4NRYA 4QLWA 3EJZD 5DC9B 2R56H 3DX0A 4K7PL 2ZAIA 1NBYA 4BWTA 4RDQF 4PRPD 3MCLH 5GRJL 3ZMNA 4RIRA 4P5TA 3VWJD 3RIKA 4Z77A 4MAYB 2BIQA 2F1AA 1TETL 1JV5A 3H85A 4WNJA 5DSCB 3VI4E 4OT1H 3QJTB 4MD5B 1IFHL 1E40A 4PJEA 3PL6C 3C5ZB 3WY4A 2X6VA 4PCSA 3WN5B 1E5YA 3Q1EA 2CK0H 4JGNA 4PJCB 1JS4A 2YKLL 2ZOLB 2HKAA 3B2VL 3IKKA 4MJ5B 5I2IB 3W0WB 1UT1A 3FT3B 2N1KA 3CMGA 1GA2A 4D9QE 3QIUB 4KROD 2CKNA 5I0XA 4IDJL 4WUUE 3WLWC 5EEVA 4QOKA 4ZO9A 1HZHH 1A6UH 1RUML 2WIIA 3BUQA 3OC8A 3QUZB 2V9QA 5FCSH 5TE7H 3QJRB 5HGHB 5C0BA 2ZE0A 5ACMA 5BZWB 5IG7A 4JMNA 5AZ2H 1AFVH 3WGVB 4IKIA 4GAJH 4Y4FB 3H53A 2OMUA 3FFCD 4GINA 4PGCB 5ILTL 4ODTL 2P8LB 2ZCLL 4LRNH 5EBMA 1RZGB 2NY5C 1MI5A 2BP0B 2DQCL 2E8YA 1CDUA 2HN7B 4YHKL 5ETUA 3WXWH 3VD9A 4MQ7B 1IBZA 4Y16B 3BVWA 1KYFA 3EUDA 3QPQC 1MCCA 2ZSVB 4IGBD 4LFHG 2X0WA 4GIAA 3IT8D 4APXB 3KPOA 4BQCA 5HHVH 4WI7A 3THML 3EYQC 3D05A 2ETWA 1RV6X 2BVYA 2UZIL 4JFXA 3KYKL 3PWVB 1U8LA 3CZUB 1ZTMA 2XVKA 4UM9D 5LXVA 3B83A 3VXTA 3NG5A 5C3LD 1EHLH 4GS7C 3JTTB 3FQUB 5L2KA 3QS2A 1CT8B 3LNHA 1KPUA 2JMRA 4PVLA 4X8GA 1M7DB 5BVPH 5T5FA 5C7XL 1TTGA 5DMKA 2QV2A 4Y4KB 5D7JD 1F02I 1XH0A 3QS3A 3L4WA 4WDIB 1Q0EA 1G6RH 1QQDB 1WAAA 3CMOL 3F65A 1AHKA 1NGZA 4GSDH 4G8IA 4FFTA 4XPTH 3TA3D 1RZ8A 2OTPA 1DQDL 3CU1A 4I2XA 2G2RA 5FKAB 5JQIB 4U7MA 3FN3A 3NZHH 3T0BA 1KB5A 4QHLB 5LBGA 1OE2A 3UP1A 1LO0L 4HGMA 2R69A 3AU1B 1JYNA 4FHBD 2B9AA 5DI8A 1ZDQA 1INQA 1C08B 4XXWC 2EDXA 2OMTB 5DQDL 5BXFA 3MLZL 4R2GB 1XTMA 5EIVA 4EUPB 4DPRA 3N1GC 1Q1PA 3P4NB 3PNWB 4OF7A 4UMSA 1CE6A 3K2UL 4G6FB 3K72B 2ZQKA 4Z0XA 1JCKA 2BXYA 5A2AA 5ANMA 2V33A 4FZEL 3FH7A 4HG4J 2X4RB 4JN1H 3RWEA 4Y9CA 4JJ5A 1FPTH 3PHOB 3X3FH 2BSTA 4RSVA 5DO2D 3ZSTA 4B9IA 2GUOA 2IF7A 1KF9B 1T1YA 2ADGB 4HEMA 4NUPA 3GHEL 5EU4A 1PKQA 5ANHA 3G5XB 2QKIA 2VH5L 3P0GB 3DVNB 2IFGA 3G6DH 1ZSHA 4MJ6B 3OL2A 5EBLB 2A9CA 4GRLB 4EVNB 2EACA 2VTFA 1UGNA 2XZQL 1KJMA 5C07D 2B59B 4HW6A 3QORB 4JPKL 4D3CH 1QFPA 2EEXA 1T66C 5FFOA 2IG2H 2ZYRA 2VLRB 3MLWH 1GY1A 1FLTX 2CHWA 5GSRA 1NFDF 2NY1B 4BFIA 3KLHD 5AB1A 5BPPA 5GS1A 1F13A 4QAWA 1ZGLB 4LAJH 1RXLA 3GEFA 1HH6A 2VZVA 4N0UA 1FQ9C 4PJ8C 3A47A 5CLZA 5FO7A 3WBDA 2VR9A 1JZFA 4PJFE 1T2QL 5KYYB 1AAJA 1BFVH 1DCLA 5DJAB 4U1HB 5D7KE 5E4OA 4J3VA 5I8CB 2EXSA 1NSNL 3CC5A 3UMTA 1A7OH 3BPLB 1EIBA 2H6UA 5EUOB 3CZNA 3SDAC 4ZPTB 1AR2A 2DEYX 2IDFA 5H94A 3WJLA 3GO1H 5KVEL 1PBYA 4X7SL 2CJUH 3OAZH 4CRPA 3DXAD 2K9FB 2LFEA 2Y2YA 1FBIH 2X41A 2XQBL 5TPWH 5BUAA 2OQJB 1QATA 4WO4D 5DD6A 4KK9D 4W9ZA 4AC2A 5KYYA 5C09A 3B5GA 3L4CA 3CDCA 5E2WL 1GOGA 3ZMEA 2CDGB 3RILA 1A7NH 2FT8A 1WFNA 4PJCE 3ECBA 4NQXB 4R5XA 3EJJX 2ZKWA 5LNGA 1CLOL 4J1UA 1AVAA 3T8MA 4I77L 4B9FA 4WUUB 5ESQA 3W5MA 5A43C 4TVSa 1UWXH 1XGUB 3NFSH 3VGHA 2J88L 2DWTA 5GRUL 3FB8A 1MN4A 3QDMA 4JRYA 2PW1A 3P9WB 3CFJA 2B59A 3ARFD 4JG9A 5AYUL 5D1ZB 3WTWA 3P9MA 4MD0A 4ZXBA 3DPDA 2Y06H 5FYKE 1AACA 3VXRA 3GSNA 3S8GB 2WXMA 3AUVA 4XT1C 2P7TB 5D1ZI 4J6IA 4ENEC 3HRPA 3ARSA 3KAAA 4XOEA 4XO4A 3SBPA 5C0CD 5E0QA 2HVJA 4MX7A 4LASH 1BOYA 5ICZB 3SE3A 4PG9B 3OGOE 2HJFA 1J0YA 4ZT1A 1HHGB 2LE9A 4UWQB 1GS6X 4LDEB 3QI9A 4PS8A 4DKAA 1HDMB 5CZVL 2ZTBA 1A02N 1ITBB 3E6HA 3TZVD 1AO7D 4X6CE 2EDQA 3AQYA 1N68A 4JFYA 3LRGA 4OLVL 1NCNA 1ZGLA 5DJ6A 2Y7OA 3M17B 4OCRL 5AD0B 4YWGL 5KVDE 5BXFB 3AMKA 5BVPL 5L0QB 1CXIA 1HWGB 1JPEA 1ZAGA 2B77A 35C8H 4DEPC 4X6DE 3VFSA 2X1PA 3DX3A 1P1VA 2UY6B 1AYRA 3ESVF 4HZAA 5DD5L 3SEPA 5HYQB 1BF8A 5EU7C 3ESUF 4EN3B 4ZYKA 3US1A 3MV7A 2ADFH 2H8PB 4XTRC 1PU0A 5FKAA 1RFDH 2FIKA 4AYGA 4KO7A 1U8MB 2O5NA 5KTEL 2FK9A 1B6DA 4G8IB 3IMTA 1HWWA 1RL1A 4PU2A 1AGEA 4PUBH 1E4KA 4I3SL 3BKML 4MJ6A 4ZW6A 4UTBH 4WTXA 1PG7X 3A67H 4M7KH 4BUHA 1PKQB 2C4XA 1JP5A 2KZKA 1O6VA 4DEUA 1DLHB 2YAFA 2H1PL 2Z31A 1BQRA 5AOKA 5J4MA 5J89A 4RISH 3WNNA 3DMMA 3I9GL 4UM8A 5I1GL 4EIBA 3O6KH 4FZEH 5LBSA 3QCTH 2I5YH 4QYOB 2ZWSA 4PWHA 1CTMA 1FPTL 2DYRB 3SE3C 3T65B 1NUFA 1M71A 2W0KA 4PJIB 3MRNB 3ZTJH 2R1WA 2CE6A 4AEHL 4IU2B 4FI6A 2BLFA 3BQUB 2X4TB 3GJFK 3QZWG 1AZVA 2BHYA 3OZ9L 1MFUA 2WCGA 3TV3L 4K8RD 4RMSA 3U7WL 4I4WB 1YMME 4LL1A 1GGTA 4XNUH 4ODBD 4JPWL 3W39A 3HFML 2EVFA 2HT4D 4NC1C 2YGQA 2ZWLT 4W6WB 1E27B 4KWUA 4F15B 1SXNA 1YG9A 3QDJE 4HJUA 3VB9A 2GSGB 4FLOA 4F8NA 5CLXA 5I5JA 2EXWD 4U3XA 1RUKH 2M26A 1IGTA 3GS0A 5EORL 4XH2A 3KLSA 4UIKH 4W4NA 3QJQB 4HIXL 1TQTA 4NWTH 4N2BA 1JN6B 1PQZB 1JTPA 4QRPD 3IMVA 1BFVL 4HLZG 5T33L 3MRRA 2P52A 1BV8A 2DN7A 2VDRH 2DTSA 1CGSL 2ITFA 4YEEA 1CFVL 1VF5C 2YWZA 3FN9A 1RUQH 3EG9B 4MDJA 2K4WA 5C07A 5D1QD 3V4PB 2X70A 3UCQA 4MD5A 1D5ZB 3BDBA 4I13B 4ZMQA 3QAZB 3MRBB 2LHAA 2K3HA 4A04A 2OL3H 4PP2A 1TJHL 2R9HC 4ZW8A 1BREA 5EZLB 3S88L 2CLRB 1UT2A 5CSZB 3TO2B 1W80A 1TJIH 3G5VB 4MB1A 3MV9E 1M2OA 1JVKA 2YA2A 5MEND 2PW2B 2BW5A 4OIBA 2YPKB 3GPSA 1ECZA 4NQEE 4XCEA 4LVOB 4LPYA 3RX8A 3NDZE 3VE0B 3U46A 1BZ8A 3UJTH 1LK3H 1UHVA 2NCEA 1YZZA 1RZJL 3NH7L 2IAMD 1X6NA 4OV5B 4H1LG 1RZKL 3RWHA 3T77B 3VGAC 2FR4A 2XWJA 4PJCA 5F7EH 3MA9L 5ALCL 5CD5D 4OJAA 2WLMA 5LN4A 3C8KA 3TA3C 4ELMB 4OFIA 5HY9B 2AS5M 4AM0A 1SQ2N 5ID0B 1K3IA 1X7SA 3O8XC 3V9EA 5C2UB 4Q4IA 2E46A 5DSCA 3I3BA 2YD5A 5D71L 2D3NA 4ZTPH 5DHYA 1LGVA 4JRYE 1AKJB 1DCEA 3KPLA 1A3RH 4Z7QB 5B4MC 3RFZA 3ABMB 3O2DA 1EUUA 4M48L 1IEBA 3VDCA 3T4AA 1FHNA 4OCWH 2J8HA 2YEZA 2XKSA 5E5UB 3ELQA 2Y7QA 1MWAL 1ZT4A 3B1TA 3N0PB 1UWGH 2B4CH 4DP0X 5JO5A 5BS0E 1FZOB 1JZ7A 5DLLA 1NLBH 3CXHJ 3DX9A 4YNYB 3ROLA 2APSA 3CVHH 1P6FA 3QIBA 3MACL 4OKVA 3SE9H 2APVA 4IIZA 5E2UH 2AANA 2FWUA 2MCPL 1SNRA 3GXFA 3S8FB 4KPHL 3TN0D 3BZDA 4MWFB 4TUJB 5DS1A 1SEBA 2EUWA 4F33B 3ME0B 2QHLA 2Y36L 2YBRA 2FZ3A 3BFQG 3CLEL 4GP5B 5BNXD 1PSKL 3JUZA 3QI9D 1WSST 2X40A 4M7KL 1KEGL 5D96C 1J1XH 2EIZB 1KIUB 2G5UA 1EAOA 4HGKC 3BEWA 5EO1A 2NNFA 3NIFB 4OM1L 4UZSA 2B1OA 4XNYL 1DZBA 2BXZA 2CALA 1NCJA 1WP6A 1MFEH 2GI0A 3FN0H 4XP5H 2QADD 1I7TB 3HMXA 4WWKD 2R2CA 3V4UH 1A8JH 1K4DB 3H0TA 2EIBA 1BD2B 1M3JA 2CO3A 2P45B 4KO6A 1J87A 4GEJA 4PJ7F 4EI5D 2Y1VA 4LHQB 4DNLA 4WI8A 1ROCA 4OKDA 4P2RE 3AGWA 4N85A 2DD8H 5IFAL 4GAGL 3ISRA 3MV8B 1JGUL 1T80A 5D7KD 4FABH 3VQMA 1JFQH 1RURL 4J39A 1MCRA 3LZFL 3HLAB 3TV3H 1CD8A 2D2OA 4E9XA 3GTNA 4ZX3A 1XTLA 2VSKB 3REVA 1THCA 3F7YA 3HFMH 2W81C 4OD2A 2Q10A 4X4XA 1D5IH 1E90A 2NY7H 1TKWB 3QO1B 3DVFA 4TQIA 2RA1A 4H7VA 1HYRC 1CD1B 4WV1A 1KN2H 1U8JB 4HD5A 3V5HA 4HLEA 4AQAA 2H1XA 2CBPA 3HE7C 4IQHA 3GIVB 3KLQA 2WJ5A 2WB7A 1A7PH 4ZBJA 1AZRA 4RZCA 4PJGF 2C5DC 4X6CB 4HWZB 2BVPB 3RAJL 2BZCA 2RMNA 4U6XA 3IDNB 2MHAA 1HH9A 2VJXA 5E5LA 1X9QA 1GKEA 1CICB 4Y16D 4YBQC 2DPKA 4N5UA 5FHBH 4HHGA 3IAGC 4PREA 2FD6L 4XC3L 4HXBL 3QIWC 2K7QA 3VD7A 3LQMA 4P2AA 3PCYA 1HCZA 2J5LB 3RVVD 1DFBL 2IWGA 3AXLB 2VC2H 4KUCD 3WKYA 4PW3A 2DQEL 15C8H 4OZHA 3UG5A 4C4UA 1J48A 1AQMA 1F11A 2NOYA 4XBMA 4BELD 1E9QA 4IK7A 2G5BA 2XX1A 4F8LA 5AUMB 3GI8H 1DJYA 2ZAGA 4LNRA 4MMYA 4WO4A 5IJCC 2XTJE 4ACTA 1WIPA 5AW3B 4PCTA 2NY0C 2QR0B 3ZGIA 2EEBA 4HGWA 5FOJA 5CD3A 1T5XB 3RWCB 1MRFH 4EKXA 3CLFL 4FFVC 5CEZE 2NY6B 2XN1A 4WHCA 4PWEA 3ILEA 4FA6A 2BOLA 2X9XA 2X88A 1LK3L 5J0BA 4M6NH 3V0VA 3STLB 4E68A 2UX7A 3A6OA 4KOCA 4F7KA 5DVNA 1JYWA 5TDPA 4Y1AA 2Z7WA 4LSTL 1OIOA 2P8MB 3IE4A 3VGBA 2DS4A 2ATPA 2WBXA 3O0RL 4FYTA 1Z9OA 5FYKL 1USZA 3LKQB 3N42F 3E38A 1LD9A 3LSOA 4PG2C 5C0EA 1NWPA 3K6SA 3P2TA 3WIFA 3T0VA 2YRZA 1R3IL 3BP7A 2ZOTA 3F83A 3BDXA 3V95A 2HG5A 3FQXB 3RP1A 3BVTA 3FSVA 4UYQA 1OP5K 4CSSA 5TH2A 1ZEAL 3NOIA 2FBRA 2CSPA 1FO0L 4A55A 1Y1UA 2VR7A 2G60L 4XTRD 3PGFL 3S5LG 4ZTOL 4XX5A 5E1IA 3V52H 5AOJA 3IRZA 3GC3A 1FAIL 3PXHA 3EAKA 4S10A 3E0GA 2PWHA 3ARFB 1BZOA 3EFDL 1T3FB 3S98A 5DJ8A 2HTKC 4FQ1H 1DJWA 4KI1A 4PJAB 3PWPE 3SYOA 2WXFA 4O5LL 5D9SB 4WWKA 4R0LA 1BLNB 1II4E 5DJDB 1NCCL 3MLRL 3G6AA 5BOJA 1I7RA 3O2VL 4WCYH 3S34L 5FW8A 3QEGH 3HZ3A 4H26B 1BLIA 1INEL 1DQLL 3VXQA 5C08E 1P5VB 4OLZL 2P44B 1T5WB 4NBXB 3WEAA 1A6ZA 2G9HB 2HT4C 3BEWB 5EO1B 1B9KA 5LCVH 1CGXA 4GXUM 5D72H 4OI9A 2K6YA 5HGGS 1CL7I 3FF8A 5FDWA 1YNLH 1BBDL 4TNWK 1JZHA 3T6VA 5EHFA 1G7HB 1HXMB 3MV9B 1SEBB 4E0RA 2KLSA 2OMYA 1XF1A 4OZFG 3GKZA 3KL3A 4XCCH 1RY7B 3U1PA 3PGCB 2XN9A 3FTXA 5DRNA 5SWQB 2XWTB 4DGVL 3LH2L 2CK2A 3QIBD 4Y4HD 4ZK8A 3EDEA 5A2FA 4FQXA 4KK6C 1TMCB 4XN5A 5HGBA 4NZJA 4P06A 5EO9A 3AS2A 4A67A 5IB3A 4U6HB 1HEHC 4L18A 5BVJB 1S3KH 4WFEE 3F84A 3GFUA 1Q0YH 3OTTA 1MSPA 4WFHD 3H6AA 2UVEA 1BQUA 3HC0A 3QIBC 4OU3A 2BVQB 1I9EA 1V7NH 3BP4B 4M3KB 5D7HA 3QC5X 5A16A 3II1A 2HVKA 5E2JA 3GSVB 4EJ1C 1RIVL 2MTAA 3KPRE 3ZBMA 1YHPA 1HESA 4I48A 1O75A 4CAGA 5IESH 2FQFA 5IROA 3ZHFA 5DA0B 3NSFA 5ACLA 2E7LA 3BGMA 4L3FA 3UPCA 5IHLB 2ATKB 4QJ3B 4L8DA 1XZWA 4HKBB 3TV8A 4N2LA 2R0KL 4B5ZA 5LJYH 3OD3A 4NHUA 1JPSL 3T77A 1L0XA 2XLLA 5C9JA 1MFBH 1CFTB 4GAAA 1XGRB 1OSEA 1I1RA 1I1AB 4U1IB 4JPVL 4XNMB 3U4KA 1G1KA 2A1WL 1NFIA 5SV3A 5T5NG 5IVXA 1NFIB 4OGYH 3BX7C 3OX8B 1DFBH 1WBZB 5DS2A 4FULA 3U46B 4V2CB 3W11D 2XDHA 3ULVH 4EXKA 3I50L 3GJEB 1Q0XH 1RK1A 3FTWA 4G80B 3H9HB 4OW6A 4HC1H 4P46A 1DFXA 2ATKA 3R8BB 4X6EB 2WAQA 1A0QH 1I8IA 4Z7WE 4GIPD 4E41A 4PGZA 2C9SA 3O8XD 1SPDA 3KXFB 2VABB 3BOVA 2CLRA 2PUQT 2YA0A 3BXNA 4HWBL 4KQ4L 4C4KO 2N0KA 3UTTA 3FZUD 2FE0A 3L2LA 5INCB 2OCFD 5J12B 1DR9A 2BSED 1J1OH 1MCWM 4RFNC 2VDKL 3LXCA 5CD5C 5GGTL 5I16A 4X5RA 1T0MA 3EZJB 1DBKL 3QAZC 4IMKA 4QF1A 5D1XE 2LTQB 1JWMA 4ZO7A 4JM4L 3LPWA 4M6MH 1NCOA 2FBJH 1NGPH 4UT9A 3CQPA 4C4KT 3BEVA 3EDFA 3R06A 4QRTA 2PP9A 1UEYA 1TCRB 2XWTA 3KLAA 4BE6A 1BWMA 1YEKH 4U1KA 3CVHB 4X80H 2BOBA 1L9SA 4QGTA 1UKTA 4ZPVB 4E0RB 1HXMA 3MV9A 3HNTH 4HOMA 5DD0H 3FUMA 3MNVB 4RBPH 1IAOB 1I7ZA 1SJEA 4RAUB 1EVTC 5FYLL 9CGTA 1ZLSH 4FA8A 3L16A 4RMBA 4WFFE 5AVYB 4UQ3B 1AQKH 2H0PA 4KKNA 1RZ7L 3LS5H 4I3RH 4A7GA 4B0MM 2KZ1B 1JE6A 5E00A 3U30B 3HRZB 4L3CA 3BIAX 2Z91A 4I18C 2IBGA 1KG0B 2XZAH 4R4FH 3W3BA 5B1CA 2N4IA 4FNLL 3O8XB 1PIFA 4KI5D 3UEQA 3QI9C 1IU1A 1DL7H 2XZCH 3LB6C 3KEHA 3LH8A 5AAMC 3EZ8A 1UD6A 4KI5C 2JCCB 3QR2A 4QKXB 4IBLT 5BRZB 1MHHB 3O3BB 4BFEA 1T6BX 1DLHA 1ZVYA 4JZNB 3DMMD 4X99A 1WWAX 1BD2E 3FT1A 3KCPA 2AK4B 5CLYA 1AH1A 4CUCA 5D72L 1X7TA 4FDWA 1XSIA 3IWVA 4LNRB 1G7QB 4UAHA 3W0WD 3RFZC 2YS4A 3C6LA 1MCNA 4YS4A 3LNIA 3MBEC 1N3NA 1CDBA 2JLPA 3DMMC 1H8LA 1GW6A 2ITDB 3HG1D 3MUGB 3MV8E 3QUXD 3FUDA 4N0YL 5IIEA 3VXOB 4AITA 4OZIA 3DVIA 2AMGA 1B9ZA 1MDAA 1A9EB 4Z0BH 5HHMD 4RFEB 1LHZA 1S9XB 3V79C 1N8ZB 2BDNH 3MGAA 1N5YH 3L9YA 3MBED 1YPZF 3STZB 2C9RA 4FQJL 5TGBA 4C59B 3OGCA 3UAJC 4BXSV 4KNUA 1L6ZA 5H37H 1NBVL 1U4FA 2MHAB 5IOKA 4J3OH 4LPWA 1MCJA 1IBYA 3V4PL 4FFYA 2V5RA 3U4AA 5FGRA 5DJ6B 5AD0A 2W60B 2WKOF 4WGVB 5DZVA 1OZUA 2YD3A 1NUNB 1FFOA 2B1HL 3KLLA 3VWKD 1BJ1H 2MJWA 5B3JF 2RCSH 3NT0A 4QLRA 2VZ3A 2FX9H 5TE6H 3RWCA 1HHGA 3L9EA 2HJFB 2Q76B 4PG9A 4HCRH 4ZS7H 4ZOEA 4J3TA 1XV8A 2H7WA 5LAXA 3ESNA 2AKRB 2WYZA 4KTEH 4P9HL 1KBPA 1Z9MA 4IRZH 3J8F7 5HGDA 2Y7MA 2PR9A 4DFIA 1DBBH 3E3QE 4G1MB 1M57B 1JZ5A 1WT5A 5EU6D 1YUKB 4C56E 5D6DC 1QEWA 1WEJH 3SBRA 1OAZH 3INUH 5DVLA 5BQ7A 4LCCA 5IBLD 4AYID 5ERWB 4L4TE 4HV8A 3B9KC 3H0TB 3PP4H 1HH9B 1MCPH 3S3CB 3SB3A 3MO1A 1WJ3A 4HWUA 3NEOA 5DXWA 2NT0A 4S1SL 4LF3A 1WO2A 2DEXX 5GRVL 5TK4A 5LB1A 3VJ6A 3C6SB 1AHWA 2JQMA 5D4IA 2HFEB 5I8EB 4NI6A 3AW5A 3UC0H 1N7MH 4NJ9L 4WV1B 3BRGC 1L5GB 4M7ZC 1LP9A 2F68X 2J4WL 3ILPB 1TEFA 1VENA 2X2HA 4Z95H 1M9WA 1FZKB 2NSMA 2VXUH 3ATBA 3BFWA 3FCBA 4YAQA 5JHBA 5E6SB 2VE6A 3NA4A 3REVB 2CQVA 4OKVB 1KWKA 2R83A 3WUWA 5C70A 2VXVL 3CC5B 3BWAA 3D1MC 3OF6D 1NM4A 4QY8B 4JO4L 3RHWF 1AXSA 2AJVH 4NOBA 4Y89A 4YHPA 1KACB 3RKDC 5GZOA 2AJ3A 4NC2B 2FEJA 2Y7QB 5EZIH 1SVCP 4ZX5A 5FGCE 4I3GA 3IN2A 3GHPA 5J9PA 3QQ9D 3PGDB 2VRKA 4G7VH 3ZGHA 1UH4A 4TQ8A 4BCYA 1GGBH 1KBBA 3BUPA 3KPLB 1SN2A 2WO4A 1K4DA 2F7PA 1EHKB 3IPFA 2ZKMX 4LOUD 4J6RL 1TYEB 4PJHF 4X6DB 2OYPA 5CM1A 5KW9L 3EOTL 3UADA 2X1QA 4OLWL 4XN9A 1F18A 1C5CL 4U3HA 3ZK0A 4DJMA 2YA1A 1CG9B 2NW3B 1ZS2A 3IXTA 3MOBL 2IAND 3MR9A 1ZWIB 3ISWA 3Q8BA 3ZQXA 3Q2LA 3WFCL 4O2EB 2DBLL 1BMZA 3NABL 1JNNL 2V3EA 4DVBA 4K9EC 2EXTA 3B8SA 1F3RB 3QDGA 3OKKB 1S9VB 4PBWD 2WCSA 1ZJAA 3OMAB 3VD3A 2XTLA 5I19L 4GW4B 1V05A 3CFEA 3QHFH 1SLWA 1DP0A 2DI7A 4WJKB 3WYRA 4A7QA 2J1WA 1ZIBA 2P24B 4XO9A 2VCOA 1VFBA 2BERA 1XCTA 2VERN 4TULH 5D6CA 3SZ6A 1FORH 4JFDB 1MLBB 5A6MA 1ID2A 4JAMA 4KZEL 5JR1L 4GMSH 1H5BA 1ES0A 1H3GA 1KTBA 4K5PA 4H40A 4LPUA 1CXFA 3ALWA 5GGQL 4PGEA 4W70A 2HAZA 4F5CA 3JVGA 4Z7IA 4A7UA 2AEQH 1NAMB 4YXHL 1BM7A 4P4KD 2YEZB 4BK4A 3NBNA 3DX6A 4NQEA 4KTYA 4LP8A 4KRNA 4P5RA 3TO2A 5HVGB 5ITBL 4Z7WB 1IAMA 4WNQB 2QPUA 2GAZA 5ALBH 3U4EA 3U0WH 2QZ5A 2VDML 2ZOOA 3ZU8A 4FQHA 3ARQA 2OR8A 1P9MA 3QXAA 2C7UB 5E99H 1TFHA 1C12A 2CWRA 4ALAH 2BX5A 3RLSA 4DP6X 3KJ6L 2BS9A 4D9QD 5LWYL 4QCIA 2VMFA 3TPUB 4JZJC 4JGUA 3VXMB 3TP4A 5E8OB 3CQQA 5MI0C 1YMMA 1KCVL 1B0WA 4RNRB 3CK0H 1TF4A 4L0YA 2FR4B 1ZLWK 3RWHB 4NXKA 2JF1A 3O6FA 1KDIA 3PHQB 4GRLC 1P4BH 2L04A 5DD3H 4JDVB 2L8AA 3SDDA 3BHBB 1YPZB 4MB3A 2G2PA 4KKCC 3SO3B 4LRIA 4Z23A 4PGJA 2WHVA 5DRZA 1R3LB 1FFNA 2Z7YA 1MEXL 1P0SE 3L54A 3IJSA 4U0QB 2ERJB 2G0KA 1Q9OA 5I8OH 4NUJB 4YFEA 2YPLA 3KPRD 2NY1C 3P40A 4X7TB 4FLRA 2A6KB 5F96H 3HG1A 1G9EA 2K78A 3IE9A 4CVUA 1K4CB 4LDLB 4P9HH 4QWWD 5AQ0A 5TDOA 3SE4C 2L7QA 2PABA 4WI0A 3VFRA 4AENA 2WXIA 2VN3A 2WP3O 2MKLC 4GQ9L 3MBEA 1G1CA 3ILQC 4PP2B 5DUML 1RJYB 1UA7A 2JKWA 2AGJL 4ZMYA 4HS6B 4YDKL 4FXKB 1X5YA 1AS6A 2WYIA 1RZKC 4IHOA 3ZKNC 3IXAB 1HZKA 4WEBL 3WFHB 4LLUA 3EG9A 1RZJC 4NLAA 3WJLC 5IHUH 5E5MA 2VC2B 3VFGH 5B1KA 3GSRA 4FKHA 3GSNL 4Y5VA 2V17H 1DVQA 4JMXA 4A2HA 4HWBA 5TK2A 4GAFB 4ZW5A 5ENWB 3IDXH 1JN6A 3CVIH 4L2LA 1K2DA 2XN2A 3UO1H 4JDVA 1SVZA 3EJSA 1J9SA 3L3OA 2HX8A 2JCCE 3Q48A 3QNZA 4HCFA 3C8HA 1KZQA 4MJJA 4YXLH 3DSNB 2RR3A 1EXUB 5JXEA 1PFCA 3V8OA 4YE0A 1I1AC 3ZIMA 4HOZA 2NX5A 2X89D 1YEHL 2ICWI 2AABL 2YMXH 4ISVB 1P7QA 3B6SA 4O4YL 1WF5A 1EJOL 2CR6A 4TV3A 3MRCA 1YN7A 3MYZA 4UB0H 1HYSC 2AAAA 2FIKB 1QLEH 3GMLA 1QTSA 4NRZA 3NCFB 1XDTT 3O4LD 4Z77B 2MIZA 2I60L 3FUFA 3EFFB 2X4TA 2AJVL 4HJSA 1HYSD 3FMGL 3UTOA 3BAKA 4OZ4A 4UT6H 4C56B 3LIUA 3CN3A 2WINB 3DX6B 4NQEB 2VZOA 4LCVA 4TRPH 1TU2A 1IQDA 4NN5C 1H9DA 3IB4A 4OLYH 5J12C 4N2AA 3SGEI 3QORD 3VI3F 2V9UA 4R90L 3ZDYE 2AQ2A 3QUYB 2FLBT 3QZLA 2H6PA 3MV9D 2CA4A 4ZFGH 1I3RA 4NB7A 2J71A 2O6DA 2GPZA 3DI2B 3MLUH 3GPEA 4FKEA 3KJ4C 5FF6B 1CGWA 1EUTA 4GW4A 1KBVA 4UQDA 4B3EA 5LGHL 3GSNB 4J3XA 1K72A 4UINH 5DU7A 2GCYA 5IEHA 1DVXA 2ZXBA 4A6YB 5IWLA 3N1PC 3UBXI 1FORL 3AUWB 1AGDA 3LZLA 3WDIA 1FL3B 3KM1A 4JE0A 4HJGB 4RH4A 4TSCH 4ATWA 3IJ9A 3CDGA 3CN0A 4R2GD 4XVSH 1HS6A 4ZYKB 3ML9A 4EN3A 4YLBA 5IT2H 1C5DA 4OI7A 5D7LA 1EBAA 3UACA 2CUMA 5F9JB 4AVKA 1OAUH 4MBRA 3HG2A 4JM2B 3NJKA 1IC4H 1E4XI 3M17A 5I24A 1T0NB 3ULSB 2X4NA 5F9DC 4W6YB 3IYLW 3U25A 1YYMH 5C09B 1TMQA 2AZAA 2H26B 1WZ1H 2G9KA 3CZJA 3N40P 3RB7A 1YEJL 3P4LA 4AKOA 1IGFH 1UWXK 1XWVA 2R2BA 3NAAH 3TJEL 1YJDL 4HH9A 1V54B 4ONHB 4P2YA 3Q2WA 4Y4HA 3ARRA 3O6LH 4WI4A 2BSBA 1QBAA 3V6ZA 1A6TB 3C5JB 3IJEA 3C60A 3UJIL 4OQ1A 3MJ9H 1OT1A 4YHOL 4AKQA 3KPTA 3UABA 4Z7OE 3JXAA 4FZ8L 1HH6B 2A73B 2IOIA 4N0UB 2J1KA 1T0NA 5FO7B 3SD2A 3ULSA 3C6SA 3SQRA 4AGOA 4F9LC 5SX4H 4QRSB 1FL6B 4G9DB 2Q6WB 1ETZA 1N0XL 5FEBA 2Y7NA 1NFAA 1A7QL 1UURA 3CXHK 4JPSA 1TVBA 1PEWA 3L3IB 1LNUA 3S0PA 5CNHA 3D4ZA 1IBDA 1E4WL 1BAWA 3HZMA 3DURB 2NQ3A 5JIIA 2AVFA 1H3XA 1UM5H 4GQRA 2NY0D 3DKHA 4PQXA 2B08A 4ENED 3DK0A 4G8EA 4IIQC 2W91A 4LLWB 1JRHI 2A74B 5DJCA 4PJ7A 1RZIB 1UADC 2IBBA 4PYHA 2KPWA 3VFUA 4E5XG 3QG7H 5A3ID 4KO9A 3NEXA 1QFWH 3ESMA 3DBSA 5DR5L 4LOVA 5JOFB 1C5BL 5E08H 2QKIB 3SDCB 2ALAA 1Z0MA 3CX5K 1IJNA 4W6XB 1ND0A 5EU4B 1GYWA 4HXAH 2C34A 1BXUA 2VAJA 1DVFD 5FK9A 4CGTA 4PRHB 5I8CA 1U8KA 4M7LL 4XR8C 3K2UH 2WWOA 1N18A 3OG6B 4LHUD 3HNSH 4X7EC 1SJXA 2AEOA 3AG1B 4CBZA 5CBAA 5I17A 4HWEH 5ANMB 3OXSA 2NDFA 1AZCA 4QRUA 5B7FA 3X3FL 2NTFB 5D7IB 2W60A 3UO1L 3MX0B 1ZS8B 3BT0A 3TS8A 4MS8C 4NZRL 3QGVA 5G4MA 4S2SA 2YSSB 4YHYC 4DOHB 4XBEH 3UXFA 4TVPD 4U3SB 4ABQA 5GSRB 4W9HC 4YL9A 1DLFH 3FO9B 1YYCA 5T1DL 3WXVL 5GGRY 3MXWL 3RIAK 1YEHH 2EILB 3UTQA 1J9QA 4NHCH 1A2YA 3RWGA 1EJOH 3O2DL 3ZTEA 2YC1B 4QEGA 2LQRA 1YDPB 1MWAB 3UMNA 4AKPA 4F7CA 3WS3A 3VXOA 2D2CC 3QORA 5JHMA 1CK0L 1H5BC 1P7QB 3B6SB 5CGBA 1UJTA 1G7JB 1MCBA 1R5IA 4JKWA 2VRAA 3G5XA 4OZGF 4JKLA 5GZOD 4I5BB 2ADGA 4X99B 2DH3A 1IGYB 2GJ6A 2GUOB 4BSWA 2WCPA 2KLRA 1CT8A 1K2DB 1WS8A 3N43F 4OJDH 3RVXC 3RIFK 4F2ME 1JZJA 2E7CA 2X4RA 4ZUVA 2GITB 5AWNL 3VTMA 2Z35A 5I76B 4P4KC 5F0LB 4BWUA 2L7EA 4X9IA 1OPGL 3HZYA 3MZTA 3KWXA 4NO3B 4ZFGL 1RLBA 2IQAA 4OD3H 4HS8H 2O5XH 1S7XA 4J4PD 5FFLA 3AMLA 4FP8H 3WJJA 5C0IB 3LY6A 4TXVB 1G7LB 3W37A 5DI8B 1TZIB 4LE8A 4LOEA 3HMXL 1ZE3C 2ADYA 3DA0A 4HHWA 4JDZB 2W07B 4M6AA 1KGXA 4L3CB 2XWDA 4PIRF 2ZUSA 4OVUA 4CMMA 4R5TA 4N2CA 3HC3L 3L5XL 3RPBA 3BP5B 3FFDA 3MMEB 5JW4N 4BGDA 4BSVA 1DE4A 3KPQB 3NFPB 5EPMA 5BOZG 3Q2VA 5CXPA 5JQ6H 4TSCL 5GIRA 1D9KA 4TUKH 5DUBB 4LARL 2VOTA 4RGMC 1NEPA 3WIIH 1XGTB 1FG2A 3S4SA 4ZPVA 4AUJA 1URLA 5C09E 5CJXC 1XEUA 3ATDA 4U1MA 1Z5HA 3RKPA 5I66A 1HI6A 4KKCD 4F80A 5EEWA 2CO6B 1YPZA 1P1ZA 3FULA 4JW3A 1COBA 3PYCA 5DJYB 2X2JA 3FQUA 1QNZH 4QRTB 3ECQA 5CP7A 1ZGLM 1X9LA 2IADA 3LAFA 4IRSC 5GXBB 3EOAB 3T08A 4NOFA 5I2IA 1GGIL 3QA3B 4RAVB 5HGAB 5CFAA 3JVFC 1VRSA 3HKFA 1C1EH 5CZXC 4JVPA 1R1CA 4MNHA 5IB2A 2FH8A 4HLJA 4MXQC 2I9TB 3IFPA 3OMZA 2Q0ZX 2BRQA 3P11H 1SN5A 1JV5B 5DVPA 1EZVX 3FONA 5B8CB 2JELL 3HE7B 4DP8X 3OAUH 4K9EL 1YEEL 1ZDSA 3KBEA 5C0NC 3VI3B 4OV6F 1IKNC 1KCRL 1ADQA 1WFIA 3KVQA 3SDXB 4E9YA 5HVHB 1P4IL 2W92A 3QDME 5LNEA 1FVDB 3V6BR 1T04B 1QI5A 3S97C 4ADIA 4YOKA 2BVTA 3S35L 4K7PH 2WOBA 2QSCL 3SKJH 1WBZA 4POUB 1QFUL 1W91A 3ARTA 4HPYL 2PCFB 3CFIC 5K5YA 3RZWA 4H4NA 4GY4A 1FVCB 2DYPD 3UZQB 1PNDA 1IT9H 5DZAA 2JK5A 3FZUC 5HPMB 3ZKXC 2GHWB 3NIGE 2W0PA 3ZTJG 4HKBA 2QVIA 5F7DB 4HZLA 5DT1H 1S9VA 4BH8A 1NGQL 3OKKA 4ODHL 2F1EA 1CICC 3QRLA 3JV0A 4E9RA 3D9AL 3AREA 1NWOA 1T6VN 3BZ5A 4DKFL 3POCA 4UMGA 4HXAL 3T1WA 5C09D 2V2WB 1SJHA 3MJWA 2D0HA 3H42L 4MA3A 3RRQA 3DOSA 2E6PA 2VDQB 5ECGA 4MAYA 2WWNA 1CICD 3GSVA 1F45A 4X6DA 1IFRA 2VDRB 2NR6A 1FH5L 3CZEA 2P1YA 4RIRB 3U7YL 2GJJA 1NUDA 2WKOA 4IW4C 1UXSB 1J5OL 4ZMLA 4M3JA 5CJ8A 3B4NA 3P9LA 3OHXB 1YY9C 4FQXB 1G7IA 3MUY1 2I26N 5D7JA 1LE9B 4PJHA 3QO0A 2NY6C 5DO2C 5DJZA 1O9VA 2NY3B 3WUWB 2CM6A 1QA9B 1W6LA 1JNLH 4XCYA 1HAWA 2WN3A 1KFAH 1VZIA 1ANUA 1E7UA 3QUML 1UXMA 4ZMOA 2X1OA 1KJVB 2UZXB 1HL5A 3KWWA 1U93B 3MGTA 4R83A 4ELMF 1PY9A 4AK1A 3DUHA 3RL2B 3O4LA 2DY2A 1T4KA 1PZ5B 1G94A 2OFQA 2J2ZA 3A21A 4LLVA 4W9IC 2D03H 1HAUA 2G9HA 4JFVA 4X4YA 3DBXA 2DLTA 3M1BB 4OH2A 4ODWA 4R2GC 3B5TA 4LLDA 1J0IA 1W72B 1ZTXH 1MI5D 3N9GH 1FNSH 1OV8A 1ACXA 3G6AB 1PZAA 4TKWA 1KN4H 2HFFA 4NO5A 5DF0A 3EGSB 3C60C 3KGUA 1YNKH 2YPVH 2B3RA 2DQ6A 4NJAL 4WWKB 4Y2OA 1J9TA 4HV8B 4Y4FD 4Q9CA 3E8VA 1I1FB 2ZOKB 3BUDA 5M7QA 3JWOL 4G7YH 1G6RL 5IJVA 3NJVA 4HSAC 4YHZH 2AJSL 1U41A 4KVPA 4MDIB 3SE6A 4S1RL 1IMHC 1NGWA 4NUGL 2DQTL 3CFDB 2W9EH 1TJHH 3HZKB 4HYTB 1BVZA 3JWDH 4FX5A 2IQ9H 3OSKA 4UQAA 2AKRA 5JTWA 3UBXA 4LGSB 3TPKA 3CFMA 2BIIA 4HK3N 2JI1A 2GFBB 4R7NA 5AKVA 3GTTA 2NSXA 3TIDA 1JDCA 2B0SL 3KH4A 3WIIL 2GKIA 4HWNA 4AV4A 3H8NA 5I6NA 3MRMB 3UAJA 3BP7B 4IBYA 5F70A 4XNXH 3L5HA 3CTTA 5DMIH 1S9YB 1IM3B 5IFHL 2XV3A 1P4LB 1M53A 4MNGE 4PJGA 3EGXB 5LBSH 1Z9LA 2WQUA 4HKZB 3BZFA 4HS3B 3F58L 1K8IA 2NZ1A 4H20H 3CHSA 5I23A 3OAYK 5E2VH 2NT1A 4I0CC 3CC1A 1JF6A 4DZ8B 1KENH 1YCSA 1OY3B 1F2QA 4Y1AB 2AXFB 3S5LA 4Z8FH 4LLQB 4NM8H 4PJDF 4KKRA 4NNYB 2IMMA 2W38A 3HN5A 1HIML 4LEOA 3BSHA 3R1GH 1QKZH 4MA8L 4I87A 4ZZKA 2K8MA 5C71A 5IIEB 3BI9X 4Y19A 3MUGA 4GAYA 1A3LH 3CZFB 3SDXE 4CILA 1F4WL 3LQAL 3WLBB 2IG2L 1NMCC 3PAVA 3RGVD 1JSYA 2AV7B 2ITCB 3QXTA 4I89A 1CLVA 1YEEH 3SKOB 1UG9A 3IGUA 2AK4A 3NPSB 3W9DB 1ASPA 3K46A 2C1OA 4NSKA 4LSQH 4CC1A 4OCWL 3C8DA 1J05A 1MHHA 1OZTG 1CFSB 3EW3B 3HPLB 1DBAL 3ECUA 4LSVL 1RZFL 5EEZA 4PIBA 2DWYA 3N2JA 2CJ3A 2DDQH 4PP1D 1U3HA 1UKSA 5LDSA 3HR5A 5BZZA 1OWWA 2DWEB 3QDGE 4YDMA 4TTDC 2WVTA 1S4IA 4M29A 4Z7QF 1F3DH 2CK0L 2A9MH 5C0FB 4FQLL 2F19H 3HEIB 3I6KA 3MCKA 1PLGL 5KSVB 4GP8B 3QQ9C 4F37K 2EZ0D 1ET7A 3FT4B 5E95B 4TSBH 4GUPB 4A2FA 4AJVA 3NSJA 5CIPB 2XETA 2ZUWA 3ALPA 3CZGA 2WXHA 2DQHH 5DT1L 2Z9TA 4DN4H 3KWVA 2A0LD 4XC1L 1HZHL 3AQXA 3T0EC 5EDXA 3TH4T 2K6WA 1UD8A 4NQDA 3ZT6A 2FJSA 1IC5L 4GFXA 3TESA 3P4MB 1Z1WA 4TNVF 4XNYH 4LL9A 3DV4A 3NIDE 1SOKA 4UT9L 3RKDD 4KRMB 1MFEL 2GI7A 1THAA 4Y5VC 2Z4QB 4O02H 2GFBA 3VA6A 2JLLA 1DQKA 2BOBB 1CDIA 2D7OA 4IMKC 4BA0A 4X5WB 4Q56A 1AO7A 4KMLB 4QT5A 3VXNA 2BNRE 4FNTA 5DRXA 1JZEA 3CU7A 3EH3B 3MRFA 4DERA 1LDPL 3H55A 4CKVX 1CWVA 3CFDA 2YD0A 4UIMA 2QKIC 3NPZB 5GRUH 2DD8L 2NZ9C 4KJWD 4I1RA 4Y9GA 1HCYA 4G5ZH 4AMKH 1BZ9A 3HI1B 4S0HA 3NCMA 1XX9C 2XPYA 3UIYA 1I1FA 3SQOL 1ZLDA 2Q3AA 4TLSA 3S96A 1PX4A 4L4TA 4NERA 1V3MA 3ARED 5IFJB 4DPBX 1EO8L 3MOAL 4O51B 1FDLL 4MAUL 5ITFB 5KSUA 1RP8A 1Y6KR 3CFQA 2XTSA 4N2FA 2Z93A 4HISA 1VFOA 5C7XH 1UUSA 4X4YB 4KFZC 2PCYA 5E7FA 5AKTA 1J1PH 4OF5A 1USQA 2CUAA 2EC9U 4ZXBD 2F58H 1I8IB 2OXGB 3VRIA 3RHWK 4RMUA 1FNSL 3VGAB 1MY5A 2NYYD 1EQWA 2GJZA 4UM9A 1U8HB 4JQIH 3WFBH 1RUPH 3FCTB 2N56A 2DH2A 5BO1L 4HZ1A 4XCYB 1BYNA 3GDCA 2YXVA 1A5FH 1UB6A 3MREB 5I75B 4G7YL 3UPRA 3PWUA 1UJ3C 3NSCA 5F7YC 4AV5A 1XCQA 1BVLA 3LNFA 2EDMA 3GS4A 3ZT7A 3WKMH 5LAPA 3LRLA 3MROA 2FWOA 1V8HA 3MRLA 1M6OA 5DURD 3GINA 5KBMA 3L3DB 3D4YA 1AYOA 5HDQH 3RFZB 3BKYL 5EC1B 1CBJA 3G5WA 5J57B 2IOOA 1WC7A 2RFXB 4Q2ZB 1UB5B 4FQQB 1WDAA 3QUKA 2J6WA 2B0SH 2WW8A 1RCYA 4NQCB 2YK1L 3LVEA 4I48B 3VMOA 3Q9PA 3ORJA 3CLFH 4NRXB 4PJIE 4XWOD 1BG9A 1OT4A 4JQVA 3TVMD 4G6ML 5IFHH 4XMPH 4GSUA 4G43B 4KDWA 5KVGL 1DQTA 2NX5E 2X28A 3D4CA 3MLSH 5JHDB 1KULA 4XMLH 1JK8A 4JFDE 4CC4A 4M02A 5I1KH 2PCPA 3B37A 1J8KA 2XZQH 1RSFA 4EAEA 2YJLA 3SBWA 1DEDA 2VDMB 1UM6L 3DETC 3VFWB 1CLCA 4RGMB 4JFZH 1Y0LB 5HBBA 3KVPA 3TWCH 4XXDA 1R3IH 2A4ZA 5CJQH 2ZNXA 4XCEB 3IJYA 2NNRA 1TT6A 3CSBA 4LRIC 3D39B 4OLUH 3ZDWA 1KB9J 1XF4B 1QTPA 4HIJA 5IW1A 5JDSA 2A5UA 1OCZB 3DO3A 5CSZA 3VACA 3BAXA 3ZKMC 1P84K 5KS9B 1T5WA 1YY8A 6TAAA 4NZUL 5B8CA 1QUNA 3R4RA 3RUGE 5FO8B 4GKNB 1H19A 4WO0A 1JJUA 3AS1A 1FVEB 2NXYC 2X70B 5T3XE 4PJEE 4N2MA 4ANUA 2IIJA 4Q6IC 2BCKB 1FCGA 2W0LA 5E9DD 1ADWA 4Y19E 3KE0A 4HVBA 2VR5A 4P5KB 1W0YT 2CH8A 4JY5L 1I1AD 2F19L 1I85A 3MRRB 1HKFA 2X4SB 4HD9A 5F1IA 4L05A 3EOAA 4PBVC 2A9DA 4FQ2L 3RNKA 2QQKL 3L1OL 5CP7B 2JIXB 3E8UL 5DJYA 1SOSA 5FCUH 1LVEA 4ZZFA 2Z7ZA 3PFQA 4S11A 1IGTB 1HI6B 1AZNA 2FCBA 1SJVA 2RJMA 3HZVB 2JKSA 3CPLB 3COOA 2IEPA 3EDKA 5AZEL 3X1FA 4YXKH 1X9UA 4I77H 1AQDB 4E5XA 2GSGA 1H9VA 4UTAA 3CFUA 3H2WA 4UV7H 1BDYA 5GIRB 4F37F 4CW1B 4MAYD 3D3VB 2EVHA 3VFOA 1DE4B 1XGQA 2VDOB 4O9HH 3TTSA 3WFEL 2ADIB 3FHQA 2X4UA 1DEEA 1I8AA 1GXEA 1MOEA 1PIGA 4R3SA 2WTOA 1MI5E 5B38B 2EVJA 1T66D 5AALA 1UOLA 3FCUB 3JUYA 3QUMA 4Y4FC 5IGXH 3HC2A 4MQTB 4NAQA 3GLZA 3QT2A 2R1WB 3GMQA 2BNQE 3L3OC 3QJSB 3PIQA 3Q8CA 1L0YA 1PZUB 1M71B 4IYKA 3NFNB 3K2IA 5AVXB 4JRYD 5GS2D 3IK2A 5GGSY 4IBSA 3UYRH 4BZ1L 4JFFA 4ZUVB 5J3HC 5HJGA 1FDLH 4MAUH 4NCDA 3PDDA 4W1TA 1U3HC 4GPVA 2RBLA 4BSWB 5C0CA 1UACL 4GB9A 1UOKA 2XTJB 4LQ1A 5EC2A 2FSEB 4DHLA 2R7EB 2QVTA 1I1CA 2F58L 1SHWA 5F1NA 4JBSA 1F11B 1CL7L 1L6PA 4QRRE 4R7VA 3LTVA 3VWJC 3GMQB 5F6IB 3SE4A 3WS3B 1X5HA 2XWCA 5KYUA 4LEBA 3N41B 1OCWH 3KL5A 3EDJA 3EIFA 2YGOA 3RWGB 2NY5H 2V7HA 2J20A 5DFVC 4I3SH 2BIPA 4P9ML 2Y7LA 4X6CF 5F8QC 3VFSB 1XR9A 1GCFA 1JYXA 1PG7W 3WNPA 4PWIA 3OWRA 3HLKA 1NOAA 4WWID 2WV3A 3QG6B 4X4ZA 3G5YA 2JJVA 3GKWH 3I9GH 5LG6A 1W2KT 4HJ1A 1HQ4B 3B8YA 3K74B 1U8KB 5B38G 5F9OH 4WU7B 4AIZA 3ARFC 4JQXC 4YE4H 3WHE1 2OZNA 1CYGA 1GSMA 3FU5A 2QMJA 2D7PA 2LU4A 2Y6SD 3NIDB 4X4XB 3ARXA 2A6DB 2HVJB 3FUEA 1G5AA 4Y9FA 4EIGB 2X4SA 3ENEA 4NIKB 1GHFH 3MLSL 3TBYB 3E3QC 4P5KA 4PP1C 5I1KL 4K7PX 2EVIA 5JUEL 5F7MC 5AAPA 3BSZL 1MJ7H 2R59A 4HF5H 5DK2A 5HDLA 2A74A 5DJCB 1FVEA 3LEVL 2WMPA 4F20A 1MAMH 1CC3A 4NFCA 1YJDC 3VFVA 2AZUA 3CSPA 4LEXH 4AH2A 1N6QH 3JZYA 5FO8A 2O6EA 3HIZA 2P8PB 3K8KA 4A6YH 2CLVA 4FABL 2PYEA 4JFZL 1FZMA 3L95B 1HEZB 5DA4A 2QJDA 1ACCA 1TVBB 1BVKA 3OKNB 2R0LH 5GGSA 3SGJA 1ZXKA 1U91A 2GJ6E 3SPVB 1XF4A 2ZOWA 2A0LC 5AW6B 1D2OA 5DC0A 3ECBB 2A6JB 3O81A 4NQXA 4YR6A 4BEIA 3S3DB 2A6IB 1B6UA 2CDGA 4GLRH 3SGKA 4NDMB 2EIEA 3MGOB 2E6QA 5T1MB 5ISZD 2YGVA 3DLQR 4KX7A 1KN2L 1XZ0B 2DZEA 2Y25A 5E7BA 1AOHA 3SYPA 1TSRA 2DV6A 3WG7B 1P7KB 1EZLA 3O6MH 4HFUH 4WWOA 1A6TA 1N70A 4F33A 1PS3A 4QXUL 4CSTA 2OI9C 1XSKA 1NOLA 4LU5L 3BGFB 1VPOL 3FSZA 2APXA 5K9OA 3QIBB 4LSUH 4JKMA 4DVRH 2EYRB 3ULUF 2HMIC 5JHDA 1NBZB