3D33A

Crystal structure of a duf3244 family protein with an immunoglobulin-like beta-sandwich fold (bvu_0276) from bacteroides vulgatus atcc 8482 at 1.70 a resolution
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
101
structure length
94
Chain Sequence
PVKDVELDGRWDDNCPITVFTDGYLLTLKNASPDRDMTIRITDMAKGGVVYENDIPEVQSAYITISIANFPAEEYKLEITGTPSGHLTGYFTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Domain of Unknown Function with an Immunoglobulin-like Beta-sandwich Fold (YP_001297618.1) from Bacteroides vulgatus ATCC 8482 at 1.70 A resolution
rcsb
source organism Bacteroides vulgatus atcc 8482
molecule tags Unknown function
molecule keywords Domain of Unknown Function with an Immunoglobulin-like Beta-
total genus 16
structure length 94
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11589 DUF3244 Domain of unknown function (DUF3244)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3d33A00
3D33A 3SD2A 4G5AA
chains in the Genus database with same CATH superfamily
4OFVA 3I50L 4HJTA 4IQHA 5I1KH 1YPZB 4PJEF 2QQLL 4X0KA 1Q0YH 3T9WA 1I1CA 1D9KC 1IC4L 2A7BA 1CFTB 4M1GL 4P5TA 3QC5X 3BDYL 3F8UB 3ULSA 3X2QB 2D3NA 2WCGA 4N9OB 1EAJA 1DLHA 3DPDA 5CJOH 2V9TA 5C09A 3AU1A 4YHYC 4N9GA 1M7IB 3CLWA 1CGSL 2R2HB 4OZHA 1OZTG 1JIBA 1XMEB 1XGQA 1NINA 2E27H 1GCYA 4JO2H 3UYOD 1GAFH 3FCTA 1XD1A 3BKYL 3NIDF 2B15A 4PLJC 3O6LL 1RK0A 2BM3A 3P9WB 1YEWA 1A21A 2BIIA 2DLEA 4AZ8A 5E00A 3C08L 4L37A 4G8IB 5F8QC 2OYKA 3CFBB 1JV2B 5BS0A 4NO0D 3T2PA 4WY7L 1YUKB 2N1TE 4MCNA 4PRDB 4K4KA 3QQDB 4WU7A 3MBEA 2DQGL 4LHUG 5KSAD 2XKNA 3GRBA 4XGZB 1HSAB 3ALWA 4HBCH 5DXWA 4B53A 1CBVH 3DA0A 3KLHC 1QACA 2W1NA 3BZFB 2JJSC 4M3KB 2FH6A 3CHXA 1RZGA 2BVQB 5AVRB 1AD9A 2X10A 2VC2L 5D5MF 2DN7A 8PAZA 1LNUA 4UAOB 1KCSL 3GRWA 2YPVH 3EFOB 2HT2D 2JQZA 4LCWD 4AIZA 5F8RC 5BMFL 1AO7B 3NPSC 1H3UA 2YLHA 1Y07A 3MAWA 3MV7B 4XPGL 3DTXA 4N2NA 1KG0B 4FDWA 5FYLE 1DVFA 2J2ZA 4OFKA 1KN4H 2RGSA 2HX9A 4N8PA 4Z1PA 4GKOA 1HQRA 1UT2A 4BH8B 1D6EA 2PO6C 2X4SA 3EYVB 1LD9B 4QHLB 4WAFA 5IV2B 4GLRI 2GHWB 5F21B 5GGVL 4AQ8A 2Y5TB 4B9PA 2DS4A 1FV1A 5IJKA 5AKTA 3CDFA 3WTYA 3O6FA 4CVUA 3QSKB 3F04A 5ESQA 1XHHA 4P2CG 4YHLL 4JRYA 1QI5A 3COOA 2X4PB 3VI3E 5CCJA 4HMCA 4NCC2 1TKWB 2ZXGA 2FL5B 3GDCA 5H37A 5L8JB 4NUQA 5JO5B 2AC0A 2FRGP 5IQOA 4F33A 3HE6D 4H20H 3SN6N 1I7UA 4XPFL 3OJVC 5IK3A 1I7ZA 3MR9B 3WKPA 4NENA 3EYSH 2FCBA 1O9ZA 4AQ8C 2VMJA 4XP4L 5MHSE 4ZUTA 3SEPA 4DEPB 1SQMA 2HN7B 3MTXA 4G8AC 4D9RE 2WZPD 1I8KA 2O6CA 2V2WA 4XHQA 3UBGA 3ZE1B 1BLNB 5F1KC 2VDOL 3GT6A 3B9AA 3UX9B 5BUGA 3G5XB 3W82A 1MFDL 5KBDA 4HETA 2OLDA 5JPMC 1H9DA 1CD1A 3ZTEA 2BY2A 4P5KB 2R29A 2OXGB 3T6ZA 2BIOA 2VMCA 3MLTB 2FECL 1Q72H 4Z3JA 5JW4N 3PQYD 5ALCL 3SBQA 1CD0A 1C16B 4OI7A 1EIBA 5CGTA 4FNSA 1K85A 1EGJL 4W6XB 3RWGA 2MJWA 3ZGIA 3ZOAA 4FADA 5KYYA 3BJ91 3HNTL 4XX5A 2WWMC 1M1XA 1VESA 3FZUC 3GMQA 1A6AA 4AOFA 5HYFA 3US1A 2FJSA 5GRJH 4PSPA 3P3TA 1UCTA 5DJYB 3TT3L 2VXTL 3GSUA 4ZPTB 4NRXB 1WBXB 3P54A 5C97A 4EUPH 4H2CA 4DVRL 2NY6D 2V17H 4FTVA 4ZUSA 1ZTXE 5AB9A 4HUUA 5EU4A 3O2VL 2VAAA 2FZ3A 1YN6A 4U4BA 1LYQA 3FN3A 3Q5YA 1U8PA 4PB9L 3OHXB 1UD6A 3Q1SH 2DZEA 4JG1H 2YRLA 2V5TA 2VAAB 2WLIA 4K23L 2O5YH 4UV7L 4WEBH 5HI4C 3RILA 2GCYB 1OM9A 2K0RA 3FH7A 4CKQA 4ELMA 2FVNA 4FQXC 3D25A 5J12B 4LKCA 1R5VA 5I6LA 4LPVA 4DAGH 1P7QD 2QPUA 1P5UC 3SOTA 1S9VB 2JI3A 3ZN6A 4C55A 3ZUCA 3V4VB 4XOEA 1OK0A 5AVZB 1RJYA 2AEPL 3VGFA 2A6IB 4RQQB 3ZL2A 1KCVH 4YSEA 3GMLB 4PJIB 4OQTH 2DWDA 5CSGA 5FKAA 2QV4A 5KBKA 2VDNB 4G8GD 1BWWA 2H47C 5FV2A 3PGCA 1MJJA 3TA3B 4HHGA 3JWNC 1QPPA 2WO4A 4G6KH 4Z7UA 5HHQA 1RHHB 1HEZB 3FF8A 3F6JA 2DD8H 4MWFA 1NIAA 3NIGE 4KKRA 2BRQA 3G6JF 3M8OL 5I76A 1UATA 1T1WB 4YHKL 3T0EC 4K7FA 4BA0A 2FB4L 1EHKB 1E9OA 3EGSA 1A64A 1E6OL 5BOPA 3OGCB 3UPRB 3X11B 3FSVA 2ZX8A 4QI3A 1E3FA 2W65B 2WQWA 3ARQA 4JS7A 5DQDL 4G5ZH 4PJ8A 5D8JH 4APQB 2ZCHH 4UDTA 1I3UA 4OUUB 1EZSA 1XIWA 2C34A 5KYNA 3SE3A 5GJSL 3NG5A 1G1CA 2APVA 4X6DE 3QIWB 1A1NB 2FHBA 3ZRFC 2GT9A 2NY0C 4F8LA 4IIQC 1UHVA 2DLIA 4ODTL 4X4XA 5CEZD 4PJXB 3GXMA 3SHSA 1I9RH 4AIEA 12E8L 3DBXA 5MENA 5JHDB 2HWZH 4ZODA 1C7SA 5FYKH 4O2FB 1O7DE 2Y3NA 3DROB 1T21B 1YMME 1OCCB 1GY1A 2AMUA 2ITDB 4ALAH 4N2LA 1CG9B 4D8PB 3HKZA 1BBDH 2PW2B 3RWHB 1LO5A 3WY1A 1MFEH 3QZMA 1FHNA 1ZA6A 3F3HA 1MIMH 1PG7X 1MCQA 5HY9A 3OPUA 2P80A 4PGCB 7PAZA 4OZIE 1IFGA 1I8LC 2NY3D 5D93B 5C2BH 5EBMB 2IFFL 2K7PA 1T1ZA 3L3JB 1JP5A 3MCG1 2Q76B 5GGSB 5GHWH 1MG3C 3EO1A 3TZVC 2NZ9C 5JXED 3QXDB 4KHXH 4J3OG 1A7NL 4KJPD 5C71A 1CLZH 4WSGA 1YQVH 1H0DA 1VFAB 2QLVB 4QRUA 2ZZUT 3F7LA 5TJWK 1IEHA 3MGTB 4HCRL 1D3CA 5M94B 4MJIE 2HG5B 4H44C 1F6AB 1NC2B 2UZXA 5FYJD 2QKIB 3KLAA 4GLRH 2HTLD 4KKNA 5HDWA 5H94A 4ESKA 5KG9A 1PZCA 4HUWB 5E1IA 3Q9PA 5GRVK 3OD3A 5E9DB 4RZCA 1YNKL 2YGOA 15C8L 2EIMB 2CR0A 4G6MH 2VYRE 5CJQL 1RMFL 2EDRA 4QNPE 1F3JA 1KIRA 1B4JH 2WKLA 3UG3A 5L2KB 2WINA 2IBZX 1I1YB 2AABH 2EACA 3IM1A 4QF1B 3NJVA 2ZAIA 4F8OA 1SN2A 4KRPC 1TZAA 1XZWA 3QUYB 4YJZL 2GJJA 3VWKD 3BT0A 1SVZA 4PWGA 3AU0A 3MRDA 1U6AL 2OMZA 3V10A 5IEHB 5IQ7H 2A9NH 3IDNB 1SUHA 4L5FL 3OJDA 5AAPA 1QI3A 4G8GB 4BINA 5I28A 3LNIA 3CCHB 1AQMA 3UP6A 3WIFA 1S9XA 2FQGA 2OL3A 4ZUVB 4ZJ9A 1HZHH 3ZU8A 4NLAA 1JGIA 5DJ8B 3DJSA 1HQ4A 1IEBA 2HRPL 4NN7B 4AENA 3A6CL 5KYXA 2YWZA 2ZUTA 4IS6B 3HC4H 3PQYE 4FMVA 3TBWA 2XC8A 3MA7A 4I3GA 4NT6A 3RA7L 3AY2A 3BT2L 2GBAA 2DKSA 1XGPA 3KJ4C 2D7QA 1M42A 5IQ9A 4JM2B 2DBJA 3S9DB 2H0PA 4ZAKC 5HPMA 1FNHA 4A1RA 2K8QA 2XN0A 3CN4A 2C1OB 4MJIA 1G4MA 2R39A 1RPKA 4R7VA 4WTQA 3KM2A 4FABL 3N40P 3B7UX 4MZ3A 4PRAA 4KKAD 5EZPA 4NC1E 3NT0A 4YDVB 5IM7A 1NMAL 2DLFL 3GMLA 4PJIA 1NBYB 4RRPG 2FR4A 2X4TB 1R3HA 3T0EE 4KZEL 4R0LA 5F9AC 1AE6L 5F7EL 3MLXH 3K71A 3VI3F 4EN3D 2LU3A 3WUZA 3G08B 4Q89A 1E8WA 4U6YB 3LN5B 4FEIA 4PJFA 4XH2B 1INEL 1EWHA 3HS9A 1MCDA 1OAYL 4YSQA 1CJYA 4TNGA 5K39A 2CO6A 3VFSA 3WNOA 5IB2B 1NDGA 3BP6A 1UUSA 4OM0L 3TPUB 4PV9A 1C5BH 5IHHA 1N64H 3HMXH 2DEWX 5FGRA 2BLFA 4AH2B 1QSZA 3ZT5A 4NB7A 4NPYB 4RGNB 2W65A 1IGCH 4WI2A 3VCLB 3JWOL 4FERA 1QUNA 1ZPLA 3CG8A 5MENE 2F9BT 1RK1A 2DI8A 5A43C 5A40E 1AP2A 1DCLA 4LARH 4TYUA 3TWCL 5C0RL 3VE0B 4ZW7A 4IBWA 1UQSA 3RFZC 4AVHA 5CZRA 2HJLB 2ZQKA 3IPFA 3B9KC 5E70A 3VE0A 3CZEA 4G9DA 5D1QB 4PAZA 3IMBA 1JS4A 1B0IA 4J3SA 2XN9B 1SYVA 4YBQD 5EOTA 1XCQB 5I1IL 1BAFL 1JGVH 2Z31A 4I0PA 2R9HD 1JVLA 3BI9X 1NGYA 4QHNB 4YNYA 2AXFA 4AIZB 2Y6SD 4QAMB 5T1DL 3KS0J 3QJFB 3L3HA 5DRNA 1A66A 2F19L 1MRDL 3D1MC 2DMCA 1EHLL 1ANUA 2K6ZA 3MJWA 3O3EB 4WGVB 4Y4KD 1FGVL 3O4LD 3HZVA 4P0DA 5HYSA 4JQXC 3VG0L 1FL6A 3JWDH 2XTLA 5JOFB 4LSTH 1A3ZA 2AV1B 1IGIH 3HZVB 4KI5E 5JDSB 1NBVH 3QRGH 3LKQB 3QDMD 3NZHL 4XPAL 2KQMA 2WLLB 4LOUC 3ECWA 2P5WE 4V11A 4JFFB 2X38A 2NY4D 4J5VA 2GK0A 2FECI 2L8AA 1DBBH 3FO0H 1A7BA 3N50A 4P3CH 5E2VL 2XN1A 5DUJA 1JGEA 3S8WA 2FL5A 1DR9A 2JCCE 3VYNA 3EZJB 1V27A 3CHSA 3CZSA 1L9OA 3KBHE 4Z23A 5EIIB 4BQCA 1TVHA 1E27A 4X5WA 3TH3T 4H0GA 5DD1H 2MIZA 3TEYA 3DURB 4MLSA 2KZ1B 3TF7C 5AZUA 3DIVA 3BC9A 4JMNA 5I6XB 2YRZA 2J43A 2F61A 5I23A 4OF3A 5I30H 2X4RA 5E2VH 2CRZA 1NBQA 1TO5A 5LDUA 4PJDF 1KTCA 2GHZA 2JB6B 3FU9A 3RNQA 4O4YL 1N59A 1B88A 3X13B 3N43F 1NOLA 1T6VN 4TSBH 2R56L 2P5EE 5CXPA 4DP6X 1GZPA 1ILUA 2HTKC 3ZDYF 4GRLC 3HPJB 4U1KB 1JZGA 5LAXB 3I9PA 1KXQE 3OAZH 4YDIH 4H5SB 5SWSA 3BX7C 2MNJB 2QSCL 1Z9MA 5KEZA 3SGEH 1TEGA 2Z6FA 4IBTA 4OQTA 5C6PB 3RDTB 4GAYA 3GS4A 4U1LB 1NGWB 1KIUB 2AFNA 1S5IL 3FTSA 4R7NA 3ABKB 4W9JC 4WGKA 2OPCA 4LCIH 2IQAB 5F0MB 2VLLA 4HLJA 1JYNA 2UY7B 4RX4D 2OV0A 1YN6B 3MJ9L 1DLFH 3VXUB 1CLYH 2ZUQB 5EBGA 2PPEA 2DJ4A 4HIJA 2WSKA 3C6EA 2O30A 4FTVB 4KTGA 1TU2B 4QYAA 4HUXB 1JZ2A 3VXSD 3LQZB 2W0FB 3QUKA 2BSDA 5J6GB 4FFZH 2LHAA 5DRWB 4QHUA 3IMUA 2NDGA 1DBKL 2A74B 2VQUA 1IGCL 4KNQA 2I25N 3EHBD 4YL9A 3II3A 4XNMA 1BM3H 3QIWD 3FB7B 1XGTA 1QG3A 3HUJF 2A74A 4IK6A 4NO5B 3ZTCC 1HKFA 5IF0B 1BJ1J 4PVNA 4ZX5A 5INDB 5E2JA 1N5YL 1CFSA 4JEGB 1NDMB 5JPNA 1CS6A 4MAYC 2Y6TE 3C60D 2OMTA 1UEYA 3CFTA 3Q43A 3QRLA 3D18B 3DX9A 3QDJE 4JQVC 4WJKB 1XBRA 2XA8L 5JW3H 2AEQL 4G9FB 3MSPA 1FNEA 1A8ZA 4PJBB 4FYRA 4N90E 1AE6H 1OT2A 2ZKMX 5HDBB 2ZJSH 3E2HC 2ZXAA 4N2BA 5F6HI 3PWUB 1B0WA 2P1YA 3QUZB 4X9FA 5F1IA 3VSTA 3SDDD 1MCPH 3ESOA 4XAKE 2A9ML 1J5CA 2EDTA 3ZE1E 3TIDB 4F15B 3OC5A 3KR3H 3QQDA 4DHLA 1NCWL 1Z5LB 3R4RA 1UA7A 2R4RL 4KTDH 5KUKA 3DWTA 2VLRA 5C08B 2RTTA 2XWEA 3FQTA 3QDME 1W15A 4JDZA 5AL0A 1TETH 1MFAL 3TYGL 1KLUA 4MJHA 4U1NA 2VSMB 3UJTL 1I31A 1UZ8A 2IH1B 3HA0A 3O9WC 1B2WL 3AJ7A 3RQ3A 5DJXB 4W6YB 5L4JA 1B6UA 1BIIA 4AQAA 4S1QL 1URLA 2NR6C 3PUCA 1R5IB 2ERJB 3A4FA 4IJ3C 4XP5L 3ETBF 1UYWL 3L5XH 3U6RA 1NLBL 4QKXB 1PX3A 2OZ4H 1DQLL 1L5GB 4AXWB 2IOIA 4MD0B 2YD2A 5CEXA 1EO8L 2DWXA 2GJPA 3VGAB 3VGAC 2BVEA 3S4SA 1UTDA 2J8UA 2F7OA 4PY7B 3K5RA 5CP3A 2CUHA 1JJUA 4N20A 1TTBA 2YAQA 4PYHA 1BQKA 1F4YL 4TVPL 2BPBA 1FYTD 2JKJA 1FNGB 1EEYA 1Q9OA 2GY7B 3F65A 3VXSE 3BDXA 2W5PA 4NBYB 4F58H 4FG6D 3GIVA 5ENWB 1G6RL 3IJ9A 4IOFC 5C0GA 4LLVA 2NNAB 2VITA 3GKWH 1JHTA 3MRMA 1E2VA 1LLAA 5ABZA 4EIZC 2YS4A 1YG9A 3K1DA 4YDVA 5IM7B 2KPNA 1VEOA 3DO4A 4RGOH 3ATDA 3P1VA 1IQWH 1BFOA 3QH3A 3CXFA 3U4EB 3HW7A 3BUYA 1NDMA 4LFHD 2PTTA 5B1JC 1J9RA 2OR8A 3ESMA 4JHUA 3U9PL 2JF1A 5EIQA 4W9FC 3K7UA 1QSED 4CU7A 2J88H 4LSPH 3VU1A 1UT1A 4IRZH 3QARA 1IFHH 3HG2A 3O6FC 1SXAA 2BNQD 1SDDA 3CLFL 4J27A 3T6VA 1RZJC 1QNIA 4HJGB 4NAJA 2XWRA 3DV6A 2BWDA 3AGWA 4OVUA 1X5YA 3H9YA 5IVXE 2ARJA 2GJZB 4JG9A 5DT1L 5E8DH 1PX4A 4RMTA 5B1KA 4LPTA 4G8GA 5D1QC 2CLZA 3IRCA 2PP9A 2QT6A 2G2NA 2J5LB 2OM5A 2OJ1A 2P5WB 4RIRA 3T4YB 4KI5C 1S9YB 3QZPA 1TQWA 3QT2A 5D7LE 3WFBL 1E9QB 2AXFB 1RIUL 4CC4A 3T8XB 3ZR5A 4IEFA 3ZE0B 3BAYA 3GMRA 5E8NB 1FCCA 1FG2B 4GIAA 5DJYA 3TEUA 5DLML 3OBAA 1OAXH 5GS0L 5HI3D 2IPTL 4LBEB 3GMPB 2IGFH 2X89A 3U4KA 1MCFA 1NCHA 1XIWD 2P44B 2CDFA 4HIHA 4K3DH 3S35X 4NZ8A 4FFZA 1IGFH 2F58H 3CWGA 3X1NA 4FQQA 1EDYA 4GSDL 4B9JA 2GK0B 2P5EB 2V7NA 4IHOA 4W9CC 3T65A 4XP1H 3LKNB 1QSFB 1VFAA 3BP5B 3NSYA 1GIGH 2N7SA 3UTQA 2MNWA 4RNRB 1PLBA 2DQCL 1JVOA 3GXIA 3MRMB 2EKSA 2EJ1A 1KEMH 1JXJA 5CHNB 2X1QA 3DMMD 2IQ9H 3KVQA 4X80H 3S96A 1ZLDA 2KZWA 3AG3B 1OP3H 1OALA 5CHNA 3FK3A 1C7TA 1MW2A 2K9UA 4HT1L 5GGQH 1B2YA 2DM3A 4ZX3A 4XNDA 3GQFA 5KOMC 1TJHH 4OVVA 3CTTA 3VFMA 3ARPA 3NJXA 4APXB 4OGAC 5TFSH 5I1DB 3OAUH 5EUOF 4FP8L 4X5XB 3FQYA 3ZSTA 3IWUA 3TASA 4YXHL 2ZCLL 4HV8A 2I9TB 1XF5A 4O00A 5FWQA 4NNXB 3SQBB 1LP9A 2IOOA 3VACA 3HMWH 4JY6B 4PW9A 4N26A 3KE0A 1QA9B 1TJGH 3Q13A 3TCTA 4DKFL 4HFUH 4G7QB 4JG1L 4B9IA 5L88L 3LQAC 5EC2B 4HD5A 2H6UA 5E99H 5DHYA 3IFPA 1SLVA 5DC9B 1RZGB 1J0ZA 2NR6A 3LD8B 2O6EA 4AK1A 2G9KA 2E86A 2QGBA 4LOFA 2VERA 4G1EB 5EN2B 4AQAB 1AJ7L 1U21A 3TOPA 3CPLB 2E6QA 2J8UF 3TX4A 3VFTB 4DUXA 4AYEC 3ZKND 1R24B 2D7PA 4HAKA 4LLQB 3UERA 3SY0A 5IHLB 3WAKA 1QR1B 1S9YA 4HWBL 4GSXA 3MREA 4NO3A 3MUHL 4MA8H 1E30A 3ZHFA 4X6DF 4BFIB 5ALCH 4HKBA 4Z7QF 5GGSA 3RHWF 3L5WB 3FB6A 2WQSA 1KPVA 3QXVA 1UJ3C 1P4UA 5D2NC 2BNQB 4UAOC 5CN1A 5DHVB 3EXJA 2WB7A 1F00I 2AJYH 3KPTA 3VFWB 5T3XE 1OTTD 3BGFC 4TMPA 3KPSD 1ET7A 2OX5A 5KUMA 3QDGA 4MHHG 5EOCL 1WJ3A 4DW2L 1WTGT 3BW9A 2D2CC 4QLRA 1X5LA 3CQFA 3U36A 1A7RH 4UBDD 4Y5XC 4U1MA 2WXHA 4OLZH 1GYAA 1QYGL 2IV9A 4OM1L 5KSUB 4KKBC 4JJ5A 3M7FB 3G04B 2BP0A 4P9ML 2F08A 2QFPA 5I17A 2Q6WA 4GI6A 4LQFL 4OSUH 5I0VA 1S7TA 4NHCH 1KXTB 4BFBD 3H8NA 2PUQT 3MRFA 3VI4E 2OTUB 1X6LA 1ZAGA 2OMYB 2UY6B 2C7FA 2XZQL 3ENEA 1NL0H 3H4HA 4UNVA 5D9SA 3WCYA 5HHXL 4MJ5A 3LQAH 4PGDA 5EA0H 3U1SH 1N26A 5BRZA 4PWIA 1ZY9A 3AG4B 1PY0A 5FCSH 3KYKH 5C08A 3RX5A 3J07A 1TJGL 2CNYA 3KLSA 3PGDA 4B7LA 3EOTH 2VR3A 1VFBA 2Q9OA 2CRYA 4QR7A 3VQLA 2H4EA 3ZUNC 3WIIH 3WIFB 3F62A 4JCLA 4P23A 3MRKA 1QVOA 4G2AA 1A3RH 1MI5E 2ARJB 2ZTBA 4AV0A 3SE4C 3GMQB 3FQ2A 4KZ0A 5I66B 3SKJL 4LFHG 1SYSB 1EBPA 1N6QL 2H32H 4GQZA 1EXUB 4P2YA 2IWEA 5FUZH 3KGRA 4BXSV 1X7QA 2J8UB 4PY7A 5FFGA 3QR0A 3U2SA 2AJZB 4IBVA 1YY9D 2WBXA 4RFNB 1NC4D 3MA9H 3DMMB 3JSSA 4B9KC 4BBWA 4O2EA 3NK4A 4K5LA 4JZJC 2AXJA 2IPUK 3S35L 4NM4L 1SEQH 1CGUA 4O58L 2OTWA 4YPJA 4EDWH 4HJSA 1XGTB 3CIQA 2N59A 1FVEB 2BRRL 4I1RA 4L8CB 1RSFA 2W81C 2OMVB 3CVHA 4MDIA 1R5VB 2YN5A 2PR9A 1JNHB 4PJ7F 3ASWA 2EEXA 5F7BA 3DSFL 4JRLA 4HHWA 5D7JD 4C4UA 3SZKC 3BVVA 1NCDH 5DMJB 1TCRB 2R1WB 3BKJH 4H26B 4NM8L 5G4MA 2DF3A 1NLDH 2ENPA 4U1HB 1WTLA 4NNYA 4ADGA 4C4BA 4NOFA 2BIPA 5KSBB 2YWYA 5DLMH 2J7LA 4FNQA 1WIOA 3RDTD 4MRCA 4MNGE 1KJMA 3L1OL 5DUMH 3GRGA 1PCSA 2VXUL 3V5KB 5CBEA 4UQEA 3PCYA 1CIUA 3VNYA 1M7DB 2FX9L 2VKXA 4Y5VC 2JV6A 2R9HC 4POUB 4LPWA 2IDCA 2YRBA 4M9OA 1BBJA 4R2GB 1W0WA 1X5AA 5CJBA 3SDXF 3QUYA 4DP9X 1ZLWH 1RHFA 3I50H 1T66C 4A37A 3CU1A 3GO1L 1JF1A 1P7QB 1HOCA 1R5WB 3GXTA 2HKFL 3ILQC 1K6QH 4QHKI 4X6EB 4G82A 1CFNA 5ITFB 5E8DL 1TQBC 4I3SL 3U7YH 5EWIL 2VXSH 5I1DA 1KV7A 4Q6IA 4J3OC 1FJ1B 1T3FB 4MX7B 1H8LA 2EDWA 2EDDA 4QXUL 5F9JB 3DUSA 1R5IA 3PWPE 5B8CB 1TZIB 4QT5A 5JHLL 3I6SA 2YGQA 1SOSA 4JFFE 3QIWA 1P6WA 3RFZA 1TZGL 1S7WA 2Z65C 8CGTA 1CXFA 4GMTL 4IYKA 3QZNA 1JK9B 1UM4H 1UKQA 1X9RA 2B77A 4MNQE 4HEMA 3TBWB 1AC6A 3HKFA 5FO8B 4X4MA 4BSJA 4XC1L 2E7LA 3TN0C 3UJJH 1D7BA 2RMNA 4FNPA 1E4JA 4OZ4A 3N0AA 2XVKA 4Y0GA 3U6XS 4LVHB 3T2NL 4MXQD 4UILH 3CSPA 1GHFL 1P5VB 2R7EB 3MRCB 4WEMB 3L5JA 1XGYL 3IXAB 5SWQA 4N5EC 1BQSA 5F3HA 5H8DA 3QFDA 1YYLH 2NMSA 4FFYA 2L04A 4C56B 2ICEC 2Y5TA 2QHRL 1KCKA 3BEWB 1U95B 5HJDA 1OCZB 3APCA 4XWOD 4NQED 1G6RH 2DIAA 3QR1A 1IUZA 1R3HB 4FMKA 3P4LA 2OMTB 1SFHA 1AY1L 1LO3L 4M8VA 4P2AA 2A73A 4M4RA 5L6YH 1JNJA 2OI9C 4S0TD 1Q9WA 4L9DA 5E23A 2PN5A 5HGDA 1BVOA 4QRAA 3GSNH 1Y1DA 1YYML 3EJYD 4OQ1A 3SOBL 4ZRGA 4HXBH 3V8OA 4JRXA 4S1RH 3D7PA 1LK2A 3KPRE 5FM5M 1JHKL 5EHFA 3SBPA 4KK6D 4DCQA 2XTJD 3D08A 5D1XE 1YNLH 4RISH 3SDCC 5C70A 2R69H 3DX7B 1FLRH 2DWEA 4HZAA 1P7KA 1YEDA 2ZT9C 2LE9A 5E2UL 3QORD 3K6OA 3OR7A 4CBPA 1N2RB 3EADA 5L9DL 2APWA 3ORJA 3WFZA 4ACPA 3OXRB 4IU3A 4NIYE 5FDWA 3GSQB 5JIQA 1ZHLA 3CFCL 2Y6SC 4JGNA 3NCJH 3RWJB 4JO4H 2ILLA 2JELL 5FXCH 5CBAA 1DFBL 2WZ6A 4Z3GA 3LTVA 5I1EH 1FVCA 2EVIA 1JYWA 3M6DA 3REWA 3IDNA 1FJ1A 1T3FA 3CMOL 3DOIA 3HPJA 2LAGB 1Z9SB 7PCYA 3GBNL 3SYCA 4NI3A 1P4BL 4WV1A 1Q0EA 1L7TL 4ABVA 3DGDA 5EBLA 5I8EA 3T8MA 2I24N 1N7MH 4YZWA 5HYSG 3VGGA 2AQPA 2YQGA 4HKZB 4IGBC 1NGQH 1C08A 4R7XA 5DEJA 3VMOA 1E3XA 2DLHA 4WI5A 2BFGA 1YEEL 2BCKB 5CUSH 1V54B 2DQDH 3GPSA 4GKLA 4X98A 1TENA 1CWVA 2AKRB 4WCYL 3WE6A 3IGLA 5FA4A 3SE8L 3A0OA 1J9CT 1ES0A 1SY6H 2YHGA 4HU2A 5DQJA 5DS1A 1XH1A 2IH8A 1PLAA 1XVSA 2A4ZA 2I07A 4K15A 1OCWL 4Q8BA 4U6XB 4WLCA 3T4AC 3IXAA 2QEJA 1F3DJ 1BM3L 5AVQB 1DUZB 1JPTH 5D72L 4M93C 1OB0A 3REVB 4OV5B 3PWNB 4EI0A 3PIQB 2CJUH 3TBSB 1ETJA 1QUPA 1G7JB 2QGDA 5E2WL 1U58A 2FATH 1MFBL 4JPIB 3TJHD 1KULA 2RJMA 4FLRA 4I18B 1TVBB 2EDQA 1ZTXL 2YUXA 3HPLB 2B20A 4RMBA 4QRRA 5BRZE 3PJNA 3VB9A 4KHTL 4L48A 4MBOA 3DPBB 1J05A 1QWNA 1CB4A 4Q52A 5CLYA 3NP4A 3ARDD 1CLYL 5I76B 3VYOA 1E2WA 3PGFL 2FBJL 3ZTJG 1A4AA 1EAPB 3OGOE 1JN6A 3HHSB 2OTPA 2XIIA 1I8LA 4NUJB 2XWBB 3BQUC 3NEOA 3FSOA 4NQSB 3MRQB 3U9UA 1F8TH 1S5IH 2ADIB 2B1AL 2LGNA 2X9WA 5IVOA 4URTB 2IH1A 4HIXL 4IOIA 1E4XH 3B7TA 3P4MA 2YXWA 3S2CA 1VA9A 4LOEA 2MTPA 2CO3A 3IMWA 4K8RH 1NCOA 3QUMH 2BXZA 3ARGD 4NAQA 3V6FA 1LO2L 5FHBL 1UWGH 4ZDHA 4P2OC 2PO6B 1RFDH 4ZFOL 5IGXH 3RX8A 4TSBL 1XR9B 4WUUE 1JFHA 2EH8L 4N2OA 4AL8C 5JHAA 1THAA 4MDJB 4PWFA 3AFLA 5B1BB 3NOIA 2Q8AL 2X2IA 1J8HE 2A6DB 2GW5A 3EW3B 1CURA 5I30L 4ZOEA 2EYRA 2ICCA 35C8L 3D39A 3WG7B 3SGKC 4G71B 5FA3A 5ISZB 2IF7A 3KYAA 4PG9A 5DD1L 4ZFQA 4PLNC 2DL2A 3D39B 4PBDA 5FO8A 4PB0L 3VFUB 3MRIB 2YGVA 4PP1C 4AJYV 1T0MA 1L7IH 1NUFA 1YA5A 4M48H 3RTQA 2V3FA 4KK8C 4NCDA 2XBZA 1FE8L 1IQDB 2BW4A 3EYUL 2BOCA 4MZRA 3WEAA 4GG6B 1HH6B 3HC0A 4JG0H 3KHOA 3O3DB 4GXVH 4DEWA 4ZMZA 1KBKA 3CVHB 3G5WA 3KPOA 1E7VA 1MW1A 3LXBA 4TNEA 4DGIL 3NZHH 4BSWB 4EZLA 3B2VL 4ADIA 1OP5H 1KB5B 3FFCB 3HG4A 2AJXH 3HJEA 3Q8EA 4U1MB 5T33H 3QYCA 4W81A 4WW2F 4JGJA 3TO2B 5FKPA 3VFVA 3BW9B 5EU6A 1BYOA 1OB1A 5D1QD 4PY8I 4M9PA 3DVIA 4HPYH 3BO8B 4A7GA 1BQLL 2IAAC 2WBKA 4TSCL 1DSWA 1JUFB 5CN3A 4WO4B 5HJGA 4QEGA 3DURA 4HK0A 4L3EE 4Z7VA 2UZXB 5CGYC 4R97B 2NR6D 3V0VB 4PJBF 1T4KB 4WU5A 2WNKA 3MRLB 2HVJA 3PHOB 2ROYA 2VDQL 1RH8A 4U1JA 3GMNB 5T5FA 1ZANH 1HIMH 1WSST 1LEGA 3UTSA 5D5ME 4QOKD 3WKMH 1GOHA 2Y7LA 2IIJA 1JPFB 3TCLB 5D7JA 2VDML 5IVXF 4OCYL 2YD1A 5BQ7A 3WY4A 2H1PH 2QTEA 1RJLA 4XMUA 1ZT7B 5ERWB 4J6IA 3ABLB 3LDBB 1CQYA 2HLFC 1AOHA 1FC2D 1IT9L 3GSUB 4KKPA 1KACB 1LDPH 1XGZA 3DX6A 5DGRA 3D34A 1MRFL 3KJ4B 2NXZC 3STBA 4DKEL 2QQNL 5E6RB 5B3SB 1OLLA 2VMFA 2FSEA 5E8NA 3U0PA 4L8BB 2NX5E 3NRQA 5JNYA 4FNTA 3AT0A 4YO0A 2UXFA 1X5KA 2NXYC 4LSVH 2QLYA 4OLVH 4XNYH 4JANB 1SYVB 1AFVL 1WDAA 2EDMA 4ZW5A 5EU5A 2EIBA 1AACA 1MG2C 5DRXB 1ZS8A 5CSZA 2LVEA 3QNYA 4XP6H 1OF0A 1P4LB 3WTWA 4B5ZA 5HHME 4DGYL 1BEYH 2YBRA 2YZ1A 1IGTA 2XPGA 5E94B 4TXVB 3LRSB 4P2RB 5JW5A 1JCVA 1WFNA 4FQ1L 4CILA 1AZZC 4I3RL 2XFXA 3WENA 3H85A 1QFWI 3C8KB 2UWEB 1IFRA 4JKLA 4WHYG 4FZEL 5CZVL 1UZGA 2XKSA 5SX5K 1BOYA 3BZ4A 5AENA 1LDSA 5C0BE 4LCVA 4UQCA 3S5LB 5LGJB 2CDFB 4S1SH 5AQ0A 3KWUA 2F5BL 3M17B 3FQUB 4PJHA 5ETUA 4MXVE 2CXGA 3F01A 4FTVD 3MLYH 5GRYA 4BZ2H 2VLJA 4FHBD 3BN9D 3H56A 3VQ2C 3FOLB 4NNPH 4XVSH 4KXCA 1HKLL 3BYTA 3PY9A 1BFTA 5E6IB 2IJ0C 1BAWA 2P48B 4UZGA 3G6DL 1WE5A 1HAUA 3E0GA 3INUL 2E59A 5D7IB 3W57A 2WBJC 1ZLUK 1QQDB 4MD4A 3P11L 3GLAA 2LW3A 4P9HL 1KCUH 1M9SA 5HDQH 3D33A 3GJFH 2NXYB 2WQXA 3BD5A 3LSOA 1P7QA 4L1BA 5IBUB 3VFNA 4AH2A 4JGUA 2P42B 4PV9B 5JIKA 3L5IA 3QQ9D 2VXQH 3BDBA 3F83A 5HI5C 1HYSC 3JQOB 4Q2ZA 3OZLA 3D09A 4M5TA 1A1NA 1ITCA 1MH5A 4Y2NA 4MAUL 4TUOA 3UP1A 3KDMA 3OV6A 2NY1C 1F4HA 2R4SL 4KNTA 3HNVL 2RFXA 3ZE1F 1H8NA 4PIBA 2WM0A 3LKPA 1QBAA 3OKKB 2AJ3B 3GM0A 3CFKA 3HZKB 3ZE2E 2NY1D 4N2GA 3ARBD 3MRPA 1UXSB 2WKOF 1IILE 4GXVL 4F7MA 2R29H 5I0WA 4G43B 2QBWA 4YHIA 2EYRB 5DVPA 4QYOB 4IDJH 4KJWC 3U7WH 4CU6A 4B3EA 1MWOA 3BPCA 2X4NA 4JFPB 5DJ6B 1KCRH 1YQVL 1MVUA 4A2LA 3MV7E 5KWYC 2GI7A 4PJ8D 2ZONA 4X5LA 3ZYOA 1Z6JT 5CLWA 4L8CA 4KHXL 3KLKA 4E9LA 3AS3A 2BNRA 4IIQB 5G5DB 4YZFE 3KCPB 3T0WA 4DUVA 3LZFH 2E3VA 4AVJA 3MBWA 3LKOB 4JVUA 4XNBA 2Q7YA 1Q9WB 3BUDA 3BCFA 4NO0B 3NA9L 4MRBA 5B7MA 5FKAB 1B3IA 2Y1VA 4HGKC 4MXWL 1UWGL 4N6QA 1RUPL 2OA9A 5GRZA 4KFMA 2NTFA 3CBKB 1LTXA 3E2HB 3V6BR 4EF3A 3BIKA 2OYLA 3K0YA 3A6OA 4HIXH 4WKZA 1A9EB 4NQDA 4KITB 1JYXA 5FYKL 1F8TL 5BNXD 5K59F 4ZTOH 2HWZL 4MCMA 3OAYK 5KVGL 1I9RL 3R1GL 1ZEAL 1CXLA 3VB8A 3WLBA 3MRRA 3U1QA 3GM8A 5D7IF 1MWAA 3F00A 3WU1A 3O3BB 3KWVA 2TSBA 2M8XA 1T5XB 4QXGL 1GZPB 1I1YA 3PAVA 4F9PA 2K6YA 2V9QA 5ID0A 1J0JA 1YEKL 4M8QA 1H3XA 3O11B 2N01B 5IWLA 2MWCA 3C87A 1GZHC 1JI1A 2CO2A 5E2WH 5FFOA 4HHAB 2OZNA 3CFDA 4YHOL 4BWTA 1OAZH 4LAQH 4ONGL 4PWEA 1EEZA 1FZOB 3WHXA 5GS1B 1BJMA 1AH1A 3C5JA 2Y7NA 5I1HL 3Q05A 1T0NA 2H8PA 2A38A 1IL1A 3ET9F 2CA3A 2DQHL 3EJPA 4WI8A 2AF2A 2EH7H 2X9YA 4LVOB 4YHKH 4QPEA 4XPTH 3MV9B 4G7VL 4IRJD 2RCSH 1G5GA 3M1CA 4Z76B 1JWMA 4Y16C 1PEWA 4XXWA 1E9QA 1WS8A 4WUKH 3VXUA 1XB8A 1RI8A 5AVYB 4D0CA 5IFJA 5DF0A 5GRXG 2DAVA 4WNQA 2ATKB 2DTMH 3WJLA 4AEHL 1CU4H 3RDTC 4HGWB 3DV4B 3C6SB 1KCVL 2AQNA 5J6GA 2H2SD 4FNLH 4TF4A 4EZJA 4Z7IA 4HCRA 4I9WD 4IMLA 4M62H 1EHXA 4HS3A 3NSDA 3WD5L 2Z9TA 2XV2A 2EDHA 4I18C 2FEEI 4JPWH 1T04B 1HL4A 1VJSA 2BIMA 4S1SL 4YE4L 1KLGB 4FXTA 3AWGA 1EBAA 1IBZA 3GMMB 3PWVA 3GDBA 4PGDB 3EGSB 1G9NL 5F7NC 3OKDB 3F5WA 1J18A 4OJDH 4Z5RB 3QHZL 4XCNB 3FCUB 1P7HL 1B4TA 4U1GC 3GSVB 3GI8L 1F0LA 3T0DA 1HNYA 3RTQD 2XV0A 4P8QA 4XCNA 1CLOL 1I8UA 3JV0A 5TDNA 5C9KA 3AU1B 2NTSP 1RHHA 1HHKA 2H1XA 2R69L 3P4MB 3L2MA 4I85A 1DUYB 3L3KA 1ZSHA 3FHAA 4KJQC 4LL9A 4QJ4B 2ADIA 1I7RB 3CDZA 3FU7B 4G8FB 4OFQA 2VLRB 3ARGA 3M07A 4OGAD 4OIBA 1KWKA 3IS1X 3AXLA 5DJDB 4LSVL 3D50A 4XNYL 3BLPX 4Y19B 1F11B 1GMIA 3UPRA 2BMKA 4O5LH 4JFVA 1JTPA 4OLWL 3N5AA 4OKVA 2G2PA 2QQNH 3RKPA 4UNIA 3V5DA 2BMKB 4F57L 1PF3A 3VH8B 3MBEB 2J5WA 3NACL 4AM0B 5FGBC 5IROD 2FLMA 3C5XA 3T3PB 1KZYA 1KN2L 3ARRA 3CD4A 1DE4A 3QJFA 3AREB 4NP4L 5JORA 2AQQA 4NKDB 5LBSL 4YK4B 5L4FA 3MLYL 4BZ2L 3UO8B 3ZDXB 2G3MA 4KJPC 4YR6A 1MAKA 2O26U 1WBYA 4DPAX 1V3KA 1A6PA 1UM5L 4FXGB 5CSZB 3C2SA 4HMEA 4P2QE 4BFOA 2OFQA 3FB7A 2CXKA 1Y18B 1FG2A 5D2NE 5IZ7A 1IM9A 2B0SH 4BZ1A 3V4PA 3D12B 1ZIAA 4NT6B 2IDSA 2BC4A 5LDSA 3O2WL 2FWLB 5IIEB 3GIZH 3LY6A 1JNNH 4W9ZA 5EFIA 1B9ZA 4A68A 1DQJA 4HIIA 4DGYH 4JFFA 4X6FA 1YPZA 2CJTA 2ZUSA 4PJ7B 1NCJA 3QWOB 4WI0A 3QQ4A 3NMEA 5HDBE 1U95A 5H35B 3S34L 3KWTA 2HKFH 3NVQA 1RJCA 4GG6F 3MNZB 4D0BB 5AOZA 3CX5J 2JJTC 1WFIA 3WYRA 4LDOB 4HUMB 1LJMA 4NENB 2LVCA 4GT7A 2EDLA 3IJSB 4D2NA 1EA9C 3IMRA 5CEZL 3D39D 3UDWC 4FLQA 4YN3A 1WZKA 4LEXH 2Q8BL 2DQIH 2NX5D 2VM3A 5CLZA 3S7GA 1P7BA 4F7CB 3MYZA 2FE0A 4Z78A 4ZQTA 4R3SA 3RWDA 1OOWA 3BUBA 4KXDA 4WW1B 2E7LC 1CDJA 1R4XA 4HJ0C 4U3CA 2WGNB 5EULV 4AL8H 3MLZL 1ZGLP 4UINL 3RWIB 3HFMH 1OGPA 2W8CA 1EGJA 1MHCB 5LGKA 2OR9H 2P28B 2XPYA 4PMEA 1CC3A 2VR6A 1HIML 3VXUE 4MQSB 3ZPDA 4GQQA 3T1WA 5I1AB 2QMKA 1FN4B 5ALBH 3ULVL 5E6UB 4HIJB 4K8RL 1SEQL 4IGBA 4PH8A 4JFDE 4JVWA 3LZOA 3BEWA 4L1SA 3MOQA 1DJGA 1NBZB 3MFFB 5HDOA 2JB5L 4AKPA 5F3BA 1OOAA 2GTWA 5DJ2B 1X9QA 1E28B 4HPYL 3N85L 2BOCB 2V33A 1FNFA 3DNKA 1IC4H 3TVMA 3QUYC 2BSBA 3QFJA 4RFEA 4WNQB 1FIGL 1AXSA 1Q0YL 1RZ8A 4H25B 1ETZB 2BDNL 4JCMA 2H32A 2YAMA 3PABA 4OCRH 3CDCA 4Y5VA 2V5YA 5I1GL 1U8MA 2AXHA 1AHKA 3RB7A 1G7QB 4L0YA 4Z7OB 1ZTXH 4KNUA 1TCRA 4H26A 4DERA 2YR3A 5DURD 4JG0L 3H7BB 1NUNB 4Q0XL 3IJHB 1FE8H 2VB5A 5HPMB 1FG9C 3FYEB 4HH9A 5MERA 4ONFL 5CINH 5C9JB 2QKIC 3LIUA 2FJGB 2X0WA 3MYJA 3AZUA 2H7WA 1JHLH 1XF4A 1GGIL 1IBGL 3MGOB 1RURH 3E9TA 4TULH 2WO3B 1NICA 2KUTA 4JKKA 4PLJD 4WCYH 4ALAC 4I18A 4JKWA 2ZSVB 3ZKMD 1WO2A 4FJYA 4OLUH 4K5NA 1YEEH 1S46A 4HP5A 4HH8A 3BPNB 1B3JA 2VMEA 3ARSA 3BSZA 3K6SB 4QRQA 2IG2L 1OTUC 1JGUH 2H6PB 4U4IA 2WUBH 2Y5EA 4UV4H 4DPBX 3WJLC 3BVTA 3QEQD 2VR7A 1E6JL 3RIFF 4JQIH 1RVFH 3RPKA 1FGNH 2JJUA 4QHPA 4R4NC 2J6WA 3FSWA 4JFWA 2F53B 4Y16A 3EZ8A 3MLVH 2Z4TA 3L9RB 5J1AA 3VXNA 3CX5K 3JVFC 3MV8B 2H3KA 3WIHH 3ZDYB 3PGFH 1PBYA 4F9LA 5GGTL 1R3LA 1GS6X 4XE0A 2WQVA 1YMMA 1MFUA 1C8QA 4R2GD 3N06B 1VGEH 5MENB 4KHTH 2VZSA 4UTBL 3FYIB 4H4NA 4X7SL 3GXPA 5E2UH 2PTUA 4AM0Q 1E40A 2WK2A 2X4NB 4TQPA 5I8CA 4ECNA 3P69A 3IK2A 4I4WA 4FQHA 1MFCH 3VFRB 3D25B 2X3CA 4K9EH 1ZSDB 4Z7UE 3U0WL 2AJVL 3FUIA 3K72B 1AGFA 1PZBA 4G7YL 4MA7H 3C9NB 4RGND 4ZI8A 4DPRA 3QJSB 4FYQA 1TJIH 4ZUUB 5AAWC 2FAUA 3BD3A 2L4OA 5FM8A 4Y5VB 1KYDA 1ND0B 2ZSWB 5E51A 5CUSL 5JXEA 2D7OA 4M5SA 1LO3H 4OGQC 4YXHH 5ACZB 1UGNA 5E6IC 5LGYA 1NGQL 4NXKA 4J3OF 2DM7A 4PP2A 4BFGA 2AITA 3WJMA 4CSZA 3PWUA 3PHQB 5LUMA 1UZ6F 1XSJA 1AXTL 2G3XA 4DZ8A 1JZ5A 3D0VB 1LVEA 3A24A 5DSCB 4QTFA 3OB8A 3O2DL 1ADQL 4ELDA 3E8UH 1TTFA 4H88H 2CCVA 1NGPL 4GKNB 4NPKA 3O2DA 2IQ9L 4IBSA 1OP4A 3S5ZA 5DO8A 6FABH 2VWEC 3HS0A 1IKOP 4ZW6A 1CD1B 1DSYA 2L3BA 3UJJL 3ROLB 4AC4A 4OD2B 4P2QB 5ILTH 1LM8V 4RFOL 4JO4L 5J12C 4GXUN 2Q1EA 3B9VA 3CN0A 3LD8C 2CGRH 1HHGA 4TTDC 3ZRCC 1I9JH 2DY2A 4BGDA 3ABMB 4Y2DB 2W0LA 5C2UB 1SRDA 1I9IL 3KHQA 3SODB 2DQ6A 2VDKL 3RTQB 5KN5A 5IT2L 2IGFL 3P4NA 5L4IA 4X7TA 5CU5A 2XG4B 4J23A 2OK0H 4P2RE 4C54A 4CAGA 3BIAX 5DJAA 5HHMB 1JHKH 2FWUA 3BQVA 1OANA 3KWXA 2WKGA 4RDQF 5T1LD 2PNDA 1XXFC 4B95C 2OMBA 3DV4A 1KPVB 1Q9OB 3L7FA 4M4PA 4WEUD 3RVWC 3VXRE 3F7RA 1JRHH 4XMKH 1JVKA 1T6WA 5DD0L 4QXTA 5C6TH 4ZNCD 3CBJB 3HN8A 4G6JL 1E42A 3U82B 5BJTB 5JXAH 3ARFA 3AWEA 3P0VL 4DH2A 2PXYD 5T3ZD 3BN9C 3NP3A 3LKNA 3LMJL 5JIHA 4D3CL 4EJ1C 2A6JA 5KAQG 2MCG1 3L1OH 1KUMA 5DT1H 3FT3A 3GHPA 2A6JB 4KK9D 2VLKD 4R7LA 4F24A 2FYYB 1S2EA 3U4BL 4LLYB 1MQKH 1A7QH 3GSVA 2OQJB 1KXHA 3Q7JA 4Y2OA 1IBYA 4K8RD 4PJ9A 1CD8A 3CLFH 2HN7A 5HYJB 2MH4A 3MRGB 1UA6L 1E9PA 2E7BA 3NZ8A 4Y9GA 1TPXC 4HEME 2PTTB 5BQ7B 4TUJA 3BFOA 4N3TA 4EZMA 3GMOA 5JIIA 1CPUA 5CD5D 1DQDH 1QNZH 4KFZC 4KVPA 1OGAB 2C9XA 2VQ1A 1OHZA 5LNDA 2CK2A 3H9HA 4APXA 5A16A 1XO8A 3SPIA 1NKOA 1W0WB 1WCQA 4NM4H 3EGDA 4X5PA 4V33A 1FRGH 5DSCA 3MO1B 4XHJC 3WO3B 4APQA 4ZMPA 1IQWL 3GXFA 2AVGA 3FQXA 4FMFA 4TS6A 1HXMA 4KUZL 2ZUUA 1ADQH 1CF8L 3SKJH 1WIUA 3B2DC 2F5AH 3HNSH 2D8KA 5KS9A 4BCZA 2XQYK 3AUWB 5B8CA 3W37A 2YD6A 1U3YA 1N5AA 2PR4H 1Q94B 1WEJL 1BFSA 2DM4A 4ZOBA 1AG0A 2P52A 2N7AA 4JHZA 3FTVA 5I1AA 1CYXA 3NPSB 5GGRB 2WXRA 3QUXA 3DMMA 1AQDB 3MXVL 1J8HA 1ZHBA 4TLKA 2N0MA 4XB8A 4EDXB 4QJ3B 2JJSA 1IIIA 4XTRD 3FCSB 3AS2A 3FUMA 1TO4A 2JNZA 1E4XI 1TQCC 5F93C 3I74A 4LAJH 3OQRA 2B2XL 1K4DA 1AS8A 3I6GA 5F1NB 3L54A 5C0AE 1BXXA 3MI6A 4LKXA 1NL0L 4E0RA 4YHIB 1OE2A 1U8IA 3KH4A 3WFHA 5IHUL 1PYWA 5BS0D 4N8CL 3VFGL 4ADJA 1GC1L 1AQ8A 3QDGD 1I85C 4LQFH 4OSUL 1VGEL 3BCDA 2I32A 3RIFK 4DGWC 2DTSA 1EO7A 2DYSB 5KSAA 2ICES 1IO4C 3LHAA 2EDYA 2XN9D 1RJZA 1A7RL 1AXIB 3NABL 3BAJA 3MKKA 1VKXB 1U8HB 3GS0A 4QRSB 4CGTA 3SDYL 4HWEH 1SOKA 2VW7A 1G84A 4QRRE 2ZSWA 1KNOB 2B1HH 2A9AA 3Q2CA 2A4EA 1K9TA 1F56A 2WLJA 1RU9L 5I71B 3E8UL 3GBML 4LCWA 3WMPA 2NTFB 4MB1A 2WZ5A 2JKRM 2WUBL 3VRLF 3NJJA 4FS0A 1CGXA 1FAIL 4U49A 5ACMA 3A4EA 4OFYD 1F3JB 4YFLF 5JUEL 4P5KA 2VUOA 2MQCA 5HD8D 1O7VA 5B39B 1OD9A 5HVGB 3I02B 2AK4E 3V6ZA 2AEQH 5JIDA 3VXQA 3AXHA 3C5JB 5E1AA 3T2LA 1T03H 5E8PB 2R27A 1RUML 3IYLW 3SO3C 3QVAA 2LT9A 3M86A 2ATPB 2IXQB 4RMWA 1F13A 2ERJC 4MA7L 3QJVB 3GJFA 4HS6B 3UYPA 3GSRB 5AW5B 3X3FH 1ADWA 3O4OC 2DPKA 5AUMA 4BHUA 4PRHB 2YEQA 2YSSB 4EI6A 2YN3A 4GUPA 4NJAL 1DBKH 1HESA 3FCBA 3MRNB 3VJ6A 1A14H 3D4CA 2Q7AA 1JGDB 4AZUA 1HJCA 4GW5A 4N2EA 3CX2A 2CBQA 2ZCLH 1TVDA 3CPLA 1BFVL 2X3AA 4CC4C 3SPVA 2ZWNA 3X1EA 3FUDA 4WHTA 4Z8FH 4LSUH 5CD3B 4OCRL 6TAAA 1E28A 4U05A 3LS5L 5AW9B 1HL9A 3EJZD 1JCKA 4HZ1A 4CL7A 1H3PH 3WIHL 3EJUA 1FIGH 4NQCE 1R19A 1XX9C 5CR8A 3EYVA 1RU9H 1DLHB 2N56A 3IDIB 5JHBA 4FZ8H 3WTTA 2W59A 1N3NA 2JXMA 3OMAB 3Q1EA 2Z4QB 3IDYC 3O8XD 4AV5A 2NYKA 4KRPB 3EH3B 5JPNB 3K5SA 4PJCB 5CN2A 1E4HA 8FABB 1N3NB 2JXMB 2QSCH 1HTYA 3KPPA 3IFNH 3JT2A 4XXDB 1H6TA 1SVBA 4M61A 3F58H 5GRVL 3R8QA 4NFCA 1AQKL 3D87B 1JRHI 2J1KA 4PS4L 5FYJU 1KTKE 5DD3H 4CN4A 2V9RA 3SDCB 2P8MB 4BE6A 4PJCE 4OLUL 1I7ZB 1KLGA 2WWKO 3HFML 3KW7A 5AKRA 4TOYH 2IPTH 2CLVA 1QFPA 2XKNB 4TULL 1M2VB 4CN6A 3IGAB 2CLVB 4U6HB 3KLQA 4UDTB 1V8HA 2FIKB 4HCGA 4EUPA 4L4TA 4W9GC 2V5RA 4MSWA 5DZOA 3FFCD 2PO6A 2ICWI 5EV7A 2IADB 1YEJH 1AO7E 4NHUB 3MMEB 4CSTA 3VXQB 4JKPL 4NQEE 3Q0HA 4JHAL 5DURB 2F0CA 3JWDL 4QF1A 5GIRA 4IBQA 3HNSL 1HL8A 1QSFD 3BRFA 5EBLB 2D0HA 2EIZA 5I8EB 3DGGB 5DA4A 3NIGF 1EHLH 5C3IA 5IB3B 1RZIB 3ZL4L 3JTTA 1X9UA 4GRLA 1Y18A 1X4YA 2CRIA 2OMUA 5DJCB 2B1OA 1XGPB 4O51A 5DK2A 4BIKA 4Y7MA 3O2WH 1ETA1 2KPWA 4UTCA 1VGKB 4NKIL 4E41A 4X4KA 1UB5B 5FK9A 4CW1A 4P2QD 4XCEA 1P1ZB 2UUDK 5C0BA 4Z7UF 4LO9A 3ILQD 3VSUA 3E8VA 5HDRA 5BV7B 1M7UA 2C9PA 3CU7A 1WA2X 2E74C 5DJ8A 3WNKA 2ITCA 4ENEC 3HVNA 4PRIA 4QRTA 1F4XL 1G7JA 4HXAL 4AY0A 4PJ6A 4JLRA 3H3PH 3JWOH 5K9OB 3MLZH 4MAZA 4RGOL 1JDCA 3VD7A 1JD7A 3GXUB 2B9BA 3NGBC 2JIXB 5KBPA 3QNXA 2WPGA 4ODVL 4WIQA 1IC1A 3FDWA 3HS0C 4A2MA 2GITA 2ZE0A 1ZHNB 3JYCA 2E75C 4M6NH 1T2JA 2BVOB 4HJ0D 3IMVA 1SN5A 5DQ9A 3WOVA 1XAUA 2G0KA 1T80A 3OL2A 4M29A 4AKQA 4F58L 1RZFH 2QSVA 4OLWH 3BKML 3G04A 3HG1E 4G6JH 2XU9A 3D2UA 3VGBA 1YEHL 4CNIB 3P40A 1I53A 3FU6A 5E1GA 3GJEA 5E6IA 4LHQB 3WNMA 4Z77B 5LG1A 1M3IA 1Q9LA 3PWLA 1FSKC 3ROOB 1PG7H 5C0JA 2PCFB 2D3JA 3IE9A 2BNUA 4EI5C 5KZCB 5C3LD 4DJMA 3ULUD 2Z31C 4WHYH 5CZXC 3E7JA 3CH1B 3U2IA 6PAZA 4DESA 3WUWB 2YO3A 4JDEA 3CZLA 3KPSB 2B7DT 3JWNE 4BSVA 2YQ2A 3GI8H 3QG7L 1EVTC 2ZNXA 5KANI 3TN0A 3QXAA 1B0RA 2HP4A 2E76C 3D5OF 2JTYA 3JV4B 2YJQA 2GUOB 1YAZA 5EEWA 3PV6B 3R7RA 1B2WH 4JFSA 4PG9B 3D4ZA 2Y0SA 1JZ4A 2OW6A 5DS8B 3RVXC 1JK9A 3B5GA 1MFAH 1FP5A 1BXAA 1RIVH 5IW3A 2C3HA 4MDIB 3A6CH 3SDCD 3W3BA 4ZD3L 3ZHKA 1NCWH 1S7XA 3GHEL 2BFVH 5DWUL 1E5BA 4JHBA 2ATKA 1D5MB 1NGPH 4M62L 1HHHA 1MWAL 2XZAH 3JV6A 4MA3A 2EEAA 2GJRA 2YPLE 3K4AA 4GRLB 1BD2A 3B5TA 5HHOB 4FEMA 1ET8A 4O2EB 2AW2A 2DIBA 4Z7UB 1NGYB 4QHNA 4XO5A 2DTML 5FKPB 2ZJSL 3FH5A 1Z9LA 1VFMA 4FFVC 4M4RB 4A7VA 4YHML 4JFQB 5L2JA 2VSKB 3PQYB 3HI6H 3APFA 1UASA 1G7HA 2XA8H 5JW3L 1BZQK 2RCSL 2VTFA 4P23D 1S7SA 4HX1B 1IRAY 2BSRB 4NN5B 5EF0A 5TQ2H 1BBJB 1UA3A 1JPGB 2OXHB 1EAPA 1PLCA 2DQHH 1SFDA 4WENB 4OD1L 2Q87A 4TPRL 3S5LA 2R8SH 2H2PD 3QUZA 5D4QA 3D06A 4JDTH 1F6AA 1ZVHA 5C0ND 1VZGA 3DLQR 4PCTA 2VH5L 1Y1UA 5F1SA 1DVTA 1KJMB 1LEGB 3UTSB 1Z5LA 4OLYH 4ILDA 3TPUA 3F6LA 1MHHA 5KSBE 4UNTA 4CC1A 3NEEA 5BS0B 1YEDB 2XWCA 1INDL 5D7IE 2VO8A 1Z0NA 4AZ8B 4UQ3B 3TO4D 3OB0H 3MJ9H 3UJTH 1COBA 1R3KA 3R1GH 1ZWIB 5T3ZL 5E1HB 1DEDA 1PJ9A 4ZTOL 2G9HB 1WPCA 1S3KL 1RULL 4LMQE 1HILB 2D3LA 2EYTA 4FULA 3QEHA 1AQDA 3QJRB 32C2B 5DUBB 4ZMWA 3QEHB 4MKTA 1GY2A 2I7SA 5GS0D 1BYNA 4ABUA 2OSLB 2R0KH 5I1LA 3O4LA 3MVSA 4PLKC 1D7FA 1BBDL 4KO9A 3KPOB 2DMKA 3U0TB 2P45B 5HJ3A 1GGYA 4WJG3 3EJQA 4G83A 4HFWB 3GSOA 1LP9E 3DBSA 4PHXA 5FHAL 3B9KA 2CBOA 4FQIH 1H5BB 7CGTA 4BD4A 1BVKB 3OKMA 1F4WL 2F68X 4CADB 5D4JA 5L0QC 2XJLA 5AYTA 1WIPA 3Q2NA 2AZUA 2WAQA 4FQQB 3V6OA 2C1PB 4ZMQA 1A9VA 1UD4A 4XNZC 2AQTA 3IRZA 5CF3A 2Z1PA 1AGBA 3ARTA 4LASH 1P7KB 4JREC 3GLDA 3GBLA 4PJ9B 4XPAH 1MFVA 3VRIB 1I3RB 4D7PA 1Z3RA 3HNVH 3UG4A 2R2HA 3Q6FB 2UZYA 4UU9B 4Y5XA 4EN3A 4PGBB 4LESA 3MRJB 1BYPA 5HP5A 1NIEA 2X40A 2CM5A 3HEIB 4TLTA 5KVGH 2IBZY 1KBWA 3G5XA 1FQ9C 3M8OH 3NCMA 4M7LL 3QBTB 4NUJA 3RB5A 1NJ9B 5HYIA 3QGVA 2D03L 2ZKWA 4MA1C 4JFYA 2WYTA 4H8VA 2D4FA 4DFIA 3AAZA 2HPTA 3B2PA 3INUH 1S9WA 1AHWB 2G5BA 3ISYA 4KX7A 2DYRB 2VERN 4FTVE 3KXFA 3L17A 2ICEA 5IBLC 2ZPKL 5LG6A 2HXAA 2WLYA 4XGZA 3PV7A 2L0DA 3M1BB 5MEPB 1IAOA 1F11A 4UOW0 3NRFA 2YD0A 5D1ZB 1U3HC 1J0HA 3H6JA 4BFEA 2K4WA 1O6VA 5GZNC 1DVUA 2YA2A 2ZF9A 4A2HA 3QWRD 5AUMB 2W60B 2PXYC 2ENYA 1B0RB 5F3FA 1WAAF 3PHSA 1S8DB 2VDPB 2IAMA 1NFKA 1DO6A 3LPGA 4F20A 2CIKB 3L9YA 4JFDA 1QAWA 5I73C 1MCOH 2PPAA 1UB5A 4FQ1H 1FDLH 2ZG2A 2X6BA 2R29L 2R2EB 1BEYL 2ZOLA 4X50A 1TZOA 1WBYB 5GSRB 4G1MB 3HG1A 2YGNA 1U9KA 3CFEB 3O6MH 4DTGH 2N4IA 4WWID 1CI5A 1EGJH 3IDJB 5B4MD 4YWGL 1P9MA 2UWEA 1U2HA 2DLFH 4UTBA 2DICA 3FU8A 2J21A 3PP3H 1KJVB 1BW8A 4Y1AE 2F19H 1KOAA 4O9HL 1ZGLA 5AYUH 1SNRA 4PRNB 2ENQA 1MRFH 4Q9QL 1W2KT 2TRYA 4M5YH 2Y07H 3QHTC 4NPYA 3VXOB 5IMLB 4ZT1A 2MQGA 4ABWA 4IOSA 1ORSA 1M56B 4F2MB 2VUYA 4XPHL 3TZVB 2HVKA 2X4OB 2ZSVA 1TMCB 1T4KA 2ZXQA 3FQ4A 2J56A 1AKJB 4OGXL 1A4JA 3TWCH 5KVFL 4HIEB 1FZMA 1JXDA 1R47A 5KYWB 4TTDD 4MBRA 3W9DB 1H15A 3N91A 4J2QA 3TONA 2WJ5A 6PCYA 5BVJB 3WHXB 3O0RL 3DUUA 1TZIA 1NJ9A 4UIKH 4Q6IB 4YDKH 1NWPA 3NACH 3VCLA 2VZTA 3RURA 2EIZB 2XFGB 4LPXA 1YC7A 3QPXL 3U0PB 1F90H 1EK3A 4UMGA 3ULUF 2K3TA 1A6TA 1PZUB 4L0ZA 1W6WA 1M3JA 1AO7A 4MMXC 4UOJA 1WHPA 5E8EB 3K8MA 3VX1A 3Q8AA 1VERA 4BXVA 1U92A 4QWWD 5C7XH 3FB6B 4BYHA 2KZBA 2X2YA 5CD3A 1J1PH 4X99B 4PFEA 4YC2C 2VL5A 1TQBB 1ZGLM 1T20B 3B3IA 1Y7VA 3SYPA 3VFPA 1HI6A 2WBJA 1HCVA 2VIRA 4QWWC 4PTUB 2XY1A 2G4EA 1PAMA 4DKEH 3W9EA 5GISH 1U4EA 2JMRA 5ADPH 1XF3A 3U2JA 3RVUD 1NCBL 1DQJB 4HIIB 2A0LC 4L0PB 1EFXB 1SM3L 4OZFH 3VSQA 2VR4A 3ZRSA 5ITBL 4XX1G 3CQPA 1PFOA 2DQGH 2R1XB 1J9SA 1K4DB 3CVBA 1HN1A 1XIWC 1G87A 5IWLC 1YO4A 4F9PC 4KJWD 1C5DB 5AW1B 4R5VA 5B1JA 3BQUD 2Q6WB 3C08H 1NOAA 2WZ0A 4OCWL 4HUWA 3W5NA 1ZANL 5EC1A 1UH3A 4L4TE 5EU6B 3SDAD 1RFDL 4J28A 5KANG 4CMHB 5IR1B 1NC2A 1QBBA 2XXFA 4MNGA 3HE7B 4NRZB 1MHHB 2Q3ZA 3AACA 2C3XA 1ECYA 1SMOA 4YHNB 3IN2A 1QRKA 1IU1A 1REIA 5IMMA 4OZFG 1VFOA 5F9WB 2CWRA 3B5HA 2GAZA 4OFDA 1R34A 1UVQB 4P23B 1VACB 4V1DE 1WHOA 1H3GA 1GJWA 2FBJH 1CGVA 4G9FE 1K8DB 3NCFB 3RI5K 3U6XA 5T33L 2WYHA 2HLEB 1NAMH 4QTHA 4L18A 1M6UA 1HXYA 4YGVB 4DO4A 5I1HH 5K9KA 3VFTA 5AOIA 4BUGA 3S88L 1LE5B 1HINL 3SY0B 1M4KA 3KBFA 4U1IB 5KN5B 3DJ9A 4XCCH 3FU5A 4XBEL 4BA8A 4LASL 5GJSH 3T04D 1BV8A 1YY9C 3W0WE 2WN3A 4O2FA 4NO5A 2P43B 1OSPL 2IWKA 3GHBL 2ZYRA 4B97A 3NJLA 4HVBA 1A1OB 1CN4A 3MJ7B 4IMKC 2CIIB 3EDFA 1WFTA 4E9XA 3O41A 4LLUA 3QPQD 1IVTA 5DVMA 1HZKA 1BQ5A 5ECGA 3D0LB 2V8LA 3QZWB 3LNDA 3MQIA 1PAZA 4PWJA 1U8MB 2KLTA 1Z5YD 1JZ7A 5E9DE 3BHBB 4P5TB 4GAGH 4OIAA 3TURA 4KAQH 4WFED 4OCMC 2NNAA 2VITB 3KH3A 3ULUL 4ZO6A 3ZTNH 5C09D 1VEPA 4ELKA 2BIHA 3FT2B 3HRZC 3TIDA 5G4OA 3RDJA 3DI3B 4QRRB 3Q8BA 3GTNA 3UTTD 2ZWZA 3CPUA 4PGZA 2FK9A 1U58B 4FAAB 4BJLA 5BRQA 1MCJA 3JWOC 5FGSA 4G9FA 4IRJC 4LEBA 2VLJD 4ZMXA 4KKBD 2H3NB 4LDEB 5JZ7D 4G8IA 2BJML 2PYEA 4KTEL 1X5MA 1OGAA 4GEJA 1WG3A 3CFJB 1XF1A 4XMTA 4GRMA 2VJXA 1TLKA 2DQFA 4XMWA 4XHJD 3BSZH 1OCRB 4GRMB 1EEZB 2CJUL 1FL3B 2XVGA 3RY6A 3L81A 3SDXA 4U1NB 4EQ2A 4NKDA 3Q8FA 1OCWH 1TXKA 1NM9A 2OCFD 1YEGH 3GF8A 2MQ0A 4GNKB 3PV6A 4IBYA 1CUOA 5F44A 5J3HC 3B7SA 1HSBB 2J3SA 5HYEA 4JY5L 2Z3FA 2P5WA 4RIRB 5TQ2L 3T3MB 3WS3B 4P2OA 4XXCA 1DVFD 1FYTA 4XMPH 5DHVA 4M00A 3MUGA 4UQAA 4ES9A 1BQHB 3IDGB 4Y4FA 4AK2A 4ONOA 4KQ3L 2MCMA 1UXWA 2GUYA 4JFZL 1G7MA 4NO2B 5E8EA 5HJ3B 4Y4FB 3MBXL 4GFTB 2QHRH 4Z7WB 1P4BH 2CA4A 1N8OE 5IFJB 3WS6C 2G2RB 2CHNA 1FH5H 4PJ7A 3QIUB 3TBTA 3LKSB 1BCIA 4NUGH 4DO5A 1T5KA 3WNIA 1QFWM 1S3RA 1ML0A 5DMGD 4ZXBD 1XSIA 2B3RA 3HE6B 5EZOH 2CD0A 2EIEA 2FQEA 3SO3B 2EUXA 4YAQA 3KCPA 3OM3B 1I3RA 3MYJB 4K23H 4LEOB 3Q1SL 4MJJA 4F7PB 3PDDA 5H2BB 2FYYA 5CKGA 5EPMB 1PZ3A 4YSAA 4DOHE 2PWEA 3P2BA 5FM5O 1JDAA 1GZQB 2YXMA 4F7CA 1HOCB 1R5WA 2OMNA 3SKMA 4N1HB 4YLQT 4W9HC 3R7QA 5I71C 2P9RA 4GKNA 3GMNA 3KAAA 3KMDA 3VFSB 4K71B 1AGDA 4WU5B 2IANB 4X7EC 4E9WA 5K9JL 3GO1H 4JE0A 3P77A 4JQXA 4NIKB 2JKIS 2KKQA 1A6ZB 1YYMH 5IESL 2W07B 3MDJA 1YMHA 4OCXH 3TVMC 1JXKA 1QTPA 3FS9A 4JM2C 3QCVH 4L29B 4XRCB 2OMZB 5E4AA 1AY1H 3WXWL 1MRCL 2NCEA 2Y7OA 3QIUC 1ID2A 4UBDC 5LLIC 2I7OA 5C3TA 2X0UA 1LDPL 2YD9A 1A6TB 3P4NB 4BRVA 1YCSA 1IT9H 2FSEB 4Y1AA 1CCZA 2TAAA 3TBBA 5C7ZA 3SDXB 4CSPA 3W0WA 2Z31B 3EYSL 4X8CA 1G0YR 2BSSB 3POHA 3RTQC 2EYSB 1NLDL 1YN7B 3H3PL 4OCYH 1P84K 1A6WH 2AQ3A 3I75B 1A0QL 2BSSA 1KY7A 2GY5A 3K6FA 1XB3A 1OT4A 3AC0A 2PXYA 4MDRA 1GAFL 4A7TA 1PKOA 1FPTL 4G6FB 5F96L 4ZNEA 3TO4A 4A6YB 3DRQB 4AITA 4ZW8A 4M1CD 4GMTH 4ZPVB 2MHAB 5AD0B 1F5WA 4MQTB 2FLBT 4TQEL 4KMLB 2G5RA 1EFQA 4U1HA 3REVA 2ZCKL 2EE3A 4AVKA 3KYMA 5EU6E 4JO1H 4PS8A 2VXSL 3QJZA 3J7HA 1BLIA 3WSQL 3MNZA 3BFQG 2FQDA 5LBGA 2ZP0T 4RAUA 1HDMB 1KDJA 1Y0LB 2AJXL 4PJBA 4N5ED 5J1SC 2OBGA 5IB4A 1OQOA 2XNAA 1L9QA 1NPUA 5D7KE 4ETQA 1IAIM 3MRJA 4YSCA 4IRJB 3EO0B 3RNKA 4N6RB 4IOIB 5GGRY 5JXEC 1W72H 1TPXB 3BE1H 1KJ2H 4JQVA 3N41F 5JOEA 2PCPB 3AT8A 2HX8A 4A63A 2N3JA 4XCYA 5FYJE 3N9GL 4KI1A 1FFOA 4WTXA 4MQXC 4NQXB 4BFJA 3QO1B 3QQ3B 4NP9A 4PJAA 4KXZH 4NKOB 3W2DH 1LWHA 3HZMB 1OXYA 4XMLH 5A6LA 4FE9A 3RZWA 4WWKC 3GSNB 1G0DA 2VM4A 1MJ8H 2J55A 1P4IL 3KNBA 4H1LB 4ORGA 5IHBA 5D71H 2E6PA 4IK7A 2Z8SA 1AQKH 5J9PA 5GZOD 4H1LA 4JO2L 1KT2B 2XQ0A 4P5MB 2D3VA 3GSRA 3X1FA 2EO7A 4ZUSB 1P1VA 4Q6IC 1DEEA 3NCXA 1WBXA 2GBVA 2NY3B 3OJ2C 4OGZA 1D7DA 4AT6A 4ZMVA 1EEYB 1X6NA 3K4DA 5LGHH 2DQTH 1NEZA 3H9SD 1MRCH 1U92B 3ESNA 3RKDC 5EU7C 1MZYA 2XN2A 1NBZA 3CJJA 3MFFA 4HUKB 5J4MA 4HZLA 5FUZL 1QI4A 3L3DB 3B1TA 4M02A 4NQEB 4CDHA 1QR1A 5DYOA 3BXNB 3WFHB 4GQPH 1RPUA 2OR7A 4NGHH 4BK5C 4HLEA 3BMVA 3CXHK 4F27A 3FT4B 3EYFA 2NLJA 4JRXD 2VZUA 5I0ZA 3F7YB 1E5CA 5EF1A 3MBWB 3L95B 4K3JH 3IVKA 3FCGA 4WF7A 1BFOB 4GKSB 4UWQB 4LP8A 2R59A 4AIXA 2BVUA 1OPOA 1JD9A 5EA0L 1NMCC 4AEEA 1IC5H 2F8OA 3ZW3A 2JWYA 3S3PA 5I2IA 1FO0H 4OZFA 4BFKA 5CFHA 4X9BA 3ARDC 3DHPA 3N41B 3C5ZB 1R9FA 3QUYD 1G9ML 5DEGA 4Z95H 4UYQA 4NRXA 1DJZA 4JZJA 1I82A 4N2IA 4ZFGL 4TUUA 1TJHL 1PJWA 1XR9A 1W6LA 1DJHA 5K1JA 2AJSH 1JNLL 2N7BA 2APSA 3RDTA 3OKEB 4UANA 1U2YA 2VDNL 1D5BB 4JL1A 3DUSB 5DA0B 1MCWM 3P3SA 3X3GH 4YQXL 4XXWC 1QWHA 5KYUA 4OJFL 4KK5D 3EJYC 4LGRB 3SE4A 4Q9RH 2UXTA 4G1EA 3MNWA 5FWRA 3QYMA 4PCYA 1U3HB 3IAGC 2CIIA 4K2UL 4LNVA 2Y4SA 4LLMB 1U3NA 5F0JB 4GSDH 3UBXB 5IJVB 5L8KB 2XIDA 5AG8A 2PWHA 4RH4A 3UAJD 1QD0A 1S7XB 3IE4A 3GZQA 4CDGC 4JFEA 4ELME 5AVSB 4G8EA 2ESVD 1JYVA 2CZNA 4UZUA 4WW2C 4NCC1 2XFXB 1LEIA 4JR9H 3RL1B 2Y23A 5SWZE 1KBVA 3QHFH 5HHOE 5GSVB 3TBSA 3FXIC 2CBMA 1TKWA 5D7LD 4YDMA 5GJTL 2ZOKB 2LU5A 2QVKA 3AG2B 3QFJB 4OIIL 1UACH 2EC9T 3NQKA 1JL8A 1T1ZB 3L3JA 3OGCA 5KVMC 4OZIF 3LJ3A 3JTBA 4PSRA 1RXLA 4DP2X 5EBWA 4F7PA 5L7XL 4L8SC 1RAMA 4TV3A 4U6YA 3TV3L 4D9LL 3UTQB 4FP8H 5SWZD 2GJ6E 5IKCB 4J4PD 3K8LA 5DUPL 4HT1H 2F5AL 2UYLA 3IETB 5D1XA 4MD4B 3ZTNL 5KVEH 3AUVA 4KUZH 1AIFA 2FQFA 2NY4C 4QHKJ 4JX0A 3MJ8A 3DUUB 3EIFA 4EEEA 4RZCB 5I15H 4KK9C 3N43B 3OX8A 5C07D 3SZ6A 5J8OA 4FQXA 2PO6D 2EE6A 1ONQB 3DTUB 5ID0B 7TAAA 2EC9U 3TO4C 4F7EA 3BPOB 1ORQA 2MEJB 3SQOL 3Q06A 2R15A 3R19A 5I0XA 3QDHA 5JR1L 3IGUA 1IGFL 3TH2T 3U9PH 5DEZA 3MRNA 4FQJL 3TCLA 2XG4A 4KOBA 3QEGL 4LGSB 3FO2B 5ISZD 5I18H 4NUMA 2DQUL 1EQWA 3CCHA 2ADGB 1OAJA 2AANA 2OL3B 1AKPA 4P48A 1U8OB 1Y6KR 3N42B 2DKMA 3VFRA 4RA3A 2ZUVA 1J1XL 4PRIE 3SKNA 5E24E 4M56A 2A9CA 3F64A 3STLA 4P4RA 1KGXA 1QO3B 4E9RA 1MVYA 2C3GA 2JKSA 4Y19E 4IOFD 1H3WM 1QZ1A 3B43A 2G3ZA 4M5ZH 2Z4QA 1TYJA 2NY4B 2LLNA 4OTXH 2Q7YB 3FFCA 2BC4B 4M7KL 3SPHA 3MLSH 4A2EA 4AMKL 5T1JA 1BD2B 4NZRL 4JPVL 2SEBA 4OJEH 1KIPA 2OX5B 2MNUA 4LGPB 3R06A 2ADFH 4NWUH 2YK1H 3FUHA 4OAWA 5I24A 1DBAH 1KEGL 4N86A 5DHDA 2Z8VC 1MXGA 1JTOA 1OIOA 4RAUB 3SPJA 3ULVF 4QRSA 1N68A 1M57B 1TVBA 3HPLA 1F2QA 2YD7A 3H9ZA 4XP5H 1E3ZA 1P0SE 5DD6B 2AI0H 3MR9A 4EN2A 4LK4A 5FECA 1RZ7L 3GSQA 3VXMA 1IFHL 1TNMA 3PNWB 3RWFA 3IKCA 2NY6C 5F6IB 4KQ0A 1MWAB 3MRRB 1MCCA 1MAMH 2OMXA 2P80D 3K74B 4X4ZA 3N55A 3HBQA 5K39B 5ICZB 1FFNB 3OXSA 3N1PC 1D9KB 3E1F1 1YJDL 4BZ1L 2UWEF 4Y4FD 3PG2A 4M7ZB 3EFFA 3WTSA 4XNZB 1D2OA 2CQVA 5FDYA 2HFFA 4PPTA 3UBHA 5CLTA 5C0JB 3RVVD 3QNZA 1BD2E 5FW6A 3F7QA 3LS4L 1J1PL 3GKWL 4NWTL 3S4SB 2XIBA 3ZSSA 3QFGA 1FNAA 1CDYA 4P46A 3LEYH 1J10A 4YUEH 5JHDA 5T1MB 5D1QA 3RVUC 4P49A 4GP5B 4LLUB 4WDIB 1UQSB 5TD4A 3ARYA 1K8DA 1TJIL 3RGVA 2VUKA 2AJUL 1V7MH 5HGAB 4PRBB 1E8XA 2I69A 4YDKL 5KW9H 1DBMH 4MNHA 2QVFB 1GGBH 2ZYIA 1DQVA 2WSDA 4BFIA 5F9DC 2VABB 3SE9L 2DEXX 3B9DA 2VSDA 4P57B 2IH9A 3L3GA 4QRTB 2XXCB 3BWUC 1MI5A 1NLBH 3VX0A 5DR5L 3L3IA 4WSJA 2ZG3A 4HS3B 3TO4B 2CO4A 1I3GH 4FC3E 4NHCL 4UTBH 4H25A 1GYWA 5E5UB 5HI3C 4A04A 4ICXA 1LGVA 4X6BA 5FAAA 2HB0A 2AQ2A 2DJSA 4DK3A 4OM1H 4WKZB 2BY3A 1UOLA 1KYOK 4R83A 1TETL 3W39B 2OXHA 3NIFF 4XAWL 4HJIA 2BSRA 1IBBA 1T1WA 2ISDA 3LNHA 4DW2H 5I17B 4BKLA 5AZEL 3R06B 1IAIH 2VN6A 5DZLA 1SEBA 5AYUL 5K1NA 1UADC 4UM9A 3EBHA 4LVNB 3ILPA 1EMTL 2FO4A 4XWGL 5MEOA 1UD5A 4X5XA 2K6WA 3GZPA 3FQRA 3MOBH 5F2FA 5CM1A 3QRFM 3G7TA 1WCBB 4XC3L 5DI8B 5T1LB 3V4UL 5HVHB 5KS9B 2FHFA 2OCCB 3EYOB 3SPGA 2E8ZA 5HHPB 1T7ZA 1CDIA 1EAQA 2EZ0D 4LRNL 5JHMA 4A7QA 5KYWA 1JERA 2J20A 2IDTA 2ETWA 1E90A 3H3BC 2FJHB 4L23A 5D6CB 3VD2A 1KPUA 2V2TA 1I85A 1PNCA 5GRUL 3VW3L 5D70H 3PNRB 5E5MA 3NJNA 3S36X 1IBGH 4OD3H 5CR1A 1S9XB 1SBSL 2VDPH 3RGHA 3V0GA 3X1GA 1KCWA 3UYPB 4NDMB 3FHQA 4XNQB 4YSPA 3RVWD 5BO0D 3QUHA 2AV1A 1PTZA 1VGKA 4E41B 5F9OL 3OMIB 3F7KA 3FMGL 4PLOB 5DK0B 3OHMB 1WAAE 5DC2A 3TZVD 4PGCA 3FNKA 4N0UE 4NBZB 3WHE0 3C6LA 4RWYL 2BCKA 1IGIL 1O7DC 5SV4A 2C3WA 4OCSH 2O5NA 1RUAL 3RVTD 4PU2A 5GGQL 1PKQA 3SD2A 2ZXEB 1GGCH 1SY6A 2HCZX 3KPLA 3BVUA 3U36B 5DC0A 3V4PL 3VWJD 1H8OA 1ZLEA 5E4EC 4CC0A 2VZOA 4XO9A 5BOJA 2ENJA 5T1KD 1J5IA 4BQ6A 4C4KO 3IBEA 3IDXH 4HWZA 4S0SD 4XBPA 4B5EA 5D1ZI 1GSKA 4D0BA 4GSUA 1UG9A 3OZKA 3NIFB 3THML 2QPEB 4JW3A 1HH9A 3V55A 2FD6H 2X6AA 3P3UA 1KJVA 5DMIL 2FO8A 3CC5A 5B38A 5F1OB 4LQ1A 5K69A 1NDGB 1MCNA 3CFMA 3LKRB 3FFDA 2AV7A 4OI9A 1YECH 1P5UB 2WXKA 5H2BA 4XPBH 1CQKA 3KYNA 3GI9H 4WWNA 5AEAA 1C5BL 3T4AA 5JMOC 3D48R 3HAEH 2KC0A 3R4DA 4N0YH 4WFFE 4ATWA 4KY2A 1H6EA 4NKOA 3WN5C 1F42A 3RI5F 4F8QA 3UAFA 4ELMF 5IJKC 4KRMB 5ANHA 4MMZA 1AP2B 1CXHA 4RWHA 5DJXA 2MMXA 5FLVA 1J1OH 3KGUA 4ZBJA 4MXQC 5JHLA 2VR9A 1QLFB 5FCUL 1XF5B 1DVFC 3ARFC 2XN9A 2F1BA 2PWFA 3V4UH 4WV1C 4GPVA 2IH3B 3G5YB 4FRWA 3SDAB 3RRQA 5EU6D 4AEIL 3APNA 4HJ1A 2BVQA 4ODWA 5KSVB 1MRDH 4JB9H 4J12A 2BNQA 3L4ZA 4M6MH 4ZSOB 4FCAA 1ZV9A 3ZYZA 2LLGA 1CZ8H 3GIZL 3L7FB 5B39G 2BHUA 3T3MF 1RK7A 1MNNA 4YE0A 3MA7B 2Z91B 3IFLH 4LDCA 2BSTA 2VDQB 5AL8A 1QTSA 2QADB 3PL6D 3BT2H 4CADA 2NSQA 3OLIA 4QOKB 5F7MC 3UYRH 2NQCA 5AB0A 5D2LF 3C8DA 1MEXH 5IFHL 3MRHA 1DN0A 1AANA 1V10A 4UNUA 1Z5HA 4P57A 4PRAB 2XTJC 2D7TL 4YL4A 5C0BB 5C0RH 3L7EA 4XOBA 1W16A 3HN5A 1QR4A 3VFOA 5JHDE 3B4NA 3V8CA 3O9WA 5EO9B 1QSEE 4TNWF 4E5XG 4FQ2L 4F91B 1I8IB 2DV6A 4OLYL 4PJXE 1MCWW 2OMYA 3IVKB 3M88A 4EAEA 5HGHA 3K71B 2K3HA 2EXTA 3Q6GL 4HF5H 1ZD6A 2IAMD 1N64L 3HMXL 3U4EA 3UZEA 1ED3B 2NNFA 3KPPB 5D1XB 1C8PA 4HWBA 3MROB 4H40A 4PM1A 3BKCH 4G7RB 4UUJB 4AYFA 3J8F7 1OAYH 2BH0A 2ZWLT 1JF1B 5DQ9B 1ETB1 2HG0A 5IJCC 5IB1B 3GB7A 2HFTA 3FONA 4HKXA 3TT1L 3VMNA 2XWBA 1HDMA 1R3KB 1BMGA 4L3CA 4X6CE 5KVDH 1IEAA 1QLRA 1JPST 2HFFB 1B4JL 4FA6A 4LSRH 15C8H 5C0CA 5JPNC 4GAYB 3JTSB 4I0PC 2PABA 4FABH 2H2PC 2OW7A 4UT6L 5I0YA 4YBHA 1IAMA 2JKNA 1DZBA 2LTQB 3LRKA 3UAAA 5DFAA 4ZFOB 5DUBA 3DX8A 1T1YA 1G9NH 4B0MM 3NFNB 4AMXA 3AABA 5AWNH 4ZAKD 1HS6A 1M1XB 4QJ5B 5HGAA 5AOLA 1RZJL 2FO1A 2AAAA 3H4FA 3P4OA 5CP3H 5E2TH 2DM2A 3S37X 3X12A 5DRZB 1X9LA 1U93A 5DD5L 2HX7A 4FF9A 2IFFH 5CS7A 3QE5A 5G55A 1ZOXA 3MLWH 3UZVA 3FCSA 3DX3A 4L05A 2EEDA 3U4AA 2QHLA 1QHQA 5A2CA 4AEIH 2NXZB 1VCAA 1BGXL 3BAWA 1PG7L 4MHHI 4LRIA 4NWUL 3T1FB 3UC0H 3WTUA 4Z0XB 1GTFA 2J6EA 3ZBMA 4AWJC 2EP6A 1A02N 4ZFZB 3QWQB 2GSGA 1IIKA 4TKWA 1G5AA 3G9VA 5JYLA 4PR5B 4CVWA 4Y1TA 4FXKA 2EXSA 2WUCH 3AVEA 2AABL 2F18A 3IJYB 3RP1A 1N5YH 4ODTH 2R0LH 3B8SA 3ULUC 1MOEA 1QSFA 1HL5A 5GS0C 2K78A 4NNYB 4HJEA 4OUUA 4LCCC 2NY5H 2XTJB 5EN3A 4L9LB 2WC7A 3PNWA 1N2RA 3UGUA 4AVIA 4DP4X 1AQHA 3K6SA 2FWOA 3CDGB 3ZIYA 4DOHB 2EEFA 5SX4H 4HA1A 5F7UA 2JFCA 3TP4A 4WJ5A 1R3JA 3C09C 3QEGH 2FJGA 4NKQB 3X14A 1NCUA 1CICB 5BVJA 3FB8A 1YUHB 1IGJB 2BP8B 3FU3A 4DN3H 2KI6A 5IFHH 4HKJA 1LP9B 3EF4A 4ZXBB 1CLZL 3IMTA 2GBTA 5B39A 1DP0A 3V2AR 1JF6A 4PRID 4P46B 1CD9B 2MOGA 3CZKA 3FBQA 4NNXA 3SQBA 4MS8D 4RDBA 4WV1B 5I15L 3AB0B 3TTSA 1JZ6A 3X1BA 3P9LB