3D36A

How to switch off a histidine kinase: crystal structure of geobacillus stearothermophilus kinb with the inhibitor sda
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
226
structure length
217
Chain Sequence
GPHMVIRLAASISHEIRNPLTAARGFIQLIEEQPLAADKRRQYARIAIEELDRAEAIITDYLTFAKPAPETPEKLNVKLEIERVIDILRPLANMSCVDIQATLAPFSVIGEREKFRQCLLNVMKNAIEAMPNGGTLQVYVSIDNGRVLIRIADTGVGMTKEQLERLGEPYFTTKGVKGTGLGMMVVYRIIESMNGTIRIESEIHKGTTVSIYLPLAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sporulation kinase B
publication title How to switch off a histidine kinase: crystal structure of Geobacillus stearothermophilus KinB with the inhibitor Sda
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/transferase inhibitor
total genus 68
structure length 217
sequence length 226
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3d36A02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3d36A01
3PEHA 4ASBA 2XDXA 5CTUA 1UY9A 1UYLA 2CGFA 3TUHA 4CWFA 3RKZA 1Y8OA 1ZXMA 3IEDA 3RLRA 1TC0A 4HXZA 1UY7A 3VHCA 1I5CA 4EM7A 1EI1A 4GT8A 4H81A 1UYMA 2VW5A 3RLQA 3K99A 4E00A 4XITA 3GIGB 3HYZA 4GT1A 5D7DA 5M4KA 4K4OA 4O04A 4PL9A 3B27A 3VADA 3U2DA 4CWQA 1GKXA 4AS9A 3R4PA 4URNA 2Q8HA 1MX0A 3GIFA 1Z59A 2XHXA 3U67A 1TBWA 1YSZA 5FNFA 3B24A 4LC1A 2YGFA 2YKIA 3EKRA 3TZ4A 1OSFA 4CE2A 4CWNA 4XDMA 4R3MA 5B1OA 3SL2A 3K98A 4B7PA 1TC6A 2O1VA 2YKJA 2IWUA 3A0YA 4O07A 3B25A 3MNRP 3CRKA 3G75A 1L0OA 2YKCA 4GCZA 2GQPA 2YI6A 1B62A 4Q20A 1YC3A 3FT5A 1BKNA 4ASGA 2CCSA 4L91A 2YECA 2YE6A 4MPCA 4CE1A 4I3HA 3HHUA 4W7TA 2YEEA 4V26A 3KE6A 4BIZA 5CPHA 3TZ5A 2FYPA 1BXDA 2WI4A 1I58A 5D6PA 3B26A 4FCRA 3LPSA 2QG2A 1I5AA 2YE4A 4DUHA 1ZW9A 2YE3A 2YEDA 3FV5A 2ZDXA 2Q8FA 3OW6A 3ZKDA 2BU2A 5CTYA 2WI2A 2QF6A 5IDMA 4XKOA 3D0BA 4B6CA 4LPBA 5M4NA 1KIJA 2BU5A 3MD0A 4XC0A 1B63A 3VHDA 4HZ0A 5M4PA 3A0XA 1EA6A 3INWA 3WHAA 3O2FA 2Q8IA 5CTWA 3BMYA 4YKTA 2Q8GA 4LP0A 2AKPA 4YKYA 3R91A 2FWYA 2YEBA 2H8MA 2YKBA 4V25A 1I5BA 2BRCA 2XX5A 1ZXNA 2XHRA 2YGAA 5D7RA 4YKUA 3ZKBA 2BU7A 2P67A 3R92A 4FCQA 2FTKA 2JJCA 3CGZA 4EGKA 2Q2EB 4HY6A 4YKRA 2YK9A 4XKKA 4HXWA 3D2RA 3D36A 3JZ3A 3CWVA 4NH7A 1ID0A 1R62A 2QM7A 4PRXA 2ZKJA 4BAEA 3TK1A 3K60A 4HY1A 2E0AA 5M4EA 4PU9A 4P8OA 3ZRWB 4KQVA 3A0ZA 1Y8PA 1GJVA 4CWOA 2IWSA 2LFRA 4U93A 1JOYA 3NXSA 2CG9A 4JAVA 2HCHA 3EHFA 4ZKIA 4L93A 1I5DA 1F51A 3T0HA 2C2AA 4YKWA 2YEAA 2CCTA 2LFSA 2YEJA 4JAUA 2O1UA 3OPDA 4BQGA 1YSRA 3A0TA 1NHIA 4MT8A 2O1WA 1NHJA 2WWWA 4EGIA 4AWPA 2XDUA 3T1KA 3H4LA 4EFUA 4AWOA 5GGZA 4LWFA 1H7SA 4X9LA 4UROA 2QFOA 2WI6A 2BREA 3B28A 2CH4A 4GEEA 4MPNA 4EEHA 4XE2A 2HKJA 3P32A 4CWTA 3Q5JA 2WEQA 1IXMA 1Y4SA 1H7UA 4KP4A 1AM1A 1BGQA 1TIDA 3K97A 5IN9A 4KSHA 2ESAA 1YESA 1UYKA 3BM9A 2YEFA 1ZWHA 4GGLA 2YEIA 4HZ5A 2XX2A 3QDDA 5BODA 1I59A 3C0EA 2VWCA 1S14A 2QG0A 4MB9A 2QM8A 4H85A 2WEPA 2WI3A 4CWSA 1UYEA 2ZDYA 2XDLA 3H80A 2XD6A 3WQ9A 3DGEA 4QPJA 4CE3A 2YI0A 2BU6A 3INXA 2XJGA 1UYDA 3QTFA 2JKIA 1JM6A 2ZBKB 3GIEA 1YC4A 1QZRA 4I5SA 1UYCA 4P7AA 4LWEA 5B1NA 1UYIA 2XCMA 2WI1A 3T10A 4XKAA 4WUDA 4E01A 4EMVA 4URLA 4XTJA 4BIUA 2BYHA 3GIGA 3ZXOA 3TZ0A 3FT8A 4PRVA 3CGYA 4MBCA 4LWHA 4WUCA 5CTXA 2YE7A 5C93A 4XIRA 4ZVIA 4O09A 4R1FA 4JQLA 3U2KA 4XCLA 4CWRA 1Z5CA 4DZYA 5M4MA 3TZ2A 4ASAA 1YT0A 4XD8A 4FCPA 4L8ZA 2IOPA 1S16A 5D6QA 2YJXA 5IDJA 3R4NA 2CCUA 4O05A 2YE8A 5F5RA 1GKZA 1AJ6A 4U7OA 2XJXA 2YI7A 1TILA 2K5BA 3C11A 1MU5A 3Q5LA 3HZ5A 3T2SA 4YKZA 4JYBA 1B3QA 4KTNA 4NH9A 2FWZA 3EHHA 5M4HA 4BXIA 3ZRXA 5F3KA 2PNRA 2XHTA 5L3JA 2BTZA 2BYIA 3R4OA 4NH8A 4L90A 5CF0A 3EKOA 1Y8NA 3T0ZA 1YS3A 4H7QA 3OWDA 1AMWA 3EHJA 3HZ1A 3EHGA 4U7NA 1AH6A 4EFTA 5BOCA 2YGEA 5J6AA 2H55A 2XK2A 4WUBA 1NHHA 4E02A 1KZNA 4KSGA 1A4HA 3OWBA 2WERA 1UYHA 4JASA 5J71A 2YI5A 3R4MA 2IOQA 2BT0A 2VCJA 5FNDA 4QPKA 2YEHA 4EGHA 1Z5AA 2BU8A 2YE2A 1UY6A 4HYPA 2GFDA 4HYMA 4R3AA 2XABA 4YKXA 4LWIA 3HEKA 3TTZA 4O0BA 4URMA 3A0RA 2YE5A 1U2OA 3Q5KA 3LNUA 3VHAA 1Y4UA 3CRLA 1UYGA 1QYEA 3PEJA 4BQJA 2YKEA 1YT2A 1THNA 4AWQA 2WI5A 3G7EA 2BZ5A 3ZRVA 4MP7A 1TH8A 4L94A 1BYQA 2UWDA 3G7BA 1AH8A 1U0ZA 1Z5BA 2WI7A 3O0IA 2IWXA 3O6OA 5FWKA 4XCJA 4XIPA 4KFGA 4XIQA 1US7A 1YETA 4LWGA 2YK2A 1YT1A 2YE9A 4CWPA 4GQTA 2VCIA 1UYFA 2XDSA 3RLPA 2HG1A 3ZCCA 2XJJA 2FXSA 4MPEA 5D7CA 3ZM7A 2BSMA 4ASFA 3NMQA 2XX4A 4MTXA 2YJWA 5FNCA 3ZXQA 2IORA 3OMUA 4FMTA 1YC1A 2XDKA 4FPPA 3HYYA 4MOTA 1UY8A 1PVGA 1YERA 4GFNA 4YKQA 1QY8A 3A0WA 4JYCA 3ZRWA 2EXLA 4MP2A 2YEGA
chains in the Genus database with same CATH superfamily
5J2UB 3D36C 4JTDB 1Q90D 1UY9A 4CWFA 3VBBA 5IYDO 4GKJB 1TC0A 2DYRB 2O57A 3W7TA 5CA1B 1Q3EA 1WA8A 5KLVH 1I5CA 3GWOA 3ML0A 1LUVA 4JI7O 2CDYA 2UUCB 3ETGA 4H81A 2YXLA 3RLQA 4XITA 1JVMA 3GIGB 1SQVH 4UCVA 3CCSV 3E86A 4LCUC 4EFBA 4JI2O 2QE7G 4X20A 4K4OA 1ROPA 4PV1B 4GX2A 4EEQA 2W6IG 4AS9A 4X89A 4I7ZB 4MSWC 3ABUA 2Q8HA 1MX0A 2XHXA 3AG3B 1YF2A 2ZNJA 2XHBA 1TBWA 3WU2Z 1YSZA 1SZTA 3K04A 1GM7A 4F4LA 2YGFA 5B3SC 4CWNA 1RPOA 3ZS8C 4R3MA 4XDMA 3WB2A 4L87A 3K98A 4XDLA 3LDCA 5H6RA 4X1KA 1Y4MA 2YKJA 2VQEB 3FAVB 3MNRP 3CRKA 3CB2A 3AK3A 1GO3F 3L74H 2E5LB 2UU9O 1QNMA 5EBWC 1ZTEA 1N36B 4MVSA 2RJZA 4Q20A 2K1EA 2ZD9A 2H94A 5LMUO 4E72A 3N2GB 4MPCA 3HHUA 1H2KA 4W7TA 2NN4A 2YEEA 4LF6O 2G38A 4LF8O 1FAFA 1SQFA 2BSKA 3H1KH 1BXDA 3A0HZ 2WI4A 1BQZA 1M1KW 2QG2A 3EHBB 4TQFA 2YE3A 2N05A 2YEDA 2F23A 3UT5B 1FFTB 2EIJC 3CRQA 5BY1A 1PNKA 4FLXA 2JK5C 3ZKDA 2BU2A 5CTYA 2QF6A 5IDMA 4XKOA 4TQDA 4LPBA 2BTQB 1Q43A 5M4NA 3ASNC 3IJ4A 2BU5A 4LH6A 3MD0A 3THOA 4CH6A 1B63A 3JAKA 2W6JG 3QG5A 3A0XA 4ZHQA 3INWA 3OMAB 2M6YA 4NYKA 1V9PA 5B1BB 1FKAO 2ITDC 1Q6IA 1MA1A 1XBLA 2FWYA 2YKBA 4V25A 1I5BA 5KHJA 2BRCA 3N2KB 5E1AC 2AW9A 3OW2U 3OR6C 4DV3B 5DECA 2OTJV 2BU7A 1XL6A 1IBKO 1P4RA 4NKGB 4X62B 1VMGA 1GM8A 3K59A 3BVOA 1M9NA 2PYJA 2Q2EB 3C3SA 4HY6A 4FLWA 2YK9A 3AG4B 4O2AB 1COWG 3D36A 4NXNO 4P2ZA 1ID0A 2IH1C 5KAFZ 4DUYB 1N32B 2GUZA 1FFXA 2QM7A 4PRXA 4HNAB 3TK1A 3K60A 2OCCB 5KX5B 2Z5UA 4P8OA 2H3OA 5JH7B 2Q67A 1OCOB 2ZIOA 5LOVA 1JOYA 3NXSA 4JAVA 3K9AA 4DV5O 4G28B 3SJAC 4L93A 4GX5A 4FLVA 1I5DA 1F51A 3T0HA 2C2AA 1MABG 3P30A 4H0LB 2LFSA 4B3MB 4TUYB 2PYLA 2FYUH 2OYQA 4DV1B 1BZKA 3JAWA 3OPDA 4BQGA 4E2LA 1NVPD 1ZL8B 4DRXA 5FNVB 1IX9A 1ZAUA 4MT8A 2FKXA 5FL7G 3T1HB 4KHPB 4U3JB 4AWPA 3H4LA 2UXCO 3CCVV 1NVPB 2WLKA 3JASA 4J11A 4LWFA 5FPRA 5H6QA 1GH6A 1Q86W 2A06H 3E35A 1HR0O 2BREA 1XI1A 4XE2A 5DM6V 1XUQA 1YJWV 4EB6A 3LSUA 4CS2A 3ETQA 1N8RW 4IL6Z 3JCZA 1IURA 2UXNA 2ATKC 2OT5A 5IN9A 4B3SO 4ABMA 2YEFA 4HZ5A 5KHGA 3QDDA 1AB3A 3OTFA 3P3PA 3ZX6A 5IYZB 3JCUZ 1P7GA 1S14A 2QG0A 2F1MA 1KMIZ 2YDEA 1PL4A 1N0JA 4H85A 2WI3A 4WFFA 3CE2A 2XUMA 5KMGA 1UYEA 3CRMA 2XDLA 1R3KC 2QA4V 1U97A 3FB8C 3OFNG 3DGEA 3QO7A 2BU6A 2YI0A 1Z2GA 5D5QA 2BCCH 3BA9A 3INXA 5IY5C 2XJGA 3QTFA 3GIEA 3ETEA 4P7AA 1G6UA 1D5AA 2IBZH 4DR7O 2EILC 4NTYA 2EZOA 3KZIZ 5KHIA 1UYIA 3I55V 2EULA 1MMMA 4O4HB 1JJOA 3ZXOA 4DR2O 3TZ0A 4PRVA 4FM1A 1AJQA 3O65A 4LWHA 4LFBB 1ZSPA 3CPWU 1Y66A 4JPRA 2GTAA 5H2FZ 2A0LA 4R1FA 3G67A 1YXBA 4PD4F 4MVUA 3R66A 4JQLA 3U2KA 4XCLA 1PNLA 4CWRA 4DZYA 1DF4A 1AI4A 2PY5A 1WPXA 3CRRA 4GKJO 5LL6Y 2LW7A 2PZSA 4BW5A 2CH7A 1NR7A 2ZDIC 4J10A 5BMVB 2YXYA 2UUCO 2CE4A 2BTOA 5EZYA 3OEHG 2Y69B 3CCUV 1GKZA 2XJXA 4U7OA 2YI7A 2Q6AA 2YIBD 4I55A 4DO2A 2ZKOA 5LGUA 1X59A 4I9QA 4KTNA 4NH9A 1NTZH 1SQGA 3WB1A 4AQYB 1OCZC 2Y0IA 4HYOA 4WFGA 3ZIAG 3ZMTA 2BTZA 1US6A 4LBEC 3T1CA 1R1BA 5CF0A 3T0ZA 3OWDA 3EHGA 3ZBHA 1QLEB 2A79B 3LNMB 4X8AA 1MNGA 1P7BA 5J2TB 1KKDA 4XDKA 5EYPB 3OAAG 1KZNA 4DV6B 2WERA 4DV0B 2VQEO 2YI5A 1R73A 1W0JG 3R4MA 2IOQA 4FM0A 1JPXA 2BT0A 2E5LO 5B1AC 1NI8A 2VCJA 2DN9A 3KCYA 4UVCA 1N36O 1N33B 4QPKA 2Y48A 2YEHA 2BU8A 1KU9A 4WFBV 2YE2A 2JEUA 2YUAA 4ZOLB 3BCCH 2GFDA 4HYMA 3ASOC 2LGQA 1FXVA 2ZR2A 4D7SA 5B66Z 4I4TB 4AILC 3T4DA 1L0NH 1TVKA 2YE5A 1U2OA 3CYOA 5FLXN 2Z3YA 4WF9V 3D3IA 2A7WA 2P6JA 1AVMA 2YKEA 1YT2A 1BS3A 1XHZA 4UUJC 4PHZA 3A0BZ 4RO2A 1JCHA 3AG2C 4MP7A 4L94A 3JATB 1NJIW 1U0ZA 2EJRA 1F4MA 2WLIB 4IHJA 1YETA 5C8YA 3RT3C 1BHBA 4WBNB 1GMGA 1PV0A 3ZCCA 4MPEA 2DE0X 3OR7C 3QO5A 4LF4B 2XX4A 4I0XA 2C1GA 2IORA 1WB7A 5CB4B 1NU1H 4MOTA 2BOCC 1FXHA 4JI5O 1UY8A 1CPYA 4FIPC 1BGYH 1YERA 2GTSA 4U3FH 1AI5A 5CMUA 3F5WC 5JVDB 2CTPA 4KXRA 4CBCA 3OEEG 5GONA 1RPRA 4DV3O 1HWYA 4ASBA 5CTUA 2VRZA 4PA4A 1FJGB 4X1YA 1V55C 2HEPA 3FKSG 2YEVA 3RLRA 5EBLC 2Q0OC 1G8MA 4HXZA 2ZCEA 1UY7A 1JX9A 3SPJA 3I56V 3SYOA 3VHCA 4CC6A 4FM2A 4KUMA 3UCSC 2W0XA 4RQEA 2PI4A 3F5TA 4DUYO 3K99A 3FX7A 4OGQB 3UO2A 4TOIA 1MOFA 3CRAA 4GT1A 4F6RA 5M4KA 3A8TA 2ZDIA 1T5EA 4I50A 3T1YB 1R6NA 4JYAB 4O04A 1DTOA 1XEQA 4PL9A 1VIBA 2CTRA 3VADA 4NTWA 5L3DA 3R4PA 1IBLO 3GIFA 3U67A 2WLJA 3DC5A 1K73W 4JI1B 4RUFA 3B24A 3TZ4A 1WAZA 4OX9B 4X64B 4CE2A 2P06A 1Q6HA 4TWKA 5IWAB 1TAEA 4RQFA 1XQ8A 2VS0A 5EK0A 3W7XA 4D7TA 1BL8A 4DV1O 3ZEDA 5LXTA 1ZX3A 2Q5ZA 4UCRA 3A0YA 3B25A 2HR3A 1BMFG 4X65B 2V7QG 2GQPA 1B62A 3IC9A 2ITCC 4GX0A 5IJ0A 2HHHB 1YC3A 3T1HO 3FT5A 1BKNA 4DV4O 4L91A 1B04A 3VQVA 3FFQA 2AXTZ 4DR5B 4GZRB 1NR1A 5CPHA 3TZ5A 2XT9A 5KHKA 4MW3A 5D6PA 3B26A 2EIMC 4KFMA 4FCRA 2EX3A 1I5YA 3ZN0A 1I5AA 1XOUA 3HKEA 1M57C 5LP6B 3KG2A 4IYIA 4YJ3A 3FV5A 2ZDXA 3K9SA 2WA3A 4LF5B 3H1IH 2WI2A 2Q7HA 1RP3B 1FPOA 1F23A 3AG1C 4B6CA 4X88A 3CXCU 3DTUB 2P7TC 3L73H 1QQCA 2LO1A 4PI0A 4RUEA 3ZHTA 2UXBB 3WHAA 3W7WA 3SDLA 3O2FA 2LW1A 2Q8IA 1KBHA 4HZ3A 2EINC 2YIDA 3AEIA 4UCSA 4YKTA 2Q8GA 1SA0A 4LP0A 2UXXA 1MSWD 1R6KA 1YITV 4YJ2A 2Q4PA 5ITZA 2V4DA 2DJVA 2H8MA 2YEBA 1JFFA 3RYHA 2BOBC 1Z5WA 3B77A 5JQGB 4LNUB 4IYHA 5L3FA 2LGWA 5D7RA 4JTAB 5HFLA 3BHPA 5IE9A 2RDCA 1P84F 3R92A 4FCQA 4QJFB 1Q8IA 3CC2V 2WLLB 5DN6G 3HB3B 4JI6B 3RYCA 1J5EO 4EGKA 1XNQB 1SC5B 3HKCA 2PUSA 1EN6A 3VOUA 3AG2B 2PF4E 3CHXA 3JZ3A 4NH7A 1B06A 2HVJC 3H01A 1MSDA 3B40A 4BAEA 4HY1A 2RQ6A 3ABMB 3CMAV 4B3RB 1N34B 4DR1B 4PU9A 4UXNA 3ZRWB 3W7SA 3SPGA 1Y76A 3JD2A 5KHHA 2CG9A 2ZM6B 1XMOB 3EHFA 4AQYO 4J80A 2IJJA 3FD9A 1YI2V 4FJCC 2Q68A 2QKSA 3BRCA 1Q82W 1GN4A 1WA8B 5CN0A 5EC2C 2JDIG 1HNZB 4E4EA 1AR1B 3K08A 1DK1A 1UFIA 1YSRA 2RCVA 3SYCA 2E74B 1A32A 4CH4A 3PN1A 1V55B 4KL1A 2WWWA 2ETNA 3RYIA 4DV6O 4DV0O 3IGAC 2XDUA 2VQFO 1QCEA 4X20B 4AWOA 3E83A 1H7SA 4FVMA 4PA9A 4CC5A 4UROA 1GN2A 1N33O 3ZMSA 2WI6A 1XILA 4OPAA 1NBMG 1M56C 3K58A 4MPNA 1Y74A 3P32A 2ZXWC 3OD4A 2ILMA 3Q5JA 4G2KA 1Y4SA 5KA6A 1AM1A 1BGQA 3CEIA 4UB8Z 1TIDA 1KUQA 3KCXA 3K97A 4J7ZA 3ZHRA 1YESA 3SR2C 4X1KB 3BM9A 4CS4A 1ZWHA 4GGLA 1QHTA 2YEIA 3CCMV 1K8AW 1W0KG 4LF9O 2QM4A 1TGOA 3JD0A 1JQ0A 2AZ0A 2VWCA 2QM8A 4CWSA 2OIGA 4DYLA 1M5IA 2R72A 4D6TH 3AK1A 2B5UA 3H80A 3E8FA 2XD6A 2ZT9B 4GUNA 2ZR3A 4MVMA 4QPJA 2ARHA 3G4SV 1QR8A 1VP7A 4CE3A 3QNEA 5IJ9A 5J9PC 3CC4V 1UYDA 2BSKB 1YC4A 1QZRA 3SYAA 3KKYA 5EIBC 1Z5VA 3JARA 3J7AU 3SJBC 1GN3A 1RFYA 3RVZA 2ZIMA 2CAZC 4CZZA 4FFBA 2UXDB 3BAAA 3JYCA 2Y0PA 3STLC 2KG7A 1W2BU 3M7MX 5H5NA 1THZA 2A3QA 2EIMB 3UM7A 4ZVIA 3B8NA 4O09A 3DXRA 1RSOA 3JAKB 1NKDA 1NT2B 1SQQH 3G71V 4FZ1A 4ZHQB 1FJGO 1HNWB 2UUBB 1BSMA 1NZ6A 5M4MA 3K0GA 1MZEA 3B2EE 3L71H 3SYQA 2MK3A 3CYGA 4Z1MG 5JJNB 2X6BA 3Q4HA 2L35A 3AG1B 3CCEV 2EBOA 2EIKB 3WG7C 1VQNV 2CTWA 3UQ8A 1XHXA 3ABLC 5IDJA 3X2QB 4O05A 1UJWB 1OCRB 5F5RA 1AJ6A 2EINB 3AG7A 3B4SA 3BA8A 2K5BA 1AILA 4YKZA 4JYBA 3VQWA 1FXKC 3T1YO 4JYAO 3ZRXA 4MTGA 4B7KA 3D8CA 5BXZA 3K5MA 4L90A 1DF5A 3K06A 2YICA 4JI1O 1AMWA 3ABKC 4U7NA 4RAIA 3ZHQA 4OX9O 4X64O 2X0LA 4NB5A 2GUZB 5IWAO 5BOCA 1FFXB 5GTHZ 4LF7B 4JI0B 1I94B 2XK2A 1SS3A 4KSGA 5IYBO 3OWBA 4JASA 4JI3B 3ABTA 2Q7EA 2WLMA 4NVPA 4NXMB 1GTOA 5FNDA 5LOVB 5FPOA 2HHHO 1WLEA 2DYSC 4OPHA 4AI8A 4ZIBA 2AZ2A 4YKXA 4LWIA 3ICXA 5BR8B 3HEKA 4DR5O 4J7JA 1IZ3A 3A0RA 4PA6A 5L3BA 4J42A 2Z0AA 3JAWB 5L3GA 2EJ7A 4K3AA 1Y4UA 3CRLA 4DRXB 1QYEA 2EZPA 5B3SB 4LFCB 5GTIZ 1VQKV 1THNA 4AWQA 1Q5OA 2BZ5A 1H8EG 1QVGU 3JASB 1VEWA 3O0IA 1SKVA 4B3TO 1Z5BA 4LF5O 2IWXA 4KFGA 2ZQMA 4AHCA 1YT1A 2WSSG 4CWPA 3BY6A 3I5DA 2HVKC 4BW9A 1UYFA 4EB6B 1R6TA 2HG1A 4X66B 2XJJA 3ZHUA 4K0KO 1BQ0A 1K97A 2L6LA 2UXBO 2AHYA 2NLJC 4ASFA 1OCCC 4MTXA 5FNCA 3OMUA 1Y6XA 4H13B 1QBZA 1YC1A 4FPPA 2F93B 1NTMH 5L3CA 3L9DA 1QR9A 3ZRSA 4DV2B 3U0ZA 4GFNA 2ZXWB 1SERA 2GBOA 3ZMZA 1QY8A 2CUGA 2EXLA 4DR6B 2A9HA 5KMGB 3HKDA 5H9CA 1S3JA 3CCJV 2Q9LA 3CC7V 4L8JA 2EIJB 5KUMA 2JGUA 1S5JA 2P90A 5JCOC 3PEHA 2XDXA 1VF6C 1UYLA 2CGFA 3TUHA 4JV5B 2QJ1A 4JI6O 3IEDA 1XNQO 1K4CC 3ASNB 3J81N 4EM7A 1OHHG 1R3JC 1IXBA 2YSUB 5L3EA 3U10A 4JYYA 1UYMA 1VQ7V 4E00A 2Y4UA 1RM1C 4TSFG 3HYZA 4B3RO 1I5XA 1N34O 1IDSA 4DR1O 1L1FA 1YIJV 3SJQC 3CWBH 2ZM6O 1XMOO 5FNFA 4O4JA 1FS0G 1VQ6V 4CS3A 1J95A 3L72H 2OIEA 3EKRA 3ZJZA 1FXKA 1NTKH 1WB8A 3LSSA 3SL2A 4B7PA 1TC6A 2O1VA 2CH7B 4UFZA 1HNZO 4JTCB 4LP8A 1PL0A 3CCQV 2IWUA 4O07A 2R9IA 5EZYB 3EFFK 1PP9H 1L0OA 4PDVA 2PGGA 1SQPH 4I55B 2UUAB 4MTFA 1SF9A 4QIWF 3QTCA 3EXAA 4ASGA 4YHHB 3HKBA 2CCSA 1BCCH 3QF7A 2YECA 2YE6A 4CE1A 2JGDA 2OWOA 5CBGA 3KE6A 4YY3B 2D2CB 2DWDC 3RYFA 3RW0A 3A2FA 1M93A 1I58A 1FYJA 3JALA 1EBOA 3LPSA 1H2GA 1YJNV 4DUHA 1IVSA 4I9WA 2P4KA 1AROP 2QSAA 3MAQA 4N23A 4X1IA 4IIJA 4O4IA 3JSNA 3LMMA 3K3WA 2Q8FA 3OW6A 4IGGA 5B5EZ 2R9RB 4TV9A 2DYRC 1M90W 1JJ2U 4FK5C 1H2MA 4J7KA 4N21A 1KIJA 3VHDA 4HZ0A 1F4NA 1E1RG 4PDLA 1WJZA 1TVKB 2QDOA 3BMYA 2PTMA 4W4KA 3SGIA 4NTXA 3HPLC 4JI8B 2AKPA 5EBMC 3SYPA 3R91A 2JS5A 3LNNA 1WN7A 4B08A 3G6BA 1H38A 1ZXNA 2YGAA 1AP6A 1E79G 4X1IB 1VQMV 1SQBH 2ZE6A 3AG3C 4YKUA 1I7FA 4X62O 2UXDO 2P22C 4R50A 1I0HA 2ZE7A 4UV8A 4TV8A 4IHJB 5TISZ 2R9AA 2FTKA 3CGZA 5C8YB 1YSCA 4YKRA 2YI9A 5LYJA 2P4VA 3E89A 1HNWO 1PM9A 2UUBO 1VQ5V 1OZ0A 1VQPV 4I0XB 3CWVA 3CXHF 1N32O 5JCOA 3LUTB 4JZ2A 1VF6A 1R62A 1PD3A 1Q81W 1YTFB 1TUBA 4RWUA 5IY5B 3APQA 3JD3A 2ZKJA 1TUEB 2XTAA 1Y67A 3SPIA 5GW7A 1SESA 1XMQB 2EILB 4KQVA 4R6ZA 3E22A 4CWOA 5GONB 2LFRA 4U93A 2HFEC 3K57A 2HCHA 2P5OA 2N74A 4X1YB 1K4DC 2YI8A 2Q73A 2YEVB 4FFKA 4B3MO 3PJSK 2YEAA 3BABA 5JENA 4ZI7A 3TJTA 1DLBA 3BEHA 3A0TA 4LF7O 4JI0O 1I94O 4KHPO 3B09A 3CS5A 4BIOA 2F95B 1BT8A 4JI3O 4F6RB 1TA8A 1QLNA 4I50B 2E75B 2FMLA 1E1QG 5GGZA 3N27A 4G27B 4LWSA 4X9LA 4NXMO 1SRYA 2ZINA 3E8HA 4LFAB 1GRJA 3B28A 5B1BC 2CH4A 4PI2A 3OT7A 2ADQB 4EEHA 5CA0A 4CWTA 3JD1A 4H44B 4O2BA 5KA5A 4UB6Z 1AP5A 4NR1A 4B7EA 1OCZB 5BR8O 4KP4A 3OTOB 1HNXB 5A9GA 4KSHA 2ESAA 1VF5B 5LXTB 3QVNA 3OGCC 1B6QA 2QTOA 3MHSC 2XX2A 2RMKB 1ORQC 5BODA 1I59A 4LFCO 1QVFU 5IJ0B 3C0EA 1ZUQA 4ASUG 2XNDG 4MB9A 3K03A 2WEPA 4H33A 3AG4C 2YXHA 2ZDYA 2CGOA 5J2UA 4DR3B 4MVOA 3FB5C 2R70A 4QE9A 5B1AB 3W7UA 4EKWA 2Q7GA 2JKIA 2ZBKB 2JIZG 2N04A 4X66O 2OCCC 1KP3A 5CA1A 1UYCA 4HBNA 5B1NA 3TXQA 4C7UA 3ASOB 1KKCA 3HKEB 5K1PA 4PJ0Z 2XCMA 3WB0A 1OCOC 2M7WA 5DEDA 4EMVA 4YJ3B 3T2MA 4URLA 3GIGA 4DXWA 4DV2O 3FT8A 3T4ZA 4LFBO 3CGYA 2HKOA 4DUZB 2ZNIA 1YHQV 2YE7A 2GSMB 4XIRA 3GVMA 1W59A 4FLTA 1O9GA 4BR6A 1KYOF 1F7YA 1Z5CA 2F4VB 1JMKC 2QWRB 1AI6A 3APOA 4JV5O 2QWOB 3RFRA 1SA0B 4JAAA 2XAFA 3TZ2A 1VQLV 3CCLV 4YJ2B 1EN4A 1YT0A 5ITZB 4YXWG 4XD8A 1JFFB 2IOPA 3RYHB 1S16A 2YJXA 3ZN1A 3ZMVA 3FAVA 1YCIA 1IBMB 3R4NA 2YE8A 1TILA 2C1IA 1MU5A 1PKXA 2FWZA 2WLNA 4BXIA 3N2GA 2NNUA 3G6EV 2PNRA 3RYCB 2IU3A 1K92A 2XHTA 3CMEV 3C90A 2BYIA 3R4OA 3HKCB 4NH8A 3RBZA 2JRIA 2B9ZA 1URFA 1Y8NA 1YS3A 4EFEA 1UPGA 3EHJA 3RGBA 2RN9A 3H1HH 1K5QA 4XDJA 3IFXA 2YGEA 4LH7A 1DGSA 2GDSA 2JS3A 5J71A 3BPZA 4FZ0A 3UT5A 1S76D 1YVWA 5F2VO 1Y76B 3H9VA 4QNHB 2UUAO 3FB7C 4EGHA 1Z5AA 4FLYA 1WP8A 5CA3A 4YHHO 1N0NA 3AK2A 3H1JH 3R65A 2BTQA 1KD1W 3G80A 1XREA 1VQOV 2GHYA 2X6AA 3K5NA 2AGAA 4O0BA 4URMA 3LDDA 2QKCA 1EFRG 4YY3O 4MVQA 2ZE5A 1XNRB 5E79Z 3S5TA 3PEJA 5IT9N 2D3OW 1L8DA 3F7VC 3N2KA 1H2SB 4UVBA 3RYIB 3RWRD 1TH8A 1D2DA 1VQ8V 2E76B 4DV7B 2OTLV 1AH8A 1R3IC 2WI7A 3O6OA 2Q69A 2Q8VA 1KC8W 1JR9A 1US7A 2BE3A 1Y74B 3JD4A 2YK2A 1S0VA 3MHHC 2K9PA 4GQTA 2VCIA 4LF4O 4GLXA 1D5NA 5CBHA 5D7CA 2BSMA 1P49A 3NMQA 4O2AA 2Y69C 2YJWA 4P9PA 4QGPA 4PDMA 2XDKA 4JI8O 5IYCO 4WFEA 2ZE8A 4HNAA 1PVGA 4YKQA 1R3LC 4JI5B 3ZMUA 5KX5A 3CD6V 4JYCA 5JH7A 1CP9A 2X6CA 1M57B 3CCRV 4UCTA 1QLEC 4ZBMA 5IJ9B 3RKZA 1Y8OA 3GWKC 1ZXMA 4W4LA 3GB7C 2LJ2A 1XL4A 3C3TA 2E3CA 1LUWA 2WA4A 4TUYA 1EI1A 4GT8A 1ZLZA 1KB9F 1VARA 3JARB 2CGNA 4QE7A 3L75H 2VW5A 3NR7A 2DW4A 1CXZB 3LDEA 1ZL8A 5FNVA 3ETDA 4FFBB 3STZC 1GK9A 4GKKB 1PNMA 1EZVH 1NQTA 3O9OA 4U3JA 2KG7B 1XMQO 5D7DA 5LGTA 2CTQA 3B27A 3M8AA 4CWQA 3U2DA 4URNA 1ZWIC 3DXRB 1GKXA 1RSOB 1Z59A 1IBLB 4FLZA 2GV9A 1MZFA 1VQ9V 1GAXA 3OUSA 4LC1A 4X9QA 2IW5A 2YKIA 1OSFA 1WNSA 5B1OA 3Q4HB 2HLDG 4UVAA 3M99B 4K8XA 5AG2A 1HP8A 3TCUA 4X65O 3G75A 2YKCA 4GCZA 2YI6A 1S72V 5IYZA 1PPJH 3D3QA 3IC7A 4PDRA 2OCHA 2JEXA 1OJHA 4JZGA 2DMXA 4I3HA 3L70H 5A2QN 4DV4B 4LFAO 4V26A 1AR5A 3S3XA 4Z1VA 4BIZA 2FYPA 2QR4A 3OTOO 2YE4A 1HNXO 1QU7A 1ZW9A 1M4UA 2WAMA 3JAMN 5LA6A 1U96A 4O4HA 1G1XB 2HHIA 2DOSA 1H8HG 3BFRA 1K9MW 1K3EA 1GM9A 1JA8A 3D0BA 4XC0A 4DR3O 5M4PA 4MS2A 4CH3A 4J9YB 1EA6A 4DR4B 5LMNB 5CTWA 4YIOA 2QWNB 1G4YB 2JJ2G 1M56B 4XBFA 3WFVA 4YKYA 1YDXA 2IJHA 2WPDG 4Z2WA 1EM1A 2QKAA 3RVYA 4R7CA 5BMVA 2DWEC 2H8PC 2XX5A 1S5HC 2VWKA 1YZBA 2XHRA 2YS8A 1MG1A 4MW8A 4BWAA 5LA6B 3ZKBA 4JI4B 2KB1A 2P67A 4DUZO 1K33A 1SZXA 3J80N 5K1XA 2JJCA 2YIBA 5JWPA 1NH2D 1SETA 1J5EB 4XKKA 2XAQA 2F4VO 4PELA 2HJDA 3D2RA 1AJPA 4HXWA 4JI7B 2XOKG 1V54C 5BZBA 1NH2B 2JVDA 5EIBD 5J2TA 5EYPA 3UO3A 4BAYA 2E0AA 5M4EA 1WPBA 5KAIZ 4JI2B 4K8ZA 2LQTA 4GYCB 1IBMO 3A0ZA 1Y8PA 1GJVA 2KSDA 2IWSA 3HKDB 4WCEV 1Q7YW 5HFMA 1KP2A 4P9OA 1ENVA 2AHZA 4ZKIA 1KQSU 4ZOLA 5LHGA 3FB6C 3SPHA 5LBQA 1YEWA 2IJKA 4MTOA 2RNBA 4YKWA 3FYIB 3QO8A 4I4TA 2CCTA 5LP6C 2FL4A 2YIAA 2YEJA 4JAUA 2O1UA 3VQYA 1Q6UA 2UU9B 5CBFA 1NHIA 4WFHA 2O1WA 1NHJA 3TETA 4EGIA 3T1KA 5LMUB 5D5PA 4EFUA 3JATA 3JSLA 3WG7B 2VQFB 3DSQA 2QFOA 3ABLB 4LF6B 2WLIA 1S5LZ 3CRCA 4LF8B 4GEEA 3EVKA 4OXSA 4R8CA 2HKJA 3CSXA 4O4JB 4WFAV 4WBNA 2WEQA 1IXMA 4H37A 1FXKB 1H7UA 3ZHSA 2YC0A 4PA7A 1HDJA 3OMNB 2MW2B 3HR0A 2DQ3A 1UYKA 5CB4A 1XNRO 2V1DA 2IU0A 1LNQA 3CJHA 5KUKA 3ABKB 2Y4TA 5JJJB 1YJ9V 4LF9B 5JVDA 1VF7A 3HKBB 3K5OA 2W0FC 3DC6A 2XASA 4DV7O 2JGDB 3WQ9A 4IT5A 4DW0A 1GKFA 5EC1C 2FB5A 3E2EA 3F7YC 4UV9A 1HW7A 2DYSB 1JM6A 2PI5A 3ABMC 3RYFB 4I5SA 4F6EA 3JALB 2XAHA 4LWEA 3K0DA 1EN5A 4J41A 4GX1A 3VQXA 2B1IA 3IAYA 2WI1A 3T10A 4IIJB 4XKAA 4O4IB 1O9HA 4WUDA 4E01A 4XTJA 4BIUA 2BYHA 2IH3C 4YIPA 4Q6GA 1IBKB 3CJHB 3K79A 4MBCA 4TV9B 4WUCA 5CTXA 2B1GA 5C93A 4PA3A 1YTFD 5LGNA 2KQXA 3H1LH 3P3NA 2HP8A 2ADPA 5LHHA 4JGSA 3ZHVA 4O4LA 2QWPB 3RN4A 4NXNB 4DK1A 2HJFC 3TGUH 4ASAA 3E8BA 4FCPA 4L8ZA 1AJNA 5D6QA 2CK3G 1KECA 4DW1A 3TXSA 3K5LA 4J9ZB 1OCCB 1XDCA 2CCUA 2VWJA 2X7RB 1AI7A 3C11A 3Q5LA 1I08A 3HZ5A 3T2SA 4GKKO 1LR1A 1B3QA 4TV8B 4DV5B 4TT3G 3EHHA 5M4HA 3B8MA 2JJ1G 5LHIA 1WP7A 1GN6A 5F3KA 2IJIA 4JF3A 5L3JA 2IM9A 2WLHA 5LYJB 2F43G 4UCOA 3EKOA 4H7QA 4A5UB 3HZ1A 3LSQA 1AH6A 2Q0AA 4EFTA 1K5SA 1FD9A 4O4LB 4DK0A 1TUBB 5J6AA 2H55A 4WUBA 1NHHA 4E02A 1A4HA 2F66C 5LP6A 1UYHA 4MVRA 2UXCB 3SPCA 3U11A 3OE7G 2DQ0A 3E22B 1L0LH 1V54B 1HR0B 1VQ4V 1RM1B 1UY6A 4HAMA 4HYPA 1H2NA 2QTSA 1BHAA 4R3AA 2XABA 2NR5A 3TTZA 1K7DA 3UKMA 2LP7A 4ZI7B 4B3SB 2KKWA 3MDSA 3S3WA 3Q5KA 3E8GA 3LNUA 3VHAA 1UYGA 4BQJA 1EZJA 5JQGA 2WI5A 3CX5F 4FLUA 4LNUA 3G7EA 3ZRVA 4CH5A 2XAGA 1BYQA 2QGNA 2UWDA 3G7BA 4LWSB 1CEZA 1BE3H 5FWKA 4XCJA 3OGIB 4XIPA 4XIQA 4B3TB 4K35A 4ICGA 4LWGA 2YE9A 5CA0B 2WLLA 1S77D 4O2BB 2XDSA 1H2LA 3RLPA 2EIKC 2QWQB 1OV9A 3OM3B 2FXSA 3ZM7A 1SQXH 1X4TA 2XAJA 5LMNO 4DR4O 3X2QC 4DR7B 4K0KB 1OCRC 2HG5C 3OUFA 4MVZA 3ZXQA 5JJEB 4FMTA 3FYEB 3CP1A 4P30A 3HYYA 1N4CA 1NS1A 4DR2B 1K34A 2ODMA 2QEXV 4UCUA 4DR6O 3OMIB 3A0WA 4LR3A 3ZRWA 4MP2A 2YEGA 4JI4O 1AR4A 3SJCC
chains in the Genus database with same CATH topology
4JTDB 1UY9A 4CWFA 3VBBA 5IYDO 1TC0A 2DYRB 3W7TA 1I5CA 3GWOA 3ML0A 3ETGA 4H81A 3RLQA 4XITA 1JVMA 3GIGB 3CCSV 3E86A 4LCUC 2QE7G 4K4OA 1ROPA 4GX2A 2W6IG 4AS9A 4X89A 4MSWC 2Q8HA 3ABUA 1MX0A 2XHXA 3AG3B 1TBWA 1YSZA 1SZTA 3K04A 1GM7A 4F4LA 2YGFA 5B3SC 4CWNA 1RPOA 4R3MA 4XDMA 4L87A 3K98A 4XDLA 3LDCA 5H6RA 1Y4MA 2YKJA 3MNRP 3CRKA 1GO3F 5EBWC 4MVSA 4Q20A 2K1EA 2ZD9A 2H94A 4MPCA 3HHUA 4W7TA 2YEEA 1BXDA 2WI4A 1M1KW 2QG2A 3EHBB 2YE3A 2YEDA 1FFTB 2EIJC 1PNKA 2JK5C 3ZKDA 2BU2A 5CTYA 2QF6A 5IDMA 4XKOA 4LPBA 5M4NA 3ASNC 2BU5A 3MD0A 1B63A 2W6JG 3A0XA 3INWA 3OMAB 5B1BB 2ITDC 2FWYA 2YKBA 4V25A 1I5BA 2BRCA 5E1AC 3OW2U 3OR6C 2OTJV 2BU7A 1XL6A 1P4RA 1GM8A 1M9NA 2Q2EB 4HY6A 2YK9A 3AG4B 1COWG 3D36A 4P2ZA 1ID0A 2IH1C 2QM7A 4PRXA 3TK1A 3K60A 2OCCB 2Z5UA 4P8OA 2Q67A 1OCOB 1JOYA 3NXSA 4JAVA 3K9AA 4G28B 4L93A 4GX5A 1I5DA 1F51A 3T0HA 2C2AA 1MABG 3P30A 2LFSA 3OPDA 4BQGA 4E2LA 1NVPD 4MT8A 5FL7G 4AWPA 3H4LA 3CCVV 1NVPB 2WLKA 4LWFA 5H6QA 1Q86W 2BREA 3E35A 4XE2A 5DM6V 1YJWV 1N8RW 3JCZA 2UXNA 2ATKC 2OT5A 5IN9A 2YEFA 4HZ5A 3QDDA 1S14A 2QG0A 4H85A 2WI3A 4WFFA 1UYEA 2XDLA 1R3KC 2QA4V 3FB8C 3OFNG 3DGEA 2YI0A 3QO7A 2BU6A 3INXA 5IY5C 2XJGA 3QTFA 3GIEA 3ETEA 4P7AA 2EILC 2EZOA 1UYIA 3I55V 3ZXOA 3TZ0A 4PRVA 1AJQA 4LWHA 3CPWU 1Y66A 4JPRA 2A0LA 4R1FA 4MVUA 4JQLA 3U2KA 4XCLA 1PNLA 4CWRA 4DZYA 1DF4A 1AI4A 1WPXA 4BW5A 1NR7A 2ZDIC 3OEHG 2Y69B 3CCUV 1GKZA 2XJXA 4U7OA 2YI7A 2Q6AA 4DO2A 5LGUA 4KTNA 4NH9A 1OCZC 4HYOA 4WFGA 3ZIAG 3ZMTA 2BTZA 4LBEC 3T1CA 5CF0A 3T0ZA 3OWDA 3EHGA 1QLEB 2A79B 3LNMB 4X8AA 1KKDA 1P7BA 4XDKA 3OAAG 1KZNA 2WERA 2YI5A 1R73A 1W0JG 3R4MA 2IOQA 1JPXA 2BT0A 5B1AC 2VCJA 4UVCA 4QPKA 2Y48A 2YEHA 2BU8A 4WFBV 2YE2A 2JEUA 2GFDA 4HYMA 3ASOC 1FXVA 2ZR2A 3T4DA 2YE5A 1U2OA 3CYOA 2Z3YA 4WF9V 3D3IA 2P6JA 2YKEA 1YT2A 4UUJC 4RO2A 1JCHA 3AG2C 4MP7A 4L94A 1NJIW 1U0ZA 2EJRA 1F4MA 2WLIB 1YETA 1BHBA 1GMGA 3ZCCA 4MPEA 3OR7C 3QO5A 2XX4A 2IORA 4MOTA 2BOCC 1FXHA 1UY8A 1CPYA 4FIPC 1YERA 1AI5A 5CMUA 3F5WC 4CBCA 3OEEG 1RPRA 1HWYA 4ASBA 5CTUA 4PA4A 1V55C 3FKSG 2YEVA 3RLRA 5EBLC 1G8MA 4HXZA 1UY7A 1JX9A 3SPJA 3I56V 3SYOA 3VHCA 4KUMA 4RQEA 2PI4A 3K99A 1MOFA 4GT1A 5M4KA 2ZDIA 4O04A 1R6NA 1DTOA 4PL9A 3VADA 5L3DA 3R4PA 3GIFA 3U67A 2WLJA 1K73W 4RUFA 3B24A 3TZ4A 4CE2A 4TWKA 4RQFA 5EK0A 3W7XA 1BL8A 3A0YA 3B25A 2HR3A 1BMFG 2V7QG 2GQPA 1B62A 2ITCC 4GX0A 1YC3A 3FT5A 1BKNA 4L91A 1NR1A 5CPHA 3TZ5A 4MW3A 5D6PA 3B26A 2EIMC 4KFMA 4FCRA 1I5YA 3ZN0A 1I5AA 1M57C 3KG2A 3FV5A 2ZDXA 2WI2A 1F23A 3AG1C 4B6CA 4X88A 3CXCU 3DTUB 2P7TC 4RUEA 3WHAA 3W7WA 3O2FA 2Q8IA 4HZ3A 2EINC 3AEIA 4YKTA 2Q8GA 4LP0A 2UXXA 1MSWD 1R6KA 1YITV 2YEBA 2H8MA 2BOBC 3B77A 5L3FA 5D7RA 4JTAB 5HFLA 3R92A 4FCQA 4QJFB 3CC2V 2WLLB 5DN6G 3HB3B 4EGKA 3VOUA 3AG2B 3JZ3A 4NH7A 2HVJC 3H01A 4BAEA 4HY1A 3ABMB 3CMAV 4PU9A 4UXNA 3ZRWB 3W7SA 3SPGA 3JD2A 2CG9A 3EHFA 2IJJA 1YI2V 4FJCC 2Q68A 2QKSA 1Q82W 5CN0A 5EC2C 2JDIG 1AR1B 3K08A 1YSRA 3SYCA 1V55B 2WWWA 3IGAC 2XDUA 1QCEA 4AWOA 3E83A 1H7SA 4PA9A 4UROA 3ZMSA 2WI6A 1NBMG 1M56C 4MPNA 3P32A 2ZXWC 3Q5JA 4G2KA 1Y4SA 5KA6A 1AM1A 1BGQA 1TIDA 3K97A 1YESA 3BM9A 1ZWHA 4GGLA 2YEIA 3CCMV 1K8AW 1W0KG 3JD0A 1JQ0A 2VWCA 2QM8A 4CWSA 2B5UA 3H80A 3E8FA 2XD6A 2ZR3A 4MVMA 4QPJA 3G4SV 1QR8A 4CE3A 3QNEA 5J9PC 3CC4V 1UYDA 1YC4A 1QZRA 3SYAA 3RVZA 4CZZA 3JYCA 3STLC 1W2BU 1THZA 2EIMB 3UM7A 4ZVIA 3B8NA 4O09A 1NKDA 3G71V 5M4MA 3K0GA 3SYQA 2MK3A 4Z1MG 2X6BA 3AG1B 3CCEV 2EBOA 2EIKB 3WG7C 1VQNV 3ABLC 5IDJA 3X2QB 4O05A 1UJWB 1OCRB 5F5RA 1AJ6A 2EINB 2K5BA 4YKZA 4JYBA 1FXKC 3ZRXA 4MTGA 4L90A 1DF5A 3K06A 1AMWA 3ABKC 4U7NA 4RAIA 2X0LA 5BOCA 2XK2A 4KSGA 5IYBO 3OWBA 4JASA 3ABTA 2WLMA 1GTOA 5FNDA 1WLEA 2DYSC 4YKXA 4LWIA 3HEKA 3A0RA 4PA6A 5L3BA 5L3GA 1Y4UA 3CRLA 1QYEA 2EZPA 5B3SB 1VQKV 1THNA 4AWQA 2BZ5A 1H8EG 1QVGU 3O0IA 1Z5BA 2IWXA 4KFGA 2ZQMA 1YT1A 2WSSG 4CWPA 3BY6A 2HVKC 1UYFA 2HG1A 2XJJA 1K97A 2AHYA 2NLJC 4ASFA 1OCCC 4MTXA 5FNCA 3OMUA 1QBZA 1YC1A 4FPPA 5L3CA 1QR9A 3ZRSA 4GFNA 2ZXWB 1SERA 3ZMZA 1QY8A 2EXLA 2A9HA 5H9CA 1S3JA 3CCJV 3CC7V 2EIJB 5KUMA 2P90A 3PEHA 2XDXA 1UYLA 2CGFA 3TUHA 3IEDA 1K4CC 3ASNB 4EM7A 1OHHG 1R3JC 2YSUB 5L3EA 1UYMA 1VQ7V 4E00A 1RM1C 4TSFG 3HYZA 1I5XA 1L1FA 1YIJV 3SJQC 5FNFA 1FS0G 1VQ6V 1J95A 3EKRA 3ZJZA 1FXKA 3SL2A 3LSSA 4B7PA 1TC6A 2O1VA 4JTCB 4LP8A 1PL0A 3CCQV 2IWUA 4O07A 2R9IA 3EFFK 1L0OA 4PDVA 4MTFA 4QIWF 4ASGA 2CCSA 2YECA 2YE6A 4CE1A 5CBGA 3KE6A 2DWDC 3RW0A 1I58A 1EBOA 3LPSA 1H2GA 1YJNV 4DUHA 4I9WA 1AROP 4N23A 3K3WA 2Q8FA 3OW6A 2R9RB 2DYRC 1M90W 1JJ2U 4FK5C 4N21A 1KIJA 3VHDA 4HZ0A 1F4NA 1E1RG 4PDLA 3BMYA 3HPLC 2AKPA 5EBMC 3SYPA 3R91A 1H38A 1ZXNA 2YGAA 1E79G 4YKUA 1VQMV 3AG3C 4R50A 4UV8A 2FTKA 3CGZA 1YSCA 4YKRA 3E89A 1VQ5V 1OZ0A 1VQPV 3CWVA 3LUTB 1R62A 1PD3A 1Q81W 1YTFB 5IY5B 2ZKJA 3JD3A 1TUEB 3SPIA 5GW7A 1SESA 2EILB 4KQVA 4R6ZA 4CWOA 2LFRA 4U93A 2HFEC 2HCHA 1K4DC 2YEVB 3PJSK 2YEAA 1DLBA 3BEHA 3A0TA 1QLNA 1E1QG 5GGZA 4G27B 4X9LA 1SRYA 3E8HA 3B28A 5B1BC 2CH4A 4EEHA 4CWTA 3JD1A 5KA5A 1OCZB 4KP4A 4KSHA 2ESAA 3OGCC 1B6QA 2QTOA 3MHSC 2XX2A 1ORQC 5BODA 1I59A 1QVFU 3C0EA 4ASUG 2XNDG 4MB9A 3K03A 2WEPA 4H33A 3AG4C 2ZDYA 4MVOA 3FB5C 4QE9A 5B1AB 3W7UA 4EKWA 2JKIA 2ZBKB 2JIZG 2OCCC 1KP3A 1UYCA 5B1NA 3ASOB 2XCMA 1OCOC 2M7WA 4EMVA 4URLA 3T2MA 3GIGA 4DXWA 3FT8A 3T4ZA 3CGYA 2HKOA 1YHQV 2YE7A 2GSMB 4XIRA 1Z5CA 1AI6A 2XAFA 3TZ2A 1VQLV 3CCLV 1YT0A 4YXWG 4XD8A 2IOPA 1S16A 2YJXA 3ZN1A 3ZMVA 3R4NA 2YE8A 1TILA 1MU5A 1PKXA 2FWZA 2WLNA 4BXIA 2NNUA 3G6EV 2PNRA 2IU3A 1K92A 2XHTA 3CMEV 2BYIA 3R4OA 4NH8A 3RBZA 1Y8NA 1YS3A 3EHJA 1K5QA 4XDJA 3IFXA 2YGEA 5J71A 1S76D 4QNHB 3FB7C 4EGHA 1Z5AA 5CA3A 3R65A 1KD1W 1VQOV 2GHYA 2X6AA 4O0BA 4URMA 3LDDA 1EFRG 4MVQA 3PEJA 2D3OW 3F7VC 4UVBA 1TH8A 1VQ8V 2OTLV 1AH8A 1R3IC 2WI7A 3O6OA 2Q69A 1KC8W 1US7A 3JD4A 2YK2A 1S0VA 3MHHC 4GQTA 2VCIA 5CBHA 5D7CA 2BSMA 3NMQA 2Y69C 2YJWA 4P9PA 4PDMA 2XDKA 5IYCO 4WFEA 1PVGA 4YKQA 1R3LC 3ZMUA 3CD6V 4JYCA 1CP9A 1M57B 2X6CA 3CCRV 1QLEC 4ZBMA 3RKZA 1Y8OA 1ZXMA 3GB7C 1XL4A 1EI1A 4GT8A 4QE7A 2VW5A 2DW4A 3LDEA 3ETDA 3STZC 1GK9A 1PNMA 1NQTA 5D7DA 5LGTA 3B27A 4CWQA 3U2DA 4URNA 1ZWIC 1GKXA 1Z59A 1VQ9V 3OUSA 4LC1A 2IW5A 2YKIA 1OSFA 5B1OA 2HLDG 4UVAA 3M99B 3TCUA 3G75A 2YKCA 4GCZA 2YI6A 1S72V 3IC7A 4PDRA 2JEXA 4I3HA 4V26A 4BIZA 2FYPA 2YE4A 1ZW9A 2WAMA 1H8HG 1K9MW 1K3EA 1GM9A 3D0BA 4XC0A 5M4PA 4MS2A 4J9YB 1EA6A 5CTWA 1G4YB 2JJ2G 1M56B 4XBFA 3WFVA 4YKYA 2IJHA 2WPDG 3RVYA 4R7CA 2DWEC 2H8PC 2XX5A 1S5HC 2XHRA 1MG1A 4MW8A 3ZKBA 2KB1A 2P67A 1K33A 2JJCA 1NH2D 1SETA 4XKKA 2XAQA 4PELA 4HXWA 3D2RA 1AJPA 2XOKG 1V54C 5BZBA 1NH2B 4BAYA 2E0AA 5M4EA 3A0ZA 1Y8PA 1GJVA 2IWSA 4WCEV 1Q7YW 5HFMA 1KP2A 4P9OA 1ENVA 2AHZA 4ZKIA 1KQSU 5LHGA 3FB6C 3SPHA 5LBQA 2IJKA 4MTOA 4YKWA 3FYIB 3QO8A 2CCTA 2YEJA 4JAUA 2O1UA 5CBFA 1NHIA 4WFHA 2O1WA 1NHJA 3TETA 4EGIA 3T1KA 4EFUA 3WG7B 2QFOA 3ABLB 2WLIA 4GEEA 4OXSA 4R8CA 2HKJA 4WFAV 2WEQA 1IXMA 4H37A 1FXKB 1H7UA 4PA7A 3OMNB 2DQ3A 1UYKA 2V1DA 2IU0A 1LNQA 5KUKA 3ABKB 1YJ9V 2W0FC 2XASA 3WQ9A 1GKFA 5EC1C 3E2EA 3F7YC 4UV9A 2DYSB 1JM6A 2PI5A 3ABMC 4I5SA 2XAHA 4LWEA 3K0DA 4GX1A 2B1IA 2WI1A 3T10A 4XKAA 4WUDA 4E01A 4XTJA 4BIUA 2BYHA 2IH3C 3K79A 4MBCA 4WUCA 5CTXA 2B1GA 5C93A 4PA3A 1YTFD 5LGNA 5LHHA 4JGSA 2HJFC 4ASAA 3E8BA 4FCPA 4L8ZA 1AJNA 5D6QA 2CK3G 1KECA 4J9ZB 1OCCB 2CCUA 2X7RB 1AI7A 3C11A 3Q5LA 3HZ5A 3T2SA 1B3QA 4TT3G 3EHHA 5M4HA 3B8MA 2JJ1G 5LHIA 5F3KA 2IJIA 4JF3A 5L3JA 2WLHA 2F43G 3EKOA 4H7QA 3HZ1A 3LSQA 1AH6A 4EFTA 1K5SA 5J6AA 2H55A 4WUBA 1NHHA 4E02A 1A4HA 1UYHA 4MVRA 3SPCA 3OE7G 2DQ0A 1V54B 1VQ4V 1RM1B 1UY6A 4HAMA 4HYPA 1BHAA 4R3AA 2XABA 3TTZA 1K7DA 3UKMA 2LP7A 3Q5KA 3E8GA 3LNUA 3VHAA 1UYGA 4BQJA 1EZJA 2WI5A 3G7EA 3ZRVA 2XAGA 1BYQA 2UWDA 3G7BA 1CEZA 5FWKA 4XCJA 4XIPA 4XIQA 4LWGA 2YE9A 2WLLA 1S77D 2XDSA 3RLPA 2EIKC 2FXSA 3OM3B 3ZM7A 2XAJA 3X2QC 1OCRC 2HG5C 3OUFA 4MVZA 3ZXQA 4FMTA 3FYEB 3CP1A 4P30A 3HYYA 1K34A 2QEXV 3OMIB 3A0WA 3ZRWA 4MP2A 2YEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PEH A;  4ASB A;  2XDX A;  5CTU A;  1UY9 A;  1UYL A;  2CGF A;  3TUH A;  4CWF A;  3RKZ A;  1Y8O A;  1ZXM A;  3IED A;  3RLR A;  1TC0 A;  4HXZ A;  1UY7 A;  3VHC A;  1I5C A;  4EM7 A;  1EI1 A;  4GT8 A;  4H81 A;  1UYM A;  2VW5 A;  3RLQ A;  3K99 A;  4E00 A;  4XIT A;  3GIG B;  3HYZ A;  4GT1 A;  5D7D A;  5M4K A;  4K4O A;  4O04 A;  4PL9 A;  3B27 A;  3VAD A;  3U2D A;  4CWQ A;  1GKX A;  4AS9 A;  3R4P A;  4URN A;  2Q8H A;  1MX0 A;  3GIF A;  1Z59 A;  2XHX A;  3U67 A;  1TBW A;  1YSZ A;  5FNF A;  3B24 A;  4LC1 A;  2YGF A;  2YKI A;  3EKR A;  3TZ4 A;  1OSF A;  4CE2 A;  4CWN A;  4XDM A;  4R3M A;  5B1O A;  3SL2 A;  3K98 A;  4B7P A;  1TC6 A;  2O1V A;  2YKJ A;  2IWU A;  3A0Y A;  4O07 A;  3B25 A;  3MNR P;  3CRK A;  3G75 A;  1L0O A;  2YKC A;  4GCZ A;  2GQP A;  2YI6 A;  1B62 A;  4Q20 A;  1YC3 A;  3FT5 A;  1BKN A;  4ASG A;  2CCS A;  4L91 A;  2YEC A;  2YE6 A;  4MPC A;  4CE1 A;  4I3H A;  3HHU A;  4W7T A;  2YEE A;  4V26 A;  3KE6 A;  4BIZ A;  5CPH A;  3TZ5 A;  2FYP A;  1BXD A;  2WI4 A;  1I58 A;  5D6P A;  3B26 A;  4FCR A;  3LPS A;  2QG2 A;  1I5A A;  2YE4 A;  4DUH A;  1ZW9 A;  2YE3 A;  2YED A;  3FV5 A;  2ZDX A;  2Q8F A;  3OW6 A;  3ZKD A;  2BU2 A;  5CTY A;  2WI2 A;  2QF6 A;  5IDM A;  4XKO A;  3D0B A;  4B6C A;  4LPB A;  5M4N A;  1KIJ A;  2BU5 A;  3MD0 A;  4XC0 A;  1B63 A;  3VHD A;  4HZ0 A;  5M4P A;  3A0X A;  1EA6 A;  3INW A;  3WHA A;  3O2F A;  2Q8I A;  5CTW A;  3BMY A;  4YKT A;  2Q8G A;  4LP0 A;  2AKP A;  4YKY A;  3R91 A;  2FWY A;  2YEB A;  2H8M A;  2YKB A;  4V25 A;  1I5B A;  2BRC A;  2XX5 A;  1ZXN A;  2XHR A;  2YGA A;  5D7R A;  4YKU A;  3ZKB A;  2BU7 A;  2P67 A;  3R92 A;  4FCQ A;  2FTK A;  2JJC A;  3CGZ A;  4EGK A;  2Q2E B;  4HY6 A;  4YKR A;  2YK9 A;  4XKK A;  4HXW A;  3D2R A;  3D36 A;  3JZ3 A;  3CWV A;  4NH7 A;  1ID0 A;  1R62 A;  2QM7 A;  4PRX A;  2ZKJ A;  4BAE A;  3TK1 A;  3K60 A;  4HY1 A;  2E0A A;  5M4E A;  4PU9 A;  4P8O A;  3ZRW B;  4KQV A;  3A0Z A;  1Y8P A;  1GJV A;  4CWO A;  2IWS A;  2LFR A;  4U93 A;  1JOY A;  3NXS A;  2CG9 A;  4JAV A;  2HCH A;  3EHF A;  4ZKI A;  4L93 A;  1I5D A;  1F51 A;  3T0H A;  2C2A A;  4YKW A;  2YEA A;  2CCT A;  2LFS A;  2YEJ A;  4JAU A;  2O1U A;  3OPD A;  4BQG A;  1YSR A;  3A0T A;  1NHI A;  4MT8 A;  2O1W A;  1NHJ A;  2WWW A;  4EGI A;  4AWP A;  2XDU A;  3T1K A;  3H4L A;  4EFU A;  4AWO A;  5GGZ A;  4LWF A;  1H7S A;  4X9L A;  4URO A;  2QFO A;  2WI6 A;  2BRE A;  3B28 A;  2CH4 A;  4GEE A;  4MPN A;  4EEH A;  4XE2 A;  2HKJ A;  3P32 A;  4CWT A;  3Q5J A;  2WEQ A;  1IXM A;  1Y4S A;  1H7U A;  4KP4 A;  1AM1 A;  1BGQ A;  1TID A;  3K97 A;  5IN9 A;  4KSH A;  2ESA A;  1YES A;  1UYK A;  3BM9 A;  2YEF A;  1ZWH A;  4GGL A;  2YEI A;  4HZ5 A;  2XX2 A;  3QDD A;  5BOD A;  1I59 A;  3C0E A;  2VWC A;  1S14 A;  2QG0 A;  4MB9 A;  2QM8 A;  4H85 A;  2WEP A;  2WI3 A;  4CWS A;  1UYE A;  2ZDY A;  2XDL A;  3H80 A;  2XD6 A;  3WQ9 A;  3DGE A;  4QPJ A;  4CE3 A;  2YI0 A;  2BU6 A;  3INX A;  2XJG A;  1UYD A;  3QTF A;  2JKI A;  1JM6 A;  2ZBK B;  3GIE A;  1YC4 A;  1QZR A;  4I5S A;  1UYC A;  4P7A A;  4LWE A;  5B1N A;  1UYI A;  2XCM A;  2WI1 A;  3T10 A;  4XKA A;  4WUD A;  4E01 A;  4EMV A;  4URL A;  4XTJ A;  4BIU A;  2BYH A;  3GIG A;  3ZXO A;  3TZ0 A;  3FT8 A;  4PRV A;  3CGY A;  4MBC A;  4LWH A;  4WUC A;  5CTX A;  2YE7 A;  5C93 A;  4XIR A;  4ZVI A;  4O09 A;  4R1F A;  4JQL A;  3U2K A;  4XCL A;  4CWR A;  1Z5C A;  4DZY A;  5M4M A;  3TZ2 A;  4ASA A;  1YT0 A;  4XD8 A;  4FCP A;  4L8Z A;  2IOP A;  1S16 A;  5D6Q A;  2YJX A;  5IDJ A;  3R4N A;  2CCU A;  4O05 A;  2YE8 A;  5F5R A;  1GKZ A;  1AJ6 A;  4U7O A;  2XJX A;  2YI7 A;  1TIL A;  2K5B A;  3C11 A;  1MU5 A;  3Q5L A;  3HZ5 A;  3T2S A;  4YKZ A;  4JYB A;  1B3Q A;  4KTN A;  4NH9 A;  2FWZ A;  3EHH A;  5M4H A;  4BXI A;  3ZRX A;  5F3K A;  2PNR A;  2XHT A;  5L3J A;  2BTZ A;  2BYI A;  3R4O A;  4NH8 A;  4L90 A;  5CF0 A;  3EKO A;  1Y8N A;  3T0Z A;  1YS3 A;  4H7Q A;  3OWD A;  1AMW A;  3EHJ A;  3HZ1 A;  3EHG A;  4U7N A;  1AH6 A;  4EFT A;  5BOC A;  2YGE A;  5J6A A;  2H55 A;  2XK2 A;  4WUB A;  1NHH A;  4E02 A;  1KZN A;  4KSG A;  1A4H A;  3OWB A;  2WER A;  1UYH A;  4JAS A;  5J71 A;  2YI5 A;  3R4M A;  2IOQ A;  2BT0 A;  2VCJ A;  5FND A;  4QPK A;  2YEH A;  4EGH A;  1Z5A A;  2BU8 A;  2YE2 A;  1UY6 A;  4HYP A;  2GFD A;  4HYM A;  4R3A A;  2XAB A;  4YKX A;  4LWI A;  3HEK A;  3TTZ A;  4O0B A;  4URM A;  3A0R A;  2YE5 A;  1U2O A;  3Q5K A;  3LNU A;  3VHA A;  1Y4U A;  3CRL A;  1UYG A;  1QYE A;  3PEJ A;  4BQJ A;  2YKE A;  1YT2 A;  1THN A;  4AWQ A;  2WI5 A;  3G7E A;  2BZ5 A;  3ZRV A;  4MP7 A;  1TH8 A;  4L94 A;  1BYQ A;  2UWD A;  3G7B A;  1AH8 A;  1U0Z A;  1Z5B A;  2WI7 A;  3O0I A;  2IWX A;  3O6O A;  5FWK A;  4XCJ A;  4XIP A;  4KFG A;  4XIQ A;  1US7 A;  1YET A;  4LWG A;  2YK2 A;  1YT1 A;  2YE9 A;  4CWP A;  4GQT A;  2VCI A;  1UYF A;  2XDS A;  3RLP A;  2HG1 A;  3ZCC A;  2XJJ A;  2FXS A;  4MPE A;  5D7C A;  3ZM7 A;  2BSM A;  4ASF A;  3NMQ A;  2XX4 A;  4MTX A;  2YJW A;  5FNC A;  3ZXQ A;  2IOR A;  3OMU A;  4FMT A;  1YC1 A;  2XDK A;  4FPP A;  3HYY A;  4MOT A;  1UY8 A;  1PVG A;  1YER A;  4GFN A;  4YKQ A;  1QY8 A;  3A0W A;  4JYC A;  3ZRW A;  2EXL A;  4MP2 A;  2YEG A; 
#chains in the Genus database with same CATH topology
 5J2U B;  3D36 C;  4JTD B;  1Q90 D;  1UY9 A;  4CWF A;  3VBB A;  5IYD O;  4GKJ B;  1TC0 A;  2DYR B;  2O57 A;  3W7T A;  5CA1 B;  1Q3E A;  1WA8 A;  5KLV H;  1I5C A;  3GWO A;  3ML0 A;  1LUV A;  4JI7 O;  2CDY A;  2UUC B;  3ETG A;  4H81 A;  2YXL A;  3RLQ A;  4XIT A;  1JVM A;  3GIG B;  1SQV H;  4UCV A;  3CCS V;  3E86 A;  4LCU C;  4EFB A;  4JI2 O;  2QE7 G;  4X20 A;  4K4O A;  1ROP A;  4PV1 B;  4GX2 A;  4EEQ A;  2W6I G;  4AS9 A;  4X89 A;  4I7Z B;  4MSW C;  3ABU A;  2Q8H A;  1MX0 A;  2XHX A;  3AG3 B;  1YF2 A;  2ZNJ A;  2XHB A;  1TBW A;  3WU2 Z;  1YSZ A;  1SZT A;  3K04 A;  1GM7 A;  4F4L A;  2YGF A;  5B3S C;  4CWN A;  1RPO A;  3ZS8 C;  4R3M A;  4XDM A;  3WB2 A;  4L87 A;  3K98 A;  4XDL A;  3LDC A;  5H6R A;  4X1K A;  1Y4M A;  2YKJ A;  2VQE B;  3FAV B;  3MNR P;  3CRK A;  3CB2 A;  3AK3 A;  1GO3 F;  3L74 H;  2E5L B;  2UU9 O;  1QNM A;  5EBW C;  1ZTE A;  1N36 B;  4MVS A;  2RJZ A;  4Q20 A;  2K1E A;  2ZD9 A;  2H94 A;  5LMU O;  4E72 A;  3N2G B;  4MPC A;  3HHU A;  1H2K A;  4W7T A;  2NN4 A;  2YEE A;  4LF6 O;  2G38 A;  4LF8 O;  1FAF A;  1SQF A;  2BSK A;  3H1K H;  1BXD A;  3A0H Z;  2WI4 A;  1BQZ A;  1M1K W;  2QG2 A;  3EHB B;  4TQF A;  2YE3 A;  2N05 A;  2YED A;  2F23 A;  3UT5 B;  1FFT B;  2EIJ C;  3CRQ A;  5BY1 A;  1PNK A;  4FLX A;  2JK5 C;  3ZKD A;  2BU2 A;  5CTY A;  2QF6 A;  5IDM A;  4XKO A;  4TQD A;  4LPB A;  2BTQ B;  1Q43 A;  5M4N A;  3ASN C;  3IJ4 A;  2BU5 A;  4LH6 A;  3MD0 A;  3THO A;  4CH6 A;  1B63 A;  3JAK A;  2W6J G;  3QG5 A;  3A0X A;  4ZHQ A;  3INW A;  3OMA B;  2M6Y A;  4NYK A;  1V9P A;  5B1B B;  1FKA O;  2ITD C;  1Q6I A;  1MA1 A;  1XBL A;  2FWY A;  2YKB A;  4V25 A;  1I5B A;  5KHJ A;  2BRC A;  3N2K B;  5E1A C;  2AW9 A;  3OW2 U;  3OR6 C;  4DV3 B;  5DEC A;  2OTJ V;  2BU7 A;  1XL6 A;  1IBK O;  1P4R A;  4NKG B;  4X62 B;  1VMG A;  1GM8 A;  3K59 A;  3BVO A;  1M9N A;  2PYJ A;  2Q2E B;  3C3S A;  4HY6 A;  4FLW A;  2YK9 A;  3AG4 B;  4O2A B;  1COW G;  3D36 A;  4NXN O;  4P2Z A;  1ID0 A;  2IH1 C;  5KAF Z;  4DUY B;  1N32 B;  2GUZ A;  1FFX A;  2QM7 A;  4PRX A;  4HNA B;  3TK1 A;  3K60 A;  2OCC B;  5KX5 B;  2Z5U A;  4P8O A;  2H3O A;  5JH7 B;  2Q67 A;  1OCO B;  2ZIO A;  5LOV A;  1JOY A;  3NXS A;  4JAV A;  3K9A A;  4DV5 O;  4G28 B;  3SJA C;  4L93 A;  4GX5 A;  4FLV A;  1I5D A;  1F51 A;  3T0H A;  2C2A A;  1MAB G;  3P30 A;  4H0L B;  2LFS A;  4B3M B;  4TUY B;  2PYL A;  2FYU H;  2OYQ A;  4DV1 B;  1BZK A;  3JAW A;  3OPD A;  4BQG A;  4E2L A;  1NVP D;  1ZL8 B;  4DRX A;  5FNV B;  1IX9 A;  1ZAU A;  4MT8 A;  2FKX A;  5FL7 G;  3T1H B;  4KHP B;  4U3J B;  4AWP A;  3H4L A;  2UXC O;  3CCV V;  1NVP B;  2WLK A;  3JAS A;  4J11 A;  4LWF A;  5FPR A;  5H6Q A;  1GH6 A;  1Q86 W;  2A06 H;  3E35 A;  1HR0 O;  2BRE A;  1XI1 A;  4XE2 A;  5DM6 V;  1XUQ A;  1YJW V;  4EB6 A;  3LSU A;  4CS2 A;  3ETQ A;  1N8R W;  4IL6 Z;  3JCZ A;  1IUR A;  2UXN A;  2ATK C;  2OT5 A;  5IN9 A;  4B3S O;  4ABM A;  2YEF A;  4HZ5 A;  5KHG A;  3QDD A;  1AB3 A;  3OTF A;  3P3P A;  3ZX6 A;  5IYZ B;  3JCU Z;  1P7G A;  1S14 A;  2QG0 A;  2F1M A;  1KMI Z;  2YDE A;  1PL4 A;  1N0J A;  4H85 A;  2WI3 A;  4WFF A;  3CE2 A;  2XUM A;  5KMG A;  1UYE A;  3CRM A;  2XDL A;  1R3K C;  2QA4 V;  1U97 A;  3FB8 C;  3OFN G;  3DGE A;  3QO7 A;  2BU6 A;  2YI0 A;  1Z2G A;  5D5Q A;  2BCC H;  3BA9 A;  3INX A;  5IY5 C;  2XJG A;  3QTF A;  3GIE A;  3ETE A;  4P7A A;  1G6U A;  1D5A A;  2IBZ H;  4DR7 O;  2EIL C;  4NTY A;  2EZO A;  3KZI Z;  5KHI A;  1UYI A;  3I55 V;  2EUL A;  1MMM A;  4O4H B;  1JJO A;  3ZXO A;  4DR2 O;  3TZ0 A;  4PRV A;  4FM1 A;  1AJQ A;  3O65 A;  4LWH A;  4LFB B;  1ZSP A;  3CPW U;  1Y66 A;  4JPR A;  2GTA A;  5H2F Z;  2A0L A;  4R1F A;  3G67 A;  1YXB A;  4PD4 F;  4MVU A;  3R66 A;  4JQL A;  3U2K A;  4XCL A;  1PNL A;  4CWR A;  4DZY A;  1DF4 A;  1AI4 A;  2PY5 A;  1WPX A;  3CRR A;  4GKJ O;  5LL6 Y;  2LW7 A;  2PZS A;  4BW5 A;  2CH7 A;  1NR7 A;  2ZDI C;  4J10 A;  5BMV B;  2YXY A;  2UUC O;  2CE4 A;  2BTO A;  5EZY A;  3OEH G;  2Y69 B;  3CCU V;  1GKZ A;  2XJX A;  4U7O A;  2YI7 A;  2Q6A A;  2YIB D;  4I55 A;  4DO2 A;  2ZKO A;  5LGU A;  1X59 A;  4I9Q A;  4KTN A;  4NH9 A;  1NTZ H;  1SQG A;  3WB1 A;  4AQY B;  1OCZ C;  2Y0I A;  4HYO A;  4WFG A;  3ZIA G;  3ZMT A;  2BTZ A;  1US6 A;  4LBE C;  3T1C A;  1R1B A;  5CF0 A;  3T0Z A;  3OWD A;  3EHG A;  3ZBH A;  1QLE B;  2A79 B;  3LNM B;  4X8A A;  1MNG A;  1P7B A;  5J2T B;  1KKD A;  4XDK A;  5EYP B;  3OAA G;  1KZN A;  4DV6 B;  2WER A;  4DV0 B;  2VQE O;  2YI5 A;  1R73 A;  1W0J G;  3R4M A;  2IOQ A;  4FM0 A;  1JPX A;  2BT0 A;  2E5L O;  5B1A C;  1NI8 A;  2VCJ A;  2DN9 A;  3KCY A;  4UVC A;  1N36 O;  1N33 B;  4QPK A;  2Y48 A;  2YEH A;  2BU8 A;  1KU9 A;  4WFB V;  2YE2 A;  2JEU A;  2YUA A;  4ZOL B;  3BCC H;  2GFD A;  4HYM A;  3ASO C;  2LGQ A;  1FXV A;  2ZR2 A;  4D7S A;  5B66 Z;  4I4T B;  4AIL C;  3T4D A;  1L0N H;  1TVK A;  2YE5 A;  1U2O A;  3CYO A;  5FLX N;  2Z3Y A;  4WF9 V;  3D3I A;  2A7W A;  2P6J A;  1AVM A;  2YKE A;  1YT2 A;  1BS3 A;  1XHZ A;  4UUJ C;  4PHZ A;  3A0B Z;  4RO2 A;  1JCH A;  3AG2 C;  4MP7 A;  4L94 A;  3JAT B;  1NJI W;  1U0Z A;  2EJR A;  1F4M A;  2WLI B;  4IHJ A;  1YET A;  5C8Y A;  3RT3 C;  1BHB A;  4WBN B;  1GMG A;  1PV0 A;  3ZCC A;  4MPE A;  2DE0 X;  3OR7 C;  3QO5 A;  4LF4 B;  2XX4 A;  4I0X A;  2C1G A;  2IOR A;  1WB7 A;  5CB4 B;  1NU1 H;  4MOT A;  2BOC C;  1FXH A;  4JI5 O;  1UY8 A;  1CPY A;  4FIP C;  1BGY H;  1YER A;  2GTS A;  4U3F H;  1AI5 A;  5CMU A;  3F5W C;  5JVD B;  2CTP A;  4KXR A;  4CBC A;  3OEE G;  5GON A;  1RPR A;  4DV3 O;  1HWY A;  4ASB A;  5CTU A;  2VRZ A;  4PA4 A;  1FJG B;  4X1Y A;  1V55 C;  2HEP A;  3FKS G;  2YEV A;  3RLR A;  5EBL C;  2Q0O C;  1G8M A;  4HXZ A;  2ZCE A;  1UY7 A;  1JX9 A;  3SPJ A;  3I56 V;  3SYO A;  3VHC A;  4CC6 A;  4FM2 A;  4KUM A;  3UCS C;  2W0X A;  4RQE A;  2PI4 A;  3F5T A;  4DUY O;  3K99 A;  3FX7 A;  4OGQ B;  3UO2 A;  4TOI A;  1MOF A;  3CRA A;  4GT1 A;  4F6R A;  5M4K A;  3A8T A;  2ZDI A;  1T5E A;  4I50 A;  3T1Y B;  1R6N A;  4JYA B;  4O04 A;  1DTO A;  1XEQ A;  4PL9 A;  1VIB A;  2CTR A;  3VAD A;  4NTW A;  5L3D A;  3R4P A;  1IBL O;  3GIF A;  3U67 A;  2WLJ A;  3DC5 A;  1K73 W;  4JI1 B;  4RUF A;  3B24 A;  3TZ4 A;  1WAZ A;  4OX9 B;  4X64 B;  4CE2 A;  2P06 A;  1Q6H A;  4TWK A;  5IWA B;  1TAE A;  4RQF A;  1XQ8 A;  2VS0 A;  5EK0 A;  3W7X A;  4D7T A;  1BL8 A;  4DV1 O;  3ZED A;  5LXT A;  1ZX3 A;  2Q5Z A;  4UCR A;  3A0Y A;  3B25 A;  2HR3 A;  1BMF G;  4X65 B;  2V7Q G;  2GQP A;  1B62 A;  3IC9 A;  2ITC C;  4GX0 A;  5IJ0 A;  2HHH B;  1YC3 A;  3T1H O;  3FT5 A;  1BKN A;  4DV4 O;  4L91 A;  1B04 A;  3VQV A;  3FFQ A;  2AXT Z;  4DR5 B;  4GZR B;  1NR1 A;  5CPH A;  3TZ5 A;  2XT9 A;  5KHK A;  4MW3 A;  5D6P A;  3B26 A;  2EIM C;  4KFM A;  4FCR A;  2EX3 A;  1I5Y A;  3ZN0 A;  1I5A A;  1XOU A;  3HKE A;  1M57 C;  5LP6 B;  3KG2 A;  4IYI A;  4YJ3 A;  3FV5 A;  2ZDX A;  3K9S A;  2WA3 A;  4LF5 B;  3H1I H;  2WI2 A;  2Q7H A;  1RP3 B;  1FPO A;  1F23 A;  3AG1 C;  4B6C A;  4X88 A;  3CXC U;  3DTU B;  2P7T C;  3L73 H;  1QQC A;  2LO1 A;  4PI0 A;  4RUE A;  3ZHT A;  2UXB B;  3WHA A;  3W7W A;  3SDL A;  3O2F A;  2LW1 A;  2Q8I A;  1KBH A;  4HZ3 A;  2EIN C;  2YID A;  3AEI A;  4UCS A;  4YKT A;  2Q8G A;  1SA0 A;  4LP0 A;  2UXX A;  1MSW D;  1R6K A;  1YIT V;  4YJ2 A;  2Q4P A;  5ITZ A;  2V4D A;  2DJV A;  2H8M A;  2YEB A;  1JFF A;  3RYH A;  2BOB C;  1Z5W A;  3B77 A;  5JQG B;  4LNU B;  4IYH A;  5L3F A;  2LGW A;  5D7R A;  4JTA B;  5HFL A;  3BHP A;  5IE9 A;  2RDC A;  1P84 F;  3R92 A;  4FCQ A;  4QJF B;  1Q8I A;  3CC2 V;  2WLL B;  5DN6 G;  3HB3 B;  4JI6 B;  3RYC A;  1J5E O;  4EGK A;  1XNQ B;  1SC5 B;  3HKC A;  2PUS A;  1EN6 A;  3VOU A;  3AG2 B;  2PF4 E;  3CHX A;  3JZ3 A;  4NH7 A;  1B06 A;  2HVJ C;  3H01 A;  1MSD A;  3B40 A;  4BAE A;  4HY1 A;  2RQ6 A;  3ABM B;  3CMA V;  4B3R B;  1N34 B;  4DR1 B;  4PU9 A;  4UXN A;  3ZRW B;  3W7S A;  3SPG A;  1Y76 A;  3JD2 A;  5KHH A;  2CG9 A;  2ZM6 B;  1XMO B;  3EHF A;  4AQY O;  4J80 A;  2IJJ A;  3FD9 A;  1YI2 V;  4FJC C;  2Q68 A;  2QKS A;  3BRC A;  1Q82 W;  1GN4 A;  1WA8 B;  5CN0 A;  5EC2 C;  2JDI G;  1HNZ B;  4E4E A;  1AR1 B;  3K08 A;  1DK1 A;  1UFI A;  1YSR A;  2RCV A;  3SYC A;  2E74 B;  1A32 A;  4CH4 A;  3PN1 A;  1V55 B;  4KL1 A;  2WWW A;  2ETN A;  3RYI A;  4DV6 O;  4DV0 O;  3IGA C;  2XDU A;  2VQF O;  1QCE A;  4X20 B;  4AWO A;  3E83 A;  1H7S A;  4FVM A;  4PA9 A;  4CC5 A;  4URO A;  1GN2 A;  1N33 O;  3ZMS A;  2WI6 A;  1XIL A;  4OPA A;  1NBM G;  1M56 C;  3K58 A;  4MPN A;  1Y74 A;  3P32 A;  2ZXW C;  3OD4 A;  2ILM A;  3Q5J A;  4G2K A;  1Y4S A;  5KA6 A;  1AM1 A;  1BGQ A;  3CEI A;  4UB8 Z;  1TID A;  1KUQ A;  3KCX A;  3K97 A;  4J7Z A;  3ZHR A;  1YES A;  3SR2 C;  4X1K B;  3BM9 A;  4CS4 A;  1ZWH A;  4GGL A;  1QHT A;  2YEI A;  3CCM V;  1K8A W;  1W0K G;  4LF9 O;  2QM4 A;  1TGO A;  3JD0 A;  1JQ0 A;  2AZ0 A;  2VWC A;  2QM8 A;  4CWS A;  2OIG A;  4DYL A;  1M5I A;  2R72 A;  4D6T H;  3AK1 A;  2B5U A;  3H80 A;  3E8F A;  2XD6 A;  2ZT9 B;  4GUN A;  2ZR3 A;  4MVM A;  4QPJ A;  2ARH A;  3G4S V;  1QR8 A;  1VP7 A;  4CE3 A;  3QNE A;  5IJ9 A;  5J9P C;  3CC4 V;  1UYD A;  2BSK B;  1YC4 A;  1QZR A;  3SYA A;  3KKY A;  5EIB C;  1Z5V A;  3JAR A;  3J7A U;  3SJB C;  1GN3 A;  1RFY A;  3RVZ A;  2ZIM A;  2CAZ C;  4CZZ A;  4FFB A;  2UXD B;  3BAA A;  3JYC A;  2Y0P A;  3STL C;  2KG7 A;  1W2B U;  3M7M X;  5H5N A;  1THZ A;  2A3Q A;  2EIM B;  3UM7 A;  4ZVI A;  3B8N A;  4O09 A;  3DXR A;  1RSO A;  3JAK B;  1NKD A;  1NT2 B;  1SQQ H;  3G71 V;  4FZ1 A;  4ZHQ B;  1FJG O;  1HNW B;  2UUB B;  1BSM A;  1NZ6 A;  5M4M A;  3K0G A;  1MZE A;  3B2E E;  3L71 H;  3SYQ A;  2MK3 A;  3CYG A;  4Z1M G;  5JJN B;  2X6B A;  3Q4H A;  2L35 A;  3AG1 B;  3CCE V;  2EBO A;  2EIK B;  3WG7 C;  1VQN V;  2CTW A;  3UQ8 A;  1XHX A;  3ABL C;  5IDJ A;  3X2Q B;  4O05 A;  1UJW B;  1OCR B;  5F5R A;  1AJ6 A;  2EIN B;  3AG7 A;  3B4S A;  3BA8 A;  2K5B A;  1AIL A;  4YKZ A;  4JYB A;  3VQW A;  1FXK C;  3T1Y O;  4JYA O;  3ZRX A;  4MTG A;  4B7K A;  3D8C A;  5BXZ A;  3K5M A;  4L90 A;  1DF5 A;  3K06 A;  2YIC A;  4JI1 O;  1AMW A;  3ABK C;  4U7N A;  4RAI A;  3ZHQ A;  4OX9 O;  4X64 O;  2X0L A;  4NB5 A;  2GUZ B;  5IWA O;  5BOC A;  1FFX B;  5GTH Z;  4LF7 B;  4JI0 B;  1I94 B;  2XK2 A;  1SS3 A;  4KSG A;  5IYB O;  3OWB A;  4JAS A;  4JI3 B;  3ABT A;  2Q7E A;  2WLM A;  4NVP A;  4NXM B;  1GTO A;  5FND A;  5LOV B;  5FPO A;  2HHH O;  1WLE A;  2DYS C;  4OPH A;  4AI8 A;  4ZIB A;  2AZ2 A;  4YKX A;  4LWI A;  3ICX A;  5BR8 B;  3HEK A;  4DR5 O;  4J7J A;  1IZ3 A;  3A0R A;  4PA6 A;  5L3B A;  4J42 A;  2Z0A A;  3JAW B;  5L3G A;  2EJ7 A;  4K3A A;  1Y4U A;  3CRL A;  4DRX B;  1QYE A;  2EZP A;  5B3S B;  4LFC B;  5GTI Z;  1VQK V;  1THN A;  4AWQ A;  1Q5O A;  2BZ5 A;  1H8E G;  1QVG U;  3JAS B;  1VEW A;  3O0I A;  1SKV A;  4B3T O;  1Z5B A;  4LF5 O;  2IWX A;  4KFG A;  2ZQM A;  4AHC A;  1YT1 A;  2WSS G;  4CWP A;  3BY6 A;  3I5D A;  2HVK C;  4BW9 A;  1UYF A;  4EB6 B;  1R6T A;  2HG1 A;  4X66 B;  2XJJ A;  3ZHU A;  4K0K O;  1BQ0 A;  1K97 A;  2L6L A;  2UXB O;  2AHY A;  2NLJ C;  4ASF A;  1OCC C;  4MTX A;  5FNC A;  3OMU A;  1Y6X A;  4H13 B;  1QBZ A;  1YC1 A;  4FPP A;  2F93 B;  1NTM H;  5L3C A;  3L9D A;  1QR9 A;  3ZRS A;  4DV2 B;  3U0Z A;  4GFN A;  2ZXW B;  1SER A;  2GBO A;  3ZMZ A;  1QY8 A;  2CUG A;  2EXL A;  4DR6 B;  2A9H A;  5KMG B;  3HKD A;  5H9C A;  1S3J A;  3CCJ V;  2Q9L A;  3CC7 V;  4L8J A;  2EIJ B;  5KUM A;  2JGU A;  1S5J A;  2P90 A;  5JCO C;  3PEH A;  2XDX A;  1VF6 C;  1UYL A;  2CGF A;  3TUH A;  4JV5 B;  2QJ1 A;  4JI6 O;  3IED A;  1XNQ O;  1K4C C;  3ASN B;  3J81 N;  4EM7 A;  1OHH G;  1R3J C;  1IXB A;  2YSU B;  5L3E A;  3U10 A;  4JYY A;  1UYM A;  1VQ7 V;  4E00 A;  2Y4U A;  1RM1 C;  4TSF G;  3HYZ A;  4B3R O;  1I5X A;  1N34 O;  1IDS A;  4DR1 O;  1L1F A;  1YIJ V;  3SJQ C;  3CWB H;  2ZM6 O;  1XMO O;  5FNF A;  4O4J A;  1FS0 G;  1VQ6 V;  4CS3 A;  1J95 A;  3L72 H;  2OIE A;  3EKR A;  3ZJZ A;  1FXK A;  1NTK H;  1WB8 A;  3LSS A;  3SL2 A;  4B7P A;  1TC6 A;  2O1V A;  2CH7 B;  4UFZ A;  1HNZ O;  4JTC B;  4LP8 A;  1PL0 A;  3CCQ V;  2IWU A;  4O07 A;  2R9I A;  5EZY B;  3EFF K;  1PP9 H;  1L0O A;  4PDV A;  2PGG A;  1SQP H;  4I55 B;  2UUA B;  4MTF A;  1SF9 A;  4QIW F;  3QTC A;  3EXA A;  4ASG A;  4YHH B;  3HKB A;  2CCS A;  1BCC H;  3QF7 A;  2YEC A;  2YE6 A;  4CE1 A;  2JGD A;  2OWO A;  5CBG A;  3KE6 A;  4YY3 B;  2D2C B;  2DWD C;  3RYF A;  3RW0 A;  3A2F A;  1M93 A;  1I58 A;  1FYJ A;  3JAL A;  1EBO A;  3LPS A;  1H2G A;  1YJN V;  4DUH A;  1IVS A;  4I9W A;  2P4K A;  1ARO P;  2QSA A;  3MAQ A;  4N23 A;  4X1I A;  4IIJ A;  4O4I A;  3JSN A;  3LMM A;  3K3W A;  2Q8F A;  3OW6 A;  4IGG A;  5B5E Z;  2R9R B;  4TV9 A;  2DYR C;  1M90 W;  1JJ2 U;  4FK5 C;  1H2M A;  4J7K A;  4N21 A;  1KIJ A;  3VHD A;  4HZ0 A;  1F4N A;  1E1R G;  4PDL A;  1WJZ A;  1TVK B;  2QDO A;  3BMY A;  2PTM A;  4W4K A;  3SGI A;  4NTX A;  3HPL C;  4JI8 B;  2AKP A;  5EBM C;  3SYP A;  3R91 A;  2JS5 A;  3LNN A;  1WN7 A;  4B08 A;  3G6B A;  1H38 A;  1ZXN A;  2YGA A;  1AP6 A;  1E79 G;  4X1I B;  1VQM V;  1SQB H;  2ZE6 A;  3AG3 C;  4YKU A;  1I7F A;  4X62 O;  2UXD O;  2P22 C;  4R50 A;  1I0H A;  2ZE7 A;  4UV8 A;  4TV8 A;  4IHJ B;  5TIS Z;  2R9A A;  2FTK A;  3CGZ A;  5C8Y B;  1YSC A;  4YKR A;  2YI9 A;  5LYJ A;  2P4V A;  3E89 A;  1HNW O;  1PM9 A;  2UUB O;  1VQ5 V;  1OZ0 A;  1VQP V;  4I0X B;  3CWV A;  3CXH F;  1N32 O;  5JCO A;  3LUT B;  4JZ2 A;  1VF6 A;  1R62 A;  1PD3 A;  1Q81 W;  1YTF B;  1TUB A;  4RWU A;  5IY5 B;  3APQ A;  3JD3 A;  2ZKJ A;  1TUE B;  2XTA A;  1Y67 A;  3SPI A;  5GW7 A;  1SES A;  1XMQ B;  2EIL B;  4KQV A;  4R6Z A;  3E22 A;  4CWO A;  5GON B;  2LFR A;  4U93 A;  2HFE C;  3K57 A;  2HCH A;  2P5O A;  2N74 A;  4X1Y B;  1K4D C;  2YI8 A;  2Q73 A;  2YEV B;  4FFK A;  4B3M O;  3PJS K;  2YEA A;  3BAB A;  5JEN A;  4ZI7 A;  3TJT A;  1DLB A;  3BEH A;  3A0T A;  4LF7 O;  4JI0 O;  1I94 O;  4KHP O;  3B09 A;  3CS5 A;  4BIO A;  2F95 B;  1BT8 A;  4JI3 O;  4F6R B;  1TA8 A;  1QLN A;  4I50 B;  2E75 B;  2FML A;  1E1Q G;  5GGZ A;  3N27 A;  4G27 B;  4LWS A;  4X9L A;  4NXM O;  1SRY A;  2ZIN A;  3E8H A;  4LFA B;  1GRJ A;  3B28 A;  5B1B C;  2CH4 A;  4PI2 A;  3OT7 A;  2ADQ B;  4EEH A;  5CA0 A;  4CWT A;  3JD1 A;  4H44 B;  4O2B A;  5KA5 A;  4UB6 Z;  1AP5 A;  4NR1 A;  4B7E A;  1OCZ B;  5BR8 O;  4KP4 A;  3OTO B;  1HNX B;  5A9G A;  4KSH A;  2ESA A;  1VF5 B;  5LXT B;  3QVN A;  3OGC C;  1B6Q A;  2QTO A;  3MHS C;  2XX2 A;  2RMK B;  1ORQ C;  5BOD A;  1I59 A;  4LFC O;  1QVF U;  5IJ0 B;  3C0E A;  1ZUQ A;  4ASU G;  2XND G;  4MB9 A;  3K03 A;  2WEP A;  4H33 A;  3AG4 C;  2YXH A;  2ZDY A;  2CGO A;  5J2U A;  4DR3 B;  4MVO A;  3FB5 C;  2R70 A;  4QE9 A;  5B1A B;  3W7U A;  4EKW A;  2Q7G A;  2JKI A;  2ZBK B;  2JIZ G;  2N04 A;  4X66 O;  2OCC C;  1KP3 A;  5CA1 A;  1UYC A;  4HBN A;  5B1N A;  3TXQ A;  4C7U A;  3ASO B;  1KKC A;  3HKE B;  5K1P A;  4PJ0 Z;  2XCM A;  3WB0 A;  1OCO C;  2M7W A;  5DED A;  4EMV A;  4YJ3 B;  3T2M A;  4URL A;  3GIG A;  4DXW A;  4DV2 O;  3FT8 A;  3T4Z A;  4LFB O;  3CGY A;  2HKO A;  4DUZ B;  2ZNI A;  1YHQ V;  2YE7 A;  2GSM B;  4XIR A;  3GVM A;  1W59 A;  4FLT A;  1O9G A;  4BR6 A;  1KYO F;  1F7Y A;  1Z5C A;  2F4V B;  1JMK C;  2QWR B;  1AI6 A;  3APO A;  4JV5 O;  2QWO B;  3RFR A;  1SA0 B;  4JAA A;  2XAF A;  3TZ2 A;  1VQL V;  3CCL V;  4YJ2 B;  1EN4 A;  1YT0 A;  5ITZ B;  4YXW G;  4XD8 A;  1JFF B;  2IOP A;  3RYH B;  1S16 A;  2YJX A;  3ZN1 A;  3ZMV A;  3FAV A;  1YCI A;  1IBM B;  3R4N A;  2YE8 A;  1TIL A;  2C1I A;  1MU5 A;  1PKX A;  2FWZ A;  2WLN A;  4BXI A;  3N2G A;  2NNU A;  3G6E V;  2PNR A;  3RYC B;  2IU3 A;  1K92 A;  2XHT A;  3CME V;  3C90 A;  2BYI A;  3R4O A;  3HKC B;  4NH8 A;  3RBZ A;  2JRI A;  2B9Z A;  1URF A;  1Y8N A;  1YS3 A;  4EFE A;  1UPG A;  3EHJ A;  3RGB A;  2RN9 A;  3H1H H;  1K5Q A;  4XDJ A;  3IFX A;  2YGE A;  4LH7 A;  1DGS A;  2GDS A;  2JS3 A;  5J71 A;  3BPZ A;  4FZ0 A;  3UT5 A;  1S76 D;  1YVW A;  5F2V O;  1Y76 B;  3H9V A;  4QNH B;  2UUA O;  3FB7 C;  4EGH A;  1Z5A A;  4FLY A;  1WP8 A;  5CA3 A;  4YHH O;  1N0N A;  3AK2 A;  3H1J H;  3R65 A;  2BTQ A;  1KD1 W;  3G80 A;  1XRE A;  1VQO V;  2GHY A;  2X6A A;  3K5N A;  2AGA A;  4O0B A;  4URM A;  3LDD A;  2QKC A;  1EFR G;  4YY3 O;  4MVQ A;  2ZE5 A;  1XNR B;  5E79 Z;  3S5T A;  3PEJ A;  5IT9 N;  2D3O W;  1L8D A;  3F7V C;  3N2K A;  1H2S B;  4UVB A;  3RYI B;  3RWR D;  1TH8 A;  1D2D A;  1VQ8 V;  2E76 B;  4DV7 B;  2OTL V;  1AH8 A;  1R3I C;  2WI7 A;  3O6O A;  2Q69 A;  2Q8V A;  1KC8 W;  1JR9 A;  1US7 A;  2BE3 A;  1Y74 B;  3JD4 A;  2YK2 A;  1S0V A;  3MHH C;  2K9P A;  4GQT A;  2VCI A;  4LF4 O;  4GLX A;  1D5N A;  5CBH A;  5D7C A;  2BSM A;  1P49 A;  3NMQ A;  4O2A A;  2Y69 C;  2YJW A;  4P9P A;  4QGP A;  4PDM A;  2XDK A;  4JI8 O;  5IYC O;  4WFE A;  2ZE8 A;  4HNA A;  1PVG A;  4YKQ A;  1R3L C;  4JI5 B;  3ZMU A;  5KX5 A;  3CD6 V;  4JYC A;  5JH7 A;  1CP9 A;  2X6C A;  1M57 B;  3CCR V;  4UCT A;  1QLE C;  4ZBM A;  5IJ9 B;  3RKZ A;  1Y8O A;  3GWK C;  1ZXM A;  4W4L A;  3GB7 C;  2LJ2 A;  1XL4 A;  3C3T A;  2E3C A;  1LUW A;  2WA4 A;  4TUY A;  1EI1 A;  4GT8 A;  1ZLZ A;  1KB9 F;  1VAR A;  3JAR B;  2CGN A;  4QE7 A;  3L75 H;  2VW5 A;  3NR7 A;  2DW4 A;  1CXZ B;  3LDE A;  1ZL8 A;  5FNV A;  3ETD A;  4FFB B;  3STZ C;  1GK9 A;  4GKK B;  1PNM A;  1EZV H;  1NQT A;  3O9O A;  4U3J A;  2KG7 B;  1XMQ O;  5D7D A;  5LGT A;  2CTQ A;  3B27 A;  3M8A A;  4CWQ A;  3U2D A;  4URN A;  1ZWI C;  3DXR B;  1GKX A;  1RSO B;  1Z59 A;  1IBL B;  4FLZ A;  2GV9 A;  1MZF A;  1VQ9 V;  1GAX A;  3OUS A;  4LC1 A;  4X9Q A;  2IW5 A;  2YKI A;  1OSF A;  1WNS A;  5B1O A;  3Q4H B;  2HLD G;  4UVA A;  3M99 B;  4K8X A;  5AG2 A;  1HP8 A;  3TCU A;  4X65 O;  3G75 A;  2YKC A;  4GCZ A;  2YI6 A;  1S72 V;  5IYZ A;  1PPJ H;  3D3Q A;  3IC7 A;  4PDR A;  2OCH A;  2JEX A;  1OJH A;  4JZG A;  2DMX A;  4I3H A;  3L70 H;  5A2Q N;  4DV4 B;  4LFA O;  4V26 A;  1AR5 A;  3S3X A;  4Z1V A;  4BIZ A;  2FYP A;  2QR4 A;  3OTO O;  2YE4 A;  1HNX O;  1QU7 A;  1ZW9 A;  1M4U A;  2WAM A;  3JAM N;  5LA6 A;  1U96 A;  4O4H A;  1G1X B;  2HHI A;  2DOS A;  1H8H G;  3BFR A;  1K9M W;  1K3E A;  1GM9 A;  1JA8 A;  3D0B A;  4XC0 A;  4DR3 O;  5M4P A;  4MS2 A;  4CH3 A;  4J9Y B;  1EA6 A;  4DR4 B;  5LMN B;  5CTW A;  4YIO A;  2QWN B;  1G4Y B;  2JJ2 G;  1M56 B;  4XBF A;  3WFV A;  4YKY A;  1YDX A;  2IJH A;  2WPD G;  4Z2W A;  1EM1 A;  2QKA A;  3RVY A;  4R7C A;  5BMV A;  2DWE C;  2H8P C;  2XX5 A;  1S5H C;  2VWK A;  1YZB A;  2XHR A;  2YS8 A;  1MG1 A;  4MW8 A;  4BWA A;  5LA6 B;  3ZKB A;  4JI4 B;  2KB1 A;  2P67 A;  4DUZ O;  1K33 A;  1SZX A;  3J80 N;  5K1X A;  2JJC A;  2YIB A;  5JWP A;  1NH2 D;  1SET A;  1J5E B;  4XKK A;  2XAQ A;  2F4V O;  4PEL A;  2HJD A;  3D2R A;  1AJP A;  4HXW A;  4JI7 B;  2XOK G;  1V54 C;  5BZB A;  1NH2 B;  2JVD A;  5EIB D;  5J2T A;  5EYP A;  3UO3 A;  4BAY A;  2E0A A;  5M4E A;  1WPB A;  5KAI Z;  4JI2 B;  4K8Z A;  2LQT A;  4GYC B;  1IBM O;  3A0Z A;  1Y8P A;  1GJV A;  2KSD A;  2IWS A;  3HKD B;  4WCE V;  1Q7Y W;  5HFM A;  1KP2 A;  4P9O A;  1ENV A;  2AHZ A;  4ZKI A;  1KQS U;  4ZOL A;  5LHG A;  3FB6 C;  3SPH A;  5LBQ A;  1YEW A;  2IJK A;  4MTO A;  2RNB A;  4YKW A;  3FYI B;  3QO8 A;  4I4T A;  2CCT A;  5LP6 C;  2FL4 A;  2YIA A;  2YEJ A;  4JAU A;  2O1U A;  3VQY A;  1Q6U A;  2UU9 B;  5CBF A;  1NHI A;  4WFH A;  2O1W A;  1NHJ A;  3TET A;  4EGI A;  3T1K A;  5LMU B;  5D5P A;  4EFU A;  3JAT A;  3JSL A;  3WG7 B;  2VQF B;  3DSQ A;  2QFO A;  3ABL B;  4LF6 B;  2WLI A;  1S5L Z;  3CRC A;  4LF8 B;  4GEE A;  3EVK A;  4OXS A;  4R8C A;  2HKJ A;  3CSX A;  4O4J B;  4WFA V;  4WBN A;  2WEQ A;  1IXM A;  4H37 A;  1FXK B;  1H7U A;  3ZHS A;  2YC0 A;  4PA7 A;  1HDJ A;  3OMN B;  2MW2 B;  3HR0 A;  2DQ3 A;  1UYK A;  5CB4 A;  1XNR O;  2V1D A;  2IU0 A;  1LNQ A;  3CJH A;  5KUK A;  3ABK B;  2Y4T A;  5JJJ B;  1YJ9 V;  4LF9 B;  5JVD A;  1VF7 A;  3HKB B;  3K5O A;  2W0F C;  3DC6 A;  2XAS A;  4DV7 O;  2JGD B;  3WQ9 A;  4IT5 A;  4DW0 A;  1GKF A;  5EC1 C;  2FB5 A;  3E2E A;  3F7Y C;  4UV9 A;  1HW7 A;  2DYS B;  1JM6 A;  2PI5 A;  3ABM C;  3RYF B;  4I5S A;  4F6E A;  3JAL B;  2XAH A;  4LWE A;  3K0D A;  1EN5 A;  4J41 A;  4GX1 A;  3VQX A;  2B1I A;  3IAY A;  2WI1 A;  3T10 A;  4IIJ B;  4XKA A;  4O4I B;  1O9H A;  4WUD A;  4E01 A;  4XTJ A;  4BIU A;  2BYH A;  2IH3 C;  4YIP A;  4Q6G A;  1IBK B;  3CJH B;  3K79 A;  4MBC A;  4TV9 B;  4WUC A;  5CTX A;  2B1G A;  5C93 A;  4PA3 A;  1YTF D;  5LGN A;  2KQX A;  3H1L H;  3P3N A;  2HP8 A;  2ADP A;  5LHH A;  4JGS A;  3ZHV A;  4O4L A;  2QWP B;  3RN4 A;  4NXN B;  4DK1 A;  2HJF C;  3TGU H;  4ASA A;  3E8B A;  4FCP A;  4L8Z A;  1AJN A;  5D6Q A;  2CK3 G;  1KEC A;  4DW1 A;  3TXS A;  3K5L A;  4J9Z B;  1OCC B;  1XDC A;  2CCU A;  2VWJ A;  2X7R B;  1AI7 A;  3C11 A;  3Q5L A;  1I08 A;  3HZ5 A;  3T2S A;  4GKK O;  1LR1 A;  1B3Q A;  4TV8 B;  4DV5 B;  4TT3 G;  3EHH A;  5M4H A;  3B8M A;  2JJ1 G;  5LHI A;  1WP7 A;  1GN6 A;  5F3K A;  2IJI A;  4JF3 A;  5L3J A;  2IM9 A;  2WLH A;  5LYJ B;  2F43 G;  4UCO A;  3EKO A;  4H7Q A;  4A5U B;  3HZ1 A;  3LSQ A;  1AH6 A;  2Q0A A;  4EFT A;  1K5S A;  1FD9 A;  4O4L B;  4DK0 A;  1TUB B;  5J6A A;  2H55 A;  4WUB A;  1NHH A;  4E02 A;  1A4H A;  2F66 C;  5LP6 A;  1UYH A;  4MVR A;  2UXC B;  3SPC A;  3U11 A;  3OE7 G;  2DQ0 A;  3E22 B;  1L0L H;  1V54 B;  1HR0 B;  1VQ4 V;  1RM1 B;  1UY6 A;  4HAM A;  4HYP A;  1H2N A;  2QTS A;  1BHA A;  4R3A A;  2XAB A;  2NR5 A;  3TTZ A;  1K7D A;  3UKM A;  2LP7 A;  4ZI7 B;  4B3S B;  2KKW A;  3MDS A;  3S3W A;  3Q5K A;  3E8G A;  3LNU A;  3VHA A;  1UYG A;  4BQJ A;  1EZJ A;  5JQG A;  2WI5 A;  3CX5 F;  4FLU A;  4LNU A;  3G7E A;  3ZRV A;  4CH5 A;  2XAG A;  1BYQ A;  2QGN A;  2UWD A;  3G7B A;  4LWS B;  1CEZ A;  1BE3 H;  5FWK A;  4XCJ A;  3OGI B;  4XIP A;  4XIQ A;  4B3T B;  4K35 A;  4ICG A;  4LWG A;  2YE9 A;  5CA0 B;  2WLL A;  1S77 D;  4O2B B;  2XDS A;  1H2L A;  3RLP A;  2EIK C;  2QWQ B;  1OV9 A;  3OM3 B;  2FXS A;  3ZM7 A;  1SQX H;  1X4T A;  2XAJ A;  5LMN O;  4DR4 O;  3X2Q C;  4DR7 B;  4K0K B;  1OCR C;  2HG5 C;  3OUF A;  4MVZ A;  3ZXQ A;  5JJE B;  4FMT A;  3FYE B;  3CP1 A;  4P30 A;  3HYY A;  1N4C A;  1NS1 A;  4DR2 B;  1K34 A;  2ODM A;  2QEX V;  4UCU A;  4DR6 O;  3OMI B;  3A0W A;  4LR3 A;  3ZRW A;  4MP2 A;  2YEG A;  4JI4 O;  1AR4 A;  3SJC C; 
#chains in the Genus database with same CATH homology
 4JTD B;  1UY9 A;  4CWF A;  3VBB A;  5IYD O;  1TC0 A;  2DYR B;  3W7T A;  1I5C A;  3GWO A;  3ML0 A;  3ETG A;  4H81 A;  3RLQ A;  4XIT A;  1JVM A;  3GIG B;  3CCS V;  3E86 A;  4LCU C;  2QE7 G;  4K4O A;  1ROP A;  4GX2 A;  2W6I G;  4AS9 A;  4X89 A;  4MSW C;  2Q8H A;  3ABU A;  1MX0 A;  2XHX A;  3AG3 B;  1TBW A;  1YSZ A;  1SZT A;  3K04 A;  1GM7 A;  4F4L A;  2YGF A;  5B3S C;  4CWN A;  1RPO A;  4R3M A;  4XDM A;  4L87 A;  3K98 A;  4XDL A;  3LDC A;  5H6R A;  1Y4M A;  2YKJ A;  3MNR P;  3CRK A;  1GO3 F;  5EBW C;  4MVS A;  4Q20 A;  2K1E A;  2ZD9 A;  2H94 A;  4MPC A;  3HHU A;  4W7T A;  2YEE A;  1BXD A;  2WI4 A;  1M1K W;  2QG2 A;  3EHB B;  2YE3 A;  2YED A;  1FFT B;  2EIJ C;  1PNK A;  2JK5 C;  3ZKD A;  2BU2 A;  5CTY A;  2QF6 A;  5IDM A;  4XKO A;  4LPB A;  5M4N A;  3ASN C;  2BU5 A;  3MD0 A;  1B63 A;  2W6J G;  3A0X A;  3INW A;  3OMA B;  5B1B B;  2ITD C;  2FWY A;  2YKB A;  4V25 A;  1I5B A;  2BRC A;  5E1A C;  3OW2 U;  3OR6 C;  2OTJ V;  2BU7 A;  1XL6 A;  1P4R A;  1GM8 A;  1M9N A;  2Q2E B;  4HY6 A;  2YK9 A;  3AG4 B;  1COW G;  3D36 A;  4P2Z A;  1ID0 A;  2IH1 C;  2QM7 A;  4PRX A;  3TK1 A;  3K60 A;  2OCC B;  2Z5U A;  4P8O A;  2Q67 A;  1OCO B;  1JOY A;  3NXS A;  4JAV A;  3K9A A;  4G28 B;  4L93 A;  4GX5 A;  1I5D A;  1F51 A;  3T0H A;  2C2A A;  1MAB G;  3P30 A;  2LFS A;  3OPD A;  4BQG A;  4E2L A;  1NVP D;  4MT8 A;  5FL7 G;  4AWP A;  3H4L A;  3CCV V;  1NVP B;  2WLK A;  4LWF A;  5H6Q A;  1Q86 W;  2BRE A;  3E35 A;  4XE2 A;  5DM6 V;  1YJW V;  1N8R W;  3JCZ A;  2UXN A;  2ATK C;  2OT5 A;  5IN9 A;  2YEF A;  4HZ5 A;  3QDD A;  1S14 A;  2QG0 A;  4H85 A;  2WI3 A;  4WFF A;  1UYE A;  2XDL A;  1R3K C;  2QA4 V;  3FB8 C;  3OFN G;  3DGE A;  2YI0 A;  3QO7 A;  2BU6 A;  3INX A;  5IY5 C;  2XJG A;  3QTF A;  3GIE A;  3ETE A;  4P7A A;  2EIL C;  2EZO A;  1UYI A;  3I55 V;  3ZXO A;  3TZ0 A;  4PRV A;  1AJQ A;  4LWH A;  3CPW U;  1Y66 A;  4JPR A;  2A0L A;  4R1F A;  4MVU A;  4JQL A;  3U2K A;  4XCL A;  1PNL A;  4CWR A;  4DZY A;  1DF4 A;  1AI4 A;  1WPX A;  4BW5 A;  1NR7 A;  2ZDI C;  3OEH G;  2Y69 B;  3CCU V;  1GKZ A;  2XJX A;  4U7O A;  2YI7 A;  2Q6A A;  4DO2 A;  5LGU A;  4KTN A;  4NH9 A;  1OCZ C;  4HYO A;  4WFG A;  3ZIA G;  3ZMT A;  2BTZ A;  4LBE C;  3T1C A;  5CF0 A;  3T0Z A;  3OWD A;  3EHG A;  1QLE B;  2A79 B;  3LNM B;  4X8A A;  1KKD A;  1P7B A;  4XDK A;  3OAA G;  1KZN A;  2WER A;  2YI5 A;  1R73 A;  1W0J G;  3R4M A;  2IOQ A;  1JPX A;  2BT0 A;  5B1A C;  2VCJ A;  4UVC A;  4QPK A;  2Y48 A;  2YEH A;  2BU8 A;  4WFB V;  2YE2 A;  2JEU A;  2GFD A;  4HYM A;  3ASO C;  1FXV A;  2ZR2 A;  3T4D A;  2YE5 A;  1U2O A;  3CYO A;  2Z3Y A;  4WF9 V;  3D3I A;  2P6J A;  2YKE A;  1YT2 A;  4UUJ C;  4RO2 A;  1JCH A;  3AG2 C;  4MP7 A;  4L94 A;  1NJI W;  1U0Z A;  2EJR A;  1F4M A;  2WLI B;  1YET A;  1BHB A;  1GMG A;  3ZCC A;  4MPE A;  3OR7 C;  3QO5 A;  2XX4 A;  2IOR A;  4MOT A;  2BOC C;  1FXH A;  1UY8 A;  1CPY A;  4FIP C;  1YER A;  1AI5 A;  5CMU A;  3F5W C;  4CBC A;  3OEE G;  1RPR A;  1HWY A;  4ASB A;  5CTU A;  4PA4 A;  1V55 C;  3FKS G;  2YEV A;  3RLR A;  5EBL C;  1G8M A;  4HXZ A;  1UY7 A;  1JX9 A;  3SPJ A;  3I56 V;  3SYO A;  3VHC A;  4KUM A;  4RQE A;  2PI4 A;  3K99 A;  1MOF A;  4GT1 A;  5M4K A;  2ZDI A;  4O04 A;  1R6N A;  1DTO A;  4PL9 A;  3VAD A;  5L3D A;  3R4P A;  3GIF A;  3U67 A;  2WLJ A;  1K73 W;  4RUF A;  3B24 A;  3TZ4 A;  4CE2 A;  4TWK A;  4RQF A;  5EK0 A;  3W7X A;  1BL8 A;  3A0Y A;  3B25 A;  2HR3 A;  1BMF G;  2V7Q G;  2GQP A;  1B62 A;  2ITC C;  4GX0 A;  1YC3 A;  3FT5 A;  1BKN A;  4L91 A;  1NR1 A;  5CPH A;  3TZ5 A;  4MW3 A;  5D6P A;  3B26 A;  2EIM C;  4KFM A;  4FCR A;  1I5Y A;  3ZN0 A;  1I5A A;  1M57 C;  3KG2 A;  3FV5 A;  2ZDX A;  2WI2 A;  1F23 A;  3AG1 C;  4B6C A;  4X88 A;  3CXC U;  3DTU B;  2P7T C;  4RUE A;  3WHA A;  3W7W A;  3O2F A;  2Q8I A;  4HZ3 A;  2EIN C;  3AEI A;  4YKT A;  2Q8G A;  4LP0 A;  2UXX A;  1MSW D;  1R6K A;  1YIT V;  2YEB A;  2H8M A;  2BOB C;  3B77 A;  5L3F A;  5D7R A;  4JTA B;  5HFL A;  3R92 A;  4FCQ A;  4QJF B;  3CC2 V;  2WLL B;  5DN6 G;  3HB3 B;  4EGK A;  3VOU A;  3AG2 B;  3JZ3 A;  4NH7 A;  2HVJ C;  3H01 A;  4BAE A;  4HY1 A;  3ABM B;  3CMA V;  4PU9 A;  4UXN A;  3ZRW B;  3W7S A;  3SPG A;  3JD2 A;  2CG9 A;  3EHF A;  2IJJ A;  1YI2 V;  4FJC C;  2Q68 A;  2QKS A;  1Q82 W;  5CN0 A;  5EC2 C;  2JDI G;  1AR1 B;  3K08 A;  1YSR A;  3SYC A;  1V55 B;  2WWW A;  3IGA C;  2XDU A;  1QCE A;  4AWO A;  3E83 A;  1H7S A;  4PA9 A;  4URO A;  3ZMS A;  2WI6 A;  1NBM G;  1M56 C;  4MPN A;  3P32 A;  2ZXW C;  3Q5J A;  4G2K A;  1Y4S A;  5KA6 A;  1AM1 A;  1BGQ A;  1TID A;  3K97 A;  1YES A;  3BM9 A;  1ZWH A;  4GGL A;  2YEI A;  3CCM V;  1K8A W;  1W0K G;  3JD0 A;  1JQ0 A;  2VWC A;  2QM8 A;  4CWS A;  2B5U A;  3H80 A;  3E8F A;  2XD6 A;  2ZR3 A;  4MVM A;  4QPJ A;  3G4S V;  1QR8 A;  4CE3 A;  3QNE A;  5J9P C;  3CC4 V;  1UYD A;  1YC4 A;  1QZR A;  3SYA A;  3RVZ A;  4CZZ A;  3JYC A;  3STL C;  1W2B U;  1THZ A;  2EIM B;  3UM7 A;  4ZVI A;  3B8N A;  4O09 A;  1NKD A;  3G71 V;  5M4M A;  3K0G A;  3SYQ A;  2MK3 A;  4Z1M G;  2X6B A;  3AG1 B;  3CCE V;  2EBO A;  2EIK B;  3WG7 C;  1VQN V;  3ABL C;  5IDJ A;  3X2Q B;  4O05 A;  1UJW B;  1OCR B;  5F5R A;  1AJ6 A;  2EIN B;  2K5B A;  4YKZ A;  4JYB A;  1FXK C;  3ZRX A;  4MTG A;  4L90 A;  1DF5 A;  3K06 A;  1AMW A;  3ABK C;  4U7N A;  4RAI A;  2X0L A;  5BOC A;  2XK2 A;  4KSG A;  5IYB O;  3OWB A;  4JAS A;  3ABT A;  2WLM A;  1GTO A;  5FND A;  1WLE A;  2DYS C;  4YKX A;  4LWI A;  3HEK A;  3A0R A;  4PA6 A;  5L3B A;  5L3G A;  1Y4U A;  3CRL A;  1QYE A;  2EZP A;  5B3S B;  1VQK V;  1THN A;  4AWQ A;  2BZ5 A;  1H8E G;  1QVG U;  3O0I A;  1Z5B A;  2IWX A;  4KFG A;  2ZQM A;  1YT1 A;  2WSS G;  4CWP A;  3BY6 A;  2HVK C;  1UYF A;  2HG1 A;  2XJJ A;  1K97 A;  2AHY A;  2NLJ C;  4ASF A;  1OCC C;  4MTX A;  5FNC A;  3OMU A;  1QBZ A;  1YC1 A;  4FPP A;  5L3C A;  1QR9 A;  3ZRS A;  4GFN A;  2ZXW B;  1SER A;  3ZMZ A;  1QY8 A;  2EXL A;  2A9H A;  5H9C A;  1S3J A;  3CCJ V;  3CC7 V;  2EIJ B;  5KUM A;  2P90 A;  3PEH A;  2XDX A;  1UYL A;  2CGF A;  3TUH A;  3IED A;  1K4C C;  3ASN B;  4EM7 A;  1OHH G;  1R3J C;  2YSU B;  5L3E A;  1UYM A;  1VQ7 V;  4E00 A;  1RM1 C;  4TSF G;  3HYZ A;  1I5X A;  1L1F A;  1YIJ V;  3SJQ C;  5FNF A;  1FS0 G;  1VQ6 V;  1J95 A;  3EKR A;  3ZJZ A;  1FXK A;  3SL2 A;  3LSS A;  4B7P A;  1TC6 A;  2O1V A;  4JTC B;  4LP8 A;  1PL0 A;  3CCQ V;  2IWU A;  4O07 A;  2R9I A;  3EFF K;  1L0O A;  4PDV A;  4MTF A;  4QIW F;  4ASG A;  2CCS A;  2YEC A;  2YE6 A;  4CE1 A;  5CBG A;  3KE6 A;  2DWD C;  3RW0 A;  1I58 A;  1EBO A;  3LPS A;  1H2G A;  1YJN V;  4DUH A;  4I9W A;  1ARO P;  4N23 A;  3K3W A;  2Q8F A;  3OW6 A;  2R9R B;  2DYR C;  1M90 W;  1JJ2 U;  4FK5 C;  4N21 A;  1KIJ A;  3VHD A;  4HZ0 A;  1F4N A;  1E1R G;  4PDL A;  3BMY A;  3HPL C;  2AKP A;  5EBM C;  3SYP A;  3R91 A;  1H38 A;  1ZXN A;  2YGA A;  1E79 G;  4YKU A;  1VQM V;  3AG3 C;  4R50 A;  4UV8 A;  2FTK A;  3CGZ A;  1YSC A;  4YKR A;  3E89 A;  1VQ5 V;  1OZ0 A;  1VQP V;  3CWV A;  3LUT B;  1R62 A;  1PD3 A;  1Q81 W;  1YTF B;  5IY5 B;  2ZKJ A;  3JD3 A;  1TUE B;  3SPI A;  5GW7 A;  1SES A;  2EIL B;  4KQV A;  4R6Z A;  4CWO A;  2LFR A;  4U93 A;  2HFE C;  2HCH A;  1K4D C;  2YEV B;  3PJS K;  2YEA A;  1DLB A;  3BEH A;  3A0T A;  1QLN A;  1E1Q G;  5GGZ A;  4G27 B;  4X9L A;  1SRY A;  3E8H A;  3B28 A;  5B1B C;  2CH4 A;  4EEH A;  4CWT A;  3JD1 A;  5KA5 A;  1OCZ B;  4KP4 A;  4KSH A;  2ESA A;  3OGC C;  1B6Q A;  2QTO A;  3MHS C;  2XX2 A;  1ORQ C;  5BOD A;  1I59 A;  1QVF U;  3C0E A;  4ASU G;  2XND G;  4MB9 A;  3K03 A;  2WEP A;  4H33 A;  3AG4 C;  2ZDY A;  4MVO A;  3FB5 C;  4QE9 A;  5B1A B;  3W7U A;  4EKW A;  2JKI A;  2ZBK B;  2JIZ G;  2OCC C;  1KP3 A;  1UYC A;  5B1N A;  3ASO B;  2XCM A;  1OCO C;  2M7W A;  4EMV A;  4URL A;  3T2M A;  3GIG A;  4DXW A;  3FT8 A;  3T4Z A;  3CGY A;  2HKO A;  1YHQ V;  2YE7 A;  2GSM B;  4XIR A;  1Z5C A;  1AI6 A;  2XAF A;  3TZ2 A;  1VQL V;  3CCL V;  1YT0 A;  4YXW G;  4XD8 A;  2IOP A;  1S16 A;  2YJX A;  3ZN1 A;  3ZMV A;  3R4N A;  2YE8 A;  1TIL A;  1MU5 A;  1PKX A;  2FWZ A;  2WLN A;  4BXI A;  2NNU A;  3G6E V;  2PNR A;  2IU3 A;  1K92 A;  2XHT A;  3CME V;  2BYI A;  3R4O A;  4NH8 A;  3RBZ A;  1Y8N A;  1YS3 A;  3EHJ A;  1K5Q A;  4XDJ A;  3IFX A;  2YGE A;  5J71 A;  1S76 D;  4QNH B;  3FB7 C;  4EGH A;  1Z5A A;  5CA3 A;  3R65 A;  1KD1 W;  1VQO V;  2GHY A;  2X6A A;  4O0B A;  4URM A;  3LDD A;  1EFR G;  4MVQ A;  3PEJ A;  2D3O W;  3F7V C;  4UVB A;  1TH8 A;  1VQ8 V;  2OTL V;  1AH8 A;  1R3I C;  2WI7 A;  3O6O A;  2Q69 A;  1KC8 W;  1US7 A;  3JD4 A;  2YK2 A;  1S0V A;  3MHH C;  4GQT A;  2VCI A;  5CBH A;  5D7C A;  2BSM A;  3NMQ A;  2Y69 C;  2YJW A;  4P9P A;  4PDM A;  2XDK A;  5IYC O;  4WFE A;  1PVG A;  4YKQ A;  1R3L C;  3ZMU A;  3CD6 V;  4JYC A;  1CP9 A;  1M57 B;  2X6C A;  3CCR V;  1QLE C;  4ZBM A;  3RKZ A;  1Y8O A;  1ZXM A;  3GB7 C;  1XL4 A;  1EI1 A;  4GT8 A;  4QE7 A;  2VW5 A;  2DW4 A;  3LDE A;  3ETD A;  3STZ C;  1GK9 A;  1PNM A;  1NQT A;  5D7D A;  5LGT A;  3B27 A;  4CWQ A;  3U2D A;  4URN A;  1ZWI C;  1GKX A;  1Z59 A;  1VQ9 V;  3OUS A;  4LC1 A;  2IW5 A;  2YKI A;  1OSF A;  5B1O A;  2HLD G;  4UVA A;  3M99 B;  3TCU A;  3G75 A;  2YKC A;  4GCZ A;  2YI6 A;  1S72 V;  3IC7 A;  4PDR A;  2JEX A;  4I3H A;  4V26 A;  4BIZ A;  2FYP A;  2YE4 A;  1ZW9 A;  2WAM A;  1H8H G;  1K9M W;  1K3E A;  1GM9 A;  3D0B A;  4XC0 A;  5M4P A;  4MS2 A;  4J9Y B;  1EA6 A;  5CTW A;  1G4Y B;  2JJ2 G;  1M56 B;  4XBF A;  3WFV A;  4YKY A;  2IJH A;  2WPD G;  3RVY A;  4R7C A;  2DWE C;  2H8P C;  2XX5 A;  1S5H C;  2XHR A;  1MG1 A;  4MW8 A;  3ZKB A;  2KB1 A;  2P67 A;  1K33 A;  2JJC A;  1NH2 D;  1SET A;  4XKK A;  2XAQ A;  4PEL A;  4HXW A;  3D2R A;  1AJP A;  2XOK G;  1V54 C;  5BZB A;  1NH2 B;  4BAY A;  2E0A A;  5M4E A;  3A0Z A;  1Y8P A;  1GJV A;  2IWS A;  4WCE V;  1Q7Y W;  5HFM A;  1KP2 A;  4P9O A;  1ENV A;  2AHZ A;  4ZKI A;  1KQS U;  5LHG A;  3FB6 C;  3SPH A;  5LBQ A;  2IJK A;  4MTO A;  4YKW A;  3FYI B;  3QO8 A;  2CCT A;  2YEJ A;  4JAU A;  2O1U A;  5CBF A;  1NHI A;  4WFH A;  2O1W A;  1NHJ A;  3TET A;  4EGI A;  3T1K A;  4EFU A;  3WG7 B;  2QFO A;  3ABL B;  2WLI A;  4GEE A;  4OXS A;  4R8C A;  2HKJ A;  4WFA V;  2WEQ A;  1IXM A;  4H37 A;  1FXK B;  1H7U A;  4PA7 A;  3OMN B;  2DQ3 A;  1UYK A;  2V1D A;  2IU0 A;  1LNQ A;  5KUK A;  3ABK B;  1YJ9 V;  2W0F C;  2XAS A;  3WQ9 A;  1GKF A;  5EC1 C;  3E2E A;  3F7Y C;  4UV9 A;  2DYS B;  1JM6 A;  2PI5 A;  3ABM C;  4I5S A;  2XAH A;  4LWE A;  3K0D A;  4GX1 A;  2B1I A;  2WI1 A;  3T10 A;  4XKA A;  4WUD A;  4E01 A;  4XTJ A;  4BIU A;  2BYH A;  2IH3 C;  3K79 A;  4MBC A;  4WUC A;  5CTX A;  2B1G A;  5C93 A;  4PA3 A;  1YTF D;  5LGN A;  5LHH A;  4JGS A;  2HJF C;  4ASA A;  3E8B A;  4FCP A;  4L8Z A;  1AJN A;  5D6Q A;  2CK3 G;  1KEC A;  4J9Z B;  1OCC B;  2CCU A;  2X7R B;  1AI7 A;  3C11 A;  3Q5L A;  3HZ5 A;  3T2S A;  1B3Q A;  4TT3 G;  3EHH A;  5M4H A;  3B8M A;  2JJ1 G;  5LHI A;  5F3K A;  2IJI A;  4JF3 A;  5L3J A;  2WLH A;  2F43 G;  3EKO A;  4H7Q A;  3HZ1 A;  3LSQ A;  1AH6 A;  4EFT A;  1K5S A;  5J6A A;  2H55 A;  4WUB A;  1NHH A;  4E02 A;  1A4H A;  1UYH A;  4MVR A;  3SPC A;  3OE7 G;  2DQ0 A;  1V54 B;  1VQ4 V;  1RM1 B;  1UY6 A;  4HAM A;  4HYP A;  1BHA A;  4R3A A;  2XAB A;  3TTZ A;  1K7D A;  3UKM A;  2LP7 A;  3Q5K A;  3E8G A;  3LNU A;  3VHA A;  1UYG A;  4BQJ A;  1EZJ A;  2WI5 A;  3G7E A;  3ZRV A;  2XAG A;  1BYQ A;  2UWD A;  3G7B A;  1CEZ A;  5FWK A;  4XCJ A;  4XIP A;  4XIQ A;  4LWG A;  2YE9 A;  2WLL A;  1S77 D;  2XDS A;  3RLP A;  2EIK C;  2FXS A;  3OM3 B;  3ZM7 A;  2XAJ A;  3X2Q C;  1OCR C;  2HG5 C;  3OUF A;  4MVZ A;  3ZXQ A;  4FMT A;  3FYE B;  3CP1 A;  4P30 A;  3HYY A;  1K34 A;  2QEX V;  3OMI B;  3A0W A;  3ZRW A;  4MP2 A;  2YEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...