3D36A

How to switch off a histidine kinase: crystal structure of geobacillus stearothermophilus kinb with the inhibitor sda
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
226
structure length
217
Chain Sequence
GPHMVIRLAASISHEIRNPLTAARGFIQLIEEQPLAADKRRQYARIAIEELDRAEAIITDYLTFAKPAPETPEKLNVKLEIERVIDILRPLANMSCVDIQATLAPFSVIGEREKFRQCLLNVMKNAIEAMPNGGTLQVYVSIDNGRVLIRIADTGVGMTKEQLERLGEPYFTTKGVKGTGLGMMVVYRIIESMNGTIRIESEIHKGTTVSIYLPLAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How to switch off a histidine kinase: crystal structure of Geobacillus stearothermophilus KinB with the inhibitor Sda
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/transferase inhibitor
molecule keywords Sporulation kinase B
total genus 68
structure length 217
sequence length 226
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3d36A02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3d36A01
1I59A 1UY7A 2BU7A 3INXA 3CWVA 3HYZA 5M4PA 4L90A 3GIGB 5D6PA 4YKWA 4CWNA 1NHHA 2YEAA 3R4NA 3EHHA 1YC4A 2YGFA 1BYQA 4JQLA 1Z5AA 1UYMA 2WEQA 5F5RA 3VHDA 1YETA 2FXSA 4JYCA 2Q8IA 4CWRA 3C0EA 3TZ2A 5B1NA 5FNCA 4CE3A 4DUHA 3PEHA 1YSRA 4JAVA 1GJVA 3PEJA 2YEIA 5BODA 1YERA 1UYFA 4O07A 2HCHA 2WI3A 5CTWA 2IOQA 5C93A 1H7UA 2YI5A 2LFSA 2Q8GA 5FWKA 2IWSA 1YT0A 4WUDA 4B7PA 4FMTA 2QM8A 1I5AA 2WERA 2O1WA 3ZKDA 1I5DA 3K99A 5FNDA 4WUCA 3MD0A 4HYPA 1UYDA 4AWOA 4P7AA 4NH9A 4AWPA 2IWXA 1Z5BA 2XHXA 1AM1A 1JM6A 1NHJA 1THNA 2P67A 3K97A 2CCSA 1UY8A 4PL9A 1I5BA 4MTXA 1Y4SA 4BQGA 4WUBA 2BREA 2XDLA 2WEPA 2YEBA 4LPBA 1BGQA 4XCJA 1YC1A 5CTXA 2XX2A 4NH8A 3H4LA 4PRXA 1PVGA 3VADA 3BMYA 1EI1A 4JYBA 2IORA 4CWQA 4MPNA 2HG1A 2BU8A 3H80A 4CWOA 4E02A 4HZ0A 1AH6A 2XHTA 2YEDA 4L91A 3CGZA 2QM7A 4GQTA 5B1OA 2BRCA 3D2RA 4XKOA 2YGAA 4E00A 2YEHA 4FPPA 1U0ZA 4O04A 3B25A 4EGKA 2QG2A 4XKAA 3R91A 3TZ0A 1U2OA 3D36A 4O05A 3RLPA 4EGIA 2XDUA 2XDXA 1UYCA 4XCLA 5FNFA 1Z59A 3T0ZA 3R92A 3TTZA 2CG9A 4LWIA 2CCTA 4GFNA 3R4MA 5D7CA 1ZXNA 4X9LA 2XCMA 4HY6A 4CWTA 3B28A 2YK9A 2YK2A 3O0IA 4XTJA 1ZXMA 4BXIA 3D0BA 2IWUA 2YI7A 2WI2A 2O1UA 4YKTA 4PRVA 3TUHA 3NXSA 3A0WA 3P32A 3FT5A 4ASFA 3OWDA 5D7RA 3ZXQA 3B26A 2ZDYA 2ZBKB 4XDMA 1S14A 3R4OA 3LNUA 1ZWHA 1Y8OA 4BIZA 2AKPA 2ZKJA 4AS9A 2BU5A 1B63A 2XJXA 3EHGA 2O1VA 4YKRA 1UYGA 2K5BA 1AJ6A 4P8OA 2XJGA 3HYYA 2UWDA 3INWA 3QTFA 2PNRA 1ID0A 3WHAA 5IDJA 2YKEA 2YEEA 3K60A 2YI6A 3G75A 4URLA 1UY9A 2YE8A 3EHJA 2C2AA 2YEJA 3HZ5A 1TH8A 2EXLA 4MT8A 4ASBA 4EEHA 5D6QA 2VW5A 4YKZA 4K4OA 4LWGA 4R3AA 4R3MA 3O6OA 2WI5A 3CRKA 5CF0A 1NHIA 3ZRXA 2XHRA 4AWQA 2FTKA 3Q5JA 1R62A 4XC0A 3G7BA 2YE9A 1Y4UA 1GKXA 1B3QA 3T10A 5CTYA 4GCZA 1UYKA 3ZCCA 5GGZA 5IDMA 1TBWA 4YKQA 4URNA 2YE7A 4FCQA 4LWFA 4R1FA 1EA6A 4URMA 2VCJA 4XITA 4MP7A 4I3HA 2YKIA 4FCPA 1B62A 1I58A 3KE6A 2LFRA 4XD8A 1QY8A 2Q8HA 3GIEA 2WWWA 3QDDA 1KIJA 2GQPA 4YKUA 4UROA 4O0BA 3VHAA 2QFOA 4ASAA 3T2SA 4W7TA 4DZYA 3LPSA 3U2KA 4BAEA 4Q20A 4U93A 4B6CA 2IOPA 4KFGA 2YKJA 2YE6A 1US7A 3A0XA 4V26A 3JZ3A 2YE3A 4LP0A 4JAUA 3ZKBA 2CH4A 1S16A 2YEGA 1TIDA 4EMVA 1GKZA 2YI0A 3G7EA 4QPKA 5D7DA 2JJCA 5M4MA 3CRLA 4QPJA 2YE5A 3RKZA 1F51A 4JASA 4YKXA 4MB9A 2BTZA 1MX0A 3NMQA 3ZRWB 2VWCA 3RLRA 3OW6A 3OPDA 2XABA 4HXZA 3OWBA 2BU6A 3MNRP 1YT1A 3HZ1A 3U2DA 4CWPA 4XE2A 1TC6A 3FV5A 4LC1A 4U7OA 3TZ4A 4MPEA 4ZKIA 2WI1A 3U67A 1I5CA 2Q8FA 1UY6A 2XX4A 1IXMA 4U7NA 3WQ9A 3EKRA 4LWHA 4HXWA 1KZNA 4KQVA 2YEFA 2FWZA 1TC0A 4GGLA 5BOCA 2BT0A 3B27A 4H85A 2YKBA 2WI7A 4H7QA 1YS3A 4MP2A 4EM7A 1AMWA 1JOYA 1YT2A 2XD6A 3B24A 5L3JA 3HEKA 1UYHA 4KP4A 4E01A 3RLQA 1AH8A 1QZRA 4YKYA 3A0TA 2GFDA 4L93A 1H7SA 4MBCA 2VCIA 1Y8NA 5CTUA 3GIFA 1UYEA 2YE4A 4GT1A 4XIPA 2YJXA 1TILA 2BZ5A 4L94A 3EHFA 4HY1A 4GEEA 2Q2EB 4KSHA 3TK1A 4BQJA 2BYIA 3Q5LA 3EKOA 4EFTA 2QF6A 3OMUA 1Z5CA 4XIRA 3FT8A 1UYIA 3ZM7A 5M4NA 1BXDA 1Y8PA 5M4EA 3K98A 3GIGA 4ASGA 1UYLA 4H81A 3R4PA 4O09A 4CE1A 2CGFA 1YSZA 3TZ5A 3Q5KA 4MOTA 2JKIA 1A4HA 4KSGA 4KTNA 4V25A 5F3KA 4CWSA 2XX5A 4CWFA 4BIUA 3A0ZA 4NH7A 2H8MA 2FYPA 4FCRA 2WI6A 1OSFA 3VHCA 2CCUA 4HZ5A 5J6AA 3ZRWA 4XKKA 3O2FA 4XIQA 1MU5A 4L8ZA 3DGEA 3SL2A 4GT8A 3ZRVA 2E0AA 2XJJA 4HYMA 4PU9A 2YKCA 2YGEA 2BYHA 5CPHA 4LWEA 3T0HA 4CE2A 2YE2A 3A0RA 4EFUA 3A0YA 2WI4A 2YECA 3CGYA 3IEDA 1L0OA 2BU2A 1QYEA 3T1KA 2HKJA 4MPCA 3HHUA 3ZXOA 4ZVIA 2FWYA 2XDKA 3C11A 2XDSA 2BSMA 1YC3A 2XK2A 5M4KA 5J71A 2YJWA 5M4HA 2QG0A 1ZW9A 2ESAA 5IN9A 2H55A 2ZDXA 3BM9A 4EGHA 1YESA 1BKNA 4I5SA
chains in the Genus database with same CATH superfamily
1I59A 1K34A 3CD6V 4O4HA 3CWVA 3HYZA 2Q67A 4X1YB 1H2GA 3CCRV 3GIGB 5D6PA 3OM3B 3RYIA 4CWNA 1TVKB 4LBEC 2UUBB 5KUMA 3QO8A 5B5EZ 1Y76B 3F5WC 1QQCA 1UYMA 1R6NA 2UUCB 1XDCA 2N04A 2Q8IA 4AQYB 2Q9LA 4JZGA 1FJGB 3AG2B 5FNCA 2WLKA 1EN4A 1M9NA 4LFBO 4JAVA 4B3RB 1GJVA 3U0ZA 1XMQO 2YEIA 4PA6A 1YERA 3QO7A 2ZE6A 2X6BA 1N32B 4MTFA 3K5LA 1VQPV 2P22C 2D3OW 1FFXA 2LFSA 1IBLB 2XASA 4BIOA 5FWKA 1VIBA 3C3SA 4JZ2A 3GVMA 4FVMA 1GM9A 4WUDA 1HDJA 3ZKDA 1I5DA 1X4TA 5FNDA 4DV4B 3MD0A 4DUYB 1UYDA 5L3EA 3BHPA 4P7AA 4NH9A 5IWAB 2IWXA 1NH2B 4TUYA 1RP3B 5J2UB 1H8EG 4GKKB 5GTHZ 2CCSA 2OT5A 3I55V 5IY5C 2FL4A 2ARHA 2F93B 1DK1A 3ETDA 2A7WA 2JJ1G 5FL7G 1NT2B 4DV6B 2YEBA 2CH7A 4JTDB 1K33A 1QLNA 4QE9A 3FD9A 4TUYB 4TQFA 5DEDA 1NTZH 2L35A 4NH8A 3H4LA 2HP8A 3BVOA 3VADA 4LFCO 2EJ7A 4JYBA 4JYAB 1R1BA 4JI5O 4IYHA 1EI1A 3BA9A 3H1KH 5C8YB 4J9ZB 3JSLA 1TUBB 2GUZB 2WA4A 4PV1B 3JD4A 2L6LA 2DYRB 2XHTA 4WFHA 4L91A 1FXKB 4MVZA 4O2BA 3CGZA 1N4CA 5B1OA 4ZHQB 3D2RA 4XKOA 4E72A 2YGAA 3I5DA 3OEEG 5BR8O 1U0ZA 4O04A 1VP7A 2VQFO 2R70A 1AP6A 1YHQV 1FYJA 3D36A 3ZMUA 4EGIA 2XDUA 4DR5B 2CDYA 3L73H 1AVMA 1FXKC 2Q7GA 2GV9A 4IL6Z 4WFAV 3J81N 4DV7B 2JGDA 3HKDB 4LWIA 5HFMA 4HYOA 3ICXA 3R4MA 2Y0IA 1ZAUA 4X9LA 2XCMA 4FM1A 2EZPA 1QLEC 5LOVA 3ABMC 4X65O 1QHTA 5KHIA 4XTJA 4BXIA 1ZXMA 4JGSA 1XL6A 2IWUA 4NXNO 3J80N 1KECA 4YKTA 1VQLV 4MVSA 3A0WA 1GN2A 3KZIZ 2Z5UA 4TOIA 3AEIA 1HNXO 4KL1A 2ZDYA 1AI5A 2ZBKB 4CC5A 1ZWHA 3RT3C 2ZQMA 1Y8OA 4FFBA 4Z1VA 3SYPA 3E86A 3O65A 3JATA 1TA8A 1ZLZA 1ENVA 1H2KA 1SQXH 3ZHTA 1I5XA 4XDLA 3SYQA 2DWEC 2XJXA 3EFFK 1RM1B 4YKRA 4DR6B 3K3WA 2GTSA 2ZCEA 2XJGA 1VF6A 4UFZA 2UWDA 3QTFA 5BMVB 4O4LA 5LGNA 3WHAA 3K60A 2YEEA 3AG4C 1Y76A 1S3JA 3E8BA 4I4TB 4JI3O 2YE8A 2JEUA 2X0LA 3EHJA 2Y69B 1RFYA 4JTCB 3AG1C 1IDSA 3WB1A 4BW9A 3B8MA 2P4KA 1IBKO 2IU0A 4K4OA 3AG4B 4NVPA 4NTWA 3WU2Z 3O6OA 5FPRA 1FFXB 3K08A 2CAZC 1I5YA 1XBLA 2HG5C 3K0GA 3M7MX 3E89A 4CS2A 1NBMG 2XHRA 3IFXA 4XC0A 1B3QA 3T10A 5BXZA 5EYPB 2RNBA 3ASNC 4JI2B 1TBWA 3L74H 4YKQA 4URNA 3CEIA 4LWFA 4R1FA 1P4RA 5LYJB 4B3TB 4CH5A 1BE3H 1TVKA 4GX1A 4DXWA 3ZRSA 2B5UA 2EIMC 1RSOB 2WAMA 1GK9A 4LFBB 4B3RO 2LFRA 3UO2A 2Q8HA 4B3SO 3OMAB 3STZC 4UV8A 1M57C 4RWUA 1V54B 3VHAA 4W7TA 1OCZB 2IJJA 1AP5A 4JI1O 2Y69C 2C1GA 4UCOA 3ASOB 1PV0A 5LHGA 2JK5C 2IOPA 2YE6A 2E5LB 1US7A 1D5AA 3A0XA 3APQA 2P06A 5IWAO 1K3EA 2YE3A 3N2KA 5GONA 2HJFC 4KXRA 1SC5B 4FLZA 3GWKC 3FB5C 2ZR3A 2WLHA 4X1IA 2UXCB 1TIDA 1H2MA 2YI0A 1VQ4V 4QPKA 1H2NA 5D7DA 1J5EB 1YZBA 4QPJA 5CA1B 4DV0O 1N33O 3RKZA 4YKXA 4JASA 2BTZA 4LFAB 1AILA 1MX0A 2MW2B 3K03A 4P30A 4EFBA 5CBFA 3CPWU 2VWCA 4RQEA 1K8AW 3JD1A 4WBNB 1VQOV 4NR1A 3OMNB 4FLTA 1BHAA 1N0JA 1G8MA 4EFEA 3U2DA 4UVBA 5KA6A 4XE2A 4CWPA 2BSKB 4PDRA 5KUKA 1RSOA 3F5TA 4MPEA 5LHIA 4ZKIA 2IJIA 1GAXA 2Q8FA 4LWHA 1RM1C 2PGGA 4HXWA 4O2AA 1B6QA 1VF6C 2AXTZ 1M93A 2X6CA 1M4UA 2HHIA 3B27A 1JX9A 1S5LZ 3CX5F 3MAQA 1YS3A 5H2FZ 2QWPB 2YIDA 1GM8A 5GTIZ 3G6EV 3RYIB 1AMWA 4KUMA 1JOYA 3KCYA 5EZYB 3ZEDA 1BZKA 1G1XB 1YT2A 1KB9F 3RYHA 1L0LH 2PUSA 3RLQA 4CS3A 4RUFA 2VCIA 4DR4B 1XUQA 3AK2A 4E4EA 2UU9O 3GIFA 3CXCU 3OTFA 2QTOA 2H8PC 4NTXA 4K3AA 4UV9A 4L8JA 1NZ6A 2F1MA 1BQ0A 2BYIA 1XNRO 5H5NA 3OTOO 1VQKV 3OMUA 1SZTA 1JR9A 3SPGA 1BMFG 1HW7A 1VQ7V 4TSFG 4FLWA 3ZM7A 4J42A 5FPOA 4DK0A 1BQZA 4ASGA 1WPXA 2ZDIC 1YSZA 4UXNA 4DV3O 4KSGA 4KTNA 3A0HZ 4CWSA 3CCMV 4NH7A 5C8YA 2H8MA 4FCRA 2UUCO 2BOBC 2FB5A 2WI6A 3FYIB 5J6AA 4AQYO 1OCCC 1W59A 1IBKB 1ORQC 4A5UB 4GT8A 3Q4HA 3SGIA 3ZIAG 5LP6C 2IM9A 2YKCA 1N32O 5CPHA 3N2GA 2PYLA 3R65A 1OCOC 4LWEA 4YJ2B 3T2MA 4AILC 3L9DA 2YEVA 3RBZA 5CN0A 4OPHA 4H37A 4DR3O 1QVFU 4Q6GA 3TGUH 1PL4A 3E22B 3JALA 4RO2A 5IJ9A 3SJQC 2WLIA 4MPCA 3TJTA 4W4KA 3HHUA 4DV4O 2EBOA 3EVKA 5JQGB 3WFVA 2XK2A 4YY3O 2QG0A 3FAVA 3FKSG 1ZX3A 3CSXA 1ZW9A 5LMUO 5IN9A 3E83A 4EGHA 2VWKA 1SKVA 4O2BB 1WP7A 1UY7A 1NR1A 1L1FA 4KHPO 5J2TA 1WA8A 1JFFA 1V9PA 3UT5B 5EBLC 1VMGA 1V55B 2JGDB 3ZMTA 2YEAA 3R4NA 3EHHA 1SQPH 1YC4A 2GDSA 4JQLA 2KG7B 2ZXWB 4GUNA 2DN9A 4LFCB 2WEQA 3VHDA 1YETA 4JI5B 1UJWB 3QTCA 2E5LO 1VQMV 2HEPA 1COWG 3U11A 1S72V 5B1NA 3ZHRA 2ADQB 3OD4A 4JI7B 4CE3A 4DUHA 1Q43A 4X8AA 3PEHA 2KB1A 3H1JH 3PEJA 2HJDA 3CMEV 1OJHA 3RW0A 5IYZB 4EEQA 3UT5A 2HCHA 2WI3A 5CA0B 1W0JG 5KX5A 3HR0A 1H7UA 2IOQA 2Q8GA 1RPRA 2RCVA 3E8GA 5IT9N 3GB7C 1YT0A 3ABLB 5LBQA 2ZD9A 1YTFB 1Q6UA 4FMTA 2QM8A 3B8NA 4AI8A 3K99A 4LNUB 1QVGU 4AWOA 4GX2A 3D36C 1S5HC 1AROP 2QWNB 5JQGA 5D5QA 2AZ0A 2CTPA 1AM1A 1JM6A 1S5JA 2QKAA 2P67A 1GRJA 3CJHB 3E8FA 4TV8A 3ABLC 2YSUB 2D2CB 5L3BA 4LF4O 1I5BA 1WLEA 4QJFB 2YIBA 4P9PA 1SQVH 5EIBC 1YI2V 2HLDG 2UXDB 2BREA 4PHZA 3OUFA 2WEPA 1Y74A 3SYOA 1Q82W 4LPBA 1U96A 2QA4V 1X59A 3CCSV 3UKMA 2XX2A 5FLXN 4PRXA 1L8DA 2ITDC 1PVGA 1MSWD 4D7SA 4DV1O 1R3IC 2IORA 1FXKA 2F43G 1AR4A 1Q6IA 3ASNB 1VF5B 4X64O 4MTOA 2ZIOA 4U3JA 2IH1C 4WFBV 1KU9A 3JAKA 4I50A 4PA9A 3JD3A 2BRCA 1NS1A 2ILMA 5KHJA 4XKAA 5KHGA 4DR4O 1G4YB 3WB0A 4IYIA 3FYEB 4B3MB 2PI4A 2Z0AA 2XAQA 1G6UA 1NU1H 2ZT9B 4CH3A 4O4JB 3R92A 1K4CC 2JJ2G 3TTZA 4JI4B 1GM7A 4GFNA 1W0KG 3OMIB 1GKFA 3EXAA 4UUJC 2YK2A 4J80A 2E74B 2ETNA 1K73W 4PRVA 2P7TC 3TUHA 3NXSA 4DV5B 1KP2A 3U10A 1ZL8B 3FT5A 1HNZO 3WB2A 2ZR2A 4TWKA 4ASFA 3T4ZA 3OWDA 1SRYA 4DR7O 5D7RA 2Z3YA 1SESA 1OCRC 4O4IB 3B26A 1Q3EA 4GX5A 5D5PA 1ZWIC 1S14A 1SZXA 3LNUA 1WPBA 2R9IA 4BIZA 2AKPA 1LUVA 4DYLA 2ZKJA 4GX0A 4B3SB 2YI8A 4DRXA 4LF8B 4DW0A 1B63A 4RUEA 3EHGA 1XILA 3CB2A 1UYGA 2Y4UA 2CUGA 3CHXA 1F4MA 5GONB 2PNRA 2GSMB 1ID0A 5IDJA 2YKEA 1GMGA 2YI6A 1JA8A 2XAHA 1Q90D 3VQWA 3K59A 1P84F 4JI6B 2C2AA 4LNUA 3L72H 2YEJA 4FM0A 1PD3A 2H94A 1TH8A 2PF4E 4EEHA 1BT8A 5D6QA 5LXTA 3M8AA 2UXCO 3SYCA 2UUAB 4R3AA 4PDLA 1Q8IA 3F7VC 3P30A 3A8TA 4LF5B 1SS3A 3NR7A 2N05A 4O4LB 1DTOA 3CRKA 5CA0A 4WFGA 4ZIBA 5B66Z 2UXNA 4IHJB 3JASB 2VQEB 4X62O 2FTKA 3Q5JA 3G7BA 1S0VA 2F95B 2W6JG 2A0LA 3JSNA 4FLVA 4ZBMA 5GGZA 5ITZA 1MOFA 1NTMH 4OGQB 4URMA 4XITA 4H44B 5LMNB 5FNVB 1H38A 2YKIA 4DO2A 1YCIA 3K5NA 3AG3B 5K1PA 2Q7EA 2JDIG 4MVOA 5TISZ 1KIJA 3RYCA 1MMMA 3ABUA 4RAIA 2NN4A 4MVUA 2ZXWC 3SJBC 3T2SA 1BS3A 3D3IA 3U2KA 4BAEA 4Q20A 5FNVA 3BRCA 4U93A 3DC5A 1Q5OA 2G38A 3W7UA 4B6CA 3CC2V 1KKDA 1B04A 2ZNIA 2A3QA 4V26A 2WLIB 3VBBA 4LP0A 3KKYA 3AG7A 4J7KA 4FLYA 4HZ3A 1IBMO 1ZTEA 5JH7B 2BE3A 1GH6A 5H6RA 1I7FA 2YEVB 1WB7A 1SF9A 3CCVV 5IYCO 5JJEB 5DN6G 3FB7C 3W7SA 5F2VO 3CCQV 3CRLA 3QG5A 4FFBB 5KHKA 1I0HA 4UCUA 2YE5A 3CRRA 4I0XA 2P90A 1MA1A 3G6BA 3ZRWB 1FXVA 3OW6A 4J7ZA 3B40A 3PJSK 3ABKB 4X66B 3OWBA 5JJNB 3H1LH 3RVZA 1AI4A 1YT1A 2VWJA 5JVDA 3TETA 3SJAC 4F6EA 4CS4A 1I94B 4DV3B 1AR5A 3TZ4A 4I55B 2YC0A 4PD4F 3CC4V 3T1YO 1BL8A 4FZ1A 3WQ9A 2IBZH 3JAMN 3EKRA 3F7YC 3AK1A 4KQVA 1PNKA 3OAAG 5AG2A 1XOUA 3RVYA 1TC0A 4NB5A 2RMKB 2BT0A 2DYSC 4K8ZA 4B7KA 3ZMZA 3S3XA 3SDLA 1B06A 4X20A 4JI0O 1JPXA 2BTOA 3DSQA 3B24A 4B7EA 1JFFB 4F6RB 2DWDC 4FLXA 4E01A 1MNGA 4IT5A 4DR3B 1QZRA 1WP8A 2GFDA 1H7SA 1JJOA 4CC6A 2MK3A 2YE4A 4O4JA 3ZHUA 2XOKG 4H13B 1GN3A 4DR7B 2JRIA 3K06A 4DV2O 2BZ5A 1N34O 5LMUB 4GEEA 4BQJA 1SERA 3I56V 4NXMO 3JAWA 1Z5CA 2YXYA 4QGPA 1UYIA 4LF8O 1AJPA 1BXDA 3G71V 5M4EA 4CBCA 2Y48A 1UYLA 4H81A 3K5MA 3R4PA 3W7WA 3Q5KA 1CP9A 5F3KA 4XDKA 2WLMA 2VQFB 3K5OA 1VEWA 2B9ZA 3PN1A 4BAYA 4WCEV 2FYPA 3SPCA 1NKDA 1ZL8A 4JI6O 4DR5O 3D3QA 5CB4B 1T5EA 4YIPA 4XKKA 1MU5A 4JV5O 3UQ8A 3OR6C 4JI7O 5EC2C 4F4LA 1E1RG 1KMIZ 1QU7A 2CTWA 3ZN0A 5L3CA 4YJ3B 4UVAA 4UCVA 1NQTA 3A0RA 4EFUA 2WLLA 2VQEO 4HNAA 3CGYA 3UCSC 1H2LA 1XEQA 2K9PA 3IEDA 2A06H 2BOCC 2BU2A 3CYOA 2AHYA 1QYEA 3M99B 4KFMA 4ZVIA 3KCXA 2XDKA 3C11A 4LF9O 2KKWA 1HNXB 2X7RB 2QEXV 4FM2A 1NH2D 2O57A 2YJWA 5M4HA 1AR1B 3RYFB 2ZNJA 4UVCA 2BTQA 2BCCH 3MDSA 2H55A 3SPIA 3B77A 4ZHQA 1PNMA 1N36O 3IC7A 3CRQA 4CZZA 1E79G 4DR6O 2BU7A 4K35A 3LDCA 1O9HA 1KYOF 5LOVB 1M1KW 1M56B 3X2QC 4JI8O 2Q68A 4YXWG 2CE4A 4R8CA 4YKWA 3STLC 2EJRA 4BW5A 3RYFA 1NHHA 4UCTA 5LYJA 1Y6XA 1BYQA 2XAFA 4PA3A 3LNNA 1Z5AA 4NKGB 2QE7G 4H0LB 3X2QB 3C0EA 3TZ2A 1VARA 1GN4A 1K97A 4FIPC 3BAAA 3OGCC 3KG2A 1FJGO 1YSRA 1THZA 4DR1O 4YJ2A 3ZHSA 1UYFA 2NLJC 2BSKA 4O07A 1SETA 1DGSA 3K04A 3FB6C 2N74A 3K0DA 3LNMB 4TT3G 4EKWA 3L70H 1M90W 2XAJA 1DF5A 1M5IA 1Y67A 4ICGA 1QBZA 1O9GA 2BTQB 3RGBA 2Q4PA 4WUCA 3SR2C 2ODMA 4GKKO 4DUYO 2YDEA 1Z5BA 1UFIA 2DOSA 1JCHA 5CA1A 1NHJA 4ZOLA 1THNA 3K97A 2FMLA 5BMVA 2XUMA 4I7ZB 1N8RW 4LF6O 5BY1A 1UY8A 4PL9A 1Y4SA 4BQGA 2OCCC 2XDLA 3CWBH 1FAFA 3ZHVA 3RN4A 5KAFZ 2GHYA 1YC1A 4JI1B 5CTXA 3WG7B 2OYQA 1TUEB 3BMYA 1LUWA 3S3WA 3BFRA 4MPNA 3UO3A 4U3JB 4JYAO 2JGUA 4CWOA 4E02A 1YEWA 4HZ0A 3K58A 2K1EA 1AH6A 2YEDA 5CMUA 3CC7V 1PNLA 5KX5B 4FZ0A 3HKBB 4PI2A 5BR8B 2OIGA 4FK5C 1Y4MA 4E00A 2RJZA 4FPPA 1VQ5V 3P3PA 3N27A 2QG2A 4JTAB 3G67A 1U2OA 4LFAO 4MW8A 4DK1A 4GLXA 2DJVA 1HNWO 5ITZB 2XDXA 3JALB 2QJ1A 4XCLA 1Z59A 3OGIB 5B1BC 1PKXA 3T0ZA 1AJNA 2ZKOA 4LF5O 3SYAA 1EN6A 5D7CA 1ZXNA 3N2GB 3B28A 2YK9A 3TXSA 3G80A 4EB6A 3D0BA 3T4DA 2F66C 4X65B 2QGNA 4BR6A 2O1UA 2KQXA 1FS0G 4DR2O 4NXNB 1XREA 3OUSA 2DMXA 2PYJA 2FKXA 2HHHO 2XNDG 2WSSG 1K4DC 2QDOA 4MVQA 1XNQO 1KBHA 1DF4A 3DC6A 1PPJH 1QR9A 2Q0OC 4XDMA 5CBHA 4JF3A 2YUAA 3LUTB 4PELA 2BU5A 5IYZA 1BSMA 4TV9B 5KMGB 1BCCH 4OXSA 3K9AA 3ML0A 1AJ6A 3AG2C 1NJIW 4PDVA 4ZI7A 3HYYA 2Q6AA 4TV9A 3INWA 1SA0B 5B1AB 1JVMA 2EIJC 2XHBA 3HB3B 4URLA 4UCRA 4OX9B 4WBNA 3DXRA 5JCOA 3HZ5A 4L87A 1VQ6V 4BWAA 4MT8A 4UB8Z 2VW5A 5IE9A 4LWGA 2AGAA 4CH6A 4J41A 1BGYH 4R3MA 1N36B 1P49A 5H9CA 4WF9V 1XMQB 4J7JA 4EB6B 2WI5A 1QR8A 5CF0A 1SA0A 2NNUA 4AWQA 1WJZA 1R62A 3FFQA 4U3FH 2YE9A 1TAEA 3RFRA 2R9AA 4JI2O 4GKJO 4GCZA 1UYKA 5KMGA 1R3LC 1YTFD 3HKEA 2B1IA 5KA5A 4MVMA 2YE7A 4FCQA 2EILB 1JJ2U 1KUQA 4MP7A 4FCPA 3CRAA 3JASA 1B62A 1I58A 4DR1B 1QY8A 1IVSA 4FJCC 1VQ8V 3LDDA 4X9QA 3GIEA 1OZ0A 1NTKH 2WWWA 3QDDA 3CCEV 2GQPA 1URFA 2HR3A 2M7WA 5B1AC 4YKUA 4O0BA 3LPSA 2OCHA 4XDJA 4KFGA 4HAMA 3B2EE 2OWOA 2AZ2A 2X6AA 3E8HA 3A2FA 3D8CA 4X1KA 4JAUA 2CH4A 4LF6B 2YEGA 2ATKC 3IAYA 2WLLB 1NR7A 1XHXA 4PA4A 4DV0B 1N33B 1QCEA 3JATB 2JJCA 5M4MA 4ZOLB 3FX7A 5J2UA 3JCUZ 3ZBHA 5CA3A 3AG3C 1F51A 4MB9A 1Q86W 1OCRB 4J11A 4H33A 4LWSB 3RLRA 3OPDA 2XABA 3P3NA 3CE2A 5E79Z 4LWSA 4HXZA 2P5OA 3DTUB 4I4TA 2EZOA 4E2LA 2BU6A 2DQ0A 5KAIZ 2EINB 3FV5A 1WNSA 2WPDG 4U7OA 5A2QN 5LL6Y 3U67A 1I5CA 3BCCH 2XX4A 1IXMA 4X1KB 1KZNA 2QWOB 2Q0AA 3OE7G 2FWZA 5BOCA 3E35A 1YXBA 1XHZA 4H85A 1MSDA 3LDEA 2EIJB 2CTQA 3ABKC 2IH3C 4MP2A 4EM7A 4AHCA 3BPZA 3IGAC 3T1HB 5L3JA 3HEKA 1R3KC 1VF7A 5GW7A 1UYHA 4LF4B 4KP4A 2Q7HA 1YITV 4F6RA 4WFEA 4NYKA 1AH8A 3A0TA 1S77D 2VRZA 4OPAA 3ZX6A 4L93A 4MBCA 2GTAA 1N0NA 5CTUA 4I9QA 5LA6A 1UYEA 5BZBA 2P4VA 1TILA 3CS5A 5DECA 1XNQB 3UM7A 4I0XB 4L94A 3LSUA 5EIBD 4DV1B 3VQXA 3VQYA 2QWRB 3K57A 3Q5LA 3EKOA 2KG7A 4EFTA 2V7QG 2QF6A 1XNRB 3OTOB 1R6TA 1WN7A 4MVRA 4YHHO 1LNQA 4X64B 1CEZA 3QO5A 4O09A 4CE1A 3ZMVA 3N2KB 2VS0A 2CGFA 3TZ5A 5B3SB 1JQ0A 1A4HA 1EM1A 5J2TB 2DW4A 2P6JA 4BIUA 2LQTA 3A0ZA 5LXTB 2ZE8A 3T1CA 2NR5A 2CTRA 4HZ5A 1DLBA 2OCCB 2AW9A 2QTSA 4R6ZA 3O2FA 4XIQA 4B3TO 4L8ZA 1KD1W 1EZVH 3TCUA 3DGEA 4G2KA 3SL2A 3JD0A 1KKCA 3ZRVA 2E0AA 4DUZO 2FYUH 2YGEA 2BYHA 2A9HA 1HR0O 2YI9A 2Y0PA 4CE2A 2YE2A 5CBGA 3CXHF 2DYRC 2YECA 2R9RB 1L0OA 1OCCB 1WAZA 3GWOA 2XAGA 1ZSPA 3C90A 3T1KA 2FWYA 1RPOA 2JIZG 5J9PC 3QNEA 5HFLA 2QR4A 1K9MW 1PL0A 3JARB 3MHHC 1V55C 4YY3B 2ESAA 3BM9A 4FFKA 3OFNG 4K0KO 2HVJC 2ZE5A 2HVKC 3HKBA 4I5SA 3ZN1A 1VQ9V 1TGOA 4UCSA 3INXA 3RYHB 2QKCA 2LGQA 5M4PA 1BHBA 4L90A 3W7TA 3CRCA 3BY6A 2YGFA 5A9GA 1XL4A 4Z1MG 1KQSU 4LF7O 5F5RA 2FXSA 1K5QA 4JYCA 4O2AB 4FLUA 2UXBO 4CWRA 3LSQA 4G28B 4RQFA 4TQDA 1XMOO 5BODA 1V54C 4YJ3A 2CGOA 3L75H 5CTWA 4GYCB 3EHBB 1XQ8A 2LO1A 1K92A 4X62B 3Q4HB 2A79B 1QNMA 5C93A 2YI5A 1KP3A 3ASOC 3BEHA 2IWSA 4IIJB 4YIOA 1SQBH 2JS3A 3RWRD 4B7PA 3WG7C 3MHSC 1I5AA 1Q6HA 1M56C 3C3TA 2JS5A 2O1WA 3JARA 2V1DA 2WERA 4HYPA 4IIJA 4X89A 5LP6A 4AWPA 2XHXA 2IW5A 4PDMA 4CH4A 4N23A 4ZI7B 4PI0A 1S76D 3LSSA 4ASUG 4MTXA 2ZE7A 2UXDO 4WUBA 1K7DA 2F23A 4DR2B 3R66A 1YJ9V 2HHHB 1BGQA 4XCJA 3VQVA 1K5SA 5JVDB 1FPOA 1D2DA 2GBOA 5B3SC 1Y66A 2V4DA 1US6A 1PP9H 1Z5VA 3IC9A 3E2EA 4CWQA 4G27B 2HG1A 1WA8B 2BU8A 3H80A 2IJKA 1XI1A 5KLVH 1NVPD 5EBWC 2QM7A 4GQTA 3SPJA 2YEHA 3B25A 4EGKA 1F7YA 4X20B 3R91A 1IBLO 4LP8A 3TZ0A 5IY5B 4O05A 1EZJA 2XTAA 4OX9O 2RQ6A 3RLPA 3OR7C 5L3GA 3ABTA 1UYCA 1R73A 2QKSA 5FNFA 1HP8A 5EYPA 5LGUA 2LW7A 1FFTB 5IJ0B 5H6QA 4JI4O 2Q69A 4MS2A 1Z5WA 3A0BZ 4IGGA 2CG9A 1YSCA 2CCTA 4IHJA 4CWTA 4HY6A 5IYDO 3B09A 4D6TH 3O0IA 3K9SA 2YI7A 4GKJB 3ZHQA 2WI2A 5EK0A 3CP1A 3K79A 1YIJV 3ETQA 5EC1C 2ZINA 2HFEC 3P32A 3ETEA 4DV5O 2QSAA 2Q73A 2OTJV 1HNZB 1AB3A 3ZXQA 2ITCC 1AJQA 3R4OA 2WLJA 5JENA 3E22A 4AS9A 2W0XA 3HKCB 2H3OA 4JAAA 2O1VA 4KHPB 5K1XA 1HR0B 2K5BA 4P8OA 3ABMB 4Z2WA 3HKCA 1YDXA 3CJHA 2EILC 3G75A 1ROPA 1UY9A 4LH6A 1FXHA 2EX3A 2CK3G 3OT7A 4DV2B 3S5TA 1CPYA 1P7BA 2E75B 1N34B 4MW3A 2EXLA 2ZM6B 4ASBA 1JMKC 3DXRB 1VQNV 2UUAO 4LR3A 1OCOB 4YKZA 2EIMB 4W4LA 2XT9A 2ZIMA 4DV7O 2B1GA 5EZYA 3AK3A 1M57B 1NHIA 3ZRXA 5JWPA 5LHHA 1MZFA 4X1IB 1Y4UA 2HKOA 1GKXA 4B08A 2Q5ZA 5CTYA 5L3DA 5JCOC 5EBMC 3ZCCA 2QM4A 5IDMA 2F4VB 4LF7B 3HKEB 5LMNO 3O9OA 4JV5B 2UXBB 1EA6A 2VCJA 4HNAB 4R7CA 4I3HA 3W7XA 5LA6B 3ZJZA 3KE6A 1IX9A 4XD8A 1GN6A 3AG1B 2OIEA 3LMMA 2IJHA 4K8XA 4UROA 1YVWA 2WA3A 2QFOA 4ASAA 4DZYA 3HKDA 2UUBO 4NTYA 1FKAO 1R6KA 5B1BB 2DE0X 2EIKB 1MABG 2OTLV 2YKJA 2DYSB 3THOA 2R72A 3JZ3A 3T1HO 1F23A 1Y74B 4PJ0Z 1OV9A 3ZKBA 3CCUV 1S16A 3SJCC 4EMVA 1GKZA 1U97A 3ZS8C 1IBMB 4P9OA 3JAWB 3G7EA 4I55A 2EIKC 1UPGA 4D7TA 4JI8B 4I9WA 1R3JC 1OHHG 3HPLC 1W2BU 1SQGA 3JYCA 5LP6B 1OCZC 3NMQA 5CB4A 2W6IG 1P7GA 2JVDA 1WB8A 4B3MO 2DQ3A 1AI7A 3H9VA 3BABA 3ETGA 3MNRP 4YHHB 3HZ1A 4X66O 2Q8VA 1AI6A 1TC6A 4LC1A 3IJ4A 2E76B 3T1YB 1I94O 2WI1A 4J9YB 2WLNA 4DV6O 3CCJV 2YICA 4U7NA 2CGNA 4MTGA 5IJ0A 1UY6A 1J95A 1EN5A 2LW1A 2ZDIA 4C7UA 2YEFA 3QVNA 4J10A 4GGLA 4N21A 4HBNA 2YKBA 2ADPA 2WI7A 5L3FA 4JI0B 2Y4TA 2E3CA 4H7QA 2RN9A 5LGTA 2IU3A 3OW2U 4DUZB 4QE7A 3FB8C 2YIAA 4R50A 2YXHA 3BA8A 2LP7A 2XD6A 2W0FC 4O4HB 2PZSA 1Q81W 4QIWF 2YS8A 2PI5A 4LH7A 4YKYA 1J5EO 2EINC 1QLEB 1Y8NA 1FD9A 2KSDA 1F4NA 3FAVB 2YIBD 1SQFA 4GT1A 4XIPA 4JPRA 1CXZB 1NVPB 3CMAV 2M6YA 1ZUQA 1L0NH 1I08A 3APOA 2YJXA 3G4SV 3VOUA 3H01A 3EHFA 4HY1A 2EULA 3J7AU 2PTMA 2Q2EB 3TK1A 2YXLA 5IJ9B 4KSHA 3CYGA 4K0KB 1YJNV 4XIRA 3FT8A 4NXMB 2AHZA 5M4NA 1Y8PA 3SPHA 5JH7A 3K98A 2LJ2A 4X1YA 3GIGA 3OEHG 3JD2A 4TV8B 3JAKB 4I50B 1IXBA 3ZMSA 4MOTA 2JKIA 4GZRB 4V25A 4MSWC 3H1IH 3QF7A 2XX5A 1TUBA 2GUZA 4XBFA 5IYBO 4CWFA 5DM6V 1H2SB 1MG1A 5KHHA 1OSFA 4PA7A 1HNWB 2CCUA 3VHCA 4WFFA 3ZRWA 1MZEA 1GTOA 2ZM6O 1XMOB 3RYCB 1GO3F 1YJWV 1LR1A 2LGWA 2XJJA 4HYMA 3B4SA 4PU9A 2CH7B 1PM9A 2UXXA 4QNHB 3T0HA 1EBOA 1SQQH 2JEXA 1YF2A 4UB6Z 3A0YA 1NI8A 2QWQB 2WI4A 2C1IA 1A32A 1IZ3A 1Z2GA 3H1HH 4DRXB 1KC8W 4LF9B 1H8HG 1HWYA 2HKJA 3ZXOA 4JI3B 5E1AC 3CCLV 2UU9B 4DW1A 1EFRG 2F4VO 2BSMA 1YC3A 2PY5A 4O4IA 2XDSA 5M4KA 4LCUC 2RDCA 4P2ZA 5J71A 1IURA 1D5NA 4ABMA 4X88A 4JYYA 3CRMA 1E1QG 2ZDXA 1YESA 3TXQA 1BKNA 3L71H 1Q7YW 5JJJB 3JCZA
chains in the Genus database with same CATH topology
3IC7A 1I59A 1UY7A 4CZZA 1NR1A 1E79G 1L1FA 2BU7A 1K34A 3CD6V 3LDCA 3INXA 1M1KW 1M56B 3CWVA 3HYZA 3X2QC 2Q67A 2Q68A 5EBLC 5M4PA 4YXWG 1BHBA 4L90A 3GIGB 1H2GA 3CCRV 5D6PA 4R8CA 3W7TA 1V55B 3STLC 2EJRA 3OM3B 4YKWA 3BY6A 4CWNA 4BW5A 3ZMTA 1NHHA 2YEAA 4LBEC 3R4NA 3EHHA 1YC4A 2YGFA 1BYQA 4JQLA 2XAFA 1XL4A 2ZXWB 3QO8A 4PA3A 5KUMA 4Z1MG 1KQSU 3F5WC 1Z5AA 1UYMA 2WEQA 1R6NA 5F5RA 1YETA 2FXSA 3VHDA 1K5QA 1UJWB 4JYCA 2QE7G 1VQMV 2Q8IA 4CWRA 3LSQA 1COWG 4G28B 3X2QB 3C0EA 3TZ2A 1S72V 4RQFA 1K97A 3AG2B 4FIPC 2WLKA 5B1NA 3OGCC 5FNCA 4CE3A 4DUHA 4X8AA 3KG2A 1M9NA 3PEHA 1YSRA 4JAVA 1GJVA 1THZA 2KB1A 3PEJA 2YEIA 1V54C 4PA6A 1YERA 5BODA 1UYFA 3QO7A 3CMEV 2NLJC 2X6BA 3RW0A 4O07A 4MTFA 2HCHA 1VQPV 2WI3A 5CTWA 1W0JG 1SETA 3EHBB 2D3OW 3K04A 3FB6C 1K92A 2IOQA 3K0DA 2A79B 5C93A 1H7UA 2LFSA 3LNMB 2YI5A 1KP3A 2XASA 4TT3G 2Q8GA 3BEHA 3ASOC 1RPRA 4EKWA 1M90W 2XAJA 5FWKA 2IWSA 3E8GA 1DF5A 1GM9A 3GB7C 3ABLB 5LBQA 1YT0A 4WUDA 2ZD9A 4B7PA 3WG7C 1YTFB 3MHSC 4FMTA 2QM8A 1QBZA 1I5AA 1M56C 3B8NA 2O1WA 2WERA 1I5DA 2V1DA 3K99A 3ZKDA 5FNDA 4WUCA 3MD0A 1QVGU 4HYPA 1UYDA 4AWOA 5L3EA 4GX2A 1S5HC 4X89A 1AROP 4NH9A 4P7AA 4AWPA 2IWXA 1Z5BA 1NH2B 2XHXA 1JCHA 1AM1A 1JM6A 1H8EG 2IW5A 1NHJA 1THNA 2P67A 3K97A 4PDMA 1N8RW 3E8FA 4N23A 3ABLC 2CCSA 2YSUB 5L3BA 2OT5A 3I55V 5IY5C 1S76D 1UY8A 4PL9A 3LSSA 1I5BA 4ASUG 4MTXA 1WLEA 1Y4SA 4BQGA 4WUBA 4QJFB 2OCCC 4P9PA 1K7DA 3ETDA 2BREA 1YI2V 2JJ1G 2HLDG 2XDLA 5FL7G 3OUFA 2WEPA 2YEBA 1YJ9V 3SYOA 3ZXOA 4JTDB 1K33A 1Q82W 4LPBA 1QLNA 1BGQA 2QA4V 4XCJA 2GHYA 4QE9A 1YC1A 1K5SA 3CCSV 5CTXA 3UKMA 3WG7B 5B3SC 2XX2A 4NH8A 3H4LA 1Y66A 4PRXA 2ITDC 1PVGA 3VADA 1MSWD 1TUEB 3BMYA 1EI1A 4JYBA 1R3IC 2IORA 3E2EA 4CWQA 4MPNA 4G27B 1FXKA 4J9ZB 2F43G 2BU8A 2HG1A 3H80A 4CWOA 4E02A 4HZ0A 3ASNB 3JD4A 2K1EA 1AH6A 2IJKA 2DYRB 2XHTA 2YEDA 5CMUA 3CC7V 1PNLA 4MTOA 4WFHA 1NVPD 1FXKB 4MVZA 2IH1C 5EBWC 4WFBV 3CGZA 2QM7A 4L91A 4GQTA 4FK5C 4PA9A 5B1OA 3JD3A 3SPJA 1Y4MA 2BRCA 2YGAA 3D2RA 4XKOA 2YEHA 4CE1A 4E00A 3OEEG 4FPPA 1U0ZA 4O04A 1VQ5V 3B25A 4EGKA 2QG2A 4XKAA 3R91A 4LP8A 1YHQV 3TZ0A 4JTAB 1U2OA 5IY5B 3D36A 4O05A 1EZJA 3ZMUA 3T1KA 1G4YB 4MW8A 3RLPA 3OR7C 4EGIA 5L3GA 2XDUA 3FYEB 2XDXA 3ABTA 1UYCA 2PI4A 1FXKC 1R73A 2XAQA 2QKSA 4XCLA 5FNFA 1Z59A 5LGUA 1FFTB 5B1BC 1PKXA 5H6QA 3T0ZA 1AJNA 2Q69A 4MS2A 4WFAV 3R92A 1K4CC 2JJ2G 3TTZA 3SYAA 2CG9A 4LWIA 5HFMA 4HYOA 1YSCA 1GM7A 2CCTA 4GFNA 3R4MA 5D7CA 1ZXNA 1W0KG 2XCMA 3OMIB 4HY6A 2EZPA 1QLEC 3B28A 4X9LA 4CWTA 1GKFA 3ABMC 5IYDO 2YK9A 4UUJC 2YK2A 3O0IA 4XTJA 1ZXMA 4BXIA 3D0BA 3T4DA 4JGSA 1XL6A 2IWUA 2YI7A 2WI2A 1KECA 5EK0A 1K73W 2O1UA 4PRVA 1FS0G 2P7TC 3CP1A 4YKTA 3K79A 3TUHA 1YIJV 3NXSA 1VQLV 1KP2A 4MVSA 3OUSA 5EC1C 3A0WA 2XDSA 2HFEC 3P32A 3FT5A 2Z5UA 2ZR2A 3ETEA 4TWKA 2XNDG 3T4ZA 2WSSG 3AEIA 1K4DC 1SRYA 2OTJV 4MVQA 3OWDA 1DF4A 5D7RA 2Z3YA 1QR9A 1SESA 1OCRC 2ZDYA 3B26A 3ZXQA 2ITCC 4GX5A 1AJQA 1AI5A 2ZBKB 4XDMA 1ZWIC 1S14A 3R4OA 3LNUA 2R9IA 1ZWHA 2ZQMA 5CBHA 1Y8OA 2WLJA 4BIZA 4JF3A 2AKPA 3SYPA 3LUTB 4PELA 3E86A 2ZKJA 4AS9A 2BU5A 4GX0A 1ENVA 4XDLA 1I5XA 3SYQA 2DWEC 1B63A 2XJXA 4RUEA 3EFFK 3EHGA 4OXSA 3K9AA 2O1VA 1RM1B 1UYGA 4YKRA 2K5BA 3ML0A 1AJ6A 3K3WA 3AG2C 1NJIW 3ABMB 4P8OA 4PDVA 2XJGA 3HYYA 2Q6AA 2UWDA 3INWA 3QTFA 1F4MA 4ASFA 2PNRA 2EILC 5B1AB 2GSMB 1ID0A 5LGNA 3WHAA 5IDJA 2YKEA 2YEEA 3AG4C 1JVMA 3K60A 1GMGA 2YI6A 2EIJC 3HB3B 1S3JA 3G75A 3E8BA 4URLA 1ROPA 2XAHA 1UY9A 2YE8A 1FXHA 2JEUA 2X0LA 3EHJA 2C2AA 2CK3G 2Y69B 2YEJA 1CPYA 1P7BA 1PD3A 2H94A 4L87A 4MW3A 4JTCB 3AG1C 1VQ6V 1TH8A 2EXLA 3HZ5A 4MT8A 4ASBA 4EEHA 1VQNV 5D6QA 3B8MA 1OCOB 2VW5A 4YKZA 2IU0A 2EIMB 4K4OA 4LWGA 4R3AA 3SYCA 4R3MA 3AG4B 4PDLA 3F7VC 3P30A 5H9CA 4WF9V 3O6OA 3K08A 2WI5A 1QR8A 3CRKA 2B1GA 1DTOA 1I5YA 4WFGA 2HG5C 3K0GA 5CF0A 3E89A 1M57B 2UXNA 1NHIA 2NNUA 1NBMG 3ZRXA 2XHRA 4AWQA 2FTKA 3Q5JA 5LHHA 1R62A 3IFXA 4XC0A 2YE9A 3G7BA 1S0VA 1Y4UA 2HKOA 1GKXA 1B3QA 3T10A 5CTYA 5L3DA 4GCZA 5EBMC 1UYKA 2W6JG 1R3LC 1YTFD 2A0LA 3ASNC 3ZCCA 2B1IA 4ZBMA 5KA5A 5GGZA 5IDMA 4MVMA 1TBWA 4YKQA 4URNA 1MOFA 2YE7A 4FCQA 4LWFA 2EILB 4R1FA 1P4RA 1JJ2U 1EA6A 4URMA 2VCJA 4XITA 4R7CA 4MP7A 4GX1A 4I3HA 3W7XA 4DXWA 1H38A 3ZRSA 2YKIA 3ZJZA 2B5UA 4DO2A 2EIMC 2WAMA 4FCPA 1GK9A 1B62A 1I58A 3KE6A 2LFRA 3AG3B 4XD8A 1QY8A 2Q8HA 4FJCC 3OMAB 1VQ8V 3AG1B 3LDDA 3STZC 3GIEA 1OZ0A 2JDIG 2WWWA 4MVOA 3QDDA 3CCEV 1KIJA 2GQPA 4YKUA 2HR3A 2IJHA 2M7WA 4UV8A 5B1AC 1M57C 3ABUA 1V54B 4RAIA 4MVUA 4UROA 4O0BA 3VHAA 2ZXWC 2QFOA 3T2SA 4ASAA 4W7TA 4DZYA 1OCZB 2IJJA 3LPSA 3D3IA 3U2KA 4BAEA 4Q20A 2Y69C 4U93A 3ASOB 3W7UA 1R6KA 4B6CA 5B1BB 5LHGA 2JK5C 2EIKB 4XDJA 1MABG 3CC2V 2OTLV 4HAMA 1KKDA 2IOPA 2YE6A 2YKJA 1US7A 4KFGA 2DYSB 3A0XA 4V26A 2X6AA 3JZ3A 2WLIB 3E8HA 3VBBA 1K3EA 1F23A 2YE3A 4LP0A 2HJFC 4HZ3A 4JAUA 3ZKBA 3FB5C 3CCUV 2ZR3A 2CH4A 1S16A 2WLHA 5H6RA 1TIDA 2ATKC 2YEGA 4EMVA 2WLLB 2YEVB 1NR7A 1GKZA 4P9OA 2YI0A 3CCVV 1VQ4V 5IYCO 4QPKA 3G7EA 4PA4A 2EIKC 3FB7C 5DN6G 3W7SA 5D7DA 1QCEA 2JJCA 3CCQV 4I9WA 3CRLA 5M4MA 4QPJA 1R3JC 2YE5A 5CA3A 1OHHG 3HPLC 3AG3C 1F51A 4JASA 4YKXA 3RKZA 4MB9A 1W2BU 2BTZA 2P90A 3JYCA 1Q86W 1OCRB 1OCZC 1MX0A 4H33A 3K03A 4P30A 3NMQA 5CBFA 3ZRWB 3CPWU 2VWCA 4RQEA 1FXVA 2W6IG 1K8AW 3RLRA 3OW6A 3OPDA 2XABA 3PJSK 3ABKB 3JD1A 2DQ3A 1VQOV 1AI7A 3OMNB 4HXZA 3DTUB 3OWBA 2EZOA 1BHAA 3ETGA 3RVZA 4E2LA 2BU6A 1AI4A 1G8MA 2DQ0A 1YT1A 3HZ1A 3MNRP 2EINB 1AI6A 3TETA 3U2DA 4UVBA 5KA6A 4XE2A 4CWPA 1TC6A 3FV5A 4LC1A 2WPDG 4PDRA 5KUKA 4U7OA 3TZ4A 3CC4V 4MPEA 5LHIA 4ZKIA 2IJIA 2WI1A 4J9YB 3U67A 2WLNA 1BL8A 1I5CA 2Q8FA 1UY6A 3CCJV 2XX4A 1IXMA 4U7NA 4MTGA 3WQ9A 3EKRA 1RM1C 4LWHA 4HXWA 3F7YC 1KZNA 1J95A 2ZDIA 4KQVA 1PNKA 3OAAG 1B6QA 3OE7G 2YEFA 2X6CA 3RVYA 2FWZA 1TC0A 4GGLA 5BOCA 2BT0A 3E35A 2DYSC 4N21A 3B27A 4H85A 1JX9A 2YKBA 2WI7A 3ZMZA 3LDEA 5L3FA 2EIJB 4H7QA 1YS3A 5LGTA 2IU3A 1GM8A 2IH3C 3ABKC 3G6EV 3OW2U 1JPXA 4MP2A 4EM7A 4QE7A 3FB8C 1AMWA 4KUMA 1JOYA 3IGAC 4R50A 2LP7A 1YT2A 2XD6A 3B24A 5L3JA 3HEKA 1R3KC 5GW7A 1UYHA 2W0FC 2DWDC 4KP4A 1Q81W 4QIWF 3RLQA 4E01A 1YITV 2PI5A 4WFEA 1AH8A 1QZRA 4YKYA 3A0TA 1S77D 4RUFA 2EINC 2GFDA 1QLEB 1H7SA 4L93A 4MBCA 2VCIA 1Y8NA 5CTUA 1F4NA 2MK3A 3GIFA 1UYEA 3CXCU 4GT1A 5BZBA 2YE4A 4XIPA 4JPRA 1NVPB 2YJXA 3CMAV 1TILA 2QTOA 2H8PC 3G4SV 2XOKG 3VOUA 4UV9A 3K06A 3UM7A 2BZ5A 3H01A 4L94A 3EHFA 4HY1A 4GEEA 2Q2EB 4KSHA 3TK1A 4BQJA 2BYIA 1SERA 3I56V 1YJNV 3EKOA 3Q5LA 4EFTA 2V7QG 1VQKV 2QF6A 1SZTA 1Z5CA 3OMUA 3SPGA 4XIRA 3FT8A 1BMFG 1VQ7V 1UYIA 4TSFG 1AJPA 2AHZA 4MVRA 3ZM7A 5M4NA 1BXDA 1Y8PA 1LNQA 3SPHA 3G71V 5M4EA 4CBCA 1CEZA 3K98A 2Y48A 3GIGA 4ASGA 3QO5A 1WPXA 3OEHG 1UYLA 3JD2A 3R4PA 3W7WA 2ZDIC 3ZMVA 1YSZA 4UXNA 2CGFA 4H81A 4O09A 3TZ5A 3ZMSA 3Q5KA 2JKIA 4MOTA 5B3SB 1JQ0A 1A4HA 4KSGA 1CP9A 4KTNA 4V25A 5F3KA 4MSWC 4XDKA 2WLMA 2DW4A 2P6JA 4CWSA 3CCMV 2XX5A 5IYBO 4XBFA 4CWFA 4BIUA 5DM6V 3A0ZA 4NH7A 2H8MA 4BAYA 4WCEV 2FYPA 4FCRA 3SPCA 3T1CA 1MG1A 2BOBC 1NKDA 3FYIB 2WI6A 1OSFA 4PA7A 3VHCA 2CCUA 4HZ5A 1DLBA 5J6AA 2OCCB 4WFFA 3ZRWA 1GTOA 4R6ZA 3O2FA 4XKKA 4XIQA 1MU5A 4L8ZA 1KD1W 1OCCC 3OR6C 3TCUA 5EC2C 3DGEA 1ORQC 4G2KA 4F4LA 3SL2A 1GO3F 4GT8A 3JD0A 3ZRVA 1YJWV 2E0AA 3ZIAG 2XJJA 4HYMA 4PU9A 1E1RG 2YKCA 2YGEA 2BYHA 5CPHA 3R65A 2A9HA 3ZN0A 2UXXA 1OCOC 4QNHB 4LWEA 5L3CA 3T0HA 4CE2A 1EBOA 4UVAA 3T2MA 2YE2A 1NQTA 3A0RA 2JEXA 5CBGA 4EFUA 2WLLA 2YEVA 3RBZA 5CN0A 3A0YA 2DYRC 2WI4A 2YECA 3CGYA 4H37A 1QVFU 2BOCC 3IEDA 2R9RB 1L0OA 1OCCB 1KC8W 2BU2A 3CYOA 2AHYA 1QYEA 4RO2A 3SJQC 3GWOA 1H8HG 1HWYA 2WLIA 2XAGA 3M99B 4KFMA 2HKJA 3HHUA 5E1AC 4MPCA 2FWYA 1RPOA 3CCLV 2JIZG 2EBOA 5J9PC 2XDKA 3C11A 4ZVIA 1EFRG 2X7RB 3WFVA 3QNEA 2QEXV 1YC3A 5HFLA 2BSMA 1NH2D 4LCUC 4P2ZA 1K9MW 2XK2A 5J71A 5M4KA 2YJWA 5M4HA 1AR1B 1PL0A 2QG0A 3FKSG 4UVCA 3MHHC 1V55C 1ZW9A 4X88A 2ESAA 5IN9A 1E1QG 3E83A 3SPIA 2H55A 3B77A 2ZDXA 3BM9A 4EGHA 1YESA 1PNMA 3OFNG 1BKNA 2HVJC 2HVKC 1Q7YW 4I5SA 3ZN1A 1VQ9V 3JCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I59 A;  1UY7 A;  2BU7 A;  3INX A;  3CWV A;  3HYZ A;  5M4P A;  4L90 A;  3GIG B;  5D6P A;  4YKW A;  4CWN A;  1NHH A;  2YEA A;  3R4N A;  3EHH A;  1YC4 A;  2YGF A;  1BYQ A;  4JQL A;  1Z5A A;  1UYM A;  2WEQ A;  5F5R A;  3VHD A;  1YET A;  2FXS A;  4JYC A;  2Q8I A;  4CWR A;  3C0E A;  3TZ2 A;  5B1N A;  5FNC A;  4CE3 A;  4DUH A;  3PEH A;  1YSR A;  4JAV A;  1GJV A;  3PEJ A;  2YEI A;  5BOD A;  1YER A;  1UYF A;  4O07 A;  2HCH A;  2WI3 A;  5CTW A;  2IOQ A;  5C93 A;  1H7U A;  2YI5 A;  2LFS A;  2Q8G A;  5FWK A;  2IWS A;  1YT0 A;  4WUD A;  4B7P A;  4FMT A;  2QM8 A;  1I5A A;  2WER A;  2O1W A;  3ZKD A;  1I5D A;  3K99 A;  5FND A;  4WUC A;  3MD0 A;  4HYP A;  1UYD A;  4AWO A;  4P7A A;  4NH9 A;  4AWP A;  2IWX A;  1Z5B A;  2XHX A;  1AM1 A;  1JM6 A;  1NHJ A;  1THN A;  2P67 A;  3K97 A;  2CCS A;  1UY8 A;  4PL9 A;  1I5B A;  4MTX A;  1Y4S A;  4BQG A;  4WUB A;  2BRE A;  2XDL A;  2WEP A;  2YEB A;  4LPB A;  1BGQ A;  4XCJ A;  1YC1 A;  5CTX A;  2XX2 A;  4NH8 A;  3H4L A;  4PRX A;  1PVG A;  3VAD A;  3BMY A;  1EI1 A;  4JYB A;  2IOR A;  4CWQ A;  4MPN A;  2HG1 A;  2BU8 A;  3H80 A;  4CWO A;  4E02 A;  4HZ0 A;  1AH6 A;  2XHT A;  2YED A;  4L91 A;  3CGZ A;  2QM7 A;  4GQT A;  5B1O A;  2BRC A;  3D2R A;  4XKO A;  2YGA A;  4E00 A;  2YEH A;  4FPP A;  1U0Z A;  4O04 A;  3B25 A;  4EGK A;  2QG2 A;  4XKA A;  3R91 A;  3TZ0 A;  1U2O A;  3D36 A;  4O05 A;  3RLP A;  4EGI A;  2XDU A;  2XDX A;  1UYC A;  4XCL A;  5FNF A;  1Z59 A;  3T0Z A;  3R92 A;  3TTZ A;  2CG9 A;  4LWI A;  2CCT A;  4GFN A;  3R4M A;  5D7C A;  1ZXN A;  4X9L A;  2XCM A;  4HY6 A;  4CWT A;  3B28 A;  2YK9 A;  2YK2 A;  3O0I A;  4XTJ A;  1ZXM A;  4BXI A;  3D0B A;  2IWU A;  2YI7 A;  2WI2 A;  2O1U A;  4YKT A;  4PRV A;  3TUH A;  3NXS A;  3A0W A;  3P32 A;  3FT5 A;  4ASF A;  3OWD A;  5D7R A;  3ZXQ A;  3B26 A;  2ZDY A;  2ZBK B;  4XDM A;  1S14 A;  3R4O A;  3LNU A;  1ZWH A;  1Y8O A;  4BIZ A;  2AKP A;  2ZKJ A;  4AS9 A;  2BU5 A;  1B63 A;  2XJX A;  3EHG A;  2O1V A;  4YKR A;  1UYG A;  2K5B A;  1AJ6 A;  4P8O A;  2XJG A;  3HYY A;  2UWD A;  3INW A;  3QTF A;  2PNR A;  1ID0 A;  3WHA A;  5IDJ A;  2YKE A;  2YEE A;  3K60 A;  2YI6 A;  3G75 A;  4URL A;  1UY9 A;  2YE8 A;  3EHJ A;  2C2A A;  2YEJ A;  3HZ5 A;  1TH8 A;  2EXL A;  4MT8 A;  4ASB A;  4EEH A;  5D6Q A;  2VW5 A;  4YKZ A;  4K4O A;  4LWG A;  4R3A A;  4R3M A;  3O6O A;  2WI5 A;  3CRK A;  5CF0 A;  1NHI A;  3ZRX A;  2XHR A;  4AWQ A;  2FTK A;  3Q5J A;  1R62 A;  4XC0 A;  3G7B A;  2YE9 A;  1Y4U A;  1GKX A;  1B3Q A;  3T10 A;  5CTY A;  4GCZ A;  1UYK A;  3ZCC A;  5GGZ A;  5IDM A;  1TBW A;  4YKQ A;  4URN A;  2YE7 A;  4FCQ A;  4LWF A;  4R1F A;  1EA6 A;  4URM A;  2VCJ A;  4XIT A;  4MP7 A;  4I3H A;  2YKI A;  4FCP A;  1B62 A;  1I58 A;  3KE6 A;  2LFR A;  4XD8 A;  1QY8 A;  2Q8H A;  3GIE A;  2WWW A;  3QDD A;  1KIJ A;  2GQP A;  4YKU A;  4URO A;  4O0B A;  3VHA A;  2QFO A;  4ASA A;  3T2S A;  4W7T A;  4DZY A;  3LPS A;  3U2K A;  4BAE A;  4Q20 A;  4U93 A;  4B6C A;  2IOP A;  4KFG A;  2YKJ A;  2YE6 A;  1US7 A;  3A0X A;  4V26 A;  3JZ3 A;  2YE3 A;  4LP0 A;  4JAU A;  3ZKB A;  2CH4 A;  1S16 A;  2YEG A;  1TID A;  4EMV A;  1GKZ A;  2YI0 A;  3G7E A;  4QPK A;  5D7D A;  2JJC A;  5M4M A;  3CRL A;  4QPJ A;  2YE5 A;  3RKZ A;  1F51 A;  4JAS A;  4YKX A;  4MB9 A;  2BTZ A;  1MX0 A;  3NMQ A;  3ZRW B;  2VWC A;  3RLR A;  3OW6 A;  3OPD A;  2XAB A;  4HXZ A;  3OWB A;  2BU6 A;  3MNR P;  1YT1 A;  3HZ1 A;  3U2D A;  4CWP A;  4XE2 A;  1TC6 A;  3FV5 A;  4LC1 A;  4U7O A;  3TZ4 A;  4MPE A;  4ZKI A;  2WI1 A;  3U67 A;  1I5C A;  2Q8F A;  1UY6 A;  2XX4 A;  1IXM A;  4U7N A;  3WQ9 A;  3EKR A;  4LWH A;  4HXW A;  1KZN A;  4KQV A;  2YEF A;  2FWZ A;  1TC0 A;  4GGL A;  5BOC A;  2BT0 A;  3B27 A;  4H85 A;  2YKB A;  2WI7 A;  4H7Q A;  1YS3 A;  4MP2 A;  4EM7 A;  1AMW A;  1JOY A;  1YT2 A;  2XD6 A;  3B24 A;  5L3J A;  3HEK A;  1UYH A;  4KP4 A;  4E01 A;  3RLQ A;  1AH8 A;  1QZR A;  4YKY A;  3A0T A;  2GFD A;  4L93 A;  1H7S A;  4MBC A;  2VCI A;  1Y8N A;  5CTU A;  3GIF A;  1UYE A;  2YE4 A;  4GT1 A;  4XIP A;  2YJX A;  1TIL A;  2BZ5 A;  4L94 A;  3EHF A;  4HY1 A;  4GEE A;  2Q2E B;  4KSH A;  3TK1 A;  4BQJ A;  2BYI A;  3Q5L A;  3EKO A;  4EFT A;  2QF6 A;  3OMU A;  1Z5C A;  4XIR A;  3FT8 A;  1UYI A;  3ZM7 A;  5M4N A;  1BXD A;  1Y8P A;  5M4E A;  3K98 A;  3GIG A;  4ASG A;  1UYL A;  4H81 A;  3R4P A;  4O09 A;  4CE1 A;  2CGF A;  1YSZ A;  3TZ5 A;  3Q5K A;  4MOT A;  2JKI A;  1A4H A;  4KSG A;  4KTN A;  4V25 A;  5F3K A;  4CWS A;  2XX5 A;  4CWF A;  4BIU A;  3A0Z A;  4NH7 A;  2H8M A;  2FYP A;  4FCR A;  2WI6 A;  1OSF A;  3VHC A;  2CCU A;  4HZ5 A;  5J6A A;  3ZRW A;  4XKK A;  3O2F A;  4XIQ A;  1MU5 A;  4L8Z A;  3DGE A;  3SL2 A;  4GT8 A;  3ZRV A;  2E0A A;  2XJJ A;  4HYM A;  4PU9 A;  2YKC A;  2YGE A;  2BYH A;  5CPH A;  4LWE A;  3T0H A;  4CE2 A;  2YE2 A;  3A0R A;  4EFU A;  3A0Y A;  2WI4 A;  2YEC A;  3CGY A;  3IED A;  1L0O A;  2BU2 A;  1QYE A;  3T1K A;  2HKJ A;  4MPC A;  3HHU A;  3ZXO A;  4ZVI A;  2FWY A;  2XDK A;  3C11 A;  2XDS A;  2BSM A;  1YC3 A;  2XK2 A;  5M4K A;  5J71 A;  2YJW A;  5M4H A;  2QG0 A;  1ZW9 A;  2ESA A;  5IN9 A;  2H55 A;  2ZDX A;  3BM9 A;  4EGH A;  1YES A;  1BKN A;  4I5S A; 
#chains in the Genus database with same CATH topology
 1I59 A;  1K34 A;  3CD6 V;  4O4H A;  3CWV A;  3HYZ A;  2Q67 A;  4X1Y B;  1H2G A;  3CCR V;  3GIG B;  5D6P A;  3OM3 B;  3RYI A;  4CWN A;  1TVK B;  4LBE C;  2UUB B;  5KUM A;  3QO8 A;  5B5E Z;  1Y76 B;  3F5W C;  1QQC A;  1UYM A;  1R6N A;  2UUC B;  1XDC A;  2N04 A;  2Q8I A;  4AQY B;  2Q9L A;  4JZG A;  1FJG B;  3AG2 B;  5FNC A;  2WLK A;  1EN4 A;  1M9N A;  4LFB O;  4JAV A;  4B3R B;  1GJV A;  3U0Z A;  1XMQ O;  2YEI A;  4PA6 A;  1YER A;  3QO7 A;  2ZE6 A;  2X6B A;  1N32 B;  4MTF A;  3K5L A;  1VQP V;  2P22 C;  2D3O W;  1FFX A;  2LFS A;  1IBL B;  2XAS A;  4BIO A;  5FWK A;  1VIB A;  3C3S A;  4JZ2 A;  3GVM A;  4FVM A;  1GM9 A;  4WUD A;  1HDJ A;  3ZKD A;  1I5D A;  1X4T A;  5FND A;  4DV4 B;  3MD0 A;  4DUY B;  1UYD A;  5L3E A;  3BHP A;  4P7A A;  4NH9 A;  5IWA B;  2IWX A;  1NH2 B;  4TUY A;  1RP3 B;  5J2U B;  1H8E G;  4GKK B;  5GTH Z;  2CCS A;  2OT5 A;  3I55 V;  5IY5 C;  2FL4 A;  2ARH A;  2F93 B;  1DK1 A;  3ETD A;  2A7W A;  2JJ1 G;  5FL7 G;  1NT2 B;  4DV6 B;  2YEB A;  2CH7 A;  4JTD B;  1K33 A;  1QLN A;  4QE9 A;  3FD9 A;  4TUY B;  4TQF A;  5DED A;  1NTZ H;  2L35 A;  4NH8 A;  3H4L A;  2HP8 A;  3BVO A;  3VAD A;  4LFC O;  2EJ7 A;  4JYB A;  4JYA B;  1R1B A;  4JI5 O;  4IYH A;  1EI1 A;  3BA9 A;  3H1K H;  5C8Y B;  4J9Z B;  3JSL A;  1TUB B;  2GUZ B;  2WA4 A;  4PV1 B;  3JD4 A;  2L6L A;  2DYR B;  2XHT A;  4WFH A;  4L91 A;  1FXK B;  4MVZ A;  4O2B A;  3CGZ A;  1N4C A;  5B1O A;  4ZHQ B;  3D2R A;  4XKO A;  4E72 A;  2YGA A;  3I5D A;  3OEE G;  5BR8 O;  1U0Z A;  4O04 A;  1VP7 A;  2VQF O;  2R70 A;  1AP6 A;  1YHQ V;  1FYJ A;  3D36 A;  3ZMU A;  4EGI A;  2XDU A;  4DR5 B;  2CDY A;  3L73 H;  1AVM A;  1FXK C;  2Q7G A;  2GV9 A;  4IL6 Z;  4WFA V;  3J81 N;  4DV7 B;  2JGD A;  3HKD B;  4LWI A;  5HFM A;  4HYO A;  3ICX A;  3R4M A;  2Y0I A;  1ZAU A;  4X9L A;  2XCM A;  4FM1 A;  2EZP A;  1QLE C;  5LOV A;  3ABM C;  4X65 O;  1QHT A;  5KHI A;  4XTJ A;  4BXI A;  1ZXM A;  4JGS A;  1XL6 A;  2IWU A;  4NXN O;  3J80 N;  1KEC A;  4YKT A;  1VQL V;  4MVS A;  3A0W A;  1GN2 A;  3KZI Z;  2Z5U A;  4TOI A;  3AEI A;  1HNX O;  4KL1 A;  2ZDY A;  1AI5 A;  2ZBK B;  4CC5 A;  1ZWH A;  3RT3 C;  2ZQM A;  1Y8O A;  4FFB A;  4Z1V A;  3SYP A;  3E86 A;  3O65 A;  3JAT A;  1TA8 A;  1ZLZ A;  1ENV A;  1H2K A;  1SQX H;  3ZHT A;  1I5X A;  4XDL A;  3SYQ A;  2DWE C;  2XJX A;  3EFF K;  1RM1 B;  4YKR A;  4DR6 B;  3K3W A;  2GTS A;  2ZCE A;  2XJG A;  1VF6 A;  4UFZ A;  2UWD A;  3QTF A;  5BMV B;  4O4L A;  5LGN A;  3WHA A;  3K60 A;  2YEE A;  3AG4 C;  1Y76 A;  1S3J A;  3E8B A;  4I4T B;  4JI3 O;  2YE8 A;  2JEU A;  2X0L A;  3EHJ A;  2Y69 B;  1RFY A;  4JTC B;  3AG1 C;  1IDS A;  3WB1 A;  4BW9 A;  3B8M A;  2P4K A;  1IBK O;  2IU0 A;  4K4O A;  3AG4 B;  4NVP A;  4NTW A;  3WU2 Z;  3O6O A;  5FPR A;  1FFX B;  3K08 A;  2CAZ C;  1I5Y A;  1XBL A;  2HG5 C;  3K0G A;  3M7M X;  3E89 A;  4CS2 A;  1NBM G;  2XHR A;  3IFX A;  4XC0 A;  1B3Q A;  3T10 A;  5BXZ A;  5EYP B;  2RNB A;  3ASN C;  4JI2 B;  1TBW A;  3L74 H;  4YKQ A;  4URN A;  3CEI A;  4LWF A;  4R1F A;  1P4R A;  5LYJ B;  4B3T B;  4CH5 A;  1BE3 H;  1TVK A;  4GX1 A;  4DXW A;  3ZRS A;  2B5U A;  2EIM C;  1RSO B;  2WAM A;  1GK9 A;  4LFB B;  4B3R O;  2LFR A;  3UO2 A;  2Q8H A;  4B3S O;  3OMA B;  3STZ C;  4UV8 A;  1M57 C;  4RWU A;  1V54 B;  3VHA A;  4W7T A;  1OCZ B;  2IJJ A;  1AP5 A;  4JI1 O;  2Y69 C;  2C1G A;  4UCO A;  3ASO B;  1PV0 A;  5LHG A;  2JK5 C;  2IOP A;  2YE6 A;  2E5L B;  1US7 A;  1D5A A;  3A0X A;  3APQ A;  2P06 A;  5IWA O;  1K3E A;  2YE3 A;  3N2K A;  5GON A;  2HJF C;  4KXR A;  1SC5 B;  4FLZ A;  3GWK C;  3FB5 C;  2ZR3 A;  2WLH A;  4X1I A;  2UXC B;  1TID A;  1H2M A;  2YI0 A;  1VQ4 V;  4QPK A;  1H2N A;  5D7D A;  1J5E B;  1YZB A;  4QPJ A;  5CA1 B;  4DV0 O;  1N33 O;  3RKZ A;  4YKX A;  4JAS A;  2BTZ A;  4LFA B;  1AIL A;  1MX0 A;  2MW2 B;  3K03 A;  4P30 A;  4EFB A;  5CBF A;  3CPW U;  2VWC A;  4RQE A;  1K8A W;  3JD1 A;  4WBN B;  1VQO V;  4NR1 A;  3OMN B;  4FLT A;  1BHA A;  1N0J A;  1G8M A;  4EFE A;  3U2D A;  4UVB A;  5KA6 A;  4XE2 A;  4CWP A;  2BSK B;  4PDR A;  5KUK A;  1RSO A;  3F5T A;  4MPE A;  5LHI A;  4ZKI A;  2IJI A;  1GAX A;  2Q8F A;  4LWH A;  1RM1 C;  2PGG A;  4HXW A;  4O2A A;  1B6Q A;  1VF6 C;  2AXT Z;  1M93 A;  2X6C A;  1M4U A;  2HHI A;  3B27 A;  1JX9 A;  1S5L Z;  3CX5 F;  3MAQ A;  1YS3 A;  5H2F Z;  2QWP B;  2YID A;  1GM8 A;  5GTI Z;  3G6E V;  3RYI B;  1AMW A;  4KUM A;  1JOY A;  3KCY A;  5EZY B;  3ZED A;  1BZK A;  1G1X B;  1YT2 A;  1KB9 F;  3RYH A;  1L0L H;  2PUS A;  3RLQ A;  4CS3 A;  4RUF A;  2VCI A;  4DR4 B;  1XUQ A;  3AK2 A;  4E4E A;  2UU9 O;  3GIF A;  3CXC U;  3OTF A;  2QTO A;  2H8P C;  4NTX A;  4K3A A;  4UV9 A;  4L8J A;  1NZ6 A;  2F1M A;  1BQ0 A;  2BYI A;  1XNR O;  5H5N A;  3OTO O;  1VQK V;  3OMU A;  1SZT A;  1JR9 A;  3SPG A;  1BMF G;  1HW7 A;  1VQ7 V;  4TSF G;  4FLW A;  3ZM7 A;  4J42 A;  5FPO A;  4DK0 A;  1BQZ A;  4ASG A;  1WPX A;  2ZDI C;  1YSZ A;  4UXN A;  4DV3 O;  4KSG A;  4KTN A;  3A0H Z;  4CWS A;  3CCM V;  4NH7 A;  5C8Y A;  2H8M A;  4FCR A;  2UUC O;  2BOB C;  2FB5 A;  2WI6 A;  3FYI B;  5J6A A;  4AQY O;  1OCC C;  1W59 A;  1IBK B;  1ORQ C;  4A5U B;  4GT8 A;  3Q4H A;  3SGI A;  3ZIA G;  5LP6 C;  2IM9 A;  2YKC A;  1N32 O;  5CPH A;  3N2G A;  2PYL A;  3R65 A;  1OCO C;  4LWE A;  4YJ2 B;  3T2M A;  4AIL C;  3L9D A;  2YEV A;  3RBZ A;  5CN0 A;  4OPH A;  4H37 A;  4DR3 O;  1QVF U;  4Q6G A;  3TGU H;  1PL4 A;  3E22 B;  3JAL A;  4RO2 A;  5IJ9 A;  3SJQ C;  2WLI A;  4MPC A;  3TJT A;  4W4K A;  3HHU A;  4DV4 O;  2EBO A;  3EVK A;  5JQG B;  3WFV A;  2XK2 A;  4YY3 O;  2QG0 A;  3FAV A;  3FKS G;  1ZX3 A;  3CSX A;  1ZW9 A;  5LMU O;  5IN9 A;  3E83 A;  4EGH A;  2VWK A;  1SKV A;  4O2B B;  1WP7 A;  1UY7 A;  1NR1 A;  1L1F A;  4KHP O;  5J2T A;  1WA8 A;  1JFF A;  1V9P A;  3UT5 B;  5EBL C;  1VMG A;  1V55 B;  2JGD B;  3ZMT A;  2YEA A;  3R4N A;  3EHH A;  1SQP H;  1YC4 A;  2GDS A;  4JQL A;  2KG7 B;  2ZXW B;  4GUN A;  2DN9 A;  4LFC B;  2WEQ A;  3VHD A;  1YET A;  4JI5 B;  1UJW B;  3QTC A;  2E5L O;  1VQM V;  2HEP A;  1COW G;  3U11 A;  1S72 V;  5B1N A;  3ZHR A;  2ADQ B;  3OD4 A;  4JI7 B;  4CE3 A;  4DUH A;  1Q43 A;  4X8A A;  3PEH A;  2KB1 A;  3H1J H;  3PEJ A;  2HJD A;  3CME V;  1OJH A;  3RW0 A;  5IYZ B;  4EEQ A;  3UT5 A;  2HCH A;  2WI3 A;  5CA0 B;  1W0J G;  5KX5 A;  3HR0 A;  1H7U A;  2IOQ A;  2Q8G A;  1RPR A;  2RCV A;  3E8G A;  5IT9 N;  3GB7 C;  1YT0 A;  3ABL B;  5LBQ A;  2ZD9 A;  1YTF B;  1Q6U A;  4FMT A;  2QM8 A;  3B8N A;  4AI8 A;  3K99 A;  4LNU B;  1QVG U;  4AWO A;  4GX2 A;  3D36 C;  1S5H C;  1ARO P;  2QWN B;  5JQG A;  5D5Q A;  2AZ0 A;  2CTP A;  1AM1 A;  1JM6 A;  1S5J A;  2QKA A;  2P67 A;  1GRJ A;  3CJH B;  3E8F A;  4TV8 A;  3ABL C;  2YSU B;  2D2C B;  5L3B A;  4LF4 O;  1I5B A;  1WLE A;  4QJF B;  2YIB A;  4P9P A;  1SQV H;  5EIB C;  1YI2 V;  2HLD G;  2UXD B;  2BRE A;  4PHZ A;  3OUF A;  2WEP A;  1Y74 A;  3SYO A;  1Q82 W;  4LPB A;  1U96 A;  2QA4 V;  1X59 A;  3CCS V;  3UKM A;  2XX2 A;  5FLX N;  4PRX A;  1L8D A;  2ITD C;  1PVG A;  1MSW D;  4D7S A;  4DV1 O;  1R3I C;  2IOR A;  1FXK A;  2F43 G;  1AR4 A;  1Q6I A;  3ASN B;  1VF5 B;  4X64 O;  4MTO A;  2ZIO A;  4U3J A;  2IH1 C;  4WFB V;  1KU9 A;  3JAK A;  4I50 A;  4PA9 A;  3JD3 A;  2BRC A;  1NS1 A;  2ILM A;  5KHJ A;  4XKA A;  5KHG A;  4DR4 O;  1G4Y B;  3WB0 A;  4IYI A;  3FYE B;  4B3M B;  2PI4 A;  2Z0A A;  2XAQ A;  1G6U A;  1NU1 H;  2ZT9 B;  4CH3 A;  4O4J B;  3R92 A;  1K4C C;  2JJ2 G;  3TTZ A;  4JI4 B;  1GM7 A;  4GFN A;  1W0K G;  3OMI B;  1GKF A;  3EXA A;  4UUJ C;  2YK2 A;  4J80 A;  2E74 B;  2ETN A;  1K73 W;  4PRV A;  2P7T C;  3TUH A;  3NXS A;  4DV5 B;  1KP2 A;  3U10 A;  1ZL8 B;  3FT5 A;  1HNZ O;  3WB2 A;  2ZR2 A;  4TWK A;  4ASF A;  3T4Z A;  3OWD A;  1SRY A;  4DR7 O;  5D7R A;  2Z3Y A;  1SES A;  1OCR C;  4O4I B;  3B26 A;  1Q3E A;  4GX5 A;  5D5P A;  1ZWI C;  1S14 A;  1SZX A;  3LNU A;  1WPB A;  2R9I A;  4BIZ A;  2AKP A;  1LUV A;  4DYL A;  2ZKJ A;  4GX0 A;  4B3S B;  2YI8 A;  4DRX A;  4LF8 B;  4DW0 A;  1B63 A;  4RUE A;  3EHG A;  1XIL A;  3CB2 A;  1UYG A;  2Y4U A;  2CUG A;  3CHX A;  1F4M A;  5GON B;  2PNR A;  2GSM B;  1ID0 A;  5IDJ A;  2YKE A;  1GMG A;  2YI6 A;  1JA8 A;  2XAH A;  1Q90 D;  3VQW A;  3K59 A;  1P84 F;  4JI6 B;  2C2A A;  4LNU A;  3L72 H;  2YEJ A;  4FM0 A;  1PD3 A;  2H94 A;  1TH8 A;  2PF4 E;  4EEH A;  1BT8 A;  5D6Q A;  5LXT A;  3M8A A;  2UXC O;  3SYC A;  2UUA B;  4R3A A;  4PDL A;  1Q8I A;  3F7V C;  3P30 A;  3A8T A;  4LF5 B;  1SS3 A;  3NR7 A;  2N05 A;  4O4L B;  1DTO A;  3CRK A;  5CA0 A;  4WFG A;  4ZIB A;  5B66 Z;  2UXN A;  4IHJ B;  3JAS B;  2VQE B;  4X62 O;  2FTK A;  3Q5J A;  3G7B A;  1S0V A;  2F95 B;  2W6J G;  2A0L A;  3JSN A;  4FLV A;  4ZBM A;  5GGZ A;  5ITZ A;  1MOF A;  1NTM H;  4OGQ B;  4URM A;  4XIT A;  4H44 B;  5LMN B;  5FNV B;  1H38 A;  2YKI A;  4DO2 A;  1YCI A;  3K5N A;  3AG3 B;  5K1P A;  2Q7E A;  2JDI G;  4MVO A;  5TIS Z;  1KIJ A;  3RYC A;  1MMM A;  3ABU A;  4RAI A;  2NN4 A;  4MVU A;  2ZXW C;  3SJB C;  3T2S A;  1BS3 A;  3D3I A;  3U2K A;  4BAE A;  4Q20 A;  5FNV A;  3BRC A;  4U93 A;  3DC5 A;  1Q5O A;  2G38 A;  3W7U A;  4B6C A;  3CC2 V;  1KKD A;  1B04 A;  2ZNI A;  2A3Q A;  4V26 A;  2WLI B;  3VBB A;  4LP0 A;  3KKY A;  3AG7 A;  4J7K A;  4FLY A;  4HZ3 A;  1IBM O;  1ZTE A;  5JH7 B;  2BE3 A;  1GH6 A;  5H6R A;  1I7F A;  2YEV B;  1WB7 A;  1SF9 A;  3CCV V;  5IYC O;  5JJE B;  5DN6 G;  3FB7 C;  3W7S A;  5F2V O;  3CCQ V;  3CRL A;  3QG5 A;  4FFB B;  5KHK A;  1I0H A;  4UCU A;  2YE5 A;  3CRR A;  4I0X A;  2P90 A;  1MA1 A;  3G6B A;  3ZRW B;  1FXV A;  3OW6 A;  4J7Z A;  3B40 A;  3PJS K;  3ABK B;  4X66 B;  3OWB A;  5JJN B;  3H1L H;  3RVZ A;  1AI4 A;  1YT1 A;  2VWJ A;  5JVD A;  3TET A;  3SJA C;  4F6E A;  4CS4 A;  1I94 B;  4DV3 B;  1AR5 A;  3TZ4 A;  4I55 B;  2YC0 A;  4PD4 F;  3CC4 V;  3T1Y O;  1BL8 A;  4FZ1 A;  3WQ9 A;  2IBZ H;  3JAM N;  3EKR A;  3F7Y C;  3AK1 A;  4KQV A;  1PNK A;  3OAA G;  5AG2 A;  1XOU A;  3RVY A;  1TC0 A;  4NB5 A;  2RMK B;  2BT0 A;  2DYS C;  4K8Z A;  4B7K A;  3ZMZ A;  3S3X A;  3SDL A;  1B06 A;  4X20 A;  4JI0 O;  1JPX A;  2BTO A;  3DSQ A;  3B24 A;  4B7E A;  1JFF B;  4F6R B;  2DWD C;  4FLX A;  4E01 A;  1MNG A;  4IT5 A;  4DR3 B;  1QZR A;  1WP8 A;  2GFD A;  1H7S A;  1JJO A;  4CC6 A;  2MK3 A;  2YE4 A;  4O4J A;  3ZHU A;  2XOK G;  4H13 B;  1GN3 A;  4DR7 B;  2JRI A;  3K06 A;  4DV2 O;  2BZ5 A;  1N34 O;  5LMU B;  4GEE A;  4BQJ A;  1SER A;  3I56 V;  4NXM O;  3JAW A;  1Z5C A;  2YXY A;  4QGP A;  1UYI A;  4LF8 O;  1AJP A;  1BXD A;  3G71 V;  5M4E A;  4CBC A;  2Y48 A;  1UYL A;  4H81 A;  3K5M A;  3R4P A;  3W7W A;  3Q5K A;  1CP9 A;  5F3K A;  4XDK A;  2WLM A;  2VQF B;  3K5O A;  1VEW A;  2B9Z A;  3PN1 A;  4BAY A;  4WCE V;  2FYP A;  3SPC A;  1NKD A;  1ZL8 A;  4JI6 O;  4DR5 O;  3D3Q A;  5CB4 B;  1T5E A;  4YIP A;  4XKK A;  1MU5 A;  4JV5 O;  3UQ8 A;  3OR6 C;  4JI7 O;  5EC2 C;  4F4L A;  1E1R G;  1KMI Z;  1QU7 A;  2CTW A;  3ZN0 A;  5L3C A;  4YJ3 B;  4UVA A;  4UCV A;  1NQT A;  3A0R A;  4EFU A;  2WLL A;  2VQE O;  4HNA A;  3CGY A;  3UCS C;  1H2L A;  1XEQ A;  2K9P A;  3IED A;  2A06 H;  2BOC C;  2BU2 A;  3CYO A;  2AHY A;  1QYE A;  3M99 B;  4KFM A;  4ZVI A;  3KCX A;  2XDK A;  3C11 A;  4LF9 O;  2KKW A;  1HNX B;  2X7R B;  2QEX V;  4FM2 A;  1NH2 D;  2O57 A;  2YJW A;  5M4H A;  1AR1 B;  3RYF B;  2ZNJ A;  4UVC A;  2BTQ A;  2BCC H;  3MDS A;  2H55 A;  3SPI A;  3B77 A;  4ZHQ A;  1PNM A;  1N36 O;  3IC7 A;  3CRQ A;  4CZZ A;  1E79 G;  4DR6 O;  2BU7 A;  4K35 A;  3LDC A;  1O9H A;  1KYO F;  5LOV B;  1M1K W;  1M56 B;  3X2Q C;  4JI8 O;  2Q68 A;  4YXW G;  2CE4 A;  4R8C A;  4YKW A;  3STL C;  2EJR A;  4BW5 A;  3RYF A;  1NHH A;  4UCT A;  5LYJ A;  1Y6X A;  1BYQ A;  2XAF A;  4PA3 A;  3LNN A;  1Z5A A;  4NKG B;  2QE7 G;  4H0L B;  3X2Q B;  3C0E A;  3TZ2 A;  1VAR A;  1GN4 A;  1K97 A;  4FIP C;  3BAA A;  3OGC C;  3KG2 A;  1FJG O;  1YSR A;  1THZ A;  4DR1 O;  4YJ2 A;  3ZHS A;  1UYF A;  2NLJ C;  2BSK A;  4O07 A;  1SET A;  1DGS A;  3K04 A;  3FB6 C;  2N74 A;  3K0D A;  3LNM B;  4TT3 G;  4EKW A;  3L70 H;  1M90 W;  2XAJ A;  1DF5 A;  1M5I A;  1Y67 A;  4ICG A;  1QBZ A;  1O9G A;  2BTQ B;  3RGB A;  2Q4P A;  4WUC A;  3SR2 C;  2ODM A;  4GKK O;  4DUY O;  2YDE A;  1Z5B A;  1UFI A;  2DOS A;  1JCH A;  5CA1 A;  1NHJ A;  4ZOL A;  1THN A;  3K97 A;  2FML A;  5BMV A;  2XUM A;  4I7Z B;  1N8R W;  4LF6 O;  5BY1 A;  1UY8 A;  4PL9 A;  1Y4S A;  4BQG A;  2OCC C;  2XDL A;  3CWB H;  1FAF A;  3ZHV A;  3RN4 A;  5KAF Z;  2GHY A;  1YC1 A;  4JI1 B;  5CTX A;  3WG7 B;  2OYQ A;  1TUE B;  3BMY A;  1LUW A;  3S3W A;  3BFR A;  4MPN A;  3UO3 A;  4U3J B;  4JYA O;  2JGU A;  4CWO A;  4E02 A;  1YEW A;  4HZ0 A;  3K58 A;  2K1E A;  1AH6 A;  2YED A;  5CMU A;  3CC7 V;  1PNL A;  5KX5 B;  4FZ0 A;  3HKB B;  4PI2 A;  5BR8 B;  2OIG A;  4FK5 C;  1Y4M A;  4E00 A;  2RJZ A;  4FPP A;  1VQ5 V;  3P3P A;  3N27 A;  2QG2 A;  4JTA B;  3G67 A;  1U2O A;  4LFA O;  4MW8 A;  4DK1 A;  4GLX A;  2DJV A;  1HNW O;  5ITZ B;  2XDX A;  3JAL B;  2QJ1 A;  4XCL A;  1Z59 A;  3OGI B;  5B1B C;  1PKX A;  3T0Z A;  1AJN A;  2ZKO A;  4LF5 O;  3SYA A;  1EN6 A;  5D7C A;  1ZXN A;  3N2G B;  3B28 A;  2YK9 A;  3TXS A;  3G80 A;  4EB6 A;  3D0B A;  3T4D A;  2F66 C;  4X65 B;  2QGN A;  4BR6 A;  2O1U A;  2KQX A;  1FS0 G;  4DR2 O;  4NXN B;  1XRE A;  3OUS A;  2DMX A;  2PYJ A;  2FKX A;  2HHH O;  2XND G;  2WSS G;  1K4D C;  2QDO A;  4MVQ A;  1XNQ O;  1KBH A;  1DF4 A;  3DC6 A;  1PPJ H;  1QR9 A;  2Q0O C;  4XDM A;  5CBH A;  4JF3 A;  2YUA A;  3LUT B;  4PEL A;  2BU5 A;  5IYZ A;  1BSM A;  4TV9 B;  5KMG B;  1BCC H;  4OXS A;  3K9A A;  3ML0 A;  1AJ6 A;  3AG2 C;  1NJI W;  4PDV A;  4ZI7 A;  3HYY A;  2Q6A A;  4TV9 A;  3INW A;  1SA0 B;  5B1A B;  1JVM A;  2EIJ C;  2XHB A;  3HB3 B;  4URL A;  4UCR A;  4OX9 B;  4WBN A;  3DXR A;  5JCO A;  3HZ5 A;  4L87 A;  1VQ6 V;  4BWA A;  4MT8 A;  4UB8 Z;  2VW5 A;  5IE9 A;  4LWG A;  2AGA A;  4CH6 A;  4J41 A;  1BGY H;  4R3M A;  1N36 B;  1P49 A;  5H9C A;  4WF9 V;  1XMQ B;  4J7J A;  4EB6 B;  2WI5 A;  1QR8 A;  5CF0 A;  1SA0 A;  2NNU A;  4AWQ A;  1WJZ A;  1R62 A;  3FFQ A;  4U3F H;  2YE9 A;  1TAE A;  3RFR A;  2R9A A;  4JI2 O;  4GKJ O;  4GCZ A;  1UYK A;  5KMG A;  1R3L C;  1YTF D;  3HKE A;  2B1I A;  5KA5 A;  4MVM A;  2YE7 A;  4FCQ A;  2EIL B;  1JJ2 U;  1KUQ A;  4MP7 A;  4FCP A;  3CRA A;  3JAS A;  1B62 A;  1I58 A;  4DR1 B;  1QY8 A;  1IVS A;  4FJC C;  1VQ8 V;  3LDD A;  4X9Q A;  3GIE A;  1OZ0 A;  1NTK H;  2WWW A;  3QDD A;  3CCE V;  2GQP A;  1URF A;  2HR3 A;  2M7W A;  5B1A C;  4YKU A;  4O0B A;  3LPS A;  2OCH A;  4XDJ A;  4KFG A;  4HAM A;  3B2E E;  2OWO A;  2AZ2 A;  2X6A A;  3E8H A;  3A2F A;  3D8C A;  4X1K A;  4JAU A;  2CH4 A;  4LF6 B;  2YEG A;  2ATK C;  3IAY A;  2WLL B;  1NR7 A;  1XHX A;  4PA4 A;  4DV0 B;  1N33 B;  1QCE A;  3JAT B;  2JJC A;  5M4M A;  4ZOL B;  3FX7 A;  5J2U A;  3JCU Z;  3ZBH A;  5CA3 A;  3AG3 C;  1F51 A;  4MB9 A;  1Q86 W;  1OCR B;  4J11 A;  4H33 A;  4LWS B;  3RLR A;  3OPD A;  2XAB A;  3P3N A;  3CE2 A;  5E79 Z;  4LWS A;  4HXZ A;  2P5O A;  3DTU B;  4I4T A;  2EZO A;  4E2L A;  2BU6 A;  2DQ0 A;  5KAI Z;  2EIN B;  3FV5 A;  1WNS A;  2WPD G;  4U7O A;  5A2Q N;  5LL6 Y;  3U67 A;  1I5C A;  3BCC H;  2XX4 A;  1IXM A;  4X1K B;  1KZN A;  2QWO B;  2Q0A A;  3OE7 G;  2FWZ A;  5BOC A;  3E35 A;  1YXB A;  1XHZ A;  4H85 A;  1MSD A;  3LDE A;  2EIJ B;  2CTQ A;  3ABK C;  2IH3 C;  4MP2 A;  4EM7 A;  4AHC A;  3BPZ A;  3IGA C;  3T1H B;  5L3J A;  3HEK A;  1R3K C;  1VF7 A;  5GW7 A;  1UYH A;  4LF4 B;  4KP4 A;  2Q7H A;  1YIT V;  4F6R A;  4WFE A;  4NYK A;  1AH8 A;  3A0T A;  1S77 D;  2VRZ A;  4OPA A;  3ZX6 A;  4L93 A;  4MBC A;  2GTA A;  1N0N A;  5CTU A;  4I9Q A;  5LA6 A;  1UYE A;  5BZB A;  2P4V A;  1TIL A;  3CS5 A;  5DEC A;  1XNQ B;  3UM7 A;  4I0X B;  4L94 A;  3LSU A;  5EIB D;  4DV1 B;  3VQX A;  3VQY A;  2QWR B;  3K57 A;  3Q5L A;  3EKO A;  2KG7 A;  4EFT A;  2V7Q G;  2QF6 A;  1XNR B;  3OTO B;  1R6T A;  1WN7 A;  4MVR A;  4YHH O;  1LNQ A;  4X64 B;  1CEZ A;  3QO5 A;  4O09 A;  4CE1 A;  3ZMV A;  3N2K B;  2VS0 A;  2CGF A;  3TZ5 A;  5B3S B;  1JQ0 A;  1A4H A;  1EM1 A;  5J2T B;  2DW4 A;  2P6J A;  4BIU A;  2LQT A;  3A0Z A;  5LXT B;  2ZE8 A;  3T1C A;  2NR5 A;  2CTR A;  4HZ5 A;  1DLB A;  2OCC B;  2AW9 A;  2QTS A;  4R6Z A;  3O2F A;  4XIQ A;  4B3T O;  4L8Z A;  1KD1 W;  1EZV H;  3TCU A;  3DGE A;  4G2K A;  3SL2 A;  3JD0 A;  1KKC A;  3ZRV A;  2E0A A;  4DUZ O;  2FYU H;  2YGE A;  2BYH A;  2A9H A;  1HR0 O;  2YI9 A;  2Y0P A;  4CE2 A;  2YE2 A;  5CBG A;  3CXH F;  2DYR C;  2YEC A;  2R9R B;  1L0O A;  1OCC B;  1WAZ A;  3GWO A;  2XAG A;  1ZSP A;  3C90 A;  3T1K A;  2FWY A;  1RPO A;  2JIZ G;  5J9P C;  3QNE A;  5HFL A;  2QR4 A;  1K9M W;  1PL0 A;  3JAR B;  3MHH C;  1V55 C;  4YY3 B;  2ESA A;  3BM9 A;  4FFK A;  3OFN G;  4K0K O;  2HVJ C;  2ZE5 A;  2HVK C;  3HKB A;  4I5S A;  3ZN1 A;  1VQ9 V;  1TGO A;  4UCS A;  3INX A;  3RYH B;  2QKC A;  2LGQ A;  5M4P A;  1BHB A;  4L90 A;  3W7T A;  3CRC A;  3BY6 A;  2YGF A;  5A9G A;  1XL4 A;  4Z1M G;  1KQS U;  4LF7 O;  5F5R A;  2FXS A;  1K5Q A;  4JYC A;  4O2A B;  4FLU A;  2UXB O;  4CWR A;  3LSQ A;  4G28 B;  4RQF A;  4TQD A;  1XMO O;  5BOD A;  1V54 C;  4YJ3 A;  2CGO A;  3L75 H;  5CTW A;  4GYC B;  3EHB B;  1XQ8 A;  2LO1 A;  1K92 A;  4X62 B;  3Q4H B;  2A79 B;  1QNM A;  5C93 A;  2YI5 A;  1KP3 A;  3ASO C;  3BEH A;  2IWS A;  4IIJ B;  4YIO A;  1SQB H;  2JS3 A;  3RWR D;  4B7P A;  3WG7 C;  3MHS C;  1I5A A;  1Q6H A;  1M56 C;  3C3T A;  2JS5 A;  2O1W A;  3JAR A;  2V1D A;  2WER A;  4HYP A;  4IIJ A;  4X89 A;  5LP6 A;  4AWP A;  2XHX A;  2IW5 A;  4PDM A;  4CH4 A;  4N23 A;  4ZI7 B;  4PI0 A;  1S76 D;  3LSS A;  4ASU G;  4MTX A;  2ZE7 A;  2UXD O;  4WUB A;  1K7D A;  2F23 A;  4DR2 B;  3R66 A;  1YJ9 V;  2HHH B;  1BGQ A;  4XCJ A;  3VQV A;  1K5S A;  5JVD B;  1FPO A;  1D2D A;  2GBO A;  5B3S C;  1Y66 A;  2V4D A;  1US6 A;  1PP9 H;  1Z5V A;  3IC9 A;  3E2E A;  4CWQ A;  4G27 B;  2HG1 A;  1WA8 B;  2BU8 A;  3H80 A;  2IJK A;  1XI1 A;  5KLV H;  1NVP D;  5EBW C;  2QM7 A;  4GQT A;  3SPJ A;  2YEH A;  3B25 A;  4EGK A;  1F7Y A;  4X20 B;  3R91 A;  1IBL O;  4LP8 A;  3TZ0 A;  5IY5 B;  4O05 A;  1EZJ A;  2XTA A;  4OX9 O;  2RQ6 A;  3RLP A;  3OR7 C;  5L3G A;  3ABT A;  1UYC A;  1R73 A;  2QKS A;  5FNF A;  1HP8 A;  5EYP A;  5LGU A;  2LW7 A;  1FFT B;  5IJ0 B;  5H6Q A;  4JI4 O;  2Q69 A;  4MS2 A;  1Z5W A;  3A0B Z;  4IGG A;  2CG9 A;  1YSC A;  2CCT A;  4IHJ A;  4CWT A;  4HY6 A;  5IYD O;  3B09 A;  4D6T H;  3O0I A;  3K9S A;  2YI7 A;  4GKJ B;  3ZHQ A;  2WI2 A;  5EK0 A;  3CP1 A;  3K79 A;  1YIJ V;  3ETQ A;  5EC1 C;  2ZIN A;  2HFE C;  3P32 A;  3ETE A;  4DV5 O;  2QSA A;  2Q73 A;  2OTJ V;  1HNZ B;  1AB3 A;  3ZXQ A;  2ITC C;  1AJQ A;  3R4O A;  2WLJ A;  5JEN A;  3E22 A;  4AS9 A;  2W0X A;  3HKC B;  2H3O A;  4JAA A;  2O1V A;  4KHP B;  5K1X A;  1HR0 B;  2K5B A;  4P8O A;  3ABM B;  4Z2W A;  3HKC A;  1YDX A;  3CJH A;  2EIL C;  3G75 A;  1ROP A;  1UY9 A;  4LH6 A;  1FXH A;  2EX3 A;  2CK3 G;  3OT7 A;  4DV2 B;  3S5T A;  1CPY A;  1P7B A;  2E75 B;  1N34 B;  4MW3 A;  2EXL A;  2ZM6 B;  4ASB A;  1JMK C;  3DXR B;  1VQN V;  2UUA O;  4LR3 A;  1OCO B;  4YKZ A;  2EIM B;  4W4L A;  2XT9 A;  2ZIM A;  4DV7 O;  2B1G A;  5EZY A;  3AK3 A;  1M57 B;  1NHI A;  3ZRX A;  5JWP A;  5LHH A;  1MZF A;  4X1I B;  1Y4U A;  2HKO A;  1GKX A;  4B08 A;  2Q5Z A;  5CTY A;  5L3D A;  5JCO C;  5EBM C;  3ZCC A;  2QM4 A;  5IDM A;  2F4V B;  4LF7 B;  3HKE B;  5LMN O;  3O9O A;  4JV5 B;  2UXB B;  1EA6 A;  2VCJ A;  4HNA B;  4R7C A;  4I3H A;  3W7X A;  5LA6 B;  3ZJZ A;  3KE6 A;  1IX9 A;  4XD8 A;  1GN6 A;  3AG1 B;  2OIE A;  3LMM A;  2IJH A;  4K8X A;  4URO A;  1YVW A;  2WA3 A;  2QFO A;  4ASA A;  4DZY A;  3HKD A;  2UUB O;  4NTY A;  1FKA O;  1R6K A;  5B1B B;  2DE0 X;  2EIK B;  1MAB G;  2OTL V;  2YKJ A;  2DYS B;  3THO A;  2R72 A;  3JZ3 A;  3T1H O;  1F23 A;  1Y74 B;  4PJ0 Z;  1OV9 A;  3ZKB A;  3CCU V;  1S16 A;  3SJC C;  4EMV A;  1GKZ A;  1U97 A;  3ZS8 C;  1IBM B;  4P9O A;  3JAW B;  3G7E A;  4I55 A;  2EIK C;  1UPG A;  4D7T A;  4JI8 B;  4I9W A;  1R3J C;  1OHH G;  3HPL C;  1W2B U;  1SQG A;  3JYC A;  5LP6 B;  1OCZ C;  3NMQ A;  5CB4 A;  2W6I G;  1P7G A;  2JVD A;  1WB8 A;  4B3M O;  2DQ3 A;  1AI7 A;  3H9V A;  3BAB A;  3ETG A;  3MNR P;  4YHH B;  3HZ1 A;  4X66 O;  2Q8V A;  1AI6 A;  1TC6 A;  4LC1 A;  3IJ4 A;  2E76 B;  3T1Y B;  1I94 O;  2WI1 A;  4J9Y B;  2WLN A;  4DV6 O;  3CCJ V;  2YIC A;  4U7N A;  2CGN A;  4MTG A;  5IJ0 A;  1UY6 A;  1J95 A;  1EN5 A;  2LW1 A;  2ZDI A;  4C7U A;  2YEF A;  3QVN A;  4J10 A;  4GGL A;  4N21 A;  4HBN A;  2YKB A;  2ADP A;  2WI7 A;  5L3F A;  4JI0 B;  2Y4T A;  2E3C A;  4H7Q A;  2RN9 A;  5LGT A;  2IU3 A;  3OW2 U;  4DUZ B;  4QE7 A;  3FB8 C;  2YIA A;  4R50 A;  2YXH A;  3BA8 A;  2LP7 A;  2XD6 A;  2W0F C;  4O4H B;  2PZS A;  1Q81 W;  4QIW F;  2YS8 A;  2PI5 A;  4LH7 A;  4YKY A;  1J5E O;  2EIN C;  1QLE B;  1Y8N A;  1FD9 A;  2KSD A;  1F4N A;  3FAV B;  2YIB D;  1SQF A;  4GT1 A;  4XIP A;  4JPR A;  1CXZ B;  1NVP B;  3CMA V;  2M6Y A;  1ZUQ A;  1L0N H;  1I08 A;  3APO A;  2YJX A;  3G4S V;  3VOU A;  3H01 A;  3EHF A;  4HY1 A;  2EUL A;  3J7A U;  2PTM A;  2Q2E B;  3TK1 A;  2YXL A;  5IJ9 B;  4KSH A;  3CYG A;  4K0K B;  1YJN V;  4XIR A;  3FT8 A;  4NXM B;  2AHZ A;  5M4N A;  1Y8P A;  3SPH A;  5JH7 A;  3K98 A;  2LJ2 A;  4X1Y A;  3GIG A;  3OEH G;  3JD2 A;  4TV8 B;  3JAK B;  4I50 B;  1IXB A;  3ZMS A;  4MOT A;  2JKI A;  4GZR B;  4V25 A;  4MSW C;  3H1I H;  3QF7 A;  2XX5 A;  1TUB A;  2GUZ A;  4XBF A;  5IYB O;  4CWF A;  5DM6 V;  1H2S B;  1MG1 A;  5KHH A;  1OSF A;  4PA7 A;  1HNW B;  2CCU A;  3VHC A;  4WFF A;  3ZRW A;  1MZE A;  1GTO A;  2ZM6 O;  1XMO B;  3RYC B;  1GO3 F;  1YJW V;  1LR1 A;  2LGW A;  2XJJ A;  4HYM A;  3B4S A;  4PU9 A;  2CH7 B;  1PM9 A;  2UXX A;  4QNH B;  3T0H A;  1EBO A;  1SQQ H;  2JEX A;  1YF2 A;  4UB6 Z;  3A0Y A;  1NI8 A;  2QWQ B;  2WI4 A;  2C1I A;  1A32 A;  1IZ3 A;  1Z2G A;  3H1H H;  4DRX B;  1KC8 W;  4LF9 B;  1H8H G;  1HWY A;  2HKJ A;  3ZXO A;  4JI3 B;  5E1A C;  3CCL V;  2UU9 B;  4DW1 A;  1EFR G;  2F4V O;  2BSM A;  1YC3 A;  2PY5 A;  4O4I A;  2XDS A;  5M4K A;  4LCU C;  2RDC A;  4P2Z A;  5J71 A;  1IUR A;  1D5N A;  4ABM A;  4X88 A;  4JYY A;  3CRM A;  1E1Q G;  2ZDX A;  1YES A;  3TXQ A;  1BKN A;  3L71 H;  1Q7Y W;  5JJJ B;  3JCZ A; 
#chains in the Genus database with same CATH homology
 3IC7 A;  1I59 A;  1UY7 A;  4CZZ A;  1NR1 A;  1E79 G;  1L1F A;  2BU7 A;  1K34 A;  3CD6 V;  3LDC A;  3INX A;  1M1K W;  1M56 B;  3CWV A;  3HYZ A;  3X2Q C;  2Q67 A;  2Q68 A;  5EBL C;  5M4P A;  4YXW G;  1BHB A;  4L90 A;  3GIG B;  1H2G A;  3CCR V;  5D6P A;  4R8C A;  3W7T A;  1V55 B;  3STL C;  2EJR A;  3OM3 B;  4YKW A;  3BY6 A;  4CWN A;  4BW5 A;  3ZMT A;  1NHH A;  2YEA A;  4LBE C;  3R4N A;  3EHH A;  1YC4 A;  2YGF A;  1BYQ A;  4JQL A;  2XAF A;  1XL4 A;  2ZXW B;  3QO8 A;  4PA3 A;  5KUM A;  4Z1M G;  1KQS U;  3F5W C;  1Z5A A;  1UYM A;  2WEQ A;  1R6N A;  5F5R A;  1YET A;  2FXS A;  3VHD A;  1K5Q A;  1UJW B;  4JYC A;  2QE7 G;  1VQM V;  2Q8I A;  4CWR A;  3LSQ A;  1COW G;  4G28 B;  3X2Q B;  3C0E A;  3TZ2 A;  1S72 V;  4RQF A;  1K97 A;  3AG2 B;  4FIP C;  2WLK A;  5B1N A;  3OGC C;  5FNC A;  4CE3 A;  4DUH A;  4X8A A;  3KG2 A;  1M9N A;  3PEH A;  1YSR A;  4JAV A;  1GJV A;  1THZ A;  2KB1 A;  3PEJ A;  2YEI A;  1V54 C;  4PA6 A;  1YER A;  5BOD A;  1UYF A;  3QO7 A;  3CME V;  2NLJ C;  2X6B A;  3RW0 A;  4O07 A;  4MTF A;  2HCH A;  1VQP V;  2WI3 A;  5CTW A;  1W0J G;  1SET A;  3EHB B;  2D3O W;  3K04 A;  3FB6 C;  1K92 A;  2IOQ A;  3K0D A;  2A79 B;  5C93 A;  1H7U A;  2LFS A;  3LNM B;  2YI5 A;  1KP3 A;  2XAS A;  4TT3 G;  2Q8G A;  3BEH A;  3ASO C;  1RPR A;  4EKW A;  1M90 W;  2XAJ A;  5FWK A;  2IWS A;  3E8G A;  1DF5 A;  1GM9 A;  3GB7 C;  3ABL B;  5LBQ A;  1YT0 A;  4WUD A;  2ZD9 A;  4B7P A;  3WG7 C;  1YTF B;  3MHS C;  4FMT A;  2QM8 A;  1QBZ A;  1I5A A;  1M56 C;  3B8N A;  2O1W A;  2WER A;  1I5D A;  2V1D A;  3K99 A;  3ZKD A;  5FND A;  4WUC A;  3MD0 A;  1QVG U;  4HYP A;  1UYD A;  4AWO A;  5L3E A;  4GX2 A;  1S5H C;  4X89 A;  1ARO P;  4NH9 A;  4P7A A;  4AWP A;  2IWX A;  1Z5B A;  1NH2 B;  2XHX A;  1JCH A;  1AM1 A;  1JM6 A;  1H8E G;  2IW5 A;  1NHJ A;  1THN A;  2P67 A;  3K97 A;  4PDM A;  1N8R W;  3E8F A;  4N23 A;  3ABL C;  2CCS A;  2YSU B;  5L3B A;  2OT5 A;  3I55 V;  5IY5 C;  1S76 D;  1UY8 A;  4PL9 A;  3LSS A;  1I5B A;  4ASU G;  4MTX A;  1WLE A;  1Y4S A;  4BQG A;  4WUB A;  4QJF B;  2OCC C;  4P9P A;  1K7D A;  3ETD A;  2BRE A;  1YI2 V;  2JJ1 G;  2HLD G;  2XDL A;  5FL7 G;  3OUF A;  2WEP A;  2YEB A;  1YJ9 V;  3SYO A;  3ZXO A;  4JTD B;  1K33 A;  1Q82 W;  4LPB A;  1QLN A;  1BGQ A;  2QA4 V;  4XCJ A;  2GHY A;  4QE9 A;  1YC1 A;  1K5S A;  3CCS V;  5CTX A;  3UKM A;  3WG7 B;  5B3S C;  2XX2 A;  4NH8 A;  3H4L A;  1Y66 A;  4PRX A;  2ITD C;  1PVG A;  3VAD A;  1MSW D;  1TUE B;  3BMY A;  1EI1 A;  4JYB A;  1R3I C;  2IOR A;  3E2E A;  4CWQ A;  4MPN A;  4G27 B;  1FXK A;  4J9Z B;  2F43 G;  2BU8 A;  2HG1 A;  3H80 A;  4CWO A;  4E02 A;  4HZ0 A;  3ASN B;  3JD4 A;  2K1E A;  1AH6 A;  2IJK A;  2DYR B;  2XHT A;  2YED A;  5CMU A;  3CC7 V;  1PNL A;  4MTO A;  4WFH A;  1NVP D;  1FXK B;  4MVZ A;  2IH1 C;  5EBW C;  4WFB V;  3CGZ A;  2QM7 A;  4L91 A;  4GQT A;  4FK5 C;  4PA9 A;  5B1O A;  3JD3 A;  3SPJ A;  1Y4M A;  2BRC A;  2YGA A;  3D2R A;  4XKO A;  2YEH A;  4CE1 A;  4E00 A;  3OEE G;  4FPP A;  1U0Z A;  4O04 A;  1VQ5 V;  3B25 A;  4EGK A;  2QG2 A;  4XKA A;  3R91 A;  4LP8 A;  1YHQ V;  3TZ0 A;  4JTA B;  1U2O A;  5IY5 B;  3D36 A;  4O05 A;  1EZJ A;  3ZMU A;  3T1K A;  1G4Y B;  4MW8 A;  3RLP A;  3OR7 C;  4EGI A;  5L3G A;  2XDU A;  3FYE B;  2XDX A;  3ABT A;  1UYC A;  2PI4 A;  1FXK C;  1R73 A;  2XAQ A;  2QKS A;  4XCL A;  5FNF A;  1Z59 A;  5LGU A;  1FFT B;  5B1B C;  1PKX A;  5H6Q A;  3T0Z A;  1AJN A;  2Q69 A;  4MS2 A;  4WFA V;  3R92 A;  1K4C C;  2JJ2 G;  3TTZ A;  3SYA A;  2CG9 A;  4LWI A;  5HFM A;  4HYO A;  1YSC A;  1GM7 A;  2CCT A;  4GFN A;  3R4M A;  5D7C A;  1ZXN A;  1W0K G;  2XCM A;  3OMI B;  4HY6 A;  2EZP A;  1QLE C;  3B28 A;  4X9L A;  4CWT A;  1GKF A;  3ABM C;  5IYD O;  2YK9 A;  4UUJ C;  2YK2 A;  3O0I A;  4XTJ A;  1ZXM A;  4BXI A;  3D0B A;  3T4D A;  4JGS A;  1XL6 A;  2IWU A;  2YI7 A;  2WI2 A;  1KEC A;  5EK0 A;  1K73 W;  2O1U A;  4PRV A;  1FS0 G;  2P7T C;  3CP1 A;  4YKT A;  3K79 A;  3TUH A;  1YIJ V;  3NXS A;  1VQL V;  1KP2 A;  4MVS A;  3OUS A;  5EC1 C;  3A0W A;  2XDS A;  2HFE C;  3P32 A;  3FT5 A;  2Z5U A;  2ZR2 A;  3ETE A;  4TWK A;  2XND G;  3T4Z A;  2WSS G;  3AEI A;  1K4D C;  1SRY A;  2OTJ V;  4MVQ A;  3OWD A;  1DF4 A;  5D7R A;  2Z3Y A;  1QR9 A;  1SES A;  1OCR C;  2ZDY A;  3B26 A;  3ZXQ A;  2ITC C;  4GX5 A;  1AJQ A;  1AI5 A;  2ZBK B;  4XDM A;  1ZWI C;  1S14 A;  3R4O A;  3LNU A;  2R9I A;  1ZWH A;  2ZQM A;  5CBH A;  1Y8O A;  2WLJ A;  4BIZ A;  4JF3 A;  2AKP A;  3SYP A;  3LUT B;  4PEL A;  3E86 A;  2ZKJ A;  4AS9 A;  2BU5 A;  4GX0 A;  1ENV A;  4XDL A;  1I5X A;  3SYQ A;  2DWE C;  1B63 A;  2XJX A;  4RUE A;  3EFF K;  3EHG A;  4OXS A;  3K9A A;  2O1V A;  1RM1 B;  1UYG A;  4YKR A;  2K5B A;  3ML0 A;  1AJ6 A;  3K3W A;  3AG2 C;  1NJI W;  3ABM B;  4P8O A;  4PDV A;  2XJG A;  3HYY A;  2Q6A A;  2UWD A;  3INW A;  3QTF A;  1F4M A;  4ASF A;  2PNR A;  2EIL C;  5B1A B;  2GSM B;  1ID0 A;  5LGN A;  3WHA A;  5IDJ A;  2YKE A;  2YEE A;  3AG4 C;  1JVM A;  3K60 A;  1GMG A;  2YI6 A;  2EIJ C;  3HB3 B;  1S3J A;  3G75 A;  3E8B A;  4URL A;  1ROP A;  2XAH A;  1UY9 A;  2YE8 A;  1FXH A;  2JEU A;  2X0L A;  3EHJ A;  2C2A A;  2CK3 G;  2Y69 B;  2YEJ A;  1CPY A;  1P7B A;  1PD3 A;  2H94 A;  4L87 A;  4MW3 A;  4JTC B;  3AG1 C;  1VQ6 V;  1TH8 A;  2EXL A;  3HZ5 A;  4MT8 A;  4ASB A;  4EEH A;  1VQN V;  5D6Q A;  3B8M A;  1OCO B;  2VW5 A;  4YKZ A;  2IU0 A;  2EIM B;  4K4O A;  4LWG A;  4R3A A;  3SYC A;  4R3M A;  3AG4 B;  4PDL A;  3F7V C;  3P30 A;  5H9C A;  4WF9 V;  3O6O A;  3K08 A;  2WI5 A;  1QR8 A;  3CRK A;  2B1G A;  1DTO A;  1I5Y A;  4WFG A;  2HG5 C;  3K0G A;  5CF0 A;  3E89 A;  1M57 B;  2UXN A;  1NHI A;  2NNU A;  1NBM G;  3ZRX A;  2XHR A;  4AWQ A;  2FTK A;  3Q5J A;  5LHH A;  1R62 A;  3IFX A;  4XC0 A;  2YE9 A;  3G7B A;  1S0V A;  1Y4U A;  2HKO A;  1GKX A;  1B3Q A;  3T10 A;  5CTY A;  5L3D A;  4GCZ A;  5EBM C;  1UYK A;  2W6J G;  1R3L C;  1YTF D;  2A0L A;  3ASN C;  3ZCC A;  2B1I A;  4ZBM A;  5KA5 A;  5GGZ A;  5IDM A;  4MVM A;  1TBW A;  4YKQ A;  4URN A;  1MOF A;  2YE7 A;  4FCQ A;  4LWF A;  2EIL B;  4R1F A;  1P4R A;  1JJ2 U;  1EA6 A;  4URM A;  2VCJ A;  4XIT A;  4R7C A;  4MP7 A;  4GX1 A;  4I3H A;  3W7X A;  4DXW A;  1H38 A;  3ZRS A;  2YKI A;  3ZJZ A;  2B5U A;  4DO2 A;  2EIM C;  2WAM A;  4FCP A;  1GK9 A;  1B62 A;  1I58 A;  3KE6 A;  2LFR A;  3AG3 B;  4XD8 A;  1QY8 A;  2Q8H A;  4FJC C;  3OMA B;  1VQ8 V;  3AG1 B;  3LDD A;  3STZ C;  3GIE A;  1OZ0 A;  2JDI G;  2WWW A;  4MVO A;  3QDD A;  3CCE V;  1KIJ A;  2GQP A;  4YKU A;  2HR3 A;  2IJH A;  2M7W A;  4UV8 A;  5B1A C;  1M57 C;  3ABU A;  1V54 B;  4RAI A;  4MVU A;  4URO A;  4O0B A;  3VHA A;  2ZXW C;  2QFO A;  3T2S A;  4ASA A;  4W7T A;  4DZY A;  1OCZ B;  2IJJ A;  3LPS A;  3D3I A;  3U2K A;  4BAE A;  4Q20 A;  2Y69 C;  4U93 A;  3ASO B;  3W7U A;  1R6K A;  4B6C A;  5B1B B;  5LHG A;  2JK5 C;  2EIK B;  4XDJ A;  1MAB G;  3CC2 V;  2OTL V;  4HAM A;  1KKD A;  2IOP A;  2YE6 A;  2YKJ A;  1US7 A;  4KFG A;  2DYS B;  3A0X A;  4V26 A;  2X6A A;  3JZ3 A;  2WLI B;  3E8H A;  3VBB A;  1K3E A;  1F23 A;  2YE3 A;  4LP0 A;  2HJF C;  4HZ3 A;  4JAU A;  3ZKB A;  3FB5 C;  3CCU V;  2ZR3 A;  2CH4 A;  1S16 A;  2WLH A;  5H6R A;  1TID A;  2ATK C;  2YEG A;  4EMV A;  2WLL B;  2YEV B;  1NR7 A;  1GKZ A;  4P9O A;  2YI0 A;  3CCV V;  1VQ4 V;  5IYC O;  4QPK A;  3G7E A;  4PA4 A;  2EIK C;  3FB7 C;  5DN6 G;  3W7S A;  5D7D A;  1QCE A;  2JJC A;  3CCQ V;  4I9W A;  3CRL A;  5M4M A;  4QPJ A;  1R3J C;  2YE5 A;  5CA3 A;  1OHH G;  3HPL C;  3AG3 C;  1F51 A;  4JAS A;  4YKX A;  3RKZ A;  4MB9 A;  1W2B U;  2BTZ A;  2P90 A;  3JYC A;  1Q86 W;  1OCR B;  1OCZ C;  1MX0 A;  4H33 A;  3K03 A;  4P30 A;  3NMQ A;  5CBF A;  3ZRW B;  3CPW U;  2VWC A;  4RQE A;  1FXV A;  2W6I G;  1K8A W;  3RLR A;  3OW6 A;  3OPD A;  2XAB A;  3PJS K;  3ABK B;  3JD1 A;  2DQ3 A;  1VQO V;  1AI7 A;  3OMN B;  4HXZ A;  3DTU B;  3OWB A;  2EZO A;  1BHA A;  3ETG A;  3RVZ A;  4E2L A;  2BU6 A;  1AI4 A;  1G8M A;  2DQ0 A;  1YT1 A;  3HZ1 A;  3MNR P;  2EIN B;  1AI6 A;  3TET A;  3U2D A;  4UVB A;  5KA6 A;  4XE2 A;  4CWP A;  1TC6 A;  3FV5 A;  4LC1 A;  2WPD G;  4PDR A;  5KUK A;  4U7O A;  3TZ4 A;  3CC4 V;  4MPE A;  5LHI A;  4ZKI A;  2IJI A;  2WI1 A;  4J9Y B;  3U67 A;  2WLN A;  1BL8 A;  1I5C A;  2Q8F A;  1UY6 A;  3CCJ V;  2XX4 A;  1IXM A;  4U7N A;  4MTG A;  3WQ9 A;  3EKR A;  1RM1 C;  4LWH A;  4HXW A;  3F7Y C;  1KZN A;  1J95 A;  2ZDI A;  4KQV A;  1PNK A;  3OAA G;  1B6Q A;  3OE7 G;  2YEF A;  2X6C A;  3RVY A;  2FWZ A;  1TC0 A;  4GGL A;  5BOC A;  2BT0 A;  3E35 A;  2DYS C;  4N21 A;  3B27 A;  4H85 A;  1JX9 A;  2YKB A;  2WI7 A;  3ZMZ A;  3LDE A;  5L3F A;  2EIJ B;  4H7Q A;  1YS3 A;  5LGT A;  2IU3 A;  1GM8 A;  2IH3 C;  3ABK C;  3G6E V;  3OW2 U;  1JPX A;  4MP2 A;  4EM7 A;  4QE7 A;  3FB8 C;  1AMW A;  4KUM A;  1JOY A;  3IGA C;  4R50 A;  2LP7 A;  1YT2 A;  2XD6 A;  3B24 A;  5L3J A;  3HEK A;  1R3K C;  5GW7 A;  1UYH A;  2W0F C;  2DWD C;  4KP4 A;  1Q81 W;  4QIW F;  3RLQ A;  4E01 A;  1YIT V;  2PI5 A;  4WFE A;  1AH8 A;  1QZR A;  4YKY A;  3A0T A;  1S77 D;  4RUF A;  2EIN C;  2GFD A;  1QLE B;  1H7S A;  4L93 A;  4MBC A;  2VCI A;  1Y8N A;  5CTU A;  1F4N A;  2MK3 A;  3GIF A;  1UYE A;  3CXC U;  4GT1 A;  5BZB A;  2YE4 A;  4XIP A;  4JPR A;  1NVP B;  2YJX A;  3CMA V;  1TIL A;  2QTO A;  2H8P C;  3G4S V;  2XOK G;  3VOU A;  4UV9 A;  3K06 A;  3UM7 A;  2BZ5 A;  3H01 A;  4L94 A;  3EHF A;  4HY1 A;  4GEE A;  2Q2E B;  4KSH A;  3TK1 A;  4BQJ A;  2BYI A;  1SER A;  3I56 V;  1YJN V;  3EKO A;  3Q5L A;  4EFT A;  2V7Q G;  1VQK V;  2QF6 A;  1SZT A;  1Z5C A;  3OMU A;  3SPG A;  4XIR A;  3FT8 A;  1BMF G;  1VQ7 V;  1UYI A;  4TSF G;  1AJP A;  2AHZ A;  4MVR A;  3ZM7 A;  5M4N A;  1BXD A;  1Y8P A;  1LNQ A;  3SPH A;  3G71 V;  5M4E A;  4CBC A;  1CEZ A;  3K98 A;  2Y48 A;  3GIG A;  4ASG A;  3QO5 A;  1WPX A;  3OEH G;  1UYL A;  3JD2 A;  3R4P A;  3W7W A;  2ZDI C;  3ZMV A;  1YSZ A;  4UXN A;  2CGF A;  4H81 A;  4O09 A;  3TZ5 A;  3ZMS A;  3Q5K A;  2JKI A;  4MOT A;  5B3S B;  1JQ0 A;  1A4H A;  4KSG A;  1CP9 A;  4KTN A;  4V25 A;  5F3K A;  4MSW C;  4XDK A;  2WLM A;  2DW4 A;  2P6J A;  4CWS A;  3CCM V;  2XX5 A;  5IYB O;  4XBF A;  4CWF A;  4BIU A;  5DM6 V;  3A0Z A;  4NH7 A;  2H8M A;  4BAY A;  4WCE V;  2FYP A;  4FCR A;  3SPC A;  3T1C A;  1MG1 A;  2BOB C;  1NKD A;  3FYI B;  2WI6 A;  1OSF A;  4PA7 A;  3VHC A;  2CCU A;  4HZ5 A;  1DLB A;  5J6A A;  2OCC B;  4WFF A;  3ZRW A;  1GTO A;  4R6Z A;  3O2F A;  4XKK A;  4XIQ A;  1MU5 A;  4L8Z A;  1KD1 W;  1OCC C;  3OR6 C;  3TCU A;  5EC2 C;  3DGE A;  1ORQ C;  4G2K A;  4F4L A;  3SL2 A;  1GO3 F;  4GT8 A;  3JD0 A;  3ZRV A;  1YJW V;  2E0A A;  3ZIA G;  2XJJ A;  4HYM A;  4PU9 A;  1E1R G;  2YKC A;  2YGE A;  2BYH A;  5CPH A;  3R65 A;  2A9H A;  3ZN0 A;  2UXX A;  1OCO C;  4QNH B;  4LWE A;  5L3C A;  3T0H A;  4CE2 A;  1EBO A;  4UVA A;  3T2M A;  2YE2 A;  1NQT A;  3A0R A;  2JEX A;  5CBG A;  4EFU A;  2WLL A;  2YEV A;  3RBZ A;  5CN0 A;  3A0Y A;  2DYR C;  2WI4 A;  2YEC A;  3CGY A;  4H37 A;  1QVF U;  2BOC C;  3IED A;  2R9R B;  1L0O A;  1OCC B;  1KC8 W;  2BU2 A;  3CYO A;  2AHY A;  1QYE A;  4RO2 A;  3SJQ C;  3GWO A;  1H8H G;  1HWY A;  2WLI A;  2XAG A;  3M99 B;  4KFM A;  2HKJ A;  3HHU A;  5E1A C;  4MPC A;  2FWY A;  1RPO A;  3CCL V;  2JIZ G;  2EBO A;  5J9P C;  2XDK A;  3C11 A;  4ZVI A;  1EFR G;  2X7R B;  3WFV A;  3QNE A;  2QEX V;  1YC3 A;  5HFL A;  2BSM A;  1NH2 D;  4LCU C;  4P2Z A;  1K9M W;  2XK2 A;  5J71 A;  5M4K A;  2YJW A;  5M4H A;  1AR1 B;  1PL0 A;  2QG0 A;  3FKS G;  4UVC A;  3MHH C;  1V55 C;  1ZW9 A;  4X88 A;  2ESA A;  5IN9 A;  1E1Q G;  3E83 A;  3SPI A;  2H55 A;  3B77 A;  2ZDX A;  3BM9 A;  4EGH A;  1YES A;  1PNM A;  3OFN G;  1BKN A;  2HVJ C;  2HVK C;  1Q7Y W;  4I5S A;  3ZN1 A;  1VQ9 V;  3JCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...