The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
74
|
sequence length |
342
|
structure length |
326
|
Chain Sequence |
YGYAVSVRVGGKEHRHWERYDIDSDFLIPADSFDFVIGRPDLSGESCEVVIDGQIVMTGIIGSQRHGKSKGSRELSLSGRDLAGFLVDCSAPQLNVKGMTVLDAAKKLAAPWPQIKAVVLKAENNPALGKIDIEPGETVWQALTHIANSVGLHPWLEPDGTLVVGGADYSSPPVATLCWSRTDSRCNIERMDIEWDTDNRFSEVTFLAQSHGHDLKWVYKDPTMTLHRPKTVVVSDNLAALQKQAKKQLADWRLEGFTLTITVGGHKTRDGVLWQPGLRVHVIDDEHGIDAVFFLMGRRFMLSRMDGTQTELRLKEDGIWTPDAYP
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Structural genomics, unknown function
|
molecule keywords |
Tail protein, 43 kDa
|
publication title |
The crystal structure of the tail protein from Neisseria meningitidis MC58.
rcsb |
source organism |
Neisseria meningitidis mc58
|
total genus |
74
|
structure length |
326
|
sequence length |
342
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2008-05-09 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Roll | Phage tail proteins - horseshoe like beta roll fold | Baseplate protein-like domain - beta roll fold | ||
Alpha Beta | 2-Layer Sandwich | Phage tail proteins - 2 layer sandwich fold | Baseplate protein-like domains - 2 layer sandwich fold | ||
Alpha Beta | 3-Layer(bab) Sandwich | Phage tail protein beta-alpha-beta fold | Baseplate protein-like domains |
#chains in the Genus database with same CATH superfamily 3CDD A; 1WRU A; 4MTK A; 2P5Z X; 3D37 A; 4UHV A; #chains in the Genus database with same CATH topology 2A02 A; 4JTM A; 2WZP R; 2O5P A; 4G08 A; 4UHV A; 4M0H A; 3CDD A; 2IAH A; 1WRU A; 1WTH D; 4M0N A; 1K28 D; 3ADY A; 2L4W A; 4MTK A; 2M5J A; 2W16 A; 1ZZV A; 3GS9 A; 2W6U A; 2W75 A; 3EZJ A; 2D1U A; 3D37 A; 2W77 A; 2W78 A; 4AR0 A; 2W76 A; 3GR5 A; 2W6T A; 2P5Z X; 3OV5 A; 2Z6B D; 2X53 1; #chains in the Genus database with same CATH homology 3CDD A; 1WRU A; 4MTK A; 2P5Z X; 3D37 A; 4UHV A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...