3D38L

Crystal structure of new trigonal form of photosynthetic reaction center from blastochloris viridis. crystals grown in microfluidics by detergent capture.
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
273
structure length
273
Chain Sequence
ALLSFERKYRVRGGTLIGGDLFDFWVGPYFVGFFGVSAIFFIFLGVSLIGYAASQGPTWDPFAISINPPDLKYGLGAAPLLEGGFWQAITVCALGAFISWMLREVEISRKLGIGWHVPLAFCVPIFMFCVLQVFRPLLLGSWGHAFPYGILSHLDWVNNFGYQYLNWHYNPGHMSSVSFLFVNAMALGLHGGLILSVANPGDGDKVKTAEHENQYFRDVVGYSIGALSIHRLGLFLASNIFLTGAFGTIASGPFWTRGWPEWWGWWLDIPFWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Simple host-guest chemistry to modulate the process of concentration and crystallization of membrane proteins by detergent capture in a microfluidic device.
pubmed doi rcsb
molecule keywords Photosynthetic reaction center cytochrome c subunit
molecule tags Photosynthesis
total genus 102
structure length 273
sequence length 273
ec nomenclature
pdb deposition date 2008-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00124 Photo_RC Photosynthetic reaction centre protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.85.10 Mainly Alpha Up-down Bundle Photosynthetic Reaction Center, subunit M; domain 1 Photosystem II protein D1-like 3d38L01
1.20.85.10 Mainly Alpha Up-down Bundle Photosynthetic Reaction Center, subunit M; domain 1 Photosystem II protein D1-like 3d38L02
3DTSM 2BNPB 2WJML 3G7FM 2UXLM 6PRCL 1MPSM 1RZZM 1RGNL 2HG3M 4HBHL 1AIJL 1E6DL 2J8DM 2HHKL 4IN6M 1F6NM 2JBLM 3PRCM 1L9JM 3V3YM 2UWSM 2UX3M 2UXKL 4TQQL 1JH0M 1QOVM 1FNQL 1JGZL 1K6LM 1M3XM 3T6DM 3T6EM 4H99M 1RY5M 2UXJM 1KBYM 2UWTL 2I5NL 2UX4M 3DTRM 1YF6L 2UX5L 3G7FL 1AIGM 1RVJL 2UXLL 1MPSL 2BNSA 2HG3L 2WX5L 3ZUMM 2J8DL 1K6NM 2J8CM 3DU3M 1JGWL 1L9JL 1DS8M 1PCRM 2UWSL 3PRCL 1PSTL 2UX3L 3V3YL 3V3ZM 4CASB 2GMRM 5LSEM 2UWVM 2UWUL 1K6LL 3T6DL 4H9LM 4H99L 1RY5L 3DU2M 2UXJL 4CASC 1KBYL 5PRCM 5LRIL 1YSTL 1JGYM 3ZUWM 2HG9M 1PRCM 3ZUML 2J8CL 4LWYM 3DSYM 3DU3L 4N7LL 1PCRL 1DS8L 3DTAM 1E14M 1FNPM 2GMRL 2UWVL 2HJ6M 3DTSL 3D38M 4RCRM 3DU2L 5PRCL 1RZZL 1JGYL 2HITM 4IN6L 3ZUWL 2UWWM 2HG9L 1F6NL 1DXRM 1PSSM 2JBLL 2GNUM 2RCRM 4N7KM 1JH0L 1QOVL 4LWYL 3DSYL 1M3XL 2JJ0M 3DTAL 1E14L 1FNPL 3T6EL 1S00M 2UX4L 2UXMM 3DTRL 2BNPA 2HJ6L 1RG5M 1AIGL 1UMXM 5LRIM 1OGVM 2X5UM 3WMMM 2HITL 1EYSM 6PRCM 1K6NL 2UWWL 1PSSL 1AIJM 2GNUL 1VRNM 2HHKM 2RCRL 3V3ZL 4N7KL 3I4DM 4IN5M 1JGXM 5LSEL 3DUQM 2HH1M 2JJ0L 1L9BM 2JIYM 4H9LL 2PRCM 4HBJM 1S00L 2UXML 2UX5M 2I5NM 1UMXL 1YF6M 1OGVL 2X5UL 1PRCL 3WMML 1RVJM 1EYSL 1DV6M 1RQKM 2WX5M 1DV3M 1RZHM 1VRNL 3I4DL 1JGWM 1JGXL 4IN5L 2X5VM 1R2CM 1PSTM 3DUQL 2HH1L 1L9BL 2JIYL 2WJNM 3D38L 4RCRL 4IN7M 2PRCL 2UWUM 4HBJL 7PRCM 2BOZM 2WJMM 4HBHM 1YSTM 1RGNM 2BNSB 1DXRL 1E6DM 1DV6L 1RQKL 1DV3L 1RZHL 2UXKM 4TQQM 1FNQM 1JGZM 4N7LM 2X5VL 1R2CL 2WJNL 2UWTM 1RG5L 7PRCL 4IN7L 2BOZL
chains in the Genus database with same CATH superfamily
3DTSM 2BNPB 2WJML 3G7FM 2UXLM 6PRCL 1MPSM 1RZZM 1RGNL 2HG3M 4HBHL 1AIJL 1E6DL 2J8DM 2HHKL 4IN6M 1F6NM 2JBLM 3PRCM 1L9JM 3V3YM 2UWSM 2UX3M 2UXKL 4TQQL 1JH0M 3WRXC 1QOVM 1FNQL 1JGZL 1K6LM 1M3XM 3T6DM 3T6EM 4H99M 1RY5M 2UXJM 1KBYM 2UWTL 3WRYC 2I5NL 2UX4M 3DTRM 1YF6L 2UX5L 3G7FL 1AIGM 1RVJL 2UXLL 1MPSL 2BNSA 2HG3L 2WX5L 3ZUMM 2J8DL 1K6NM 2J8CM 3DU3M 1JGWL 1L9JL 1DS8M 1PCRM 2UWSL 3PRCL 1PSTL 2UX3L 3V3YL 3V3ZM 4CASB 2GMRM 5LSEM 2UWVM 2UWUL 1K6LL 3T6DL 4H9LM 4H99L 1RY5L 3DU2M 2UXJL 4CASC 1KBYL 5PRCM 5LRIL 1YSTL 1JGYM 3ZUWM 2HG9M 1PRCM 3ZUML 2J8CL 4LWYM 3DSYM 3DU3L 4N7LL 1PCRL 1DS8L 3DTAM 1E14M 1FNPM 2GMRL 2UWVL 2HJ6M 3DTSL 3D38M 4RCRM 3DU2L 5PRCL 1RZZL 1JGYL 2HITM 4IN6L 3ZUWL 2UWWM 2HG9L 1F6NL 1DXRM 1PSSM 2JBLL 2GNUM 2RCRM 4N7KM 1JH0L 1QOVL 4LWYL 3DSYL 1M3XL 2JJ0M 3DTAL 1E14L 1FNPL 3T6EL 1S00M 2UX4L 2UXMM 3DTRL 2BNPA 2HJ6L 1RG5M 1AIGL 1UMXM 5LRIM 1OGVM 2X5UM 3WMMM 2HITL 1EYSM 6PRCM 1K6NL 2UWWL 1PSSL 1AIJM 2GNUL 1VRNM 2HHKM 2RCRL 3V3ZL 4N7KL 3I4DM 4IN5M 1JGXM 5LSEL 3DUQM 2HH1M 2JJ0L 1L9BM 2JIYM 3VKWA 4H9LL 2PRCM 4HBJM 1S00L 2UXML 2UX5M 2I5NM 1UMXL 1YF6M 1OGVL 2X5UL 1PRCL 3WMML 1RVJM 1EYSL 1DV6M 1RQKM 2WX5M 1DV3M 1RZHM 1VRNL 3I4DL 1JGWM 1JGXL 4IN5L 2X5VM 1R2CM 1PSTM 3DUQL 2HH1L 1L9BL 2JIYL 2WJNM 3D38L 4RCRL 4IN7M 2PRCL 2UWUM 4HBJL 7PRCM 2BOZM 2WJMM 4HBHM 1YSTM 1RGNM 2BNSB 1DXRL 1E6DM 1DV6L 1RQKL 1DV3L 1RZHL 2UXKM 4TQQM 1FNQM 1JGZM 4N7LM 2X5VL 1R2CL 2WJNL 2UWTM 1RG5L 7PRCL 4IN7L 2BOZL
chains in the Genus database with same CATH topology
3DTSM 2BNPB 2WJML 3G7FM 2UXLM 6PRCL 1MPSM 1RZZM 1RGNL 2HG3M 4HBHL 1AIJL 1E6DL 2J8DM 2HHKL 4IN6M 1F6NM 2JBLM 3PRCM 1L9JM 3V3YM 2UWSM 2UX3M 2UXKL 4TQQL 1JH0M 1QOVM 1FNQL 1JGZL 1K6LM 1M3XM 3T6DM 3T6EM 4H99M 1RY5M 2UXJM 1KBYM 2UWTL 2I5NL 2UX4M 3DTRM 1YF6L 2UX5L 3G7FL 1AIGM 1RVJL 2UXLL 1MPSL 2BNSA 2HG3L 2WX5L 3ZUMM 2J8DL 1K6NM 2J8CM 3DU3M 1JGWL 1L9JL 1DS8M 1PCRM 2UWSL 3PRCL 1PSTL 2UX3L 3V3YL 3V3ZM 4CASB 2GMRM 5LSEM 2UWVM 2UWUL 1K6LL 3T6DL 4H9LM 4H99L 1RY5L 3DU2M 2UXJL 4CASC 1KBYL 5PRCM 5LRIL 1YSTL 1JGYM 3ZUWM 2HG9M 1PRCM 3ZUML 2J8CL 4LWYM 3DSYM 3DU3L 4N7LL 1PCRL 1DS8L 3DTAM 1E14M 1FNPM 2GMRL 2UWVL 2HJ6M 3DTSL 3D38M 4RCRM 3DU2L 5PRCL 1RZZL 1JGYL 2HITM 4IN6L 3ZUWL 2UWWM 2HG9L 1F6NL 1DXRM 1PSSM 2JBLL 2GNUM 2RCRM 4N7KM 1JH0L 1QOVL 4LWYL 3DSYL 1M3XL 2JJ0M 3DTAL 1E14L 1FNPL 3T6EL 1S00M 2UX4L 2UXMM 3DTRL 2BNPA 2HJ6L 1RG5M 1AIGL 1UMXM 5LRIM 1OGVM 2X5UM 3WMMM 2HITL 1EYSM 6PRCM 1K6NL 2UWWL 1PSSL 1AIJM 2GNUL 1VRNM 2HHKM 2RCRL 3V3ZL 4N7KL 3I4DM 4IN5M 1JGXM 5LSEL 3DUQM 2HH1M 2JJ0L 1L9BM 2JIYM 4H9LL 2PRCM 4HBJM 1S00L 2UXML 2UX5M 2I5NM 1UMXL 1YF6M 1OGVL 2X5UL 1PRCL 3WMML 1RVJM 1EYSL 1DV6M 1RQKM 2WX5M 1DV3M 1RZHM 1VRNL 3I4DL 1JGWM 1JGXL 4IN5L 2X5VM 1R2CM 1PSTM 3DUQL 2HH1L 1L9BL 2JIYL 2WJNM 3D38L 4RCRL 4IN7M 2PRCL 2UWUM 4HBJL 7PRCM 2BOZM 2WJMM 4HBHM 1YSTM 1RGNM 2BNSB 1DXRL 1E6DM 1DV6L 1RQKL 1DV3L 1RZHL 2UXKM 4TQQM 1FNQM 1JGZM 4N7LM 2X5VL 1R2CL 2WJNL 2UWTM 1RG5L 7PRCL 4IN7L 2BOZL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DTS M;  2BNP B;  2WJM L;  3G7F M;  2UXL M;  6PRC L;  1MPS M;  1RZZ M;  1RGN L;  2HG3 M;  4HBH L;  1AIJ L;  1E6D L;  2J8D M;  2HHK L;  4IN6 M;  1F6N M;  2JBL M;  3PRC M;  1L9J M;  3V3Y M;  2UWS M;  2UX3 M;  2UXK L;  4TQQ L;  1JH0 M;  1QOV M;  1FNQ L;  1JGZ L;  1K6L M;  1M3X M;  3T6D M;  3T6E M;  4H99 M;  1RY5 M;  2UXJ M;  1KBY M;  2UWT L;  2I5N L;  2UX4 M;  3DTR M;  1YF6 L;  2UX5 L;  3G7F L;  1AIG M;  1RVJ L;  2UXL L;  1MPS L;  2BNS A;  2HG3 L;  2WX5 L;  3ZUM M;  2J8D L;  1K6N M;  2J8C M;  3DU3 M;  1JGW L;  1L9J L;  1DS8 M;  1PCR M;  2UWS L;  3PRC L;  1PST L;  2UX3 L;  3V3Y L;  3V3Z M;  4CAS B;  2GMR M;  5LSE M;  2UWV M;  2UWU L;  1K6L L;  3T6D L;  4H9L M;  4H99 L;  1RY5 L;  3DU2 M;  2UXJ L;  4CAS C;  1KBY L;  5PRC M;  5LRI L;  1YST L;  1JGY M;  3ZUW M;  2HG9 M;  1PRC M;  3ZUM L;  2J8C L;  4LWY M;  3DSY M;  3DU3 L;  4N7L L;  1PCR L;  1DS8 L;  3DTA M;  1E14 M;  1FNP M;  2GMR L;  2UWV L;  2HJ6 M;  3DTS L;  3D38 M;  4RCR M;  3DU2 L;  5PRC L;  1RZZ L;  1JGY L;  2HIT M;  4IN6 L;  3ZUW L;  2UWW M;  2HG9 L;  1F6N L;  1DXR M;  1PSS M;  2JBL L;  2GNU M;  2RCR M;  4N7K M;  1JH0 L;  1QOV L;  4LWY L;  3DSY L;  1M3X L;  2JJ0 M;  3DTA L;  1E14 L;  1FNP L;  3T6E L;  1S00 M;  2UX4 L;  2UXM M;  3DTR L;  2BNP A;  2HJ6 L;  1RG5 M;  1AIG L;  1UMX M;  5LRI M;  1OGV M;  2X5U M;  3WMM M;  2HIT L;  1EYS M;  6PRC M;  1K6N L;  2UWW L;  1PSS L;  1AIJ M;  2GNU L;  1VRN M;  2HHK M;  2RCR L;  3V3Z L;  4N7K L;  3I4D M;  4IN5 M;  1JGX M;  5LSE L;  3DUQ M;  2HH1 M;  2JJ0 L;  1L9B M;  2JIY M;  4H9L L;  2PRC M;  4HBJ M;  1S00 L;  2UXM L;  2UX5 M;  2I5N M;  1UMX L;  1YF6 M;  1OGV L;  2X5U L;  1PRC L;  3WMM L;  1RVJ M;  1EYS L;  1DV6 M;  1RQK M;  2WX5 M;  1DV3 M;  1RZH M;  1VRN L;  3I4D L;  1JGW M;  1JGX L;  4IN5 L;  2X5V M;  1R2C M;  1PST M;  3DUQ L;  2HH1 L;  1L9B L;  2JIY L;  2WJN M;  3D38 L;  4RCR L;  4IN7 M;  2PRC L;  2UWU M;  4HBJ L;  7PRC M;  2BOZ M;  2WJM M;  4HBH M;  1YST M;  1RGN M;  2BNS B;  1DXR L;  1E6D M;  1DV6 L;  1RQK L;  1DV3 L;  1RZH L;  2UXK M;  4TQQ M;  1FNQ M;  1JGZ M;  4N7L M;  2X5V L;  1R2C L;  2WJN L;  2UWT M;  1RG5 L;  7PRC L;  4IN7 L;  2BOZ L; 
#chains in the Genus database with same CATH topology
 3DTS M;  2BNP B;  2WJM L;  3G7F M;  2UXL M;  6PRC L;  1MPS M;  1RZZ M;  1RGN L;  2HG3 M;  4HBH L;  1AIJ L;  1E6D L;  2J8D M;  2HHK L;  4IN6 M;  1F6N M;  2JBL M;  3PRC M;  1L9J M;  3V3Y M;  2UWS M;  2UX3 M;  2UXK L;  4TQQ L;  1JH0 M;  3WRX C;  1QOV M;  1FNQ L;  1JGZ L;  1K6L M;  1M3X M;  3T6D M;  3T6E M;  4H99 M;  1RY5 M;  2UXJ M;  1KBY M;  2UWT L;  3WRY C;  2I5N L;  2UX4 M;  3DTR M;  1YF6 L;  2UX5 L;  3G7F L;  1AIG M;  1RVJ L;  2UXL L;  1MPS L;  2BNS A;  2HG3 L;  2WX5 L;  3ZUM M;  2J8D L;  1K6N M;  2J8C M;  3DU3 M;  1JGW L;  1L9J L;  1DS8 M;  1PCR M;  2UWS L;  3PRC L;  1PST L;  2UX3 L;  3V3Y L;  3V3Z M;  4CAS B;  2GMR M;  5LSE M;  2UWV M;  2UWU L;  1K6L L;  3T6D L;  4H9L M;  4H99 L;  1RY5 L;  3DU2 M;  2UXJ L;  4CAS C;  1KBY L;  5PRC M;  5LRI L;  1YST L;  1JGY M;  3ZUW M;  2HG9 M;  1PRC M;  3ZUM L;  2J8C L;  4LWY M;  3DSY M;  3DU3 L;  4N7L L;  1PCR L;  1DS8 L;  3DTA M;  1E14 M;  1FNP M;  2GMR L;  2UWV L;  2HJ6 M;  3DTS L;  3D38 M;  4RCR M;  3DU2 L;  5PRC L;  1RZZ L;  1JGY L;  2HIT M;  4IN6 L;  3ZUW L;  2UWW M;  2HG9 L;  1F6N L;  1DXR M;  1PSS M;  2JBL L;  2GNU M;  2RCR M;  4N7K M;  1JH0 L;  1QOV L;  4LWY L;  3DSY L;  1M3X L;  2JJ0 M;  3DTA L;  1E14 L;  1FNP L;  3T6E L;  1S00 M;  2UX4 L;  2UXM M;  3DTR L;  2BNP A;  2HJ6 L;  1RG5 M;  1AIG L;  1UMX M;  5LRI M;  1OGV M;  2X5U M;  3WMM M;  2HIT L;  1EYS M;  6PRC M;  1K6N L;  2UWW L;  1PSS L;  1AIJ M;  2GNU L;  1VRN M;  2HHK M;  2RCR L;  3V3Z L;  4N7K L;  3I4D M;  4IN5 M;  1JGX M;  5LSE L;  3DUQ M;  2HH1 M;  2JJ0 L;  1L9B M;  2JIY M;  3VKW A;  4H9L L;  2PRC M;  4HBJ M;  1S00 L;  2UXM L;  2UX5 M;  2I5N M;  1UMX L;  1YF6 M;  1OGV L;  2X5U L;  1PRC L;  3WMM L;  1RVJ M;  1EYS L;  1DV6 M;  1RQK M;  2WX5 M;  1DV3 M;  1RZH M;  1VRN L;  3I4D L;  1JGW M;  1JGX L;  4IN5 L;  2X5V M;  1R2C M;  1PST M;  3DUQ L;  2HH1 L;  1L9B L;  2JIY L;  2WJN M;  3D38 L;  4RCR L;  4IN7 M;  2PRC L;  2UWU M;  4HBJ L;  7PRC M;  2BOZ M;  2WJM M;  4HBH M;  1YST M;  1RGN M;  2BNS B;  1DXR L;  1E6D M;  1DV6 L;  1RQK L;  1DV3 L;  1RZH L;  2UXK M;  4TQQ M;  1FNQ M;  1JGZ M;  4N7L M;  2X5V L;  1R2C L;  2WJN L;  2UWT M;  1RG5 L;  7PRC L;  4IN7 L;  2BOZ L; 
#chains in the Genus database with same CATH homology
 3DTS M;  2BNP B;  2WJM L;  3G7F M;  2UXL M;  6PRC L;  1MPS M;  1RZZ M;  1RGN L;  2HG3 M;  4HBH L;  1AIJ L;  1E6D L;  2J8D M;  2HHK L;  4IN6 M;  1F6N M;  2JBL M;  3PRC M;  1L9J M;  3V3Y M;  2UWS M;  2UX3 M;  2UXK L;  4TQQ L;  1JH0 M;  1QOV M;  1FNQ L;  1JGZ L;  1K6L M;  1M3X M;  3T6D M;  3T6E M;  4H99 M;  1RY5 M;  2UXJ M;  1KBY M;  2UWT L;  2I5N L;  2UX4 M;  3DTR M;  1YF6 L;  2UX5 L;  3G7F L;  1AIG M;  1RVJ L;  2UXL L;  1MPS L;  2BNS A;  2HG3 L;  2WX5 L;  3ZUM M;  2J8D L;  1K6N M;  2J8C M;  3DU3 M;  1JGW L;  1L9J L;  1DS8 M;  1PCR M;  2UWS L;  3PRC L;  1PST L;  2UX3 L;  3V3Y L;  3V3Z M;  4CAS B;  2GMR M;  5LSE M;  2UWV M;  2UWU L;  1K6L L;  3T6D L;  4H9L M;  4H99 L;  1RY5 L;  3DU2 M;  2UXJ L;  4CAS C;  1KBY L;  5PRC M;  5LRI L;  1YST L;  1JGY M;  3ZUW M;  2HG9 M;  1PRC M;  3ZUM L;  2J8C L;  4LWY M;  3DSY M;  3DU3 L;  4N7L L;  1PCR L;  1DS8 L;  3DTA M;  1E14 M;  1FNP M;  2GMR L;  2UWV L;  2HJ6 M;  3DTS L;  3D38 M;  4RCR M;  3DU2 L;  5PRC L;  1RZZ L;  1JGY L;  2HIT M;  4IN6 L;  3ZUW L;  2UWW M;  2HG9 L;  1F6N L;  1DXR M;  1PSS M;  2JBL L;  2GNU M;  2RCR M;  4N7K M;  1JH0 L;  1QOV L;  4LWY L;  3DSY L;  1M3X L;  2JJ0 M;  3DTA L;  1E14 L;  1FNP L;  3T6E L;  1S00 M;  2UX4 L;  2UXM M;  3DTR L;  2BNP A;  2HJ6 L;  1RG5 M;  1AIG L;  1UMX M;  5LRI M;  1OGV M;  2X5U M;  3WMM M;  2HIT L;  1EYS M;  6PRC M;  1K6N L;  2UWW L;  1PSS L;  1AIJ M;  2GNU L;  1VRN M;  2HHK M;  2RCR L;  3V3Z L;  4N7K L;  3I4D M;  4IN5 M;  1JGX M;  5LSE L;  3DUQ M;  2HH1 M;  2JJ0 L;  1L9B M;  2JIY M;  4H9L L;  2PRC M;  4HBJ M;  1S00 L;  2UXM L;  2UX5 M;  2I5N M;  1UMX L;  1YF6 M;  1OGV L;  2X5U L;  1PRC L;  3WMM L;  1RVJ M;  1EYS L;  1DV6 M;  1RQK M;  2WX5 M;  1DV3 M;  1RZH M;  1VRN L;  3I4D L;  1JGW M;  1JGX L;  4IN5 L;  2X5V M;  1R2C M;  1PST M;  3DUQ L;  2HH1 L;  1L9B L;  2JIY L;  2WJN M;  3D38 L;  4RCR L;  4IN7 M;  2PRC L;  2UWU M;  4HBJ L;  7PRC M;  2BOZ M;  2WJM M;  4HBH M;  1YST M;  1RGN M;  2BNS B;  1DXR L;  1E6D M;  1DV6 L;  1RQK L;  1DV3 L;  1RZH L;  2UXK M;  4TQQ M;  1FNQ M;  1JGZ M;  4N7L M;  2X5V L;  1R2C L;  2WJN L;  2UWT M;  1RG5 L;  7PRC L;  4IN7 L;  2BOZ L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...