3D3BJ

Structural and functional analysis of the e. coli nusb-s10 transcription antitermination complex.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
87
structure length
87
Chain Sequence
GPLGSMQNQRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRSRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analysis of the E. coli NusB-S10 transcription antitermination complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords N utilization substance protein B
total genus 19
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2008-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 3d3bJ00
1XMOJ 4DUYJ 4DV0J 2VQEJ 5LM7E 4X64J 4KYZA 3JAMU 2VQFJ 4DR6J 5BR8J 4NEYA 1HNZJ 4YY3J 4DR5J 4JI4J 3J80U 4GKJJ 4DV4J 3IMQJ 5AJ3J 4JI0J 4JI3J 4B3RJ 4JV5J 4LFBJ 3J81U 4JI6J 3W1YC 4DV7J 4HHUA 2KVQE 4JI5J 4DR4J 2UU9J 4KY3A 1N32J 4JI2J 1IBKJ 4X62J 5IT9U 4B3TJ 1HNXJ 1IBLJ 4LFAJ 1XNRJ 3D3BJ 2UUCJ 4X66J 5IWAJ 4OX9J 4DR7J 3T1HJ 1J5EJ 4JYAJ 4DV2J 2UUAJ 3T1YJ 3OTOJ 3R2CJ 5LMUJ 4DR3J 2UXDJ 1IBMJ 4JI1J 2E5LJ 4PWWA 1HR0J 4DV3J 4RJVA 2MQ8A 4JI8J 4NEZA 1XNQJ 5LMNJ 1XMQJ 4V1Ak 4LF6J 1FJGJ 1N34J 2UXBJ 4YHHJ 2HHHJ 4LF9J 4JI7J 5FLXU 4LF8J 2F4VJ 4DUZJ 1I94J 4NXNJ 3D3CJ 4B3SJ 4LF7J 1N33J 4GKKJ 4LF5J 5A2QU 4B3MJ 4DV6J 2MTLA 4DR1J 2UXCJ 3R2DJ 1N36J 4AQYJ 4X65J 2MEWA 4NXMJ 2KL8A 1HNWJ 3J7AN 2UUBJ 4K0KJ 4DV5J 4DR2J 2ZM6J 4KHPJ 4DV1J 4LFCJ 4LF4J
chains in the Genus database with same CATH superfamily
4X4OA 3M7VA 4JI1F 1N48A 1JX4A 4I6YA 1YGYA 3BQ2A 2BMBA 1S57A 4NASA 5LM7E 5LT5A 4UOFA 2E9ZA 2Y0SD 1F9HA 1WKJA 3PYGA 4HHHA 1RISA 2VQFJ 5K14A 2IY5B 1K8AT 2CJQA 2XS5A 5E2QA 4X4VA 3PW4A 1RYRA 2WW4A 1V3ZA 3C19A 3K17A 3KNGA 3MM7B 1RUSA 2DGUA 2GMHA 5F41A 4P2XA 3TAMB 1M5HA 1O8BA 1IKWA 3ZO7A 3TAQA 2YXLA 3FSXA 4HDHA 5KFPA 1VQ9S 4QWDA 1S4EA 1XNQF 1SC3B 1TP7A 2L9WA 2BZ2A 4ED8A 1HIYA 1FDNA 4MTPA 2CA9A 3DLKA 4DR1F 1NLKL 5D3GA 1OQ3A 7FDRA 3OUYB 4K4VA 4Q0BA 2HMIA 3AOCA 1FNOA 2G2OA 2W2QP 5CH7B 1S59A 2CQGA 2J8AA 2V50A 4WU2A 2QT7A 1HI1A 3DXBA 5CHCB 4F3MA 4J9NA 3RTVA 4ED1A 1SL0A 1CC8A 2V2VA 4W4MA 5F9NA 2IVYA 3C16A 2DNRA 1SV5B 5B0BA 2KYXA 4EBCA 2OPQA 2QSWA 3SQGA 1EQMA 1URRA 2AYMA 2GC8A 4LF2A 2XZDB 5F0WA 5LSOA 2FVCA 2ZHBA 5JMNA 1KQSR 3UDCA 5IM0A 2UUTA 5D0GA 3G6VA 4DR7J 1RQ0A 4X66F 3DRRB 4I4BA 4KAIA 5L38A 4DR6J 2HVHA 4ZVGA 4Y3CA 1D8YA 3H40A 5I3UA 3KWMA 4D3HA 1TL7A 1VRTB 2W4CA 3Q8UA 1RT1B 1VMBA 2EXUA 3FGVA 2COLA 3NBPB 3H20A 5LJ5Y 3OFEA 1FO1A 5DDQC 4IFVB 5HMWA 1VQLS 1TUGB 3U27A 4ZPVR 3Q8YA 3CJRA 1Y3JA 3BPSP 4OX6A 2OPQB 1HD1A 4C7QA 2OPPB 4DN0A 2C2MB 2O67A 2KRRA 1FVQA 2UUBF 4NLGA 3FZ2A 5A8RB 4MKAA 5HVGA 1WTBA 2KFNA 4DR6F 1K44A 1SPBP 2QLBB 3NNAA 3AODA 4OI1A 2ZOFA 4ID5A 1SKSA 4NZ0A 4ED0A 3EICA 2DR5A 4LF8F 1SJ3P 4TU9A 5KFQA 4O44A 4JI7J 4UZBA 1X5SA 2M5YA 1RSCA 3R5JB 2BV3A 3WHIA 2FJWA 2AZ3A 2R4FA 3JAMY 4I2QB 1MN7A 3PW0A 3TW0A 2AD9A 2R8GA 1FDAA 1VQ6S 2JWNA 3SCJE 3IBCB 2DR9A 2QTWA 1TFWA 2IM0A 1BUXA 2GJ2A 4KHRA 3C6TA 4YHHF 2DPJA 2XZTB 2IM3A 3EXYA 4DCOB 3PR5B 2HZCA 3ITHB 4C11B 3PW5A 1ZTWA 3M30A 3HHLC 4KGZB 5KFAA 3MF5A 4YFUA 1CS4A 3MFHA 4DL3A 2FLLA 2EFOA 4RW7B 2RB7A 2M0GB 4Q2LA 2Z0GA 1YJUA 2UUCF 5KFCA 1RWVB 1X4FA 2D3ZA 4ATNA 3NGRA 3ZTQA 2JLGA 4YQWA 3LWLA 2YX7A 3ET6A 1NK9A 2RD5C 4OZLA 5EX3A 4ZPAA 1HMVA 2C2OB 4WK3A 1JIHA 3WBZA 1HNWJ 1B0TA 3DU5A 3G82B 1UFLA 3V6DA 1OS5A 2BVZA 1FWKA 2F8HA 2GHVC 3CDUA 2HRUA 3ZTOA 7AT1B 4QU7A 3OL7A 2C2EA 3UPFA 2V4JA 3DOLA 1B70B 2CDQA 3AA8A 4A48A 5GAHU 4E0DA 1UVJA 3WX4A 1YRTA 2H3EB 3HF5A 1H2TZ 2XSFA 4TVAB 2IYGA 4ZCKA 3HT3A 4R0JA 3OR2A 2G1HA 1YKWA 2B4PA 3OJUA 2MZTA 1U0HB 2RF2A 1NZAA 1T05B 4RU2A 3SIPB 2HZVA 1RHMB 4RNFA 1WC1A 2C3PA 3U1MA 2N4DA 3HCXA 3HPOA 4CTAA 4LFBJ 2QG9B 2YNFA 1FTCA 4GKKF 2XY7A 5DM7Q 2PD1A 2ZOGA 4MK9A 5JJBA 3SFUA 2MXYA 1ZM3A 1QVGR 1WEZA 2QLWA 3JSYA 4RUCA 3QZ7A 2ZH6A 2X1AA 2VBXA 4JI5J 1VS3A 5GAGI 3CJ4A 2KT5A 2Y1RI 3AA9A 3R5AA 2DJWA 4LRCA 3AOAA 5C25B 4Q7AA 4D3GA 1S10A 1Q8KA 1RWWB 3D1HA 4NI2A 5A2QY 1RTDA 4FBTA 2GQQA 4M5LA 1S1WA 4XK8C 1TV6A 1XNRJ 1WKKA 1UWBB 3EJMA 2Z58B 3GMGA 4PYDA 2VFTA 2DB1A 2CG4A 1SIZA 4JV0A 2XEXA 5J1PA 1MG7A 2EKNA 2Z2MA 3MM8A 1SUQB 3JSRA 2P6TA 2C3MA 4CO2A 1TKDA 4J9OA 3GZ7A 2DH9A 3EGVA 4FZVA 2AEJA 1XC9A 1Y4ZB 4TYAA 4NE9C 3KTQA 2V2KA 3OTOJ 3TJAA 2HYIB 3K5MA 3IRXB 3EYZA 1RWOB 5L1LA 5EDWA 3BS9A 4KFBB 2EWHA 2PN6A 2X51A 3I5BA 1RTHA 1S48A 2AX0A 3FFIB 3VQTA 1S1TB 2NXUA 4O0NA 1GTHA 1R3NA 1JXEA 1ULRA 2KT2A 1VI7A 3DLJA 3KXDA 2LLZA 2I2YA 2A6MA 3IS9B 1JJHA 2WRMA 5AT1B 4UY8T 3HJFA 3FQLA 4QOTA 2PMWA 4HEA9 1XMQJ 1NB7A 4LBHA 2N3LA 1XR5A 3VAJA 2K8GA 2CRLA 1WOPA 2LQBA 2YPZA 3KK3B 1N34J 1T7PA 4JI5F 2YTCA 1NAQA 1JXVA 3DDIA 2QRRA 5HL7Q 2ZBCA 4BC9A 5FLXU 2V9WA 1FK9A 2QMXA 1YJRA 1N36F 1OY8A 4F26A 3HP6A 5J1NA 5JVGQ 2HFVA 1GTEA 4MKVA 3VAIA 1YJ9S 1K9MT 2RT3A 2MKCA 3POTA 4NLXA 2HWHA 5KFHA 3I32A 2P8IA 1N32F 2DHAA 2DO0A 2LP4A 2PSZA 3MMAB 4DQSA 4URSA 1RYSA 3KOAA 1K1QA 2F40A 2A2CA 3CIZA 3FBFA 3UN5A 5IFMA 4FYYB 5L1JA 2UXCJ 5A76A 4QWBA 2W9BB 5CYQB 4K2JA 4PWDA 4PG6A 4JOUA 3DOKB 2ZJRQ 1H6KX 4WXOA 3HDSA 2IDLA 2QLXA 3BDPA 1RTJA 4RLEA 4DX5A 1KLMB 2CQHA 3F44A 1B0PA 1QAYA 2AIRB 2ZH8A 4C8LA 1JMTA 2ZH1A 2K3IA 1CC7A 1ACMB 2G13A 2HFUA 4P73A 2R7RA 5JXSA 1WC6A 2MJUA 2V8DA 2DGXA 3PHTA 3MM7A 3RBXA 1DBDA 5CCMA 2R2TA 3MM9B 4DV6F 1VRQC 2RHQB 3PM9A 5H9EK 1Q79A 2MPUA 5L46A 2Q43A 1MU2A 2AP6A 2QMWA 5KFMA 1TKXA 2BKNA 1CLFA 4O4GA 3CCWA 3KLHA 3SSQA 1EP4A 1UEVA 3CCJS 2OPSB 1QE1A 2V34A 4KH0B 5DGAA 2QMUB 2JEIA 1TL5A 1KN6A 5B0FA 1LXNA 3O1LA 2J7WA 2JLEA 3IAM9 4A4JA 2DEIA 4DF4A 1LEOA 3D7SB 3AAWB 4H4KC 1SL1A 1CULB 1Q8BA 3BM7A 1UP1A 2HQCA 2MZ1A 3VQSA 4RX6A 4P75A 4USJC 2OMOA 4NLSA 4X62F 2YKQA 3CJTA 4KGXB 4E2FB 5A8KA 5IS2A 4F8RA 2LEAA 1WORA 1FE4A 1RT4B 2EFNA 4GRSA 4KKOB 4KO0A 2CJAA 4NA3A 3W1YC 2DXFA 1X31C 3DRPB 4QW8A 2RU3A 1KD1T 4WF9Q 1XWLA 1S9GA 4PXCA 1KQFB 3R1HA 3E51A 3CULA 4UT4A 1VBYA 5LL6d 2N4CA 1SCJB 3RYLA 3H4BA 3M2VA 4C9DA 4FP9A 3M32A 4ZCMA 1N5QA 4U67Q 2XQCA 1BQXA 1CQMA 2BACA 4I2PB 2JRSA 4ZVRB 1X8DA 3G4SS 4M95A 4KTQA 3W2WB 3DN9A 5F8LA 4ECSA 5BYSA 4ELUA 3EPIA 3RRGA 3LGHA 3HD1A 1PAUB 2HNYA 3TP2A 5MAOA 2XMAA 1FFSB 1U8SA 1NJXA 1U6ZA 1ROFA 2V4QA 1TK0A 4ZVQB 4OJGA 1VQPS 3C14B 3L3CA 3BO3A 3GIJA 4DV2J 1K47A 3SEOA 3R5DA 1L3VA 4NA1A 3WIUA 2G4BA 4RUBA 1KOHA 1Y5LB 3M2RB 3SCLE 4DFPA 1URNA 2NXCA 3PNIA 4DDFA 5LMUJ 3A3NB 1FJ7A 2NSCA 2HVDA 2L9DA 3MECA 4L6V3 2YKOA 5DGBA 1UWBA 3NS5A 3BH6B 4ZLPA 3QRRA 5IT9Y 3V6KA 2DO4A 4UUWA 2L08A 2XHCA 1KR4A 3PYEA 4DCPB 1NK8A 1ITPA 1TK5A 2DNZA 1TUWA 5DLFA 3MM6B 3CC7S 4ZP7A 5AXMA 2MQ8A 4C8ZA 2RMLA 2XI3A 4OZ3A 4USVA 5HQ8A 3OD2A 4LF7F 3G96A 5IV3A 4LQ9A 3KK1A 1QAIA 4OYBA 1C4AA 2DHXA 2HHPA 1NK4A 5RUBA 1CVJA 2H54B 1R7IA 1RAFB 2LQ8A 1XERA 5J2QB 1KLMA 2XNQA 1D0EA 1HARA 5GAEI 2P9GA 2CFXA 1CJVA 1C0UB 3PCOB 1F5BA 3W2VB 5DQHA 4OHYA 1C1BA 1HQEB 2K7JA 1QM9A 2DXEA 3I96A 4ZCLA 2VFVA 5KFGA 4Y0FA 5U47A 4AD6A 3Q83A 3D0HE 1FXDA 1FJEB 1U02A 4IOAQ 1H38A 1IKYB 3AY0A 5CQGA 2MZSA 4XO0A 1GMWA 1RHJB 1TL4A 4NCGA 2ZEJA 3DRYA 1RT5B 2AEFA 2KJWA 3MXHP 3TR5A 3K5OA 4X4PA 2YNIA 1VQ8S 3VF0B 4X65J 4HL9A 3H2LA 4PRFA 4KT0C 4ED2A 1C0UA 5KFTA 2OLWA 2JEJA 1VRUA 1ZPVA 4N8OA 3F0NA 4A47A 2V8VA 2X1GA 2IRYA 3PEHA 3VZIA 4KC5A 3PKYA 1X7VA 3KK3A 4IH5A 1FFGB 4OV1A 3EMTA 4DV5J 1RT4A 2WSCC 4U6PA 1WG1A 4Q8FA 4USMA 5AE2A 5DG8A 2HHUA 2DGVA 1S6OA 1SV5A 4RR5A 1QLNA 3NNCA 1R6YA 4DX8H 2UXDF 1CPZA 4KRWA 3EXCX 5GAGU 4RO0A 1IBMF 1NCLA 2AQ4A 2W24A 2N7YA 3FMBA 3M2VB 5FDLA 3J81Y 2MZJA 2ZH2A 2ROEA 2J6SA 3OTDA 3BN4A 3NGTA 1S1WB 4X84A 4OV6A 1VQ7S 5B0CA 2KHCA 1M5SA 1LWEB 2RQ4A 3C15A 3AHPA 2L41A 1MN9A 3CD7A 1NDPA 3MD1A 2AJFE 1HWUA 3A4TA 2OP5A 3MMBB 2V2ZA 3D67A 2BJEA 3HSGA 5ETLA 5HLFA 1T3NA 2OTJS 3N6LA 2CAJA 2YKAA 2Z2ZA 2HPUA 5AXKA 1UVMA 4XAKA 5EGYA 3BYRA 1IQTA 2HSEB 4DUZF 2WVBA 2XHWA 1UW4A 3H90A 2GA7A 4FXWA 4LSNB 1RWPB 1Y0HA 3IC1A 2QA2A 5GVQA 4DG1B 1V5IB 2ZE2B 4F67A 2ZHAA 1K73T 3LUYA 1RWXB 2HHQA 2PDAA 3Q8RB 2KM8B 1R0CB 2E44A 4EZ6A 3OHAA 4BCAA 4F3OA 1BHNA 1F5AA 3TX0A 1IKVA 4ITSA 3GPAA 3PX4A 4N41A 1WD6A 4ZITA 3CMES 2P9CA 3ISNC 3WC0A 3MR5A 1VHIA 1YBTA 1YVFA 5LMUF 3NNHA 3R1LA 1T94A 2CWXA 2OPRA 3NCRA 2OH2A 1T95A 3CJKB 1W25A 3MCOA 3CNQP 4NX9A 3Q8SB 3CPWR 4DV5F 3BR9A 3QLHB 3NS6A 5IQ6A 3TZYA 1N34F 4CH1A 1KKHA 4C8OA 3TUZC 2XG8A 2VC1A 3IXQA 3ENVA 3UN2A 3K8VA 3MGJA 1R8BA 1T9YA 2B3TB 4K4SA 2IBKA 1LKZA 2CZ4A 2FHJD 2B4UA 4P2FA 2Y3YA 4CH7A 1C1CA 2IJFA 1U1NA 1B99A 4LF4F 1L3SA 2CPFA 4QYZJ 4WZMA 4L72B 4NZ6A 1LFPA 2FGOA 4PWWA 1X9MA 1S1UA 2MLXA 2RU9A 3N28A 3OXFA 3G8TA 4XPEA 1OPIA 3HHDA 1IKXB 1LW2B 2B7CB 3KDNA 4RW8A 4J9RA 2IYIA 1AZSB 3AD9C 2V0NA 3BN7A 1SC4B 3HI9A 2VQFF 2UVRA 4I67A 4V1Ak 1K0TA 2FLPA 4LR9A 3FFIA 5KG1A 1VIOA 2FDNA 3KG0A 4U95A 2LDIA 4KR0B 1WEXA 2RRBA 2MHNA 2M8HA 3KLIA 1N5SA 4NLRA 3J7ZT 3CMAS 4LRAA 1NHUA 1S9EA 2B6AB 4PPDA 4PAAA 5J2PB 5KT3A 3FSYA 3V4IB 2F4VJ 2A2DA 2W9AA 3ET6B 2DGTA 4F4XA 1SH3A 4R5PB 1IM6A 1Y5NB 2W2OP 3GJSB 5KFLA 2BKOA 1CJTB 4FYXB 4LRFA 2YY3A 3ADAC 3FRYA 4NWBA 5KG2A 3UD4P 1X9SA 2GVDA 5F0UA 4ECZA 1BQMB 1RT2B 1TKXB 1XIQA 4OHZA 4QIWD 4I69A 3MZIA 2VB6A 5LSLA 3HJVA 3KKFA 3SDEB 4B9SA 2W2PP 1FRXA 2PI4A 1AYEA 1NH8A 2HQGA 4DX7A 3OQ2A 4N47A 4GVBB 4AL7A 4DSKA 5DG7A 1QD1A 5HROA 2V69A 3WQPA 3N79A 3GR1A 4ED4A 1Q1KA 1GX5A 1GMWD 1GXUA 3RUBL 3LAKA 3NG8A 1A6LA 1WKLA 4WFYA 3ZZRA 1N0VC 1NDCA 2XULA 3H7HB 3CCES 3K0JA 1NB2A 4NLVA 3DRRA 4OI6A 5HQMA 2ASDA 1BMQB 3AQPA 3DLBA 2DR6A 3IA0A 1ZPWX 1AFIA 3MR3A 5J2NA 2DGQA 4A8MP 2RH3A 3TI0A 3BDEA 2QYCA 4X64J 2LA4A 1TKZA 1FEHA 1U1KA 3G87A 2HQDA 2QX0A 2XMUA 3ISND 3T9ZA 4I2PA 2C2KB 4USWA 3LPEA 3P6YC 1I5OB 1MWZA 2R2UA 3NGKA 2UXBF 4UOGA 1S6QA 1EARA 3NWGA 3IRXA 1NKEA 5KFZA 1X4GA 3J81U 2YNIB 3B82A 1XQIA 4RWWA 3MOZA 5LSRA 2V94A 1EIYB 3OLBA 2GO9A 1YJTA 3N5FA 4TY9A 2HRYA 5KFIA 4HYKA 1G4CA 3CJ5A 2CJYB 5DRKA 3H2UB 4I56A 4OX9F 1ZZNA 2B9YA 4J9LA 4B3OB 1ZOTA 4ZIVA 2HK2A 2YNHB 3HO1A 1D8ZA 5C42B 4OZJA 4G65A 4M1KA 4TY8A 2CJ9A 1IVZA 2IJNA 3KJVA 3FEXB 3AH6A 1N5VA 1F3FA 2BYCA 2FD2A 1N0UA 4NLPA 1U1PA 2HAFA 5IOLA 4CRJA 3GCWP 4YDXA 2AYBA 2Q6CA 1JLAA 2AW0A 5D4OA 3RBEA 2UUCJ 4DR7F 2EW9A 5IT4A 1RTIB 3Q8PB 2FUG9 4WFBQ 3L4BC 1UA1A 4MH8A 4QWCA 3TAPA 2GIRA 3TJ9A 1Y7PA 4B9VA 5HN0A 5CA5A 1RT7A 4YUDA 1C1BB 4F0KA 5FD1A 5K8PA 4CO5A 3JYTA 3CCQS 1T02A 4FS2A 2B4OA 4J91A 3GJQB 3W5XA 2VV5A 4ETXA 3SXLA 1IKVB 1LW0B 3C3LA 1DFDA 2YNGB 2CJBA 2DBBA 1VQ5S 4PQAA 3QAUA 2VG5A 3DU6A 5EN1A 3FBEA 3KYLA 4X4SA 1N56A 4G1QA 4PABA 2AKWB 5C25A 1EKRA 2PMHA 3BPDA 2VQEF 3FC9A 4K4WA 3H0PA 4DV1F 4O0IA 4DS5A 1RT2A 3S01A 1Q8IA 2QEXS 2KG0A 2RS2A 4PEOA 1EHWA 3R2DJ 1PYSB 3UCUP 1SJRA 5D6GA 1H72C 4LF6J 4MJKA 3O44A 1GAOA 1UKUA 1X0FA 3D6MB 2OHDA 4ZVFA 3R27A 4CLFA 3CCUS 2CKWA 2QLJB 2Q6BA 3HHLA 4LF8J 1RWKB 1TVRB 2RVJA 2ZNZA 1U0HA 3M9NB 3GSDA 1ICEB 1YQHA 3W66A 2VD3A 4LSZB 4WKRA 1EAYC 1KTQA 4L75A 1DJ0A 1WF2A 1TU0B 4DZDA 4IDKB 2ALYB 2GMJA 1OSDA 3R6GB 3VGSA 4CLKA 3M4XA 3H25A 2JEGA 1FKPA 2LU1A 1XJWB 2ATLA 1NUEA 4DV6J 2BOAA 3M8SA 3C46A 2K2PA 1RAJA 3EGWB 1RT3B 4OYPA 4PXDA 2ZJPQ 4B3MF 4K4ZA 1R8HA 2B7BB 3MEDB 4LIRA 5CYMB 3UVJB 4E98A 5DQGA 5F8GA 1SJFA 4CIOA 2E5JA 5KFBA 3M1VB 5HP1A 2BABA 2DXDA 3GG1A 1G7CB 3ZZTA 2UVUA 1F6TA 2EG1A 3M8WA 5B08A 3MPVA 1UEUA 2ROPA 3D0GE 1R8AA 4RW6A 5KG7A 2PA8D 2RDDA 4YB1P 1FRIA 1OIAA 2B8PA 2DNPA 2KO1A 5CD4A 2VFSA 1DHMA 3M30B 5KG4A 1FT8A 2YH1A 4DV1J 3S1TA 1CS4B 2B43A 4DV4F 4JV2A 3DMJA 1HWLA 2HNZB 2ZUGA 1HBMA 1WACA 4LT6A 1HHQA 3HKWA 2HLTA 1UVIA 2JSXA 4OYOA 4QZVB 3DYAA 1FD8A 4HACA 2KFYA 3A8KA 3NY0A 3SV4A 3FDSA 4WKYA 2B0GA 5BR8J 4LREA 1Q82T 4JI4J 4NXNF 3FNNA 4AXIA 3A13A 4RZRA 4F4YA 1GQEA 2YKNA 4XDDA 1TMMA 2FJAB 1SC1B 4A8SA 1RTJB 2EFQA 1KQKA 2CQDA 3V6HA 2NZ4A 2W2NP 1X5OA 2LQJA 3BKTA 1FRKA 3CDWA 4OI4A 3V5RA 2FGCA 4PCQA 5HVHA 3UCZP 4EFAC 4CNYA 1Q7YT 2DR7A 1KBRA 3EVMA 2NXNA 1AA1B 4H4KA 4DL5A 3H98A 1YI2S 3GFHA 3DLEA 2PEBA 2ADCA 1E6VA 4DR5F 3JQMA 1KRPA 3BQ1A 3RR8A 1N32J 4AL5A 2R7WA 2KHDA 2XLJA 4LF5F 2GIFA 3RR7A 1PJ5A 2Q66A 4LBIA 3U7JA 2DR8A 4Y28C 1YRUA 1KDNA 2R7OA 4QQBA 4YS2A 4N56A 3VAMA 4KHMA 1IBLJ 1WHXA 3OFGA 4IRKA 1NK5A 1SQEA 5C24A 1Y11A 5J2PA 2YKMA 3LP0B 3PACA 3JTPA 4WYLA 4N5SA 2UU9F 5H9FK 2IIHA 4EU0A 1U7LA 2VA2A 4ERDA 1ZBTA 2YX1A 3M2UA 4ER8A 3DCAA 1SQFA 2DNNA 3CJ3A 2RDIA 3LGMA 8ATCB 4ZVEA 1HKAA 3SQOP 4Q44A 2MB0B 4MYTA 1NK7A 1WHYA 3FQKA 3IGNA 4JP8A 1HNZF 3DHWC 1S1VB 3U1LA 3HVTA 2ZJQQ 1S0MA 3GE9A 4RNNA 2VOPA 3NWRA 5KFRA 3OL6A 4P9SA 2HVIA 2WONB 4YDDB 1XTZA 2OO4A 4NOHA 4F2RA 1ZAWA 1V5VA 3OUYA 1BC6A 2VG6A 3KG4A 3K8WA 4ZK7M 1RCOB 2FHOB 3Q86A 1X4EA 1AXQA 1QUPA 3QBCA 4C6AA 3VGVA 5B0GA 4DEZA 3DLLQ 4NEZA 3TA0A 3QJPA 2GHPA 1EP4B 1UW9A 4KV8B 4GKJF 4HLBA 2YPYA 1LWCA 4L74A 3GJTB 1M1HA 3FSIA 4A8KA 3GQCA 1JQGA 2AYEA 1EETB 1DURA 2P9EA 2CUYA 3DXSX 1CULA 3GWCA 4UW2A 1WNEA 3DRSA 1YSJA 1MMNA 4WFNQ 2Y1JA 2ZHOA 1DTTB 4O44B 4YEAA 3TEHB 4DL0C 1VBXA 3PW7A 1U09A 3M8QA 2CPDA 4I0WA 3BGFA 3LANA 5ITHA 5KFUA 5DG9A 5D77A 3HM9A 3BSAA 3HFKA 2MY7A 4HR2A 2ZVSA 2XC9A 2ZM6F 3GYGA 3VALA 2XCAA 3AFGA 4RL1A 4U9RA 2G0JA 2RUGA 2OSRA 3R3TA 5BXIA 2MEWA 4ECVA 2JHEA 4IG0A 2CVEA 2JH3A 2V5HG 3FZBA 4PUOB 3HZGA 3MPYA 2HWIA 2MQLA 3TX8A 1O0PA 2ILZA 2O5DA 2GGPB 4Q43A 3HXMA 1VQ4S 3H5UA 3IFEA 4CLTA 2WBRA 2NQPA 2H51B 2YNFB 1WELA 3C14A 3LTOA 5IXUA 1RCXB 2KU7A 1TL3B 4YB5A 3CDEA 5A6WA 1NJWA 1FI4A 2P6SA 4WTYA 3J81j 4O3OA 1S0VA 3SQGB 4A8FA 2LVWA 2M8DB 4NYPA 1UMJA 4DJBA 5B0EA 3BGRB 2CQ0A 1RACB 1IKYA 3DNCA 4BWMA 3D9BA 3FBBA 4KGKA 3BREA 1CJKB 3RRKA 4USUA 5KFFA 2CIMA 3G86A 3QATA 5T7LA 3PRBA 3DHXA 3UFCX 3OSNA 4DR5J 4PQUA 4X4NA 3UCGA 4M8LA 2CG8A 4WCEQ 3BSOA 3R6LB 2M2BA 4F4WA 2PT0A 4M5HA 3WDOA 1VC5A 1Z2LA 1IBLF 3I0RB 5I3QA 4P6QA 4IQMA 4KBIA 1NKCA 2Y0BB 2E1AA 2V8HA 3NMRA 2OMLA 1KNZA 2DEJA 4DZ6A 1RA7A 2BX6A 2EI5A 1KP6A 2HGLA 3DC2A 4DF8A 1IXKA 1FX4A 3GYNA 4UUXA 3ZXWA 4B3TJ 2MLZA 4KFBA 4OZ2A 1B7FA 4LFAJ 4LF1A 2GO8A 2WBMA 2BA9A 3ICLA 1UVNA 2I0XA 3I82A 4M5JA 4NI2B 1AW0A 4X66J 4Z2XA 3V6JA 4DFKA 1JLQB 1I1GA 3ZNUA 2ROGA 4ED3A 3TWZA 1OY9A 4E8UA 1TKTA 4WE1A 4JUZA 1SH2A 2IC3B 3CIMA 1KHWA 5BYQA 1U8WA 2HS0A 3W8PA 2OELA 2WVEA 4NLWA 4IOBA 4DV2F 2CQ2A 1WDDA 1IBCB 5CZXA 3BO4A 4KPCA 3AJ2A 1DAXA 1NSKL 4RNOA 2YWKA 3N6MA 4ZOSA 4A8OA 2CPHA 2BANA 2VG7B 1YJWS 1JJCB 4HHJA 2LQ9A 4NA2A 1TR0A 4NZ7A 4Q5VA 1T9XA 4MK7A 1FNMA 4Z7CA 3Q22A 2CVIA 3QPIA 4UOCA 1S97A 1N4LA 1Y5IB 2DGWA 4WU3A 9RUBA 2H9ZA 5K8MA 3OHBA 2BXJA 4MIBA 1QTNB 3BQ0A 1QJHA 1J5OB 4WFXA 4M5DA 4NRUA 1FNXH 3H5SA 2W7PA 2J7KA 1XNQJ 2CQ1A 2ACMA 3IP0A 4MMOA 5KG5A 5KT4A 4DQIA 4KSEB 1LQ9A 3PO5A 1GH8A 2EBEA 2FB0A 2LQ5A 2VPXB 2F8EX 2C3YA 4JV5F 2GAHC 4OLOA 4F0MA 1OYEA 2VG7A 3CCTA 2XGPA 2M9KA 5IZHA 3Q2SC 2NPFA 1F2GA 1IUJA 1FA0A 2E5IA 5T41A 1QAXA 3G6YA 1G1XA 3EDRB 3MHYA 2MKIA 1LK7A 2XI2A 3OJSA 3VTIA 1YK9A 1HPZA 3HSZA 4MKYA 3CD5A 1CSJA 2DT9A 2HS4A 3ZTSA 2WB1D 1SVDA 2FVSA 4ZVOB 3MR6A 1S7HA 3W8GA 3OT9A 1RLDA 4KV8A 4TLRA 1LV5A 3D2WA 4B9UA 1EKSA 2JC0A 3DLKB 1R8CA 4LUBA 3VVUA 3IR7B 2L9NA 3WIVA 4FYVB 4LRBA 4ZA1A 5J1EB 1S1TA 3W7BA 1S72S 1HI0P 1O51A 1GFWB 2B9EA 4LF7J 5GMDA 4LMZA 1HNWF 3DLHA 1FDBA 2DTJA 2LA6A 2HRTA 1TUVA 4DI6A 4PQUB 2MDAA 2WZ1A 2HK3A 2FY1A 3IGVA 2E9TA 3CCZA 3D0IE 3J7Z5 3A3OB 4TQSA 4DR2J 2MZRA 3OV7A 1REGX 2KI2A 3RB3A 5KOWA 3UD5A 2DPIA 4QCLA 3LQVA 3I56S 4KPYA 3BV8A 4J9QA 3BGOP 1YBUA 1RXOB 4H4OB 4USHA 2QC3A 2RHSB 3G6ES 1NEEA 3KLFA 3CCVS 2FZKB 4AT1B 2GVDB 2B5JB 2JC1A 2VPWB 3MMAA 4DQRA 1HQUB 3HVAA 5D4PA 4F02A 2DITA 3JAMU 3TVYA 2VA3A 4B3RF 2OKQA 4C4WA 4QR1A 5KFNA 4FF4A 4LFCF 1FXRA 1B0VA 1VK3A 3IMQJ 3VR1A 2Y8WA 3MD3A 3OTCA 1TL7B 1NPKA 1VRTA 1S99A 1VDHA 3TO8A 4JI8F 2HZAA 3HD2A 4UQGA 4AFFA 2R7XA 3TNVA 1LWXA 2RRNA 2XMVA 5MLCV 2MKJA 3MFIA 2L3MA 4QR2A 1LNQA 2P5VA 1U25A 4HTIA 2HQ3A 2AJ2A 1AROP 2PC6A 2QO3A 3T41A 1AUSL 4QPTA 2XWYA 4CP5A 3EE3A 4C48A 4J9KA 1PSDA 4X62J 2ZWOA 3FCVA 1U49A 2BRKA 3CO0P 2HFOA 4DL2A 4EBEA 1OJ4A 2VOOA 1PBUA 1V6HA 1X0PA 2AX1A 1NSQA 2D9PA 5H9FJ 1VC0A 5K20B 2YWFA 4J9MA 2G1DA 2YQ3A 5EX0A 4TNOA 1JLEA 4FNHA 1FJCA 4DWIA 1LK5A 1LWCB 4GC6A 4DLEA 1Q8LA 2E5HA 2I6WA 1YTYA 1HW9A 1RAHB 4YB7A 3TAMA 3W62A 3GV8B 2MKHA 3M9MB 4HTJA 5LXYA 2RQKA 2IAJA 3BZQA 2VKZG 4J7CA 3MURP 4K4UA 1WEYA 4P52A 5BYRA 3TQEA 2HHHF 4TQRA 1NK6A 3Q2TC 2WOMB 1KVIA 2D1CA 4UY85 1UCNA 4FKXA 1R31A 5CYMA 4JBCA 3OW2R 2DNGA 4ZP6A 4QWAA 1U6BA 1N5TA 4DV3J 1SKUB 4LFBF 1DLOB 2BQ3A 4Y65A 2POKA 3K59A 2R9LA 4ZLNA 1FKPB 1YRXA 2E7WA 4ANDA 1OY6A 2W2MP 3OL8A 3HHEA 3UDVA 5L39A 1M90T 4OL8A 2ZH7A 5IT0A 1H73A 3IRWP 3PFOA 3CCLS 1ZTTA 4ILRA 1VC6A 3L95X 2HFZA 4RNMA 2LKZA 3CCSS 3R7SB 1PC5A 2EFVA 1LWFB 1KFSA 2QIFA 2AJQA 3MEKA 4L73A 3P49B 2H5IB 2F5GA 2X3DA 3RB4A 1GK8A 1YG0A 2MKSA 2OPPA 2FJEB 2QN6B 3BGRA 3LGNA 3VHQA 1TQLA 3N01A 1WC4A 3W2WA 2NPIA 1TK8A 3HVWA 2DHHA 2UP1A 3AD7C 3X1LB 2AU0A 3A8EA 3MMCB 2HHXA 2HLUA 3VVTA 3TA2A 2X1FA 3TVZA 3CCRS 3W65A 2JLFA 2X7IA 2JFKA 3LP1A 3VV2B 5CYJA 2G9OA 3CTRA 4WK1A 1HR0J 5DDRC 2UUAF 2GX8A 1H0HB 4JB8B 4CTAB 2BJ9A 3QGPA 5G4DA 2KT3A 2C2ZB 3V6DB 1KQGB 1LFWA 3KDOA 3QZ8A 1L3KA 2FZGB 1F0XA 2BBEA 2RE1A 3P96A 3DRXA 4AQYF 2GQCA 3AB2B 5A0YB 1Q16B 1R27B 2XLIA 3P5TL 3THTA 2B8QA 2VPZB 5M2PA 1FRHA 3PG9A 2GNKA 1RBAA 1SJQA 1TL1B 4QIFA 2LECA 3B6BA 2MY8A 2GFFA 4BWJA 4HT5A 3ZTRA 4DV3F 3W9HA 4LF4J 1GMVA 5IM0B 4X64F 1F9FA 3AOBA 3MAAB 3J7YU 4CT8A 3RG6A 3RZAA 1RI7A 1DTTA 4X4RA 3H5YA 2J6UA 4BBYA 3C6TB 5ETPA 5L9NA 5A6PA 2MKYA 2AJ1A 3LW5C 2LEPA 4KYZA 1YJVA 3PY8A 4U7UD 2VUGA 4ICLA 2XMJA 4NEYA 3OFHA 4C8MA 5HQLA 3J80U 2N3OA 3CC2S 2HBRB 5I42B 2FJBB 2OUGA 2FJDB 1SKWA 5HI7A 3G9CA 4WE1B 3VWSA 1HQ2A 3W63A 2CNOB 1YDLA 1QVFR 1C0TB 1JNZB 5KFVA 4ZLJA 5K8NA 3OXGA 3M2UB 3CCMS 2UXCF 2UU9J 1FVSA 3LA0A 3DM2B 4OX7A 3TUJC 1LXJA 4OZ5A 5A8WB 4Y2CA 4O3QA 2BM0A 2M88A 4JI2J 5B0AA 3EWGA 2NR0A 1S77D 2HW3A 4ZDNA 4AUKA 3MAQA 3K7RA 1JLGA 1R43A 1I51B 2LCWA 4U8YA 2FHMA 1SQGA 2AJ4A 1QSSA 1PC4A 4LIWA 3DLGA 2OEKA 4HH0A 1U2CA 1J5EF 4JYAF 3DGPB 2DGSA 1RHRB 2HBZB 1IR2A 4I7FA 4W98A 1SB6A 2B56A 2OEMA 1EQ0A 2K06A 1JWWA 3HFZB 3SZ2A 2GMLA 1U2RA 4NMLA 3RB6A 2XNRA 1KOOA 4FXDA 4ZVUB 3PZPA 3RAMA 5J2MA 1L3TA 1G3OA 4LVNP 2BJ7A 1TKTB 1WSRA 2BUNA 3PTWA 5I3PA 2HHSA 4OMFG 1S6PA 1TTHB 4RUAA 3JTNA 5D78A 5I4MA 5F8MA 1HBNA 3US5A 2ASLA 1YZ6A 2KRBA 3KK2B 1WOSA 2R3VA 1CBKA 4M5IA 1Y00A 3VGTA 4NL5A 6AT1B 4LQ3A 1E6VB 3D6HB 2M4MA 3V2UC 3MCMA 1M5VC 5ETOA 3MI7X 4LBPA 4CLUA 1CQNA 1HL6A 2XS2A 1FEEA 1GT8A 3FBCA 2VF3A 3MMCA 1A0OB 4P72A 1BXNA 3OTOF 2R8IA 5LMNJ 1ZH5A 1FRJA 1NXIA 3CT9A 2W9CB 3Q0AA 2OFGX 3DDNA 2ABYA 3UR3C 1NHVA 1GX6A 4DS4A 1YJNS 3MM9A 2BDPA 2GCFA 3T6BA 3X3UA 4DR4F 4LF9J 4TU7A 1A9NB 1LW0A 4TXSA 4WWSA 3MUVP 2ZDOA 1F9EB 1WC3A 4IQXA 2KXFA 4L76A 2VDIA 4QBUA 1I94J 2KJVA 4JV5J 2VU5A 3KK1B 4N76A 4BLGA 5F9LA 3LOUA 5E5NA 2NLWA 1NK0A 2FQQB 2H5EA 2H1YA 4RUHA 1Y10A 3G71S 3R5GA 5D0RA 5FDLB 3OSPA 3B78A 1S0OA 4GKKJ 1AUDA 1Q95G 3CF5Q 4C0BA 1M0SA 4U7UK 4C3KA 5GADU 4L3NA 4FF2A 4X4TA 1HFEL 1UJ6A 2RAQA 3DMJB 3NCQA 3HULA 2HBYB 3QNWB 3LP2B 2FYXA 3P3DA 1KTVA 3D66A 3QGGA 2V63A 5EHHA 3E2EA 2MQNA 5ADZA 4OHXA 4WBFA 3NRBA 4EUVA 1T03A 1H2UX 2JL9A 3V81B 3TANA 1VK8A 4FVCA 2RJZA 3LALA 3QMQA 4G1PA 3NCPA 1CJKA 5C24B 1S7IA 2VBWA 1VQMS 1KC8T 1OMSA 1B3TA 2R7TA 2I5JA 4U8VA 3GIRA 4ZVSB 3MUTP 2FJXA 3TYTA 1AZSA 1UL3A 4ZCIA 3EZUA 3NKYA 4ZLLA 2K7KA 4FKYA 4NLQA 4NLTA 2RKIB 2ADBA 2BQRA 2IM2A 3A3PB 4YP3A 2VQEJ 5E41A 3ENQA 3JQKA 4IOCQ 1PYOB 2ZBIA 2DH8A 3DI6A 3MTKA 1S1VA 1S12A 2A10A 4C3MA 4CZCA 5KFEA 2OEJA 2BJDA 1UPMB 3GIMA 3G2XA 4IFYB 2MHEA 4TU8A 4CDIA 3UO0A 4LRDA 2Y1IA 1HNZJ 1Q81T 1XR6A 2AHOB 1FJGF 2Y8YA 4B3RJ 1HD0A 4DV7F 1HYSB 1E6YB 4FYWB 3EGNA 4OZ0A 1VHFA 4LSLB 3NLCA 4C98A 1B7YB 2HHWA 3SBMA 2KVQE 3OVSA 2V2QA 4ZP9A 4WFAQ 1JLFB 4DSIA 2Q1LA 2EKYA 2NYIA 4RW7A 1REVB 3V4MA 2YVSA 2KG1A 5HLFB 4K7QA 2J9CA 3FCWA 3D68A 3CUNA 2ZH5A 1HWKA 3CJSA 2VG5B 1WC5A 2W25A 4PWUA 4C3LA 2VIHA 1PGZA 5ETKA 4ANEA 3ZFVA 2N82B 2E7VA 2JVOA 2WONA 1VYAA 2HMIB 4NMXA 3PO4A 2FPHX 3I87A 2B9WA 2D9OA 4C2MA 2DRDA 4OX9J 2NZCA 4ZIWA 2RS8A 2PI5A 1P6TA 5IWAF 1IWAA 4KE5A 1HBOA 3VAHA 5D4NA 4GO5X 1ZZFA 2XWXA 4ZPWR 3MPUB 3O5TB 3BBCA 3KHLA 4G6VB 2IJRA 3UDLA 3QAEA 1HNXF 2EC2A 3T1YJ 4P7TA 3R9LA 2GJFA 1C4CA 4YMEA 5CAAA 1IQZA 3H42A 3D5MA 4K4TA 3ULHA 3NS7B 4EZ9A 2PGCA 4OJ1A 2B9XA 3BKUA 5DLGA 3N6NA 4WXWA 4DPYA 4LF9F 1IBMJ 4OYXA 2KTQA 2K3KA 2VONA 4QW9A 1APSA 3KLGA 1EZZB 2XBPA 3FEYB 3AXMA 3H2VE 4KH1B 2GAGC 3KUGA 2AJ0A 2QA1A 2OAUA 3ZZZA 1F1BB 4AYBD 3VZHA 5LOQA 2CQPA 1RWUA 2XYHB 2ACYA 1P27B 4O3SA 3D6TB 4DU7A 2OGUA 4HVZA 4YHHJ 3HX9A 1N5YA 1NPPA 2QGFB 2ZBQA 1UPPA 3G82A 4OJ3A 4U96A 3UWTA 5KTQA 4NRTA 1QSLA 2J6TA 4ILMA 3CJKA 2MKKA 4FNIA 4ENOA 5HP1B 2IC3A 2J76E 2YWEA 4DUZJ 4IG0B 4YY3F 3DFEA 4PUOA 3AXKA 2CNKB 2XM3A 3CJ0A 5KOXA 3PW2A 2J0QD 2PE8A 4RPFA 3S8SA 3WC2A 1YX2A 4DSFA 2YX4A 2E1RA 3IS9A 1N54B 4ZVTB 3Q23A 3T5JA 3RAXA 2BANB 4PYAA 2F1FA 1CG2A 4O4GB 4DR1J 2AGOA 2YQ1A 2BOPA 1HBMB 4PG7A 2W01A 2CPIA 2QA4S 3W64A 5G0RA 2FVQA 2E9RX 3NOGA 3UDEA 5L9XA 4ZPTR 3A1YG 2MGZA 2YKPA 5HJXA 1C0TA 3KUHA 2BJ8A 2C1EB 4HH1A 2JDJA 5D0HA 3AJ1A 3PDNA 2NUHA 5FJ4A 2YNGA 2R2RA 2C3UA 4DMZA 3Q8QB 1S0NA 3M6VA 2BE2B 1RA6A 4Y2MA 4USIA 5EWEA 3IG1A 1JJ4A 3CC4S 2HEKA 4ED5A 1VBZA 3M1VA 2MMYA 4OYMA 2IPOB 1C2PA 3ETOA 1PCAA 1HWJA 1X5TA 1Z1ZA 3ZNJ1 5IC6B 3U02A 1Y3KA 3VAGA 2A0FB 3HHLD 3E8OA 4CI0B 2GZOA 4LFCJ 5D8HB 2QA4G 4FBUA 4P71A 4ZJOA 1RKIA 1CJUB 1RTZA 1R0BG 3SYZA 2G0CA 2ZVIA 3BO2A 3D54A 1RTDB 1I3OB 4BS2A 2C2NA 2CWKA 2D69A 3KJVB 4PG5A 3OR1A 3D28A 2WK4A 1MROA 3TA1A 4IO1A 4YY3J 4IUFA 1J27A 1VRUB 1WHVA 2GGPA 3CJ2A 4DQPA 4I64A 4IR9A 2KZZA 5CZVA 2O66A 3QSIA 4QIEA 4ETZA 3MEDA 2C2DA 1P1TA 1PBAA 3HSJA 2G2ZA 2AGPA 4JI6J 3GSIA 1BQNA 2H4YB 5KG6A 4MKBA 4ES2A 3N9UC 1NKBA 4K4YA 1X60A 5AE3A 3EZ5A 3K5NA 1V9OA 1HNIB 4WIIA 3IBWA 4DR4J 1HNVB 3EVWA 3CDAA 2KN4A 4ALZA 2YWHA 2XO7A 6FDRA 2OPRB 3NGUA 4LVOP 4M5MA 2GJIA 4DSLA 4YOEA 4EYIB 3QT8A 1U2FA 5F8HA 1JNRB 3GFYA 4G1QB 3F56A 4O3PA 3T1AA 3GTYX 1WI6A 2EBGA 3R8YA 2C22A 3QJJA 1LWFA 2CQBA 3ILLA 3O6QA 1RT6B 3HKZD 1RHKB 5M2RA 3CVKA 3T1HJ 2J5AA 1R0AB 4OIXA 1J5EJ 4JYAJ 5E7OB 2AMCB 1S4FA 4USKA 4B9TA 2YKMB 3LP0A 1DTQB 4QYRA 2OSQA 2CNLB 3K57A 1TFYA 1XMQF 1IM4A 2CPXA 3HHLB 4LR8A 3B4DA 4GO7X 4MFBA 2V4RA 2PO4A 2KFZA 1UEKA 4DHVA 2GVZB 1R8PA 2ZE2A 5HJYA 5M2UA 1K1SA 4CLZA 4NLDA 3EVOA 4TY8B 2C3OA 4Q0BB 4IKAA 5D0EA 3HVTB 4MIAA 1VQYA 5GMEA 1JB0C 2B6AA 2GW8A 1ZS6A 3M6UA 1D09B 3V4IA 3I9ZA 3BBFA 3TEGA 2AYGA 2VJUA 1YWXA 2HGMA 2JEFA 3E01A 5DM6Q 2HAIA 5DS7A 3KFWX 2LXFA 3GLJA 1CJTA 1RTIA 2E1MC 4G3IA 5C5JA 4IH6A 3MECB 3HLUA 3K89A 4EI2A 5AXLA 3KHHA 3FMWA 1X5PA 1LWEA 1UWAA 2XLKA 2BR0A 1RAGB 2BM1A 3IAS9 1ZA2B 4J9VA 1UA0A 2VKRA 2CJXB 2CQCA 2D74B 1RJJA 2KDOA 3D4JA 5IC4B 1ZETA 1N33J 3HHKA 5H9EJ 4FF3A 3MM6A 3I5CA 2K1RA 1HHSA 3PYFA 5EWFA 1N6QB 3T5HA 4B3MJ 4GC7A 1Q86T 4LFAF 5CABA 3KK2A 2MSSA 3I31A 3N5BA 4YR3A 1S1UB 1WDTA 2WHOA 3DOMB 4R0EA 8AT1B 1N36J 1F2HA 2F63A 3BEGB 4I1TA 3IWNC 2ZH3A 1UJ5A 3R5BA 3T3FA 1S1XA 5T7LB 2AWZA 4ECWA 1DQ9A 4FN5A 1FKAF 1VQKS 1HA1A 3I6PA 4QR0A 2HBQB 3RW7A 2YBVA 3JXOA 1B4SA 1FKOB 4DBQA 1T8EA 2E5LF 2XYGB 2V8PA 4IO9Q 4DSJA 4K0KJ 2DYAA 4FDFA 2ZM6J 2AZ1A 2XMMA 1QSYA 2LFVA 3MEGA 2GHWA 2V8GA 2ASYA 4R25A 3S7RA 3W5ZA 1NRKA 2ZC3A 2LEBA 2R8KA 3NP5A 4UQTA 3SDEA 4DUYJ 1R6VA 4DG1A 4DV0J 4F7VA 2FY8A 5KFYA 2XY5A 1U24A 3R7BB 1WUUA 3M8QB 2VJVA 2GV1A 3PJ9A 3BF4A 3P45B 1S9FA 2MSTA 3GU0A 1PYTA 1N8RT 2JVRA 3ISZA 1OO0B 3DKDA 9ATCB 4DPOA 4LR7A 1X4DA 2EEYA 2AV5A 1UTAA 2Z8QA 3MM5A 4OQJA 1TAUA 3QO9B 4GVBA 4K5SA 4FPIA 4PXEA 5F8NA 1ELOA 4OYWA 1TELA 4P10A 1XBWA 5F8IA 1NO8A 2R2SA 1IJEB 2F7VA 5CXTA 4H4MB 4J9UE 1S76D 5L8RC 2UV8G 1MMLA 1D9DA 4KIAA 3QIPA 3F73A 2M70A 2F9DA 4J5OA 5DDOC 3FVYA 4DL4A 3PJWA 3FRZA 2ATCB 2XMKA 1YITS 1BLUA 4YR2A 4ZJLA 2HG4A 5FLXY 2DISA 3NGDA 3KLHB 4B9NA 1SC6A 2E29A 3ENAA 2DNLA 1OYDA 4CO1A 3JYTB 4IRCA 4OHVA 4ZHRB 1KEKA 4EBDA 4F3QA 3MCSA 1Z2ZA 2QFIA 1BWEA 1VCTA 3AB4B 4RW4B 2ZWPA 1TVRA 3BYPA 4KHPF 1WG4A 1MW7A 1HNIA 4PR6A 3R7NB 3SCKE 4CCHA 2DIVA 4CNZA 5LXRA 3QGIA 1DZ5A 4WPAA 5IQQA 2O1PA 4QJVA 2HNYB 4CWBA 2MQOA 2OIHA 3KG1A 4O3RA 5E3AA 1VR6A 1IR0A 1S9EB 2F9JA 3OXLA 4AE5A 4M5GA 3K58A 3W5YA 2U1AA 4M63A 1BWVA 3ZZYA 2NXEA 2WVDA 4C8KA 4WZQA 1HQEA 1VIXA 2CPYA 3KLVA 2XCPA 3R5CA 4OYZA 4MK8A 2EG2A 5DDPC 2RDJA 2ZKUA 1FFWB 2VPYB 1T05A 2QZ8A 2V4JB 4CLLA 2J0SD 4OJHA 4NCGB 4EWTA 3AT1B 4ZN1A 3D1QA 4K59A 3EDQB 2XSJA 5L1IA 3SV3A 2I1RA 4DSEA 4BC7A 1SUQA 2DNMA 2ZH4A 3IM8A 3J80Y 4FVMA 2F4FA 3ENWA 5HO4A 3BGLA 4GMKA 5HROB 3V81A 1YIJS 3D3CJ 4CYUA 3GP9A 3IBFB 1OPZA 3TOQA 3LAMA 4B3SJ 5KFWA 4V19X 2QFJA 1QE1B 4TKTA 1G6BA 2A3JA 3CW2C 4OZ1A 1UJ4A 4HACB 5E0OA 5GADI 3HT0A 2D3OR 2FVPA 4LF5J 3IWLA 3FKBA 3WZ0A 1YJ7A 2DIUA 3FUYA 4ID8A 4H4OA 3CJ8A 2XY6A 4PG8A 1XMBA 2RSQA 2YNHA 4K0KF 2J9DA 3ONQA 1Q5YA 4ILLA 2R7UA 1VQNS 3FK4A 4WTOB 1WTFA 4LSLA 1T0TV 1H7WA 4ZS6A 4AQYJ 2W8LA 1AB8A 1MSWD 1QAJA 2CZ9A 3I9V9 3WX8A 4CYUB 4IH7A 4ED7A 2PMZD 4FS1A 2WCXA 3QFHA 2B51A 2VHGA 2ZZMA 3J7A1 2EK6A 1SXLA 1KWMA 3CSKA 1WHWA 3ILJA 3IR6B 1Q4RA 1P1LA 2IRUA 1X4AA 2VFUA 1BY9A 1EETA 1RDRA 2WAQD 4IYQA 3UNYA 1U1RA 4P74A 4CQ1A 4B08A 5KFKA 4RU9A 1WOOA 4YB6A 4PKDB 2O3DA 2Z57B 3FEZA 2DVIA 3UE2A 4CT9A 5H1SV 1VOMA 1XEZA 3CGIA 2L48A 4OYAA 2MQMA 2RF2B 4WP9A 3JSBA 1YHQS 4B3OA 4J90A 1FRLA 2F8MA 3M05A 2XS7A 4ZPBA 2GIQA 3S6EA 3VCDA 3NAHA 2FZCB 1RAEB 2UUWA 4KKOA 1DQAA 3KLEB 2OI2A 2CZVC 1RTHB 2HVZA 4RW9A 2UV8A 2BJ3A 1DTQA 1PJ6A 4DV4J 1D3WA 3THVA 1PAEX 3K5LA 3UVJA 1RAOA 2D7SA 2DHSA 3KJFB 3W60A 2KH9A 1U45A 2HGNA 1RT6A 2QV6A 2V9KA 4DPUA 2XGQA 3M9OB 2JNJA 2IA0A 2CQ4A 2VBZA 5K5MA 4Q2MA 3HK2A 4HHUA 4CO0A 4W92B 2IMOA 4OI3A 2JJ4D 8RUCA 5J2NB 3KLGB 1QDUB 2C28A 2G2YA 5HK4A 5HSPA 5HMYA 4B3TF 4HT7A 1L5UA 1I6JA 4L3KA 1IBKJ 4ECTA 4ZVPB 3KLEA 2E1PA 1QTMA 1KSPA 4JI3F 2DRBA 2RILA 1W2BR 1NBEB 3B54A 1HNXJ 2R42A 4H54A 4CLSA 2VBYA 5HBMA 2FVRA 3GFZA 3P4UB 1CJUA 3QWUA 3T19A 4F04B 2W4PA 4XTTA 2ALZA 1GXTA 2CYYA 4YR0A 3OPKA 2VASA 2RNEA 2Z56B 5HMXA 2MQPA 4KO0B 5CD4H 1JKHA 1BGXT 1T9WA 2O01C 3E01B 1Q7LB 2W9CA 2D3O1 1HR0F 2UUAJ 1CJVB 4ID5B 2QL5B 2D41A 5HVFA 2ZZTA 5ETTA 2ZBRA 4K4XA 3UN3A 3NXZA 1VQOS 3MMBA 4Y6IA 1PKUA 2Z2LA 3NGSA 2EVZA 2MYFA 3SCIE 3LPYA 3QO9A 1RK8A 3EPGA 1MNEA 2V68A 3BB5A 3FCHA 3M6WA 3L7OA 3W61A 4DR3J 3J7YI 3Q24A 1Q0NA 4LF6F 2HWTA 2CQIA 3GJRB 4M5NA 1RHQB 5G0RB 2E5LJ 4JI1J 1FF2A 1REVA 2UXDJ 1U1MA 3MDFA 3CXCR 2F4VF 5K8OA 2HHTA 2IDEA 3GIIA 2FLNA 2N7CA 2W1BA 1MU2B 1NDKA 2HFSA 1S6UA 2ZBPA 4K2XA 3OFFA 4OLPA 1NMEB 2VODA 2KKHA 2XTJP 4DUTA 3OVAA 3RB0A 1RKJA 1PJ7A 2X1BA 3IG1B 1RP5A 3O3LA 1NSAA 4HDGA 3W9JA 1ZA1B 2WVCA 4DOZA 5GAEU 2RQCA 2HHHJ 5KG3A 3CE8A 3POTB 1S6PB 3RBZA 4UTGA 2J9EA 3QLHA 1RWNB 4ES1A 4RW4A 3OBIA 3CEDA 3CO9A 1X4HA 1V3SA 4EK2A 5JVHQ 3W9IA 1ZAVA 1U48A 3MTJA 4FXVA 4ZVHA 1D1UA 2CJKA 2H65B 3MCNA 2W9BA 3THPA 1SI9A 3QSYB 4QYZK 1FTRA 2CPJA 1T9TA 4NLYA 3OR1B 2QYGA 1W7WA 2HIQA 2CPZA 2CNNB 4CLYA 2AF6A 3A8JA 4P2SA 2GS8A 5A2QU 2J0XA 2Q3PA 3MEGB 4OI0A 5KFOA 1AFJA 3TRGA 1RBOB 4CO4A 2J0WA 2BW7A 2MTLA 3H8YA 4G1IA 3I55S 3HHNB 3TJ8A 1U4BA 1FD2A 1VLOA 2DNOA 3MUMP 2K1RB 3Q89A 1BQNB 5A8KB 3LH2S 1EJ7L 1HBUB 1KONA 2IBOA 2VZ9A 3P5BP 1RT1A 4GVLA 1FK9B 4O4RA 4WYWA 2BRLA 4NLUA 3PIPQ 3NEKA 1UETA 2ZOMA 4RW9B 1ZM4A 4EMDA 2YKNB 1O5JA 2M3DA 4EYHB 3MR7A 1IJFB 1S79A 2DY9A 2JOQA 4X4UA 4KHPJ 3AJDA 3EX7B 1HBOB 1RAAB 3LP2A 4C11A 1CEZA 3T6JA 1DQ8A 3I0SA 1X4CA 2HFNA 4Y00A 2I8EA 4B02A 5AE1A 3G8SA 2J9DE 3AD8C 1XMOJ 3CD0A 2LU2A 3M8ZA 1HLWA 2HKEA 4B17A 4Q45A 2XO6A 2VL1A 4A8WA 1LOUA 3KHGA 2W7AA 3D6FB 1M5PC 1VJWA 2FIUA 2FLOA 3EM1A 1BQMA 1KLNA 1NZ8A 1VGYA 2WB4A 4KGMA 1KVKA 4PPZA 3BJYA 2WVFA 4QIVA 4Z37A 4R5PA 3H4DA 4LSNA 2MJNA 4O3NA 3L09A 4WP3A 5T14A 2RRAA 1A7GE 2NREA 3G8QA 1GNKA 4MAKA 4WJBA 2VDHA 1FWPA 1WJ9A 3QGHA 5E3PA 2VICA 1WSVA 2VFRA 3SMZA 3KUEA 1RT7B 4DV7J 1JKHB 4MYUA 3GONA 2QL9B 2BE2A 1P9YA 3MM5B 2BQUA 2IMWP 2HNDB 1RT3A 3TUPA 2SXLA 4M5DB 4WFZA 2WTFA 4O23A 4CM2A 2HURA 3CB4A 1SH0A 4URGA 3OLAA 3N4WA 2LXIA 1IKXA 1LW2A 4IFYA 4ECRA 4EEYA 3PEJA 3KNAA 4QIGA 1HBNB 1FESA 4Z7YA 4ZPCA 1SJ1A 4URQU 3RW6A 2YWWA 2IVFB 4EO6A 4NPOA 3D1OA 3R97A 5IV4A 5C42A 4UOHA 3OL9A 2BJ1A 2A1BA 3ILOA 3G6XA 4ECXA 5IWAJ 4DXLA 3KLIB 4KQZA 2WW8A 5HMZA 5ETVA 2YWGA 5KFXA 1TL1A 2ERRA 3AQOA 1UZDA 2F3JA 4JI2F 4V19J 3EGZA 3QQCD 2KVIA 4QWEA 3ETMA 3GIKA 3R2CJ 2XYPB 2J8SA 2J7UA 1S5ZA 1U1LA 4PG4A 5GAHI 2KYZA 2FJVA 3C16B 3ELHA 2DHGA 2HS3A 4IG3A 5BR8F 3ZZUA 3DOMA 2P2CB 1RAIB 3PX0A 3ZC4A 4JI0F 3ZZPA 2MLYA 5AJ3F 1H3DA 5D3GB 2IVMA 4DN9A 3PKMA 3BH7B 4FF1A 2ZC4A 3E3XA 4KJIA 1TMJA 4RJVA 4J37A 2AT1B 5J2QA 3FJ2A 1N6QA 1ZAXA 1QY7A 2DH7A 5D4LA 3TZXA 1N33F 2QL7B 5EUHA 4OX8A 1FJGJ 1PG5B 5DJBA 4ZKAA 3M2RA 1NM2A 3W2VA 1H7XA 1RADB 1FERA 1R89A 4OHWA 4C0OC 4ZHRA 5DQIA 3PRVA 1RU2A 4ECYA 3JB9k 3PRDA 1JLCA 1F3VA 1MROB 3L9ZA 5KFSA 2R7QA 2DNYA 3RBDA 3BKFA 3C8YA 3C15B 5A0YA 4JV1A 2UVWA 2OD6A 2HQFA 5LJ3Y 2FTRA 1TV6B 4Q8EA 2D3UA 5DZ6A 2ZDPA 1UFWA 4X65F 3K5PA 2PFDA 5C2CA 4QU6A 5KG0A 5J1EA 4RWXA 5HANA 2ILYA 4DCJB 1JK9B 2DNQA 2QE5A 1IBKF 4MFBB 3KMQA 2DY1A 3MM8B 3RAQA 4A8YA 3H5XA 1SL2A 4IRDA 1X9WA 1M1GA 1KS2A 1SIWB 1TL3A 2APOA 2HNZA 2JZ5A 2WOMA 4FPRA 4LJMA 4XIUA 4DPXA 1D9AA 3Q8VA 3M8RA 2EFGA 3I4PA 2JFDA 1WG5A 1EB0A 3M6XA 5B0DA 2DCUB 1RGVA 3BR8A 1JLBA 2E1CA 5FIIA 3T9NA 3GYXB 1IWGA 2HQIA 4B9LA 2CXEA 3ZZ0A 1TAQA 5E3CA 4ANCA 1DARA 2NXJA 3ZTPA 4NXMJ 2ZNYA 1D9FA 1GXLA 3HSDA 4OI2A 2W8KA 1NJYA 4A8QA 1FX2A 3QYYA 2DGOA 3OTBA 4P7VA 5ETSA 3VAFA 3PYDA 4ZN3A 5E3RA 1WI8A 1R0AA 1NDLA 1H2VZ 4RBTA 5SUHA 4RBVA 2CPEA 5K9FA 1RT5A 7FD1A 3HFVA 3DDKA 3DM2A 1M5KC 1HNVA 1MWQA 3GV5B 2OD4A 3K2YA 3DLGB 1K0VA 2HIYA 3TUIC 1FWLA 2LMIA 1PILA 1NSPA 1F5CA 2NS1B 3T5LA 4MT1A 4DFMA 2U2FA 3F41A 2MQQA 1JLGB 2H5JB 2X3GA 2LXUA 3M32B 3QIDA 4ZMMA 3CMQA 2ZH9A 3SSSA 3RRHA 2RKIA 1HHTP 1U1OA 1NU4A 3GR0A 4TLQA 5ETNA 5HATA 2ZFHA 4A46A 1ZYQA 3TZWA 1XN9A 2YH0A 2RQMA 3GFXA 3RGIA 2RUSA 2Y1LB 2NUUG 2XZWA 1IN0A 1RABB 2ZD1A 3ILIA 3QWPA 1U0SA 2LDYA 1T03B 5B09A 1KFDA 4N8NA 1WWHA 2OPSA 1HMVB 4KY3A 5GMKa 4NCAA 1JLAB 1T11A 2A18A 2VG6B 3JQJA 3N0VA 1FXLA 1QUVA 2B5JA 2IHR1 2IM1A 1U1QA 1NPRA 2OTLS 1KHVA 5DO2A 1U26A 3PIOQ 2IFXA 3UW1A 3LO3A 2KXHA 4YN3B 1RZMA 3UNGC 2GVZA 3I0SB 4DLGA 3D3BJ 4Y2AA 1NH7A 1VISA 2ZUAA 4EO8A 3UR0A 4DFJA 1DY3A 4Y2IA 1IR1A 2ZKTA 3NBPA 1NNDA 1AT1B 2BE7D 5D15A 5B7WA 1RU1A 5F3TA 1KVJA 3H59A 2DNKA 1OWXA 5KT7A 1F60B 3VGUA 1N5YB 3KJNB 2XSJB 1S6QB 1VLYA 5F3ZA 4PZVA 1E6YA 3MR2A 3J7AN 3M8PA 2NYHA 2Z4PA 3M8YA 4K5RA 3MWBA 2UVVA 4QPXA 2UZAA 2IA6A 3NAIA 2OJ3A 2FHKA 4WP8A 2FC9A 3C6UB 4CLWA 4OFZA 4DUYF 4PWDB 4PXBA 2Z2YB 4C0HA 1MLAA 2R8HA 1M5OC 5CCLA 5LMNF 1N88A 2PFFB 2V67A 1H98A 2HNDA 4N7TA 3KHRA 1JJ2R 2KXNB 2RIJA 5KT2A 3P8BB 2CQ3A 1PO6A 2E7XA 3PFEA 4ELVA 4I68A 3O8WA 3CD6S 4DPTA 5DETA 5ETMA 4DX6A 3PHEA 4AL6A 1VFJA 2B4VA 3IO1A 4USTA 1SKRA 4NYOA 3DGPA 1P8GA 3I5AA 3BSCA 4I6WA 4JI6F 3UD3P 1NJZA 1BE4A 3SSRA 4JI4F 4NXNJ 3UI3A 4ZP8A 2NCKL 5I42A 1YLXA 5THWA 3ZZOA 1W2IA 2C2RA 3TARA 1HW8A 3EZOA 4ZPDA 3GV7B 1ZM2A 1FCAA 3PX6A 4DPWA 2NSBA 5ETRA 4NXMF 2IAJB 3PV8A 1JLQA 3BGUA 3VAKA 1DLOA 3OVBA 3JS9A 5DZ7A 2FHJA 2VH7A 3QT6A 2ZITA 3QIPB 2H48B 1Q53A 2BEFA 1Z4UA 2CDRB 3SI8A 1NHKL 1VJQA 1Y9OA 4RW6B 3PXGa 1NJIT 3QRQA 1UAWA 1OQ6A 1V3RA 4OZNA 1FDDA 3O2IA 3C2PA 2Y9HA 2I9SA 4ED6A 5K14B 1ZM9A 5KT6A 1JXLA 2ZZNA 1UVKA 2E5GA 2OFHX 1T3OA 4RKUC 1HBUA 4XDCA 2MGZB 2UUBJ 3PVXA 4UZCA 2KZMA 2ZD1B 1JLEB 1IKWB 1FE0A 3TQ1A 3JTOA 3RU0A 1S49A 5CYQA 3IN5A 1UFKA 5HBMB 5KT5A 3KMSA 3W3SA 4KB7A 3BBBA 1H74A 3CJQA 1JLFA 2PIIA 3LP1B 3RJMB 4BHQA 4R8UB 3NL0A 2I38A 1RBLA 3MPWA 1RWMB 2LYVA 4OYIA 4IDKA 2PA3A 5E33A 1XMOF 4X2BA 5L1KA 1RE1B 3DGVA 4JI7F 3MMJA 2G0IA 1SJ4P 1UZHA 5HAOA 4ELTA 1RB0A 3NOCA 2CADA 2HVEA 1I94F 3MEEA 4GKJJ 1YBAA 3U1NA 1FKOA 2DKOB 2KB2A 1RHUB 4ZJQA 5AJ3J 4DV0F 2AGQA 4JI0J 4JI3J 4AXJA 5J2MB 3HZEA 3DLEB 2MZQA 4CO3A 1M1KT 3DOKA 1P9QC 2M52A 1N52B 4FYDA 1JLBB 4CM0A 2E66A 4A8XA 3GCXP 1EX8A 1MWYA 3HVRA 2DK2A 4ECUA 3LF0A 4C97A 4U7CA 4NCBA 2QSFA 3QFWA 5E3QA 4F2SA 3KLFB 5A8RA 2Z30B 4F50A 1G2EA 2M7SA 1MMDA 2QLFB 4F4ZA 1J5OA 1T9UA 1TKZB 3IR5B 3T5KA 4HKQA 4P2MA 2WSFC 1U47A 2I5JB 5IT9U 4N77A 1GMUA 2Q79A 3OR2B 4I6AA 4KGVB 4Y34A 1DRZA 1O6XA 4IFVA 3QRPA 2DNHA 4RNHA 4BDPA 2V6AA 1C1CB 3PJXA 1L3UA 3A12A 3CWJA 2PEHA 2BW2A 4CLPA 3IM9A 4M5KA 1XR7A 2C42A 5KAKA 2KM8C 4X4QA 4Y2KA 3GG0A 4H4MA 2XMWA 3BSNA 4DR2F 1S9GB 4C8YA 2W7OA 3TZZA 4J9PA 1YZ7A 1U6FA 5EWGA 2W4DA 1J2VA 5BJRA 2GQ2A 1FRMA 1BD6A 4DQQA 4NYZA 2XB2D 4WIQA 2DD8S 4RBUA 4DL6A 4ES3A 2JX2A 1JLCB 2XMTA 3ITHA 3NMAA 3UQSA 1RLCL 5C7PA 1HQUA 3HMJG 2F65A 3IWXA 3SFGA 4DL7A 4XPCA 1PIEA 1HPZB 2QJ3A 1T9VA 2A6OA 3QT7A 4F0HA 5KFJA 4I2QA 4K8RA 4K50A 2EFPA 4F36A 3CDBA 1Q78A 2R7VA 4JI8J 2YQ0A 3L7UA 2EK1A 3GB0A 3I0RA 3MAAA 3MAHA 4CH0S 2HHVA 2UXBJ 4TYBA 4MIWA 5I3UB 3T1HF 3MOJB 3OTEA 3L7PA 3EUNA 2DRAA 2EC0A 4I7FB 4ICLB 1S1XB 2ASJA 1W26A 3B4MA 4M94A 1X4BA 5JUMA 4EGLA 4HI2A 3JSMA 2FC8A 3QT5A 1B64A 3KJQB 1SBRA 2EPIA 3DI6B 4RW8B 3GILA 4W90B 4B3SF 4J9SA 1Q5VA 2BE9B 3QJLA 1GEHA 1XK8A 3M8PB 5SZTA 5KFDA 3LWMA 5F8JA 1XNRF 1HI8A 4NLOA 2R8JA 4IG3B 2H4WB 6FD1A 3DOLB 1OSCA 1VQSA 2DCLA 3MPDA 4R8UA 4DU8A 5A8WA 4B9MA 4IR1A 3C6UA 3B8HA 1HYSA 1HWIA 4S0MA 4TN2A 3T1YF 2WSEC 1WF1A 4F4AA 1UVLA 3DRPA 4F25A 3TVKA 4F4KA 1TZ0A 3JSMB 2AEMA 1FHTA 4ECQA 4HI1A 3DRSB 5AXNA 3MEEB 2R7SA 2KL8A 3C66A 3PR4A 1WC0A 1WF0A 3I4HX 5ETQA 2IRXA 1VBKA 5C2GA 3DYAB 4C8NA 2VC0A 2BKPA 3A8IA 4DR3F 4UF4A
chains in the Genus database with same CATH topology
1XMOJ 4DUYJ 4DV0J 2VQEJ 5LM7E 4X64J 4KYZA 3JAMU 2VQFJ 4DR6J 5BR8J 4NEYA 1HNZJ 4YY3J 4DR5J 4JI4J 3J80U 4GKJJ 4DV4J 3IMQJ 5AJ3J 4JI0J 4JI3J 4B3RJ 4JV5J 4LFBJ 3J81U 4JI6J 3W1YC 4DV7J 4HHUA 2KVQE 4JI5J 4DR4J 2UU9J 4KY3A 1N32J 4JI2J 1IBKJ 4X62J 5IT9U 4B3TJ 1HNXJ 1IBLJ 4LFAJ 1XNRJ 3D3BJ 2UUCJ 4X66J 5IWAJ 4OX9J 4DR7J 3T1HJ 1J5EJ 4JYAJ 4DV2J 2UUAJ 3T1YJ 3OTOJ 3R2CJ 5LMUJ 4DR3J 2UXDJ 1IBMJ 4JI1J 2E5LJ 4PWWA 1HR0J 4DV3J 4RJVA 2MQ8A 4JI8J 4NEZA 1XNQJ 5LMNJ 1XMQJ 4V1Ak 4LF6J 1FJGJ 1N34J 2UXBJ 4YHHJ 2HHHJ 4LF9J 4JI7J 5FLXU 4LF8J 2F4VJ 4DUZJ 1I94J 4NXNJ 3D3CJ 4B3SJ 4LF7J 1N33J 4GKKJ 4LF5J 5A2QU 4B3MJ 4DV6J 2MTLA 4DR1J 2UXCJ 3R2DJ 1N36J 4AQYJ 4X65J 2MEWA 4NXMJ 2KL8A 1HNWJ 3J7AN 2UUBJ 4K0KJ 4DV5J 4DR2J 2ZM6J 4KHPJ 4DV1J 4LFCJ 4LF4J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMO J;  4DUY J;  4DV0 J;  2VQE J;  5LM7 E;  4X64 J;  4KYZ A;  3JAM U;  2VQF J;  4DR6 J;  5BR8 J;  4NEY A;  1HNZ J;  4YY3 J;  4DR5 J;  4JI4 J;  3J80 U;  4GKJ J;  4DV4 J;  3IMQ J;  5AJ3 J;  4JI0 J;  4JI3 J;  4B3R J;  4JV5 J;  4LFB J;  3J81 U;  4JI6 J;  3W1Y C;  4DV7 J;  4HHU A;  2KVQ E;  4JI5 J;  4DR4 J;  2UU9 J;  4KY3 A;  1N32 J;  4JI2 J;  1IBK J;  4X62 J;  5IT9 U;  4B3T J;  1HNX J;  1IBL J;  4LFA J;  1XNR J;  3D3B J;  2UUC J;  4X66 J;  5IWA J;  4OX9 J;  4DR7 J;  3T1H J;  1J5E J;  4JYA J;  4DV2 J;  2UUA J;  3T1Y J;  3OTO J;  3R2C J;  5LMU J;  4DR3 J;  2UXD J;  1IBM J;  4JI1 J;  2E5L J;  4PWW A;  1HR0 J;  4DV3 J;  4RJV A;  2MQ8 A;  4JI8 J;  4NEZ A;  1XNQ J;  5LMN J;  1XMQ J;  4V1A k;  4LF6 J;  1FJG J;  1N34 J;  2UXB J;  4YHH J;  2HHH J;  4LF9 J;  4JI7 J;  5FLX U;  4LF8 J;  2F4V J;  4DUZ J;  1I94 J;  4NXN J;  3D3C J;  4B3S J;  4LF7 J;  1N33 J;  4GKK J;  4LF5 J;  5A2Q U;  4B3M J;  4DV6 J;  2MTL A;  4DR1 J;  2UXC J;  3R2D J;  1N36 J;  4AQY J;  4X65 J;  2MEW A;  4NXM J;  2KL8 A;  1HNW J;  3J7A N;  2UUB J;  4K0K J;  4DV5 J;  4DR2 J;  2ZM6 J;  4KHP J;  4DV1 J;  4LFC J;  4LF4 J; 
#chains in the Genus database with same CATH topology
 4X4O A;  3M7V A;  4JI1 F;  1N48 A;  1JX4 A;  4I6Y A;  1YGY A;  3BQ2 A;  2BMB A;  1S57 A;  4NAS A;  5LM7 E;  5LT5 A;  4UOF A;  2E9Z A;  2Y0S D;  1F9H A;  1WKJ A;  3PYG A;  4HHH A;  1RIS A;  2VQF J;  5K14 A;  2IY5 B;  1K8A T;  2CJQ A;  2XS5 A;  5E2Q A;  4X4V A;  3PW4 A;  1RYR A;  2WW4 A;  1V3Z A;  3C19 A;  3K17 A;  3KNG A;  3MM7 B;  1RUS A;  2DGU A;  2GMH A;  5F41 A;  4P2X A;  3TAM B;  1M5H A;  1O8B A;  1IKW A;  3ZO7 A;  3TAQ A;  2YXL A;  3FSX A;  4HDH A;  5KFP A;  1VQ9 S;  4QWD A;  1S4E A;  1XNQ F;  1SC3 B;  1TP7 A;  2L9W A;  2BZ2 A;  4ED8 A;  1HIY A;  1FDN A;  4MTP A;  2CA9 A;  3DLK A;  4DR1 F;  1NLK L;  5D3G A;  1OQ3 A;  7FDR A;  3OUY B;  4K4V A;  4Q0B A;  2HMI A;  3AOC A;  1FNO A;  2G2O A;  2W2Q P;  5CH7 B;  1S59 A;  2CQG A;  2J8A A;  2V50 A;  4WU2 A;  2QT7 A;  1HI1 A;  3DXB A;  5CHC B;  4F3M A;  4J9N A;  3RTV A;  4ED1 A;  1SL0 A;  1CC8 A;  2V2V A;  4W4M A;  5F9N A;  2IVY A;  3C16 A;  2DNR A;  1SV5 B;  5B0B A;  2KYX A;  4EBC A;  2OPQ A;  2QSW A;  3SQG A;  1EQM A;  1URR A;  2AYM A;  2GC8 A;  4LF2 A;  2XZD B;  5F0W A;  5LSO A;  2FVC A;  2ZHB A;  5JMN A;  1KQS R;  3UDC A;  5IM0 A;  2UUT A;  5D0G A;  3G6V A;  4DR7 J;  1RQ0 A;  4X66 F;  3DRR B;  4I4B A;  4KAI A;  5L38 A;  4DR6 J;  2HVH A;  4ZVG A;  4Y3C A;  1D8Y A;  3H40 A;  5I3U A;  3KWM A;  4D3H A;  1TL7 A;  1VRT B;  2W4C A;  3Q8U A;  1RT1 B;  1VMB A;  2EXU A;  3FGV A;  2COL A;  3NBP B;  3H20 A;  5LJ5 Y;  3OFE A;  1FO1 A;  5DDQ C;  4IFV B;  5HMW A;  1VQL S;  1TUG B;  3U27 A;  4ZPV R;  3Q8Y A;  3CJR A;  1Y3J A;  3BPS P;  4OX6 A;  2OPQ B;  1HD1 A;  4C7Q A;  2OPP B;  4DN0 A;  2C2M B;  2O67 A;  2KRR A;  1FVQ A;  2UUB F;  4NLG A;  3FZ2 A;  5A8R B;  4MKA A;  5HVG A;  1WTB A;  2KFN A;  4DR6 F;  1K44 A;  1SPB P;  2QLB B;  3NNA A;  3AOD A;  4OI1 A;  2ZOF A;  4ID5 A;  1SKS A;  4NZ0 A;  4ED0 A;  3EIC A;  2DR5 A;  4LF8 F;  1SJ3 P;  4TU9 A;  5KFQ A;  4O44 A;  4JI7 J;  4UZB A;  1X5S A;  2M5Y A;  1RSC A;  3R5J B;  2BV3 A;  3WHI A;  2FJW A;  2AZ3 A;  2R4F A;  3JAM Y;  4I2Q B;  1MN7 A;  3PW0 A;  3TW0 A;  2AD9 A;  2R8G A;  1FDA A;  1VQ6 S;  2JWN A;  3SCJ E;  3IBC B;  2DR9 A;  2QTW A;  1TFW A;  2IM0 A;  1BUX A;  2GJ2 A;  4KHR A;  3C6T A;  4YHH F;  2DPJ A;  2XZT B;  2IM3 A;  3EXY A;  4DCO B;  3PR5 B;  2HZC A;  3ITH B;  4C11 B;  3PW5 A;  1ZTW A;  3M30 A;  3HHL C;  4KGZ B;  5KFA A;  3MF5 A;  4YFU A;  1CS4 A;  3MFH A;  4DL3 A;  2FLL A;  2EFO A;  4RW7 B;  2RB7 A;  2M0G B;  4Q2L A;  2Z0G A;  1YJU A;  2UUC F;  5KFC A;  1RWV B;  1X4F A;  2D3Z A;  4ATN A;  3NGR A;  3ZTQ A;  2JLG A;  4YQW A;  3LWL A;  2YX7 A;  3ET6 A;  1NK9 A;  2RD5 C;  4OZL A;  5EX3 A;  4ZPA A;  1HMV A;  2C2O B;  4WK3 A;  1JIH A;  3WBZ A;  1HNW J;  1B0T A;  3DU5 A;  3G82 B;  1UFL A;  3V6D A;  1OS5 A;  2BVZ A;  1FWK A;  2F8H A;  2GHV C;  3CDU A;  2HRU A;  3ZTO A;  7AT1 B;  4QU7 A;  3OL7 A;  2C2E A;  3UPF A;  2V4J A;  3DOL A;  1B70 B;  2CDQ A;  3AA8 A;  4A48 A;  5GAH U;  4E0D A;  1UVJ A;  3WX4 A;  1YRT A;  2H3E B;  3HF5 A;  1H2T Z;  2XSF A;  4TVA B;  2IYG A;  4ZCK A;  3HT3 A;  4R0J A;  3OR2 A;  2G1H A;  1YKW A;  2B4P A;  3OJU A;  2MZT A;  1U0H B;  2RF2 A;  1NZA A;  1T05 B;  4RU2 A;  3SIP B;  2HZV A;  1RHM B;  4RNF A;  1WC1 A;  2C3P A;  3U1M A;  2N4D A;  3HCX A;  3HPO A;  4CTA A;  4LFB J;  2QG9 B;  2YNF A;  1FTC A;  4GKK F;  2XY7 A;  5DM7 Q;  2PD1 A;  2ZOG A;  4MK9 A;  5JJB A;  3SFU A;  2MXY A;  1ZM3 A;  1QVG R;  1WEZ A;  2QLW A;  3JSY A;  4RUC A;  3QZ7 A;  2ZH6 A;  2X1A A;  2VBX A;  4JI5 J;  1VS3 A;  5GAG I;  3CJ4 A;  2KT5 A;  2Y1R I;  3AA9 A;  3R5A A;  2DJW A;  4LRC A;  3AOA A;  5C25 B;  4Q7A A;  4D3G A;  1S10 A;  1Q8K A;  1RWW B;  3D1H A;  4NI2 A;  5A2Q Y;  1RTD A;  4FBT A;  2GQQ A;  4M5L A;  1S1W A;  4XK8 C;  1TV6 A;  1XNR J;  1WKK A;  1UWB B;  3EJM A;  2Z58 B;  3GMG A;  4PYD A;  2VFT A;  2DB1 A;  2CG4 A;  1SIZ A;  4JV0 A;  2XEX A;  5J1P A;  1MG7 A;  2EKN A;  2Z2M A;  3MM8 A;  1SUQ B;  3JSR A;  2P6T A;  2C3M A;  4CO2 A;  1TKD A;  4J9O A;  3GZ7 A;  2DH9 A;  3EGV A;  4FZV A;  2AEJ A;  1XC9 A;  1Y4Z B;  4TYA A;  4NE9 C;  3KTQ A;  2V2K A;  3OTO J;  3TJA A;  2HYI B;  3K5M A;  3IRX B;  3EYZ A;  1RWO B;  5L1L A;  5EDW A;  3BS9 A;  4KFB B;  2EWH A;  2PN6 A;  2X51 A;  3I5B A;  1RTH A;  1S48 A;  2AX0 A;  3FFI B;  3VQT A;  1S1T B;  2NXU A;  4O0N A;  1GTH A;  1R3N A;  1JXE A;  1ULR A;  2KT2 A;  1VI7 A;  3DLJ A;  3KXD A;  2LLZ A;  2I2Y A;  2A6M A;  3IS9 B;  1JJH A;  2WRM A;  5AT1 B;  4UY8 T;  3HJF A;  3FQL A;  4QOT A;  2PMW A;  4HEA 9;  1XMQ J;  1NB7 A;  4LBH A;  2N3L A;  1XR5 A;  3VAJ A;  2K8G A;  2CRL A;  1WOP A;  2LQB A;  2YPZ A;  3KK3 B;  1N34 J;  1T7P A;  4JI5 F;  2YTC A;  1NAQ A;  1JXV A;  3DDI A;  2QRR A;  5HL7 Q;  2ZBC A;  4BC9 A;  5FLX U;  2V9W A;  1FK9 A;  2QMX A;  1YJR A;  1N36 F;  1OY8 A;  4F26 A;  3HP6 A;  5J1N A;  5JVG Q;  2HFV A;  1GTE A;  4MKV A;  3VAI A;  1YJ9 S;  1K9M T;  2RT3 A;  2MKC A;  3POT A;  4NLX A;  2HWH A;  5KFH A;  3I32 A;  2P8I A;  1N32 F;  2DHA A;  2DO0 A;  2LP4 A;  2PSZ A;  3MMA B;  4DQS A;  4URS A;  1RYS A;  3KOA A;  1K1Q A;  2F40 A;  2A2C A;  3CIZ A;  3FBF A;  3UN5 A;  5IFM A;  4FYY B;  5L1J A;  2UXC J;  5A76 A;  4QWB A;  2W9B B;  5CYQ B;  4K2J A;  4PWD A;  4PG6 A;  4JOU A;  3DOK B;  2ZJR Q;  1H6K X;  4WXO A;  3HDS A;  2IDL A;  2QLX A;  3BDP A;  1RTJ A;  4RLE A;  4DX5 A;  1KLM B;  2CQH A;  3F44 A;  1B0P A;  1QAY A;  2AIR B;  2ZH8 A;  4C8L A;  1JMT A;  2ZH1 A;  2K3I A;  1CC7 A;  1ACM B;  2G13 A;  2HFU A;  4P73 A;  2R7R A;  5JXS A;  1WC6 A;  2MJU A;  2V8D A;  2DGX A;  3PHT A;  3MM7 A;  3RBX A;  1DBD A;  5CCM A;  2R2T A;  3MM9 B;  4DV6 F;  1VRQ C;  2RHQ B;  3PM9 A;  5H9E K;  1Q79 A;  2MPU A;  5L46 A;  2Q43 A;  1MU2 A;  2AP6 A;  2QMW A;  5KFM A;  1TKX A;  2BKN A;  1CLF A;  4O4G A;  3CCW A;  3KLH A;  3SSQ A;  1EP4 A;  1UEV A;  3CCJ S;  2OPS B;  1QE1 A;  2V34 A;  4KH0 B;  5DGA A;  2QMU B;  2JEI A;  1TL5 A;  1KN6 A;  5B0F A;  1LXN A;  3O1L A;  2J7W A;  2JLE A;  3IAM 9;  4A4J A;  2DEI A;  4DF4 A;  1LEO A;  3D7S B;  3AAW B;  4H4K C;  1SL1 A;  1CUL B;  1Q8B A;  3BM7 A;  1UP1 A;  2HQC A;  2MZ1 A;  3VQS A;  4RX6 A;  4P75 A;  4USJ C;  2OMO A;  4NLS A;  4X62 F;  2YKQ A;  3CJT A;  4KGX B;  4E2F B;  5A8K A;  5IS2 A;  4F8R A;  2LEA A;  1WOR A;  1FE4 A;  1RT4 B;  2EFN A;  4GRS A;  4KKO B;  4KO0 A;  2CJA A;  4NA3 A;  3W1Y C;  2DXF A;  1X31 C;  3DRP B;  4QW8 A;  2RU3 A;  1KD1 T;  4WF9 Q;  1XWL A;  1S9G A;  4PXC A;  1KQF B;  3R1H A;  3E51 A;  3CUL A;  4UT4 A;  1VBY A;  5LL6 d;  2N4C A;  1SCJ B;  3RYL A;  3H4B A;  3M2V A;  4C9D A;  4FP9 A;  3M32 A;  4ZCM A;  1N5Q A;  4U67 Q;  2XQC A;  1BQX A;  1CQM A;  2BAC A;  4I2P B;  2JRS A;  4ZVR B;  1X8D A;  3G4S S;  4M95 A;  4KTQ A;  3W2W B;  3DN9 A;  5F8L A;  4ECS A;  5BYS A;  4ELU A;  3EPI A;  3RRG A;  3LGH A;  3HD1 A;  1PAU B;  2HNY A;  3TP2 A;  5MAO A;  2XMA A;  1FFS B;  1U8S A;  1NJX A;  1U6Z A;  1ROF A;  2V4Q A;  1TK0 A;  4ZVQ B;  4OJG A;  1VQP S;  3C14 B;  3L3C A;  3BO3 A;  3GIJ A;  4DV2 J;  1K47 A;  3SEO A;  3R5D A;  1L3V A;  4NA1 A;  3WIU A;  2G4B A;  4RUB A;  1KOH A;  1Y5L B;  3M2R B;  3SCL E;  4DFP A;  1URN A;  2NXC A;  3PNI A;  4DDF A;  5LMU J;  3A3N B;  1FJ7 A;  2NSC A;  2HVD A;  2L9D A;  3MEC A;  4L6V 3;  2YKO A;  5DGB A;  1UWB A;  3NS5 A;  3BH6 B;  4ZLP A;  3QRR A;  5IT9 Y;  3V6K A;  2DO4 A;  4UUW A;  2L08 A;  2XHC A;  1KR4 A;  3PYE A;  4DCP B;  1NK8 A;  1ITP A;  1TK5 A;  2DNZ A;  1TUW A;  5DLF A;  3MM6 B;  3CC7 S;  4ZP7 A;  5AXM A;  2MQ8 A;  4C8Z A;  2RML A;  2XI3 A;  4OZ3 A;  4USV A;  5HQ8 A;  3OD2 A;  4LF7 F;  3G96 A;  5IV3 A;  4LQ9 A;  3KK1 A;  1QAI A;  4OYB A;  1C4A A;  2DHX A;  2HHP A;  1NK4 A;  5RUB A;  1CVJ A;  2H54 B;  1R7I A;  1RAF B;  2LQ8 A;  1XER A;  5J2Q B;  1KLM A;  2XNQ A;  1D0E A;  1HAR A;  5GAE I;  2P9G A;  2CFX A;  1CJV A;  1C0U B;  3PCO B;  1F5B A;  3W2V B;  5DQH A;  4OHY A;  1C1B A;  1HQE B;  2K7J A;  1QM9 A;  2DXE A;  3I96 A;  4ZCL A;  2VFV A;  5KFG A;  4Y0F A;  5U47 A;  4AD6 A;  3Q83 A;  3D0H E;  1FXD A;  1FJE B;  1U02 A;  4IOA Q;  1H38 A;  1IKY B;  3AY0 A;  5CQG A;  2MZS A;  4XO0 A;  1GMW A;  1RHJ B;  1TL4 A;  4NCG A;  2ZEJ A;  3DRY A;  1RT5 B;  2AEF A;  2KJW A;  3MXH P;  3TR5 A;  3K5O A;  4X4P A;  2YNI A;  1VQ8 S;  3VF0 B;  4X65 J;  4HL9 A;  3H2L A;  4PRF A;  4KT0 C;  4ED2 A;  1C0U A;  5KFT A;  2OLW A;  2JEJ A;  1VRU A;  1ZPV A;  4N8O A;  3F0N A;  4A47 A;  2V8V A;  2X1G A;  2IRY A;  3PEH A;  3VZI A;  4KC5 A;  3PKY A;  1X7V A;  3KK3 A;  4IH5 A;  1FFG B;  4OV1 A;  3EMT A;  4DV5 J;  1RT4 A;  2WSC C;  4U6P A;  1WG1 A;  4Q8F A;  4USM A;  5AE2 A;  5DG8 A;  2HHU A;  2DGV A;  1S6O A;  1SV5 A;  4RR5 A;  1QLN A;  3NNC A;  1R6Y A;  4DX8 H;  2UXD F;  1CPZ A;  4KRW A;  3EXC X;  5GAG U;  4RO0 A;  1IBM F;  1NCL A;  2AQ4 A;  2W24 A;  2N7Y A;  3FMB A;  3M2V B;  5FDL A;  3J81 Y;  2MZJ A;  2ZH2 A;  2ROE A;  2J6S A;  3OTD A;  3BN4 A;  3NGT A;  1S1W B;  4X84 A;  4OV6 A;  1VQ7 S;  5B0C A;  2KHC A;  1M5S A;  1LWE B;  2RQ4 A;  3C15 A;  3AHP A;  2L41 A;  1MN9 A;  3CD7 A;  1NDP A;  3MD1 A;  2AJF E;  1HWU A;  3A4T A;  2OP5 A;  3MMB B;  2V2Z A;  3D67 A;  2BJE A;  3HSG A;  5ETL A;  5HLF A;  1T3N A;  2OTJ S;  3N6L A;  2CAJ A;  2YKA A;  2Z2Z A;  2HPU A;  5AXK A;  1UVM A;  4XAK A;  5EGY A;  3BYR A;  1IQT A;  2HSE B;  4DUZ F;  2WVB A;  2XHW A;  1UW4 A;  3H90 A;  2GA7 A;  4FXW A;  4LSN B;  1RWP B;  1Y0H A;  3IC1 A;  2QA2 A;  5GVQ A;  4DG1 B;  1V5I B;  2ZE2 B;  4F67 A;  2ZHA A;  1K73 T;  3LUY A;  1RWX B;  2HHQ A;  2PDA A;  3Q8R B;  2KM8 B;  1R0C B;  2E44 A;  4EZ6 A;  3OHA A;  4BCA A;  4F3O A;  1BHN A;  1F5A A;  3TX0 A;  1IKV A;  4ITS A;  3GPA A;  3PX4 A;  4N41 A;  1WD6 A;  4ZIT A;  3CME S;  2P9C A;  3ISN C;  3WC0 A;  3MR5 A;  1VHI A;  1YBT A;  1YVF A;  5LMU F;  3NNH A;  3R1L A;  1T94 A;  2CWX A;  2OPR A;  3NCR A;  2OH2 A;  1T95 A;  3CJK B;  1W25 A;  3MCO A;  3CNQ P;  4NX9 A;  3Q8S B;  3CPW R;  4DV5 F;  3BR9 A;  3QLH B;  3NS6 A;  5IQ6 A;  3TZY A;  1N34 F;  4CH1 A;  1KKH A;  4C8O A;  3TUZ C;  2XG8 A;  2VC1 A;  3IXQ A;  3ENV A;  3UN2 A;  3K8V A;  3MGJ A;  1R8B A;  1T9Y A;  2B3T B;  4K4S A;  2IBK A;  1LKZ A;  2CZ4 A;  2FHJ D;  2B4U A;  4P2F A;  2Y3Y A;  4CH7 A;  1C1C A;  2IJF A;  1U1N A;  1B99 A;  4LF4 F;  1L3S A;  2CPF A;  4QYZ J;  4WZM A;  4L72 B;  4NZ6 A;  1LFP A;  2FGO A;  4PWW A;  1X9M A;  1S1U A;  2MLX A;  2RU9 A;  3N28 A;  3OXF A;  3G8T A;  4XPE A;  1OPI A;  3HHD A;  1IKX B;  1LW2 B;  2B7C B;  3KDN A;  4RW8 A;  4J9R A;  2IYI A;  1AZS B;  3AD9 C;  2V0N A;  3BN7 A;  1SC4 B;  3HI9 A;  2VQF F;  2UVR A;  4I67 A;  4V1A k;  1K0T A;  2FLP A;  4LR9 A;  3FFI A;  5KG1 A;  1VIO A;  2FDN A;  3KG0 A;  4U95 A;  2LDI A;  4KR0 B;  1WEX A;  2RRB A;  2MHN A;  2M8H A;  3KLI A;  1N5S A;  4NLR A;  3J7Z T;  3CMA S;  4LRA A;  1NHU A;  1S9E A;  2B6A B;  4PPD A;  4PAA A;  5J2P B;  5KT3 A;  3FSY A;  3V4I B;  2F4V J;  2A2D A;  2W9A A;  3ET6 B;  2DGT A;  4F4X A;  1SH3 A;  4R5P B;  1IM6 A;  1Y5N B;  2W2O P;  3GJS B;  5KFL A;  2BKO A;  1CJT B;  4FYX B;  4LRF A;  2YY3 A;  3ADA C;  3FRY A;  4NWB A;  5KG2 A;  3UD4 P;  1X9S A;  2GVD A;  5F0U A;  4ECZ A;  1BQM B;  1RT2 B;  1TKX B;  1XIQ A;  4OHZ A;  4QIW D;  4I69 A;  3MZI A;  2VB6 A;  5LSL A;  3HJV A;  3KKF A;  3SDE B;  4B9S A;  2W2P P;  1FRX A;  2PI4 A;  1AYE A;  1NH8 A;  2HQG A;  4DX7 A;  3OQ2 A;  4N47 A;  4GVB B;  4AL7 A;  4DSK A;  5DG7 A;  1QD1 A;  5HRO A;  2V69 A;  3WQP A;  3N79 A;  3GR1 A;  4ED4 A;  1Q1K A;  1GX5 A;  1GMW D;  1GXU A;  3RUB L;  3LAK A;  3NG8 A;  1A6L A;  1WKL A;  4WFY A;  3ZZR A;  1N0V C;  1NDC A;  2XUL A;  3H7H B;  3CCE S;  3K0J A;  1NB2 A;  4NLV A;  3DRR A;  4OI6 A;  5HQM A;  2ASD A;  1BMQ B;  3AQP A;  3DLB A;  2DR6 A;  3IA0 A;  1ZPW X;  1AFI A;  3MR3 A;  5J2N A;  2DGQ A;  4A8M P;  2RH3 A;  3TI0 A;  3BDE A;  2QYC A;  4X64 J;  2LA4 A;  1TKZ A;  1FEH A;  1U1K A;  3G87 A;  2HQD A;  2QX0 A;  2XMU A;  3ISN D;  3T9Z A;  4I2P A;  2C2K B;  4USW A;  3LPE A;  3P6Y C;  1I5O B;  1MWZ A;  2R2U A;  3NGK A;  2UXB F;  4UOG A;  1S6Q A;  1EAR A;  3NWG A;  3IRX A;  1NKE A;  5KFZ A;  1X4G A;  3J81 U;  2YNI B;  3B82 A;  1XQI A;  4RWW A;  3MOZ A;  5LSR A;  2V94 A;  1EIY B;  3OLB A;  2GO9 A;  1YJT A;  3N5F A;  4TY9 A;  2HRY A;  5KFI A;  4HYK A;  1G4C A;  3CJ5 A;  2CJY B;  5DRK A;  3H2U B;  4I56 A;  4OX9 F;  1ZZN A;  2B9Y A;  4J9L A;  4B3O B;  1ZOT A;  4ZIV A;  2HK2 A;  2YNH B;  3HO1 A;  1D8Z A;  5C42 B;  4OZJ A;  4G65 A;  4M1K A;  4TY8 A;  2CJ9 A;  1IVZ A;  2IJN A;  3KJV A;  3FEX B;  3AH6 A;  1N5V A;  1F3F A;  2BYC A;  2FD2 A;  1N0U A;  4NLP A;  1U1P A;  2HAF A;  5IOL A;  4CRJ A;  3GCW P;  4YDX A;  2AYB A;  2Q6C A;  1JLA A;  2AW0 A;  5D4O A;  3RBE A;  2UUC J;  4DR7 F;  2EW9 A;  5IT4 A;  1RTI B;  3Q8P B;  2FUG 9;  4WFB Q;  3L4B C;  1UA1 A;  4MH8 A;  4QWC A;  3TAP A;  2GIR A;  3TJ9 A;  1Y7P A;  4B9V A;  5HN0 A;  5CA5 A;  1RT7 A;  4YUD A;  1C1B B;  4F0K A;  5FD1 A;  5K8P A;  4CO5 A;  3JYT A;  3CCQ S;  1T02 A;  4FS2 A;  2B4O A;  4J91 A;  3GJQ B;  3W5X A;  2VV5 A;  4ETX A;  3SXL A;  1IKV B;  1LW0 B;  3C3L A;  1DFD A;  2YNG B;  2CJB A;  2DBB A;  1VQ5 S;  4PQA A;  3QAU A;  2VG5 A;  3DU6 A;  5EN1 A;  3FBE A;  3KYL A;  4X4S A;  1N56 A;  4G1Q A;  4PAB A;  2AKW B;  5C25 A;  1EKR A;  2PMH A;  3BPD A;  2VQE F;  3FC9 A;  4K4W A;  3H0P A;  4DV1 F;  4O0I A;  4DS5 A;  1RT2 A;  3S01 A;  1Q8I A;  2QEX S;  2KG0 A;  2RS2 A;  4PEO A;  1EHW A;  3R2D J;  1PYS B;  3UCU P;  1SJR A;  5D6G A;  1H72 C;  4LF6 J;  4MJK A;  3O44 A;  1GAO A;  1UKU A;  1X0F A;  3D6M B;  2OHD A;  4ZVF A;  3R27 A;  4CLF A;  3CCU S;  2CKW A;  2QLJ B;  2Q6B A;  3HHL A;  4LF8 J;  1RWK B;  1TVR B;  2RVJ A;  2ZNZ A;  1U0H A;  3M9N B;  3GSD A;  1ICE B;  1YQH A;  3W66 A;  2VD3 A;  4LSZ B;  4WKR A;  1EAY C;  1KTQ A;  4L75 A;  1DJ0 A;  1WF2 A;  1TU0 B;  4DZD A;  4IDK B;  2ALY B;  2GMJ A;  1OSD A;  3R6G B;  3VGS A;  4CLK A;  3M4X A;  3H25 A;  2JEG A;  1FKP A;  2LU1 A;  1XJW B;  2ATL A;  1NUE A;  4DV6 J;  2BOA A;  3M8S A;  3C46 A;  2K2P A;  1RAJ A;  3EGW B;  1RT3 B;  4OYP A;  4PXD A;  2ZJP Q;  4B3M F;  4K4Z A;  1R8H A;  2B7B B;  3MED B;  4LIR A;  5CYM B;  3UVJ B;  4E98 A;  5DQG A;  5F8G A;  1SJF A;  4CIO A;  2E5J A;  5KFB A;  3M1V B;  5HP1 A;  2BAB A;  2DXD A;  3GG1 A;  1G7C B;  3ZZT A;  2UVU A;  1F6T A;  2EG1 A;  3M8W A;  5B08 A;  3MPV A;  1UEU A;  2ROP A;  3D0G E;  1R8A A;  4RW6 A;  5KG7 A;  2PA8 D;  2RDD A;  4YB1 P;  1FRI A;  1OIA A;  2B8P A;  2DNP A;  2KO1 A;  5CD4 A;  2VFS A;  1DHM A;  3M30 B;  5KG4 A;  1FT8 A;  2YH1 A;  4DV1 J;  3S1T A;  1CS4 B;  2B43 A;  4DV4 F;  4JV2 A;  3DMJ A;  1HWL A;  2HNZ B;  2ZUG A;  1HBM A;  1WAC A;  4LT6 A;  1HHQ A;  3HKW A;  2HLT A;  1UVI A;  2JSX A;  4OYO A;  4QZV B;  3DYA A;  1FD8 A;  4HAC A;  2KFY A;  3A8K A;  3NY0 A;  3SV4 A;  3FDS A;  4WKY A;  2B0G A;  5BR8 J;  4LRE A;  1Q82 T;  4JI4 J;  4NXN F;  3FNN A;  4AXI A;  3A13 A;  4RZR A;  4F4Y A;  1GQE A;  2YKN A;  4XDD A;  1TMM A;  2FJA B;  1SC1 B;  4A8S A;  1RTJ B;  2EFQ A;  1KQK A;  2CQD A;  3V6H A;  2NZ4 A;  2W2N P;  1X5O A;  2LQJ A;  3BKT A;  1FRK A;  3CDW A;  4OI4 A;  3V5R A;  2FGC A;  4PCQ A;  5HVH A;  3UCZ P;  4EFA C;  4CNY A;  1Q7Y T;  2DR7 A;  1KBR A;  3EVM A;  2NXN A;  1AA1 B;  4H4K A;  4DL5 A;  3H98 A;  1YI2 S;  3GFH A;  3DLE A;  2PEB A;  2ADC A;  1E6V A;  4DR5 F;  3JQM A;  1KRP A;  3BQ1 A;  3RR8 A;  1N32 J;  4AL5 A;  2R7W A;  2KHD A;  2XLJ A;  4LF5 F;  2GIF A;  3RR7 A;  1PJ5 A;  2Q66 A;  4LBI A;  3U7J A;  2DR8 A;  4Y28 C;  1YRU A;  1KDN A;  2R7O A;  4QQB A;  4YS2 A;  4N56 A;  3VAM A;  4KHM A;  1IBL J;  1WHX A;  3OFG A;  4IRK A;  1NK5 A;  1SQE A;  5C24 A;  1Y11 A;  5J2P A;  2YKM A;  3LP0 B;  3PAC A;  3JTP A;  4WYL A;  4N5S A;  2UU9 F;  5H9F K;  2IIH A;  4EU0 A;  1U7L A;  2VA2 A;  4ERD A;  1ZBT A;  2YX1 A;  3M2U A;  4ER8 A;  3DCA A;  1SQF A;  2DNN A;  3CJ3 A;  2RDI A;  3LGM A;  8ATC B;  4ZVE A;  1HKA A;  3SQO P;  4Q44 A;  2MB0 B;  4MYT A;  1NK7 A;  1WHY A;  3FQK A;  3IGN A;  4JP8 A;  1HNZ F;  3DHW C;  1S1V B;  3U1L A;  3HVT A;  2ZJQ Q;  1S0M A;  3GE9 A;  4RNN A;  2VOP A;  3NWR A;  5KFR A;  3OL6 A;  4P9S A;  2HVI A;  2WON B;  4YDD B;  1XTZ A;  2OO4 A;  4NOH A;  4F2R A;  1ZAW A;  1V5V A;  3OUY A;  1BC6 A;  2VG6 A;  3KG4 A;  3K8W A;  4ZK7 M;  1RCO B;  2FHO B;  3Q86 A;  1X4E A;  1AXQ A;  1QUP A;  3QBC A;  4C6A A;  3VGV A;  5B0G A;  4DEZ A;  3DLL Q;  4NEZ A;  3TA0 A;  3QJP A;  2GHP A;  1EP4 B;  1UW9 A;  4KV8 B;  4GKJ F;  4HLB A;  2YPY A;  1LWC A;  4L74 A;  3GJT B;  1M1H A;  3FSI A;  4A8K A;  3GQC A;  1JQG A;  2AYE A;  1EET B;  1DUR A;  2P9E A;  2CUY A;  3DXS X;  1CUL A;  3GWC A;  4UW2 A;  1WNE A;  3DRS A;  1YSJ A;  1MMN A;  4WFN Q;  2Y1J A;  2ZHO A;  1DTT B;  4O44 B;  4YEA A;  3TEH B;  4DL0 C;  1VBX A;  3PW7 A;  1U09 A;  3M8Q A;  2CPD A;  4I0W A;  3BGF A;  3LAN A;  5ITH A;  5KFU A;  5DG9 A;  5D77 A;  3HM9 A;  3BSA A;  3HFK A;  2MY7 A;  4HR2 A;  2ZVS A;  2XC9 A;  2ZM6 F;  3GYG A;  3VAL A;  2XCA A;  3AFG A;  4RL1 A;  4U9R A;  2G0J A;  2RUG A;  2OSR A;  3R3T A;  5BXI A;  2MEW A;  4ECV A;  2JHE A;  4IG0 A;  2CVE A;  2JH3 A;  2V5H G;  3FZB A;  4PUO B;  3HZG A;  3MPY A;  2HWI A;  2MQL A;  3TX8 A;  1O0P A;  2ILZ A;  2O5D A;  2GGP B;  4Q43 A;  3HXM A;  1VQ4 S;  3H5U A;  3IFE A;  4CLT A;  2WBR A;  2NQP A;  2H51 B;  2YNF B;  1WEL A;  3C14 A;  3LTO A;  5IXU A;  1RCX B;  2KU7 A;  1TL3 B;  4YB5 A;  3CDE A;  5A6W A;  1NJW A;  1FI4 A;  2P6S A;  4WTY A;  3J81 j;  4O3O A;  1S0V A;  3SQG B;  4A8F A;  2LVW A;  2M8D B;  4NYP A;  1UMJ A;  4DJB A;  5B0E A;  3BGR B;  2CQ0 A;  1RAC B;  1IKY A;  3DNC A;  4BWM A;  3D9B A;  3FBB A;  4KGK A;  3BRE A;  1CJK B;  3RRK A;  4USU A;  5KFF A;  2CIM A;  3G86 A;  3QAT A;  5T7L A;  3PRB A;  3DHX A;  3UFC X;  3OSN A;  4DR5 J;  4PQU A;  4X4N A;  3UCG A;  4M8L A;  2CG8 A;  4WCE Q;  3BSO A;  3R6L B;  2M2B A;  4F4W A;  2PT0 A;  4M5H A;  3WDO A;  1VC5 A;  1Z2L A;  1IBL F;  3I0R B;  5I3Q A;  4P6Q A;  4IQM A;  4KBI A;  1NKC A;  2Y0B B;  2E1A A;  2V8H A;  3NMR A;  2OML A;  1KNZ A;  2DEJ A;  4DZ6 A;  1RA7 A;  2BX6 A;  2EI5 A;  1KP6 A;  2HGL A;  3DC2 A;  4DF8 A;  1IXK A;  1FX4 A;  3GYN A;  4UUX A;  3ZXW A;  4B3T J;  2MLZ A;  4KFB A;  4OZ2 A;  1B7F A;  4LFA J;  4LF1 A;  2GO8 A;  2WBM A;  2BA9 A;  3ICL A;  1UVN A;  2I0X A;  3I82 A;  4M5J A;  4NI2 B;  1AW0 A;  4X66 J;  4Z2X A;  3V6J A;  4DFK A;  1JLQ B;  1I1G A;  3ZNU A;  2ROG A;  4ED3 A;  3TWZ A;  1OY9 A;  4E8U A;  1TKT A;  4WE1 A;  4JUZ A;  1SH2 A;  2IC3 B;  3CIM A;  1KHW A;  5BYQ A;  1U8W A;  2HS0 A;  3W8P A;  2OEL A;  2WVE A;  4NLW A;  4IOB A;  4DV2 F;  2CQ2 A;  1WDD A;  1IBC B;  5CZX A;  3BO4 A;  4KPC A;  3AJ2 A;  1DAX A;  1NSK L;  4RNO A;  2YWK A;  3N6M A;  4ZOS A;  4A8O A;  2CPH A;  2BAN A;  2VG7 B;  1YJW S;  1JJC B;  4HHJ A;  2LQ9 A;  4NA2 A;  1TR0 A;  4NZ7 A;  4Q5V A;  1T9X A;  4MK7 A;  1FNM A;  4Z7C A;  3Q22 A;  2CVI A;  3QPI A;  4UOC A;  1S97 A;  1N4L A;  1Y5I B;  2DGW A;  4WU3 A;  9RUB A;  2H9Z A;  5K8M A;  3OHB A;  2BXJ A;  4MIB A;  1QTN B;  3BQ0 A;  1QJH A;  1J5O B;  4WFX A;  4M5D A;  4NRU A;  1FNX H;  3H5S A;  2W7P A;  2J7K A;  1XNQ J;  2CQ1 A;  2ACM A;  3IP0 A;  4MMO A;  5KG5 A;  5KT4 A;  4DQI A;  4KSE B;  1LQ9 A;  3PO5 A;  1GH8 A;  2EBE A;  2FB0 A;  2LQ5 A;  2VPX B;  2F8E X;  2C3Y A;  4JV5 F;  2GAH C;  4OLO A;  4F0M A;  1OYE A;  2VG7 A;  3CCT A;  2XGP A;  2M9K A;  5IZH A;  3Q2S C;  2NPF A;  1F2G A;  1IUJ A;  1FA0 A;  2E5I A;  5T41 A;  1QAX A;  3G6Y A;  1G1X A;  3EDR B;  3MHY A;  2MKI A;  1LK7 A;  2XI2 A;  3OJS A;  3VTI A;  1YK9 A;  1HPZ A;  3HSZ A;  4MKY A;  3CD5 A;  1CSJ A;  2DT9 A;  2HS4 A;  3ZTS A;  2WB1 D;  1SVD A;  2FVS A;  4ZVO B;  3MR6 A;  1S7H A;  3W8G A;  3OT9 A;  1RLD A;  4KV8 A;  4TLR A;  1LV5 A;  3D2W A;  4B9U A;  1EKS A;  2JC0 A;  3DLK B;  1R8C A;  4LUB A;  3VVU A;  3IR7 B;  2L9N A;  3WIV A;  4FYV B;  4LRB A;  4ZA1 A;  5J1E B;  1S1T A;  3W7B A;  1S72 S;  1HI0 P;  1O51 A;  1GFW B;  2B9E A;  4LF7 J;  5GMD A;  4LMZ A;  1HNW F;  3DLH A;  1FDB A;  2DTJ A;  2LA6 A;  2HRT A;  1TUV A;  4DI6 A;  4PQU B;  2MDA A;  2WZ1 A;  2HK3 A;  2FY1 A;  3IGV A;  2E9T A;  3CCZ A;  3D0I E;  3J7Z 5;  3A3O B;  4TQS A;  4DR2 J;  2MZR A;  3OV7 A;  1REG X;  2KI2 A;  3RB3 A;  5KOW A;  3UD5 A;  2DPI A;  4QCL A;  3LQV A;  3I56 S;  4KPY A;  3BV8 A;  4J9Q A;  3BGO P;  1YBU A;  1RXO B;  4H4O B;  4USH A;  2QC3 A;  2RHS B;  3G6E S;  1NEE A;  3KLF A;  3CCV S;  2FZK B;  4AT1 B;  2GVD B;  2B5J B;  2JC1 A;  2VPW B;  3MMA A;  4DQR A;  1HQU B;  3HVA A;  5D4P A;  4F02 A;  2DIT A;  3JAM U;  3TVY A;  2VA3 A;  4B3R F;  2OKQ A;  4C4W A;  4QR1 A;  5KFN A;  4FF4 A;  4LFC F;  1FXR A;  1B0V A;  1VK3 A;  3IMQ J;  3VR1 A;  2Y8W A;  3MD3 A;  3OTC A;  1TL7 B;  1NPK A;  1VRT A;  1S99 A;  1VDH A;  3TO8 A;  4JI8 F;  2HZA A;  3HD2 A;  4UQG A;  4AFF A;  2R7X A;  3TNV A;  1LWX A;  2RRN A;  2XMV A;  5MLC V;  2MKJ A;  3MFI A;  2L3M A;  4QR2 A;  1LNQ A;  2P5V A;  1U25 A;  4HTI A;  2HQ3 A;  2AJ2 A;  1ARO P;  2PC6 A;  2QO3 A;  3T41 A;  1AUS L;  4QPT A;  2XWY A;  4CP5 A;  3EE3 A;  4C48 A;  4J9K A;  1PSD A;  4X62 J;  2ZWO A;  3FCV A;  1U49 A;  2BRK A;  3CO0 P;  2HFO A;  4DL2 A;  4EBE A;  1OJ4 A;  2VOO A;  1PBU A;  1V6H A;  1X0P A;  2AX1 A;  1NSQ A;  2D9P A;  5H9F J;  1VC0 A;  5K20 B;  2YWF A;  4J9M A;  2G1D A;  2YQ3 A;  5EX0 A;  4TNO A;  1JLE A;  4FNH A;  1FJC A;  4DWI A;  1LK5 A;  1LWC B;  4GC6 A;  4DLE A;  1Q8L A;  2E5H A;  2I6W A;  1YTY A;  1HW9 A;  1RAH B;  4YB7 A;  3TAM A;  3W62 A;  3GV8 B;  2MKH A;  3M9M B;  4HTJ A;  5LXY A;  2RQK A;  2IAJ A;  3BZQ A;  2VKZ G;  4J7C A;  3MUR P;  4K4U A;  1WEY A;  4P52 A;  5BYR A;  3TQE A;  2HHH F;  4TQR A;  1NK6 A;  3Q2T C;  2WOM B;  1KVI A;  2D1C A;  4UY8 5;  1UCN A;  4FKX A;  1R31 A;  5CYM A;  4JBC A;  3OW2 R;  2DNG A;  4ZP6 A;  4QWA A;  1U6B A;  1N5T A;  4DV3 J;  1SKU B;  4LFB F;  1DLO B;  2BQ3 A;  4Y65 A;  2POK A;  3K59 A;  2R9L A;  4ZLN A;  1FKP B;  1YRX A;  2E7W A;  4AND A;  1OY6 A;  2W2M P;  3OL8 A;  3HHE A;  3UDV A;  5L39 A;  1M90 T;  4OL8 A;  2ZH7 A;  5IT0 A;  1H73 A;  3IRW P;  3PFO A;  3CCL S;  1ZTT A;  4ILR A;  1VC6 A;  3L95 X;  2HFZ A;  4RNM A;  2LKZ A;  3CCS S;  3R7S B;  1PC5 A;  2EFV A;  1LWF B;  1KFS A;  2QIF A;  2AJQ A;  3MEK A;  4L73 A;  3P49 B;  2H5I B;  2F5G A;  2X3D A;  3RB4 A;  1GK8 A;  1YG0 A;  2MKS A;  2OPP A;  2FJE B;  2QN6 B;  3BGR A;  3LGN A;  3VHQ A;  1TQL A;  3N01 A;  1WC4 A;  3W2W A;  2NPI A;  1TK8 A;  3HVW A;  2DHH A;  2UP1 A;  3AD7 C;  3X1L B;  2AU0 A;  3A8E A;  3MMC B;  2HHX A;  2HLU A;  3VVT A;  3TA2 A;  2X1F A;  3TVZ A;  3CCR S;  3W65 A;  2JLF A;  2X7I A;  2JFK A;  3LP1 A;  3VV2 B;  5CYJ A;  2G9O A;  3CTR A;  4WK1 A;  1HR0 J;  5DDR C;  2UUA F;  2GX8 A;  1H0H B;  4JB8 B;  4CTA B;  2BJ9 A;  3QGP A;  5G4D A;  2KT3 A;  2C2Z B;  3V6D B;  1KQG B;  1LFW A;  3KDO A;  3QZ8 A;  1L3K A;  2FZG B;  1F0X A;  2BBE A;  2RE1 A;  3P96 A;  3DRX A;  4AQY F;  2GQC A;  3AB2 B;  5A0Y B;  1Q16 B;  1R27 B;  2XLI A;  3P5T L;  3THT A;  2B8Q A;  2VPZ B;  5M2P A;  1FRH A;  3PG9 A;  2GNK A;  1RBA A;  1SJQ A;  1TL1 B;  4QIF A;  2LEC A;  3B6B A;  2MY8 A;  2GFF A;  4BWJ A;  4HT5 A;  3ZTR A;  4DV3 F;  3W9H A;  4LF4 J;  1GMV A;  5IM0 B;  4X64 F;  1F9F A;  3AOB A;  3MAA B;  3J7Y U;  4CT8 A;  3RG6 A;  3RZA A;  1RI7 A;  1DTT A;  4X4R A;  3H5Y A;  2J6U A;  4BBY A;  3C6T B;  5ETP A;  5L9N A;  5A6P A;  2MKY A;  2AJ1 A;  3LW5 C;  2LEP A;  4KYZ A;  1YJV A;  3PY8 A;  4U7U D;  2VUG A;  4ICL A;  2XMJ A;  4NEY A;  3OFH A;  4C8M A;  5HQL A;  3J80 U;  2N3O A;  3CC2 S;  2HBR B;  5I42 B;  2FJB B;  2OUG A;  2FJD B;  1SKW A;  5HI7 A;  3G9C A;  4WE1 B;  3VWS A;  1HQ2 A;  3W63 A;  2CNO B;  1YDL A;  1QVF R;  1C0T B;  1JNZ B;  5KFV A;  4ZLJ A;  5K8N A;  3OXG A;  3M2U B;  3CCM S;  2UXC F;  2UU9 J;  1FVS A;  3LA0 A;  3DM2 B;  4OX7 A;  3TUJ C;  1LXJ A;  4OZ5 A;  5A8W B;  4Y2C A;  4O3Q A;  2BM0 A;  2M88 A;  4JI2 J;  5B0A A;  3EWG A;  2NR0 A;  1S77 D;  2HW3 A;  4ZDN A;  4AUK A;  3MAQ A;  3K7R A;  1JLG A;  1R43 A;  1I51 B;  2LCW A;  4U8Y A;  2FHM A;  1SQG A;  2AJ4 A;  1QSS A;  1PC4 A;  4LIW A;  3DLG A;  2OEK A;  4HH0 A;  1U2C A;  1J5E F;  4JYA F;  3DGP B;  2DGS A;  1RHR B;  2HBZ B;  1IR2 A;  4I7F A;  4W98 A;  1SB6 A;  2B56 A;  2OEM A;  1EQ0 A;  2K06 A;  1JWW A;  3HFZ B;  3SZ2 A;  2GML A;  1U2R A;  4NML A;  3RB6 A;  2XNR A;  1KOO A;  4FXD A;  4ZVU B;  3PZP A;  3RAM A;  5J2M A;  1L3T A;  1G3O A;  4LVN P;  2BJ7 A;  1TKT B;  1WSR A;  2BUN A;  3PTW A;  5I3P A;  2HHS A;  4OMF G;  1S6P A;  1TTH B;  4RUA A;  3JTN A;  5D78 A;  5I4M A;  5F8M A;  1HBN A;  3US5 A;  2ASL A;  1YZ6 A;  2KRB A;  3KK2 B;  1WOS A;  2R3V A;  1CBK A;  4M5I A;  1Y00 A;  3VGT A;  4NL5 A;  6AT1 B;  4LQ3 A;  1E6V B;  3D6H B;  2M4M A;  3V2U C;  3MCM A;  1M5V C;  5ETO A;  3MI7 X;  4LBP A;  4CLU A;  1CQN A;  1HL6 A;  2XS2 A;  1FEE A;  1GT8 A;  3FBC A;  2VF3 A;  3MMC A;  1A0O B;  4P72 A;  1BXN A;  3OTO F;  2R8I A;  5LMN J;  1ZH5 A;  1FRJ A;  1NXI A;  3CT9 A;  2W9C B;  3Q0A A;  2OFG X;  3DDN A;  2ABY A;  3UR3 C;  1NHV A;  1GX6 A;  4DS4 A;  1YJN S;  3MM9 A;  2BDP A;  2GCF A;  3T6B A;  3X3U A;  4DR4 F;  4LF9 J;  4TU7 A;  1A9N B;  1LW0 A;  4TXS A;  4WWS A;  3MUV P;  2ZDO A;  1F9E B;  1WC3 A;  4IQX A;  2KXF A;  4L76 A;  2VDI A;  4QBU A;  1I94 J;  2KJV A;  4JV5 J;  2VU5 A;  3KK1 B;  4N76 A;  4BLG A;  5F9L A;  3LOU A;  5E5N A;  2NLW A;  1NK0 A;  2FQQ B;  2H5E A;  2H1Y A;  4RUH A;  1Y10 A;  3G71 S;  3R5G A;  5D0R A;  5FDL B;  3OSP A;  3B78 A;  1S0O A;  4GKK J;  1AUD A;  1Q95 G;  3CF5 Q;  4C0B A;  1M0S A;  4U7U K;  4C3K A;  5GAD U;  4L3N A;  4FF2 A;  4X4T A;  1HFE L;  1UJ6 A;  2RAQ A;  3DMJ B;  3NCQ A;  3HUL A;  2HBY B;  3QNW B;  3LP2 B;  2FYX A;  3P3D A;  1KTV A;  3D66 A;  3QGG A;  2V63 A;  5EHH A;  3E2E A;  2MQN A;  5ADZ A;  4OHX A;  4WBF A;  3NRB A;  4EUV A;  1T03 A;  1H2U X;  2JL9 A;  3V81 B;  3TAN A;  1VK8 A;  4FVC A;  2RJZ A;  3LAL A;  3QMQ A;  4G1P A;  3NCP A;  1CJK A;  5C24 B;  1S7I A;  2VBW A;  1VQM S;  1KC8 T;  1OMS A;  1B3T A;  2R7T A;  2I5J A;  4U8V A;  3GIR A;  4ZVS B;  3MUT P;  2FJX A;  3TYT A;  1AZS A;  1UL3 A;  4ZCI A;  3EZU A;  3NKY A;  4ZLL A;  2K7K A;  4FKY A;  4NLQ A;  4NLT A;  2RKI B;  2ADB A;  2BQR A;  2IM2 A;  3A3P B;  4YP3 A;  2VQE J;  5E41 A;  3ENQ A;  3JQK A;  4IOC Q;  1PYO B;  2ZBI A;  2DH8 A;  3DI6 A;  3MTK A;  1S1V A;  1S12 A;  2A10 A;  4C3M A;  4CZC A;  5KFE A;  2OEJ A;  2BJD A;  1UPM B;  3GIM A;  3G2X A;  4IFY B;  2MHE A;  4TU8 A;  4CDI A;  3UO0 A;  4LRD A;  2Y1I A;  1HNZ J;  1Q81 T;  1XR6 A;  2AHO B;  1FJG F;  2Y8Y A;  4B3R J;  1HD0 A;  4DV7 F;  1HYS B;  1E6Y B;  4FYW B;  3EGN A;  4OZ0 A;  1VHF A;  4LSL B;  3NLC A;  4C98 A;  1B7Y B;  2HHW A;  3SBM A;  2KVQ E;  3OVS A;  2V2Q A;  4ZP9 A;  4WFA Q;  1JLF B;  4DSI A;  2Q1L A;  2EKY A;  2NYI A;  4RW7 A;  1REV B;  3V4M A;  2YVS A;  2KG1 A;  5HLF B;  4K7Q A;  2J9C A;  3FCW A;  3D68 A;  3CUN A;  2ZH5 A;  1HWK A;  3CJS A;  2VG5 B;  1WC5 A;  2W25 A;  4PWU A;  4C3L A;  2VIH A;  1PGZ A;  5ETK A;  4ANE A;  3ZFV A;  2N82 B;  2E7V A;  2JVO A;  2WON A;  1VYA A;  2HMI B;  4NMX A;  3PO4 A;  2FPH X;  3I87 A;  2B9W A;  2D9O A;  4C2M A;  2DRD A;  4OX9 J;  2NZC A;  4ZIW A;  2RS8 A;  2PI5 A;  1P6T A;  5IWA F;  1IWA A;  4KE5 A;  1HBO A;  3VAH A;  5D4N A;  4GO5 X;  1ZZF A;  2XWX A;  4ZPW R;  3MPU B;  3O5T B;  3BBC A;  3KHL A;  4G6V B;  2IJR A;  3UDL A;  3QAE A;  1HNX F;  2EC2 A;  3T1Y J;  4P7T A;  3R9L A;  2GJF A;  1C4C A;  4YME A;  5CAA A;  1IQZ A;  3H42 A;  3D5M A;  4K4T A;  3ULH A;  3NS7 B;  4EZ9 A;  2PGC A;  4OJ1 A;  2B9X A;  3BKU A;  5DLG A;  3N6N A;  4WXW A;  4DPY A;  4LF9 F;  1IBM J;  4OYX A;  2KTQ A;  2K3K A;  2VON A;  4QW9 A;  1APS A;  3KLG A;  1EZZ B;  2XBP A;  3FEY B;  3AXM A;  3H2V E;  4KH1 B;  2GAG C;  3KUG A;  2AJ0 A;  2QA1 A;  2OAU A;  3ZZZ A;  1F1B B;  4AYB D;  3VZH A;  5LOQ A;  2CQP A;  1RWU A;  2XYH B;  2ACY A;  1P27 B;  4O3S A;  3D6T B;  4DU7 A;  2OGU A;  4HVZ A;  4YHH J;  3HX9 A;  1N5Y A;  1NPP A;  2QGF B;  2ZBQ A;  1UPP A;  3G82 A;  4OJ3 A;  4U96 A;  3UWT A;  5KTQ A;  4NRT A;  1QSL A;  2J6T A;  4ILM A;  3CJK A;  2MKK A;  4FNI A;  4ENO A;  5HP1 B;  2IC3 A;  2J76 E;  2YWE A;  4DUZ J;  4IG0 B;  4YY3 F;  3DFE A;  4PUO A;  3AXK A;  2CNK B;  2XM3 A;  3CJ0 A;  5KOX A;  3PW2 A;  2J0Q D;  2PE8 A;  4RPF A;  3S8S A;  3WC2 A;  1YX2 A;  4DSF A;  2YX4 A;  2E1R A;  3IS9 A;  1N54 B;  4ZVT B;  3Q23 A;  3T5J A;  3RAX A;  2BAN B;  4PYA A;  2F1F A;  1CG2 A;  4O4G B;  4DR1 J;  2AGO A;  2YQ1 A;  2BOP A;  1HBM B;  4PG7 A;  2W01 A;  2CPI A;  2QA4 S;  3W64 A;  5G0R A;  2FVQ A;  2E9R X;  3NOG A;  3UDE A;  5L9X A;  4ZPT R;  3A1Y G;  2MGZ A;  2YKP A;  5HJX A;  1C0T A;  3KUH A;  2BJ8 A;  2C1E B;  4HH1 A;  2JDJ A;  5D0H A;  3AJ1 A;  3PDN A;  2NUH A;  5FJ4 A;  2YNG A;  2R2R A;  2C3U A;  4DMZ A;  3Q8Q B;  1S0N A;  3M6V A;  2BE2 B;  1RA6 A;  4Y2M A;  4USI A;  5EWE A;  3IG1 A;  1JJ4 A;  3CC4 S;  2HEK A;  4ED5 A;  1VBZ A;  3M1V A;  2MMY A;  4OYM A;  2IPO B;  1C2P A;  3ETO A;  1PCA A;  1HWJ A;  1X5T A;  1Z1Z A;  3ZNJ 1;  5IC6 B;  3U02 A;  1Y3K A;  3VAG A;  2A0F B;  3HHL D;  3E8O A;  4CI0 B;  2GZO A;  4LFC J;  5D8H B;  2QA4 G;  4FBU A;  4P71 A;  4ZJO A;  1RKI A;  1CJU B;  1RTZ A;  1R0B G;  3SYZ A;  2G0C A;  2ZVI A;  3BO2 A;  3D54 A;  1RTD B;  1I3O B;  4BS2 A;  2C2N A;  2CWK A;  2D69 A;  3KJV B;  4PG5 A;  3OR1 A;  3D28 A;  2WK4 A;  1MRO A;  3TA1 A;  4IO1 A;  4YY3 J;  4IUF A;  1J27 A;  1VRU B;  1WHV A;  2GGP A;  3CJ2 A;  4DQP A;  4I64 A;  4IR9 A;  2KZZ A;  5CZV A;  2O66 A;  3QSI A;  4QIE A;  4ETZ A;  3MED A;  2C2D A;  1P1T A;  1PBA A;  3HSJ A;  2G2Z A;  2AGP A;  4JI6 J;  3GSI A;  1BQN A;  2H4Y B;  5KG6 A;  4MKB A;  4ES2 A;  3N9U C;  1NKB A;  4K4Y A;  1X60 A;  5AE3 A;  3EZ5 A;  3K5N A;  1V9O A;  1HNI B;  4WII A;  3IBW A;  4DR4 J;  1HNV B;  3EVW A;  3CDA A;  2KN4 A;  4ALZ A;  2YWH A;  2XO7 A;  6FDR A;  2OPR B;  3NGU A;  4LVO P;  4M5M A;  2GJI A;  4DSL A;  4YOE A;  4EYI B;  3QT8 A;  1U2F A;  5F8H A;  1JNR B;  3GFY A;  4G1Q B;  3F56 A;  4O3P A;  3T1A A;  3GTY X;  1WI6 A;  2EBG A;  3R8Y A;  2C22 A;  3QJJ A;  1LWF A;  2CQB A;  3ILL A;  3O6Q A;  1RT6 B;  3HKZ D;  1RHK B;  5M2R A;  3CVK A;  3T1H J;  2J5A A;  1R0A B;  4OIX A;  1J5E J;  4JYA J;  5E7O B;  2AMC B;  1S4F A;  4USK A;  4B9T A;  2YKM B;  3LP0 A;  1DTQ B;  4QYR A;  2OSQ A;  2CNL B;  3K57 A;  1TFY A;  1XMQ F;  1IM4 A;  2CPX A;  3HHL B;  4LR8 A;  3B4D A;  4GO7 X;  4MFB A;  2V4R A;  2PO4 A;  2KFZ A;  1UEK A;  4DHV A;  2GVZ B;  1R8P A;  2ZE2 A;  5HJY A;  5M2U A;  1K1S A;  4CLZ A;  4NLD A;  3EVO A;  4TY8 B;  2C3O A;  4Q0B B;  4IKA A;  5D0E A;  3HVT B;  4MIA A;  1VQY A;  5GME A;  1JB0 C;  2B6A A;  2GW8 A;  1ZS6 A;  3M6U A;  1D09 B;  3V4I A;  3I9Z A;  3BBF A;  3TEG A;  2AYG A;  2VJU A;  1YWX A;  2HGM A;  2JEF A;  3E01 A;  5DM6 Q;  2HAI A;  5DS7 A;  3KFW X;  2LXF A;  3GLJ A;  1CJT A;  1RTI A;  2E1M C;  4G3I A;  5C5J A;  4IH6 A;  3MEC B;  3HLU A;  3K89 A;  4EI2 A;  5AXL A;  3KHH A;  3FMW A;  1X5P A;  1LWE A;  1UWA A;  2XLK A;  2BR0 A;  1RAG B;  2BM1 A;  3IAS 9;  1ZA2 B;  4J9V A;  1UA0 A;  2VKR A;  2CJX B;  2CQC A;  2D74 B;  1RJJ A;  2KDO A;  3D4J A;  5IC4 B;  1ZET A;  1N33 J;  3HHK A;  5H9E J;  4FF3 A;  3MM6 A;  3I5C A;  2K1R A;  1HHS A;  3PYF A;  5EWF A;  1N6Q B;  3T5H A;  4B3M J;  4GC7 A;  1Q86 T;  4LFA F;  5CAB A;  3KK2 A;  2MSS A;  3I31 A;  3N5B A;  4YR3 A;  1S1U B;  1WDT A;  2WHO A;  3DOM B;  4R0E A;  8AT1 B;  1N36 J;  1F2H A;  2F63 A;  3BEG B;  4I1T A;  3IWN C;  2ZH3 A;  1UJ5 A;  3R5B A;  3T3F A;  1S1X A;  5T7L B;  2AWZ A;  4ECW A;  1DQ9 A;  4FN5 A;  1FKA F;  1VQK S;  1HA1 A;  3I6P A;  4QR0 A;  2HBQ B;  3RW7 A;  2YBV A;  3JXO A;  1B4S A;  1FKO B;  4DBQ A;  1T8E A;  2E5L F;  2XYG B;  2V8P A;  4IO9 Q;  4DSJ A;  4K0K J;  2DYA A;  4FDF A;  2ZM6 J;  2AZ1 A;  2XMM A;  1QSY A;  2LFV A;  3MEG A;  2GHW A;  2V8G A;  2ASY A;  4R25 A;  3S7R A;  3W5Z A;  1NRK A;  2ZC3 A;  2LEB A;  2R8K A;  3NP5 A;  4UQT A;  3SDE A;  4DUY J;  1R6V A;  4DG1 A;  4DV0 J;  4F7V A;  2FY8 A;  5KFY A;  2XY5 A;  1U24 A;  3R7B B;  1WUU A;  3M8Q B;  2VJV A;  2GV1 A;  3PJ9 A;  3BF4 A;  3P45 B;  1S9F A;  2MST A;  3GU0 A;  1PYT A;  1N8R T;  2JVR A;  3ISZ A;  1OO0 B;  3DKD A;  9ATC B;  4DPO A;  4LR7 A;  1X4D A;  2EEY A;  2AV5 A;  1UTA A;  2Z8Q A;  3MM5 A;  4OQJ A;  1TAU A;  3QO9 B;  4GVB A;  4K5S A;  4FPI A;  4PXE A;  5F8N A;  1ELO A;  4OYW A;  1TEL A;  4P10 A;  1XBW A;  5F8I A;  1NO8 A;  2R2S A;  1IJE B;  2F7V A;  5CXT A;  4H4M B;  4J9U E;  1S76 D;  5L8R C;  2UV8 G;  1MML A;  1D9D A;  4KIA A;  3QIP A;  3F73 A;  2M70 A;  2F9D A;  4J5O A;  5DDO C;  3FVY A;  4DL4 A;  3PJW A;  3FRZ A;  2ATC B;  2XMK A;  1YIT S;  1BLU A;  4YR2 A;  4ZJL A;  2HG4 A;  5FLX Y;  2DIS A;  3NGD A;  3KLH B;  4B9N A;  1SC6 A;  2E29 A;  3ENA A;  2DNL A;  1OYD A;  4CO1 A;  3JYT B;  4IRC A;  4OHV A;  4ZHR B;  1KEK A;  4EBD A;  4F3Q A;  3MCS A;  1Z2Z A;  2QFI A;  1BWE A;  1VCT A;  3AB4 B;  4RW4 B;  2ZWP A;  1TVR A;  3BYP A;  4KHP F;  1WG4 A;  1MW7 A;  1HNI A;  4PR6 A;  3R7N B;  3SCK E;  4CCH A;  2DIV A;  4CNZ A;  5LXR A;  3QGI A;  1DZ5 A;  4WPA A;  5IQQ A;  2O1P A;  4QJV A;  2HNY B;  4CWB A;  2MQO A;  2OIH A;  3KG1 A;  4O3R A;  5E3A A;  1VR6 A;  1IR0 A;  1S9E B;  2F9J A;  3OXL A;  4AE5 A;  4M5G A;  3K58 A;  3W5Y A;  2U1A A;  4M63 A;  1BWV A;  3ZZY A;  2NXE A;  2WVD A;  4C8K A;  4WZQ A;  1HQE A;  1VIX A;  2CPY A;  3KLV A;  2XCP A;  3R5C A;  4OYZ A;  4MK8 A;  2EG2 A;  5DDP C;  2RDJ A;  2ZKU A;  1FFW B;  2VPY B;  1T05 A;  2QZ8 A;  2V4J B;  4CLL A;  2J0S D;  4OJH A;  4NCG B;  4EWT A;  3AT1 B;  4ZN1 A;  3D1Q A;  4K59 A;  3EDQ B;  2XSJ A;  5L1I A;  3SV3 A;  2I1R A;  4DSE A;  4BC7 A;  1SUQ A;  2DNM A;  2ZH4 A;  3IM8 A;  3J80 Y;  4FVM A;  2F4F A;  3ENW A;  5HO4 A;  3BGL A;  4GMK A;  5HRO B;  3V81 A;  1YIJ S;  3D3C J;  4CYU A;  3GP9 A;  3IBF B;  1OPZ A;  3TOQ A;  3LAM A;  4B3S J;  5KFW A;  4V19 X;  2QFJ A;  1QE1 B;  4TKT A;  1G6B A;  2A3J A;  3CW2 C;  4OZ1 A;  1UJ4 A;  4HAC B;  5E0O A;  5GAD I;  3HT0 A;  2D3O R;  2FVP A;  4LF5 J;  3IWL A;  3FKB A;  3WZ0 A;  1YJ7 A;  2DIU A;  3FUY A;  4ID8 A;  4H4O A;  3CJ8 A;  2XY6 A;  4PG8 A;  1XMB A;  2RSQ A;  2YNH A;  4K0K F;  2J9D A;  3ONQ A;  1Q5Y A;  4ILL A;  2R7U A;  1VQN S;  3FK4 A;  4WTO B;  1WTF A;  4LSL A;  1T0T V;  1H7W A;  4ZS6 A;  4AQY J;  2W8L A;  1AB8 A;  1MSW D;  1QAJ A;  2CZ9 A;  3I9V 9;  3WX8 A;  4CYU B;  4IH7 A;  4ED7 A;  2PMZ D;  4FS1 A;  2WCX A;  3QFH A;  2B51 A;  2VHG A;  2ZZM A;  3J7A 1;  2EK6 A;  1SXL A;  1KWM A;  3CSK A;  1WHW A;  3ILJ A;  3IR6 B;  1Q4R A;  1P1L A;  2IRU A;  1X4A A;  2VFU A;  1BY9 A;  1EET A;  1RDR A;  2WAQ D;  4IYQ A;  3UNY A;  1U1R A;  4P74 A;  4CQ1 A;  4B08 A;  5KFK A;  4RU9 A;  1WOO A;  4YB6 A;  4PKD B;  2O3D A;  2Z57 B;  3FEZ A;  2DVI A;  3UE2 A;  4CT9 A;  5H1S V;  1VOM A;  1XEZ A;  3CGI A;  2L48 A;  4OYA A;  2MQM A;  2RF2 B;  4WP9 A;  3JSB A;  1YHQ S;  4B3O A;  4J90 A;  1FRL A;  2F8M A;  3M05 A;  2XS7 A;  4ZPB A;  2GIQ A;  3S6E A;  3VCD A;  3NAH A;  2FZC B;  1RAE B;  2UUW A;  4KKO A;  1DQA A;  3KLE B;  2OI2 A;  2CZV C;  1RTH B;  2HVZ A;  4RW9 A;  2UV8 A;  2BJ3 A;  1DTQ A;  1PJ6 A;  4DV4 J;  1D3W A;  3THV A;  1PAE X;  3K5L A;  3UVJ A;  1RAO A;  2D7S A;  2DHS A;  3KJF B;  3W60 A;  2KH9 A;  1U45 A;  2HGN A;  1RT6 A;  2QV6 A;  2V9K A;  4DPU A;  2XGQ A;  3M9O B;  2JNJ A;  2IA0 A;  2CQ4 A;  2VBZ A;  5K5M A;  4Q2M A;  3HK2 A;  4HHU A;  4CO0 A;  4W92 B;  2IMO A;  4OI3 A;  2JJ4 D;  8RUC A;  5J2N B;  3KLG B;  1QDU B;  2C28 A;  2G2Y A;  5HK4 A;  5HSP A;  5HMY A;  4B3T F;  4HT7 A;  1L5U A;  1I6J A;  4L3K A;  1IBK J;  4ECT A;  4ZVP B;  3KLE A;  2E1P A;  1QTM A;  1KSP A;  4JI3 F;  2DRB A;  2RIL A;  1W2B R;  1NBE B;  3B54 A;  1HNX J;  2R42 A;  4H54 A;  4CLS A;  2VBY A;  5HBM A;  2FVR A;  3GFZ A;  3P4U B;  1CJU A;  3QWU A;  3T19 A;  4F04 B;  2W4P A;  4XTT A;  2ALZ A;  1GXT A;  2CYY A;  4YR0 A;  3OPK A;  2VAS A;  2RNE A;  2Z56 B;  5HMX A;  2MQP A;  4KO0 B;  5CD4 H;  1JKH A;  1BGX T;  1T9W A;  2O01 C;  3E01 B;  1Q7L B;  2W9C A;  2D3O 1;  1HR0 F;  2UUA J;  1CJV B;  4ID5 B;  2QL5 B;  2D41 A;  5HVF A;  2ZZT A;  5ETT A;  2ZBR A;  4K4X A;  3UN3 A;  3NXZ A;  1VQO S;  3MMB A;  4Y6I A;  1PKU A;  2Z2L A;  3NGS A;  2EVZ A;  2MYF A;  3SCI E;  3LPY A;  3QO9 A;  1RK8 A;  3EPG A;  1MNE A;  2V68 A;  3BB5 A;  3FCH A;  3M6W A;  3L7O A;  3W61 A;  4DR3 J;  3J7Y I;  3Q24 A;  1Q0N A;  4LF6 F;  2HWT A;  2CQI A;  3GJR B;  4M5N A;  1RHQ B;  5G0R B;  2E5L J;  4JI1 J;  1FF2 A;  1REV A;  2UXD J;  1U1M A;  3MDF A;  3CXC R;  2F4V F;  5K8O A;  2HHT A;  2IDE A;  3GII A;  2FLN A;  2N7C A;  2W1B A;  1MU2 B;  1NDK A;  2HFS A;  1S6U A;  2ZBP A;  4K2X A;  3OFF A;  4OLP A;  1NME B;  2VOD A;  2KKH A;  2XTJ P;  4DUT A;  3OVA A;  3RB0 A;  1RKJ A;  1PJ7 A;  2X1B A;  3IG1 B;  1RP5 A;  3O3L A;  1NSA A;  4HDG A;  3W9J A;  1ZA1 B;  2WVC A;  4DOZ A;  5GAE U;  2RQC A;  2HHH J;  5KG3 A;  3CE8 A;  3POT B;  1S6P B;  3RBZ A;  4UTG A;  2J9E A;  3QLH A;  1RWN B;  4ES1 A;  4RW4 A;  3OBI A;  3CED A;  3CO9 A;  1X4H A;  1V3S A;  4EK2 A;  5JVH Q;  3W9I A;  1ZAV A;  1U48 A;  3MTJ A;  4FXV A;  4ZVH A;  1D1U A;  2CJK A;  2H65 B;  3MCN A;  2W9B A;  3THP A;  1SI9 A;  3QSY B;  4QYZ K;  1FTR A;  2CPJ A;  1T9T A;  4NLY A;  3OR1 B;  2QYG A;  1W7W A;  2HIQ A;  2CPZ A;  2CNN B;  4CLY A;  2AF6 A;  3A8J A;  4P2S A;  2GS8 A;  5A2Q U;  2J0X A;  2Q3P A;  3MEG B;  4OI0 A;  5KFO A;  1AFJ A;  3TRG A;  1RBO B;  4CO4 A;  2J0W A;  2BW7 A;  2MTL A;  3H8Y A;  4G1I A;  3I55 S;  3HHN B;  3TJ8 A;  1U4B A;  1FD2 A;  1VLO A;  2DNO A;  3MUM P;  2K1R B;  3Q89 A;  1BQN B;  5A8K B;  3LH2 S;  1EJ7 L;  1HBU B;  1KON A;  2IBO A;  2VZ9 A;  3P5B P;  1RT1 A;  4GVL A;  1FK9 B;  4O4R A;  4WYW A;  2BRL A;  4NLU A;  3PIP Q;  3NEK A;  1UET A;  2ZOM A;  4RW9 B;  1ZM4 A;  4EMD A;  2YKN B;  1O5J A;  2M3D A;  4EYH B;  3MR7 A;  1IJF B;  1S79 A;  2DY9 A;  2JOQ A;  4X4U A;  4KHP J;  3AJD A;  3EX7 B;  1HBO B;  1RAA B;  3LP2 A;  4C11 A;  1CEZ A;  3T6J A;  1DQ8 A;  3I0S A;  1X4C A;  2HFN A;  4Y00 A;  2I8E A;  4B02 A;  5AE1 A;  3G8S A;  2J9D E;  3AD8 C;  1XMO J;  3CD0 A;  2LU2 A;  3M8Z A;  1HLW A;  2HKE A;  4B17 A;  4Q45 A;  2XO6 A;  2VL1 A;  4A8W A;  1LOU A;  3KHG A;  2W7A A;  3D6F B;  1M5P C;  1VJW A;  2FIU A;  2FLO A;  3EM1 A;  1BQM A;  1KLN A;  1NZ8 A;  1VGY A;  2WB4 A;  4KGM A;  1KVK A;  4PPZ A;  3BJY A;  2WVF A;  4QIV A;  4Z37 A;  4R5P A;  3H4D A;  4LSN A;  2MJN A;  4O3N A;  3L09 A;  4WP3 A;  5T14 A;  2RRA A;  1A7G E;  2NRE A;  3G8Q A;  1GNK A;  4MAK A;  4WJB A;  2VDH A;  1FWP A;  1WJ9 A;  3QGH A;  5E3P A;  2VIC A;  1WSV A;  2VFR A;  3SMZ A;  3KUE A;  1RT7 B;  4DV7 J;  1JKH B;  4MYU A;  3GON A;  2QL9 B;  2BE2 A;  1P9Y A;  3MM5 B;  2BQU A;  2IMW P;  2HND B;  1RT3 A;  3TUP A;  2SXL A;  4M5D B;  4WFZ A;  2WTF A;  4O23 A;  4CM2 A;  2HUR A;  3CB4 A;  1SH0 A;  4URG A;  3OLA A;  3N4W A;  2LXI A;  1IKX A;  1LW2 A;  4IFY A;  4ECR A;  4EEY A;  3PEJ A;  3KNA A;  4QIG A;  1HBN B;  1FES A;  4Z7Y A;  4ZPC A;  1SJ1 A;  4URQ U;  3RW6 A;  2YWW A;  2IVF B;  4EO6 A;  4NPO A;  3D1O A;  3R97 A;  5IV4 A;  5C42 A;  4UOH A;  3OL9 A;  2BJ1 A;  2A1B A;  3ILO A;  3G6X A;  4ECX A;  5IWA J;  4DXL A;  3KLI B;  4KQZ A;  2WW8 A;  5HMZ A;  5ETV A;  2YWG A;  5KFX A;  1TL1 A;  2ERR A;  3AQO A;  1UZD A;  2F3J A;  4JI2 F;  4V19 J;  3EGZ A;  3QQC D;  2KVI A;  4QWE A;  3ETM A;  3GIK A;  3R2C J;  2XYP B;  2J8S A;  2J7U A;  1S5Z A;  1U1L A;  4PG4 A;  5GAH I;  2KYZ A;  2FJV A;  3C16 B;  3ELH A;  2DHG A;  2HS3 A;  4IG3 A;  5BR8 F;  3ZZU A;  3DOM A;  2P2C B;  1RAI B;  3PX0 A;  3ZC4 A;  4JI0 F;  3ZZP A;  2MLY A;  5AJ3 F;  1H3D A;  5D3G B;  2IVM A;  4DN9 A;  3PKM A;  3BH7 B;  4FF1 A;  2ZC4 A;  3E3X A;  4KJI A;  1TMJ A;  4RJV A;  4J37 A;  2AT1 B;  5J2Q A;  3FJ2 A;  1N6Q A;  1ZAX A;  1QY7 A;  2DH7 A;  5D4L A;  3TZX A;  1N33 F;  2QL7 B;  5EUH A;  4OX8 A;  1FJG J;  1PG5 B;  5DJB A;  4ZKA A;  3M2R A;  1NM2 A;  3W2V A;  1H7X A;  1RAD B;  1FER A;  1R89 A;  4OHW A;  4C0O C;  4ZHR A;  5DQI A;  3PRV A;  1RU2 A;  4ECY A;  3JB9 k;  3PRD A;  1JLC A;  1F3V A;  1MRO B;  3L9Z A;  5KFS A;  2R7Q A;  2DNY A;  3RBD A;  3BKF A;  3C8Y A;  3C15 B;  5A0Y A;  4JV1 A;  2UVW A;  2OD6 A;  2HQF A;  5LJ3 Y;  2FTR A;  1TV6 B;  4Q8E A;  2D3U A;  5DZ6 A;  2ZDP A;  1UFW A;  4X65 F;  3K5P A;  2PFD A;  5C2C A;  4QU6 A;  5KG0 A;  5J1E A;  4RWX A;  5HAN A;  2ILY A;  4DCJ B;  1JK9 B;  2DNQ A;  2QE5 A;  1IBK F;  4MFB B;  3KMQ A;  2DY1 A;  3MM8 B;  3RAQ A;  4A8Y A;  3H5X A;  1SL2 A;  4IRD A;  1X9W A;  1M1G A;  1KS2 A;  1SIW B;  1TL3 A;  2APO A;  2HNZ A;  2JZ5 A;  2WOM A;  4FPR A;  4LJM A;  4XIU A;  4DPX A;  1D9A A;  3Q8V A;  3M8R A;  2EFG A;  3I4P A;  2JFD A;  1WG5 A;  1EB0 A;  3M6X A;  5B0D A;  2DCU B;  1RGV A;  3BR8 A;  1JLB A;  2E1C A;  5FII A;  3T9N A;  3GYX B;  1IWG A;  2HQI A;  4B9L A;  2CXE A;  3ZZ0 A;  1TAQ A;  5E3C A;  4ANC A;  1DAR A;  2NXJ A;  3ZTP A;  4NXM J;  2ZNY A;  1D9F A;  1GXL A;  3HSD A;  4OI2 A;  2W8K A;  1NJY A;  4A8Q A;  1FX2 A;  3QYY A;  2DGO A;  3OTB A;  4P7V A;  5ETS A;  3VAF A;  3PYD A;  4ZN3 A;  5E3R A;  1WI8 A;  1R0A A;  1NDL A;  1H2V Z;  4RBT A;  5SUH A;  4RBV A;  2CPE A;  5K9F A;  1RT5 A;  7FD1 A;  3HFV A;  3DDK A;  3DM2 A;  1M5K C;  1HNV A;  1MWQ A;  3GV5 B;  2OD4 A;  3K2Y A;  3DLG B;  1K0V A;  2HIY A;  3TUI C;  1FWL A;  2LMI A;  1PIL A;  1NSP A;  1F5C A;  2NS1 B;  3T5L A;  4MT1 A;  4DFM A;  2U2F A;  3F41 A;  2MQQ A;  1JLG B;  2H5J B;  2X3G A;  2LXU A;  3M32 B;  3QID A;  4ZMM A;  3CMQ A;  2ZH9 A;  3SSS A;  3RRH A;  2RKI A;  1HHT P;  1U1O A;  1NU4 A;  3GR0 A;  4TLQ A;  5ETN A;  5HAT A;  2ZFH A;  4A46 A;  1ZYQ A;  3TZW A;  1XN9 A;  2YH0 A;  2RQM A;  3GFX A;  3RGI A;  2RUS A;  2Y1L B;  2NUU G;  2XZW A;  1IN0 A;  1RAB B;  2ZD1 A;  3ILI A;  3QWP A;  1U0S A;  2LDY A;  1T03 B;  5B09 A;  1KFD A;  4N8N A;  1WWH A;  2OPS A;  1HMV B;  4KY3 A;  5GMK a;  4NCA A;  1JLA B;  1T11 A;  2A18 A;  2VG6 B;  3JQJ A;  3N0V A;  1FXL A;  1QUV A;  2B5J A;  2IHR 1;  2IM1 A;  1U1Q A;  1NPR A;  2OTL S;  1KHV A;  5DO2 A;  1U26 A;  3PIO Q;  2IFX A;  3UW1 A;  3LO3 A;  2KXH A;  4YN3 B;  1RZM A;  3UNG C;  2GVZ A;  3I0S B;  4DLG A;  3D3B J;  4Y2A A;  1NH7 A;  1VIS A;  2ZUA A;  4EO8 A;  3UR0 A;  4DFJ A;  1DY3 A;  4Y2I A;  1IR1 A;  2ZKT A;  3NBP A;  1NND A;  1AT1 B;  2BE7 D;  5D15 A;  5B7W A;  1RU1 A;  5F3T A;  1KVJ A;  3H59 A;  2DNK A;  1OWX A;  5KT7 A;  1F60 B;  3VGU A;  1N5Y B;  3KJN B;  2XSJ B;  1S6Q B;  1VLY A;  5F3Z A;  4PZV A;  1E6Y A;  3MR2 A;  3J7A N;  3M8P A;  2NYH A;  2Z4P A;  3M8Y A;  4K5R A;  3MWB A;  2UVV A;  4QPX A;  2UZA A;  2IA6 A;  3NAI A;  2OJ3 A;  2FHK A;  4WP8 A;  2FC9 A;  3C6U B;  4CLW A;  4OFZ A;  4DUY F;  4PWD B;  4PXB A;  2Z2Y B;  4C0H A;  1MLA A;  2R8H A;  1M5O C;  5CCL A;  5LMN F;  1N88 A;  2PFF B;  2V67 A;  1H98 A;  2HND A;  4N7T A;  3KHR A;  1JJ2 R;  2KXN B;  2RIJ A;  5KT2 A;  3P8B B;  2CQ3 A;  1PO6 A;  2E7X A;  3PFE A;  4ELV A;  4I68 A;  3O8W A;  3CD6 S;  4DPT A;  5DET A;  5ETM A;  4DX6 A;  3PHE A;  4AL6 A;  1VFJ A;  2B4V A;  3IO1 A;  4UST A;  1SKR A;  4NYO A;  3DGP A;  1P8G A;  3I5A A;  3BSC A;  4I6W A;  4JI6 F;  3UD3 P;  1NJZ A;  1BE4 A;  3SSR A;  4JI4 F;  4NXN J;  3UI3 A;  4ZP8 A;  2NCK L;  5I42 A;  1YLX A;  5THW A;  3ZZO A;  1W2I A;  2C2R A;  3TAR A;  1HW8 A;  3EZO A;  4ZPD A;  3GV7 B;  1ZM2 A;  1FCA A;  3PX6 A;  4DPW A;  2NSB A;  5ETR A;  4NXM F;  2IAJ B;  3PV8 A;  1JLQ A;  3BGU A;  3VAK A;  1DLO A;  3OVB A;  3JS9 A;  5DZ7 A;  2FHJ A;  2VH7 A;  3QT6 A;  2ZIT A;  3QIP B;  2H48 B;  1Q53 A;  2BEF A;  1Z4U A;  2CDR B;  3SI8 A;  1NHK L;  1VJQ A;  1Y9O A;  4RW6 B;  3PXG a;  1NJI T;  3QRQ A;  1UAW A;  1OQ6 A;  1V3R A;  4OZN A;  1FDD A;  3O2I A;  3C2P A;  2Y9H A;  2I9S A;  4ED6 A;  5K14 B;  1ZM9 A;  5KT6 A;  1JXL A;  2ZZN A;  1UVK A;  2E5G A;  2OFH X;  1T3O A;  4RKU C;  1HBU A;  4XDC A;  2MGZ B;  2UUB J;  3PVX A;  4UZC A;  2KZM A;  2ZD1 B;  1JLE B;  1IKW B;  1FE0 A;  3TQ1 A;  3JTO A;  3RU0 A;  1S49 A;  5CYQ A;  3IN5 A;  1UFK A;  5HBM B;  5KT5 A;  3KMS A;  3W3S A;  4KB7 A;  3BBB A;  1H74 A;  3CJQ A;  1JLF A;  2PII A;  3LP1 B;  3RJM B;  4BHQ A;  4R8U B;  3NL0 A;  2I38 A;  1RBL A;  3MPW A;  1RWM B;  2LYV A;  4OYI A;  4IDK A;  2PA3 A;  5E33 A;  1XMO F;  4X2B A;  5L1K A;  1RE1 B;  3DGV A;  4JI7 F;  3MMJ A;  2G0I A;  1SJ4 P;  1UZH A;  5HAO A;  4ELT A;  1RB0 A;  3NOC A;  2CAD A;  2HVE A;  1I94 F;  3MEE A;  4GKJ J;  1YBA A;  3U1N A;  1FKO A;  2DKO B;  2KB2 A;  1RHU B;  4ZJQ A;  5AJ3 J;  4DV0 F;  2AGQ A;  4JI0 J;  4JI3 J;  4AXJ A;  5J2M B;  3HZE A;  3DLE B;  2MZQ A;  4CO3 A;  1M1K T;  3DOK A;  1P9Q C;  2M52 A;  1N52 B;  4FYD A;  1JLB B;  4CM0 A;  2E66 A;  4A8X A;  3GCX P;  1EX8 A;  1MWY A;  3HVR A;  2DK2 A;  4ECU A;  3LF0 A;  4C97 A;  4U7C A;  4NCB A;  2QSF A;  3QFW A;  5E3Q A;  4F2S A;  3KLF B;  5A8R A;  2Z30 B;  4F50 A;  1G2E A;  2M7S A;  1MMD A;  2QLF B;  4F4Z A;  1J5O A;  1T9U A;  1TKZ B;  3IR5 B;  3T5K A;  4HKQ A;  4P2M A;  2WSF C;  1U47 A;  2I5J B;  5IT9 U;  4N77 A;  1GMU A;  2Q79 A;  3OR2 B;  4I6A A;  4KGV B;  4Y34 A;  1DRZ A;  1O6X A;  4IFV A;  3QRP A;  2DNH A;  4RNH A;  4BDP A;  2V6A A;  1C1C B;  3PJX A;  1L3U A;  3A12 A;  3CWJ A;  2PEH A;  2BW2 A;  4CLP A;  3IM9 A;  4M5K A;  1XR7 A;  2C42 A;  5KAK A;  2KM8 C;  4X4Q A;  4Y2K A;  3GG0 A;  4H4M A;  2XMW A;  3BSN A;  4DR2 F;  1S9G B;  4C8Y A;  2W7O A;  3TZZ A;  4J9P A;  1YZ7 A;  1U6F A;  5EWG A;  2W4D A;  1J2V A;  5BJR A;  2GQ2 A;  1FRM A;  1BD6 A;  4DQQ A;  4NYZ A;  2XB2 D;  4WIQ A;  2DD8 S;  4RBU A;  4DL6 A;  4ES3 A;  2JX2 A;  1JLC B;  2XMT A;  3ITH A;  3NMA A;  3UQS A;  1RLC L;  5C7P A;  1HQU A;  3HMJ G;  2F65 A;  3IWX A;  3SFG A;  4DL7 A;  4XPC A;  1PIE A;  1HPZ B;  2QJ3 A;  1T9V A;  2A6O A;  3QT7 A;  4F0H A;  5KFJ A;  4I2Q A;  4K8R A;  4K50 A;  2EFP A;  4F36 A;  3CDB A;  1Q78 A;  2R7V A;  4JI8 J;  2YQ0 A;  3L7U A;  2EK1 A;  3GB0 A;  3I0R A;  3MAA A;  3MAH A;  4CH0 S;  2HHV A;  2UXB J;  4TYB A;  4MIW A;  5I3U B;  3T1H F;  3MOJ B;  3OTE A;  3L7P A;  3EUN A;  2DRA A;  2EC0 A;  4I7F B;  4ICL B;  1S1X B;  2ASJ A;  1W26 A;  3B4M A;  4M94 A;  1X4B A;  5JUM A;  4EGL A;  4HI2 A;  3JSM A;  2FC8 A;  3QT5 A;  1B64 A;  3KJQ B;  1SBR A;  2EPI A;  3DI6 B;  4RW8 B;  3GIL A;  4W90 B;  4B3S F;  4J9S A;  1Q5V A;  2BE9 B;  3QJL A;  1GEH A;  1XK8 A;  3M8P B;  5SZT A;  5KFD A;  3LWM A;  5F8J A;  1XNR F;  1HI8 A;  4NLO A;  2R8J A;  4IG3 B;  2H4W B;  6FD1 A;  3DOL B;  1OSC A;  1VQS A;  2DCL A;  3MPD A;  4R8U A;  4DU8 A;  5A8W A;  4B9M A;  4IR1 A;  3C6U A;  3B8H A;  1HYS A;  1HWI A;  4S0M A;  4TN2 A;  3T1Y F;  2WSE C;  1WF1 A;  4F4A A;  1UVL A;  3DRP A;  4F25 A;  3TVK A;  4F4K A;  1TZ0 A;  3JSM B;  2AEM A;  1FHT A;  4ECQ A;  4HI1 A;  3DRS B;  5AXN A;  3MEE B;  2R7S A;  2KL8 A;  3C66 A;  3PR4 A;  1WC0 A;  1WF0 A;  3I4H X;  5ETQ A;  2IRX A;  1VBK A;  5C2G A;  3DYA B;  4C8N A;  2VC0 A;  2BKP A;  3A8I A;  4DR3 F;  4UF4 A; 
#chains in the Genus database with same CATH homology
 1XMO J;  4DUY J;  4DV0 J;  2VQE J;  5LM7 E;  4X64 J;  4KYZ A;  3JAM U;  2VQF J;  4DR6 J;  5BR8 J;  4NEY A;  1HNZ J;  4YY3 J;  4DR5 J;  4JI4 J;  3J80 U;  4GKJ J;  4DV4 J;  3IMQ J;  5AJ3 J;  4JI0 J;  4JI3 J;  4B3R J;  4JV5 J;  4LFB J;  3J81 U;  4JI6 J;  3W1Y C;  4DV7 J;  4HHU A;  2KVQ E;  4JI5 J;  4DR4 J;  2UU9 J;  4KY3 A;  1N32 J;  4JI2 J;  1IBK J;  4X62 J;  5IT9 U;  4B3T J;  1HNX J;  1IBL J;  4LFA J;  1XNR J;  3D3B J;  2UUC J;  4X66 J;  5IWA J;  4OX9 J;  4DR7 J;  3T1H J;  1J5E J;  4JYA J;  4DV2 J;  2UUA J;  3T1Y J;  3OTO J;  3R2C J;  5LMU J;  4DR3 J;  2UXD J;  1IBM J;  4JI1 J;  2E5L J;  4PWW A;  1HR0 J;  4DV3 J;  4RJV A;  2MQ8 A;  4JI8 J;  4NEZ A;  1XNQ J;  5LMN J;  1XMQ J;  4V1A k;  4LF6 J;  1FJG J;  1N34 J;  2UXB J;  4YHH J;  2HHH J;  4LF9 J;  4JI7 J;  5FLX U;  4LF8 J;  2F4V J;  4DUZ J;  1I94 J;  4NXN J;  3D3C J;  4B3S J;  4LF7 J;  1N33 J;  4GKK J;  4LF5 J;  5A2Q U;  4B3M J;  4DV6 J;  2MTL A;  4DR1 J;  2UXC J;  3R2D J;  1N36 J;  4AQY J;  4X65 J;  2MEW A;  4NXM J;  2KL8 A;  1HNW J;  3J7A N;  2UUB J;  4K0K J;  4DV5 J;  4DR2 J;  2ZM6 J;  4KHP J;  4DV1 J;  4LFC J;  4LF4 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...