3D3EA

Crystal structure of human 11-beta-hydroxysteroid dehydrogenase (hsd1) in complex with benzamide inhibitor
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
264
structure length
262
Chain Sequence
QPLNEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title Discovery of Novel, Potent Benzamide Inhibitors of 11beta-Hydroxysteroid Dehydrogenase Type 1 (11beta-HSD1) Exhibiting Oral Activity in an Enzyme Inhibition ex Vivo Model
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 92
structure length 262
sequence length 264
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2008-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3d3eA00
1GCOA 4BNHA 3KYCB 1R0LA 2AHRA 2AG5A 4LGVA 3ZWPA 2GN9A 4CR8A 3ZV3A 1K3TA 1C1DA 1QYDA 3LT2A 2HKIA 4EW6A 4BO9A 1K2WA 5KVSA 2PA3A 1DLIA 1WLYA 4CL8A 4HNHA 2EKPA 4DXHA 4BV8A 3K2BA 2OGUA 3WFJA 1HKUA 3DAGA 3NDRA 1D4FA 3ZN2A 4CMEA 3H7AA 4TKMA 4GI2A 1HDCA 4J7XA 5ITVA 5KJCA 1Y6JA 2HJRA 3ONEA 2GN6A 2GSDA 2ZJ1A 4DWVA 2OFPA 1W8DA 2C20A 1E3SA 3COSA 3JQFA 3UOGA 4KQWA 5IDXA 4GQAA 4CLEA 4D44A 3MJEA 3JQ8B 3WYBA 4G2NA 3BZUA 5CEEA 4J9VA 4M8SA 3H6KA 4U6QA 3VVCA 3JQGA 1SCUA 4AICA 5AQ1A 2AQ8A 3OM9A 1YL7A 5IN5A 3UGKA 3PJGA 2C82A 3ZZNA 4B8ZA 4WLOA 4GKVA 3HDJA 3KXDA 1X14A 3DZKA 3GT0A 1M76A 3DONA 1HZZA 3JQ9A 3I9KA 1DRVA 1F14A 1HSZA 1NP3A 1AXGA 1IHYA 3TN7A 3FD8A 2BLLA 2X86A 3AOGA 1GZ3A 3OIDA 2NADA 1RYEA 2C59A 1PX0A 1V9LA 4FIZA 3LF1A 4JROA 3Q9NA 4OO3A 3WTCA 1T2CA 3JQAA 4WOKA 1RM5A 3TRIA 4P4LA 1JWAB 3PDJA 2DFDA 3NAQA 4OQZA 3U4CA 1KBZA 1DJQA 3F9IA 2BFOA 2C7GA 2AEMA 4C4OA 4IGFA 3F5SA 3WIDA 3NT4A 3E5RA 4DVJA 1P1IA 1E3LA 3WGYA 3F1KA 3P2YA 3F47A 3W4JA 3ITDA 1M66A 1P45A 5ICMA 2Q2QA 3E82A 7MDHA 4RVHA 2DUUA 2CF6A 2FWMX 1LQUA 3C8MA 3KB6A 3G79A 1N5DA 1XDWA 2O3SA 3GGGA 5DZSA 4WOJA 1HWYA 4E5YA 4E5NA 5T64A 1LDEA 4NU5A 9LDTA 2AE1A 5C37A 1LQTA 1DRUA 3HNPA 4RVUA 4WK6A 5ER6A 2RCYA 5IXYA 3MJSA 1DIBA 4J2HA 2NQ8A 4BKRA 1QR6A 4NJMA 1X1EA 3IQDB 1MC5A 3NTOA 3L9XA 2BGKA 4ZVVA 3WR5A 3AUUA 5B12A 1FDVA 1E1KA 1HL3A 4IMPA 3ULKA 3MEQA 3ANMA 4CLDA 2OL4A 1H6BA 2NACA 1Z7EA 1UZNA 3A28A 4KDFA 4BL5A 2UUOA 1E3EA 4BO0A 4NDNE 1GL3A 4JXKA 3KEOA 5KVCA 4RLSA 2ZCVA 3WYCA 7ADHA 4GVLA 3KLPX 1XKQA 1MX3A 1F0YA 3T4EA 3RBVA 1HYGA 1ZUD1 4A73A 3R1IA 1ISMA 2DLDA 2WD7A 5JAZA 5JCJD 1GCUA 3INRA 2PK3A 2VHWA 3PLNA 3PHGA 2B83A 3WQSB 4YAKA 2CNBA 1PWZA 5HS6A 3EVTA 2ZTMA 4W9NA 1Q2XA 3K73O 1A72A 4TRMA 3C24A 4ZRMA 3WIEA 2E82A 4YXFA 1T2EA 2B69A 4UUNA 2ZIZA 1B2LA 1X0XA 1I10A 2X6TA 3RUFA 1IOLA 1EVYA 1HDYA 1NR1A 5DCYA 2AQKA 1PWXA 4MVJM 1L7EA 1ZK1A 2BMAA 1X15A 5A1TA 3WGGA 3OEYA 4Y98A 4R16A 1M6HA 4RV9A 4NMHA 4AJOA 3QHAA 5TRTA 3NT5A 5A02A 4B4UA 3VH1A 3NEPX 3VH3A 3WQQA 3QWBA 3IJRA 1JWBB 1S7CA 2Q99A 3GY0A 4CQMA 3UCFA 4EUFA 5G0TA 2JFHA 3RUEA 1E3WA 2OO5A 3KETA 1ZMTA 5K6AC 3GFGA 4XA8A 1HYEA 1BXKA 1DIHA 2AMFA 5G0VA 2ZQZA 3D5TA 2NTNA 1I32A 4EJ6A 3H8VA 4R9SA 5HWSA 4WLEA 5JDCA 1ZZEA 4NR0A 2BF7A 4Y6RA 1WNTA 4ZU3A 2W8ZA 2PGDA 3P5SA 2PNFA 3K30A 3N74A 1MUUA 4M89A 3RD5A 3E8XA 3HB5X 4JLWA 4TSKA 2IEBA 3TL2A 1I2ZA 1AHHA 2NU6A 4LCEA 1VL6A 1UR5A 3QWHA 4PLFA 2FPIA 3GEDA 1H9AA 2HCTA 4KOAA 4HWKA 4L9RA 4CODB 5JYEA 1XIVA 4LSWA 4JBIA 1FDUA 4I5DA 2QQ5A 3NJ8A 3BMQB 4XB2A 3PRJA 3B1KA 2POQX 1JA9A 4ZQEA 3H5NA 5F3RA 2CFCA 4CLRB 4PLGA 1DIAA 3RC2A 1H93A 4R1SA 4TRJA 1I36A 1R37A 5EERA 1MG5A 4I5FA 1P1RA 4AJEA 4C7JA 5KCZA 4IUYA 3UW3A 1A4UA 1U5CA 3QWIA 3W1VA 5G0WA 5A5FA 3PPIA 1GZ4A 1QSGA 4MVJH 1K0UA 2ZB4A 3RROA 4MPDA 1EK6A 1CDOA 1JKJA 4XYEA 3GMDA 4J1QA 4CV0A 2ZB7A 3MTJA 1B8VA 2VYVA 4IDDA 3WLFA 5JY6A 1P3DA 4OHUA 3PYLA 4P38A 3NJ4A 3TZQA 4E2YA 3GDFA 1CERA 2FRDA 1L7DA 1NPTO 2NQTA 1YONA 2GNAA 2PH3A 2X23A 3EK2A 1DIRA 3HB4X 3RJ5A 4BNMA 1UP7A 1YOVA 4FPXA 1IULA 4E2XA 1Y9EA 4J2OA 2JCYA 4BOYA 5A04A 2PTGA 4Y6PA 4DA9A 1KETA 3A14A 1WDKA 3RI3A 3U4IA 2JKVA 1XQ1A 1LUAA 4N18A 3BMOB 2YFHA 4QO7A 1Y5MA 4D3FA 3U5TA 3F5QA 3PHLA 5B4UA 2Q3EA 3WNVA 3KEQA 3LT4A 3IMFA 4HV4A 4YCAA 5HTOA 1ENYA 3AM5A 1BDMA 4RPLA 1LDBA 3BMNB 3VTZA 2VUUA 1ISJA 3TJRA 4EZBA 4YRBA 4NFSA 1T4DA 1PS8A 1SPXA 3GLQA 4YA6A 5A06A 1I3NA 2X0IA 5HBRA 1WDMA 1Y5RA 2HLPA 2GASA 1EMDA 3GUYA 3H5AA 4IZHA 4J90A 1SEPA 4RVGA 4AJLA 1MA0A 3KO8A 4IDEA 2IEDA 2P9GA 2ZATA 3CINA 2GO1A 2Y1EA 2HSDA 4BMSA 1U7HA 4WNIA 1I24A 2J3JA 1ZXLA 4CMIA 4YYZA 3PWZA 3BMCB 4A2CA 3EVNA 4FCCA 1MLDA 1XYGA 2UDPA 2DTXA 3UXYA 3VH4A 1UXKA 1GQQA 4Z0TA 1B8PA 1GUFA 3ADPA 2JCXA 3AY7A 2LDBA 4FSHA 1C1XB 2Y1GA 4UUPA 3OBBA 2ZYGA 4UVDA 3DDNA 1EZ4A 4GWGA 4FN4A 3WSWA 2UV8A 3TOZA 2NU8A 5IXSA 3DQPA 2JCVA 1T2FA 4H7PA 5BQFA 1T26A 2HUNA 4RF2A 4M87A 1O9BA 1O94A 4A0SA 2JAHA 1TT7A 4Y67A 1VM6A 1PL6A 3AOEC 3CMCO 4GX2A 4B4OA 4IJUA 2Y1CA 4A7PA 4MOWA 4CV2A 3ZNOA 5T8KC 5JDIA 3IUPA 5IZCC 1A4IA 4LVCA 1SBYA 5GZ6A 4ALLA 3DOCA 5DOVA 3KM0A 3CTMA 3SVTA 4NJOA 3RU9A 1YQDA 3HN7A 1CJCA 4S3MA 4YJHA 4HADA 3ZNQA 2RHRA 1ZSNA 1R66A 3ZHXA 1UXIA 1VJTA 4BNWA 3QA9A 5L51A 1RM3A 3CEAA 4NPCA 5H83A 2EW2A 4I5EA 2F00A 4MKZA 3A06A 2QW8A 1O89A 3NT2A 1GPDG 1QKIA 3DBRA 2NVUA 4FD3A 4WEOA 3D7LA 1I3MA 1VL8A 2R00A 3PEFA 4AJ2A 1OZAA 4R68A 4U0JA 1PJSA 4FJ1A 1CWUA 1UDCA 3AUAA 4GGOA 4JNKA 2DBVO 4Q39A 2ILTA 5JW6A 4BGUA 1YBVA 2Z5LA 1B14A 4DBVO 1PJLA 3WGHA 3GPDG 3WDSA 1K6IA 1AN9A 4W7HA 4TZKA 1IUKA 3GK3A 2I3AA 3RUHA 3BTVA 4JJIA 4WECA 4CUZA 1YKFA 2BFAA 4WEQA 4NBWA 1LDYA 5CHEA 1H2HA 5L7TA 2P4QA 4XQEA 2BD0A 3ZWWA 2CDAA 2BKAA 2VTDA 5AVOA 2AXQA 4MKRA 5IZ4A 4YEDA 4YWJA 1Z7BA 3E9MA 4LCJA 2Y1FA 2YHIB 1IPEA 2FR1A 3B20A 1ZKMA 1SZJG 2DBQA 2HMWA 3GQVA 1P1KA 5HS4A 3H2SA 1KEPA 2H5LA 3DFUA 2D8AA 4FQ8A 4CPDA 1YQGA 1DOHA 4XCVA 5FI5A 5JO9A 1UXHA 3H9GA 4MVJP 3K9QO 3ZV6A 3BHJA 3LZ6A 2DUWA 1LLCA 5TNXA 4YVFA 4BNTA 3BYZA 3GGPA 5I8WA 4OKIA 1EUDA 1DC6A 4J0FA 3DR3A 4XX0A 4WPGA 5CDUA 3AWDA 3AW9A 2QIOA 5A5EA 2XAAA 1R12A 2AG8A 3OQ1A 4D3DA 5I7VA 3RFXA 4D42A 5B4VA 3INGA 2Q1UA 3LLSA 5KJ6A 1UP4A 3SC4A 2WE8A 1R0KA 4OIMA 3Q11A 3M1LA 3ZWMA 1IE3A 1PTJA 1OBFO 4B3HA 4YT2A 4ZN6A 2EF1A 4M1QA 2AQIA 4CJXA 3H2ZA 3MJVA 2WJPA 5EL0A 2VHZA 4XKJA 5MGBA 3GNQA 1R6DA 3M2PA 4EGFA 4CMBA 2CVQA 4JBGA 2VRCA 4WCFA 2PD3A 3DBLA 1N9GB 4ONEA 4YAJA 3GZNA 1UDAA 1DJNA 1C3VA 4CM4A 4P4GA 1NYTA 4PG6A 3MZ0A 4ALIA 4BB6A 3GAFA 4KWIA 2Y0EA 3PLRA 2V6GA 2GERA 2VQ3A 1UXJA 2DKNA 2C5EA 2UUPA 1YS4A 1FXSA 5COAA 4MVJF 1ZK0A 3F3SA 3SC6A 3P2OA 4HY3A 4E12A 5F1PA 1K89A 2GN8A 2XXBA 4OYRA 4DUPA 4EYEA 3GEGA 3G1TA 4RPGA 1SB8A 1EQ2A 2EWMA 4YAIA 1PIWA 3Q2IA 2H63A 3RUAA 4HUJA 1LBEA 3RBXA 5H82A 1QYVA 5T57A 1KEWA 2EERA 2R6JA 3KYDA 3HFGA 2CMDA 2FP4A 2VWHA 1UP6A 3FBGA 1EFKA 2VTEA 4U5QA 1BG6A 1U8XX 5BSGA 3K2EA 1GEEA 3JV7A 4EJMA 5JFOA 4K6CA 3G17A 2VHYA 3L4SO 3WNQA 3DAFA 1HDZA 4JJGA 1NM5A 4CMAA 2GLXA 3PWKA 4XGIA 4E2ZA 3H9EO 2D1YA 3IKVA 3JD0A 5DF1A 4AL4A 4XGKA 3A4VA 3B1JA 3PYMA 2ZQYA 3Q3CA 3SJUA 9LDBA 2OXIA 3VC7A 5IDQA 2VRBA 3FTPA 3BTSA 1EE9A 1RM0A 2WMDA 5EMHA 3BIOA 2BI8A 4E31A 1D1TA 1WXDA 5BSFA 2TMGA 4CMGA 2HAEA 3V2UA 1DAOA 2W2KB 3LF2A 3PHIA 3ABIA 3OJ0A 3QJ5A 3HADA 3X2EA 3NKLA 1Y7TA 2G76A 2NLOA 4PZDA 4BNIA 3WXBA 1PU2A 1U3VA 2I66A 3DZIA 2QRJA 5TQVA 2Y0DA 3WQRA 3V1TC 3HSKA 5JY1A 5IG2A 1I3KA 1YBMA 3IL2A 3Q9UA 1BXGA 4R5HA 3ICCA 4RGBA 3G49A 3HDHA 4A26A 5CDYA 3ZU5A 1F17A 3C7CB 2H1SA 4IZIA 4XGNA 1ADGA 4E13A 4LRSB 1NQ5A 3BTOA 1LLDA 4CLOB 2E49A 4BUCA 1O95A 2ZYAA 1NWCA 4ND3A 4NBTA 3PGJA 3G0OA 5DDIP 1Z73A 5L7YA 5EJ2A 1U9JA 2BGLA 3GN2A 2PD6A 4II3A 1KVRA 5JE8A 3S2FA 3I9LA 1ISFA 3WB9A 3WGIA 1MGOA 1IYZA 3I1JA 3QV1A 3OH8A 4ND1A 4MVJI 2B4RO 2W2LD 1P77A 3ON5A 2J5QA 5A3VA 4FW8A 8LDHA 3WGOA 1QXSA 3O38A 2EGGA 1T24A 1NQOA 2EJVA 3FBTA 3H3FA 3OICA 3OIGA 2O4CA 3TZCA 1DPGA 3HUDA 4O59O 2V65A 3WX0A 4DREA 1GADO 4XWYA 4L8VA 2BH9A 3IC5A 5LC1A 5U1PA 1DO8A 4RQTA 1NXQA 4J49A 3D3EA 4PLPA 3R3JA 4P22A 1I33A 1Z6ZA 3VPSA 2P91A 2ZCUA 2IODA 2NNLD 1ISGA 3EC7A 1HZJA 1WWKA 4PLTA 4DMLA 3WGQA 1ISHA 4QEDA 1BWSA 1GZ6A 4LN1A 4GLLA 1QYXA 1E7SA 2Y05A 1LC3A 2DAPA 2VWQA 2Q4BA 3JQBC 1GD1O 1B0AA 2BRUA 1BW9B 3GNSA 5C3MA 5LDHA 2OBNA 3JSAA 5A9RA 1JKIA 1N7GA 1DIGA 4QFCA 1SEVA 1R4MB 1D3AA 1NVGA 4FJ2A 1TT5A 1XA0A 2X4GA 1ZEJA 4DIOA 3KSZO 3D5QA 4XQGA 3OMLA 4YT4A 1ZK4A 4BKUA 4QECA 4UEOA 1WZIA 3AUSA 1GEGA 4XJSA 2X58A 3VPXA 1MFPA 3QLJA 1MFZA 3WMWA 3M6IA 1LSSA 4DBZA 4IIUA 4F46A 3R3SA 4XEHA 4QO8A 3FWNA 4R1NA 2PH5A 2IZZA 2YV3A 1B3RA 3TFOA 2NWQA 1Y8RB 3GH3A 4KUGA 4ZJUA 3U9LA 4Z6KA 5CP8A 5KKCA 2Z1MA 3VTFA 3BMNA 4H3VA 2OZPA 5TT1A 1HXHA 1PQUA 1I5RA 4TWRA 3W6UA 1Q0HA 3OECA 4RPJA 3RQSA 1P9LA 1F8FA 2EHDA 3K5PA 1YXMA 3AY6A 1PJ2A 1AXEA 3ZWVA 4A03A 1B8UA 1DLJA 3E9NA 2Q4EA 1ZH8A 2JHGA 5GMOA 3GVPA 5COQA 3TWOA 4CMHA 5G4KB 1GUYA 2YHUA 1TEHA 2YDXA 1OMOA 4RJTA 3OF2A 3WG9A 3EDMA 1M6WA 2X0NA 1H5QA 4N5NA 4ND2A 1VKOA 1ADBA 1J0XO 2X7HA 2Y67A 3E18A 5G0UA 4CM1A 2EJWA 3JQAD 1FDWA 4PZCA 1LNQA 1VE9A 2JAPA 1YJQA 1PZGA 5BR7A 4MP3A 1W0CA 4Y6SA 2YY7A 2XPCA 2A35A 1VSUA 1M75A 1XELA 2I99A 4TRNA 3HWRA 4GH5A 3ENNA 3MOGA 4IS3A 4L74A 2PLAA 5AXBA 5C7IO 1H6AA 1J4AA 2CVOA 5I8ZA 5L4LA 4XQCA 1BRMA 4YACA 2EW8A 4ND5A 1DEHA 2IRWA 4DPMA 2NU9A 4GPD1 3AFNA 1FDSA 5IDYA 1P31A 4CM8A 1XSEA 1OC2A 5F1KA 3S2IA 3FNGA 1JLLA 4CL3A 3DOJA 4R5MA 3GN1A 1XQ6A 3FNHA 3KOUA 3H5RA 4INAA 4YJGB 4PG7A 2RAFA 1U8FO 1YB5A 4I5GA 4FJ0A 4DQXA 4U6SA 4CQLB 1KVUA 4NK4A 4O0LA 1R4NB 1MXFA 3C85A 3DTTA 4JBHA 4E2WA 1HE4A 1TA4A 4B3JA 4DC1A 1VSVA 4B7UA 1ZFNA 1JAYA 5EQFA 2P2SA 5K0ZA 2ZB8A 1BGVA 4DQVA 5DN9A 4TKLA 4B4WA 5ILOA 1XWFA 3KHUA 4J7UA 1ARZA 4YT5A 2O3RA 4DIBA 5AXAA 3TNLA 4CMKA 4YT8A 2FPGA 2DFVA 3GG2A 3VAZA 2HK9A 2JHFA 2O7QA 4GX0A 2RBEA 2G1UA 5COBA 1HSOA 1OOEA 3UH1A 2PZJA 3DAPA 3PTZA 1NTOA 3K31A 2AQHA 3CPSA 4LMRA 5I7SA 1PSDA 1IL0A 1ZMOA 2QX7A 3JYPA 4RF4A 3ZI0A 5JYDA 4YTEA 1KVTA 1NPYA 3I9NA 4LK3A 2CZCA 2FHSA 2V6MA 5AYVA 2I5PO 4MVJA 3QY9A 2G5CA 5TJHA 2YHIA 3R6DA 4Q3BA 5U9CA 1AE1A 1H6DA 1X13A 3MJ4A 3PXXA 5IJZA 4OXNA 3AI3A 5JXWA 4LW8A 3U4DA 2Y93A 4FR5A 1U5AA 4RCVA 5ADHA 4L76A 4BQPA 4XR9A 1LA2A 3GRKA 4UVHA 5FFFA 2DM6A 2B4TO 1YRLA 2OOSA 4WNCA 3W6ZA 2B4QA 4CQMD 1YL5A 1Y8QB 3F4LA 2PZMA 4HP8A 2V6BA 3L77A 5KKAA 4YPOA 3RUDA 4IDCA 3D4PA 4ALMA 3C7AA 3DBHB 1B16A 4BHTA 3MWDB 2AA3A 4NU6A 1NAHA 5EINA 3ZU3A 5AOVA 2RH4A 3ONFA 4Q9NA 3DZFA 1NNUA 4E33A 4CM9A 1HF3A 4IQ0A 2I6TA 3ITKA 5F1OA 4Y9DA 4PLHA 2GR9A 2YV2A 3WSVA 3WS7A 4LVUA 3VKVA 2GZ1A 2WDZA 4IIVA 2FY8A 1ONPA 1HRDA 4CMEC 1WAMA 1GUZA 1U3UA 1VC2A 1LDMA 1Z45A 3A9WA 4URFA 5L7WA 1U1IA 1ZK3A 4YJFB 3A1NA 3PFWO 3RC9A 4BB5A 3DMTA 2HMVA 4BNVA 1DB3A 2RH8A 4J1TA 2PGLA 3JQFC 4E4YA 3W8EA 3LDHA 1CETA 3FTNA 3PJDA 3SEFA 4FOOA 3NRCA 1YH3A 2J6IA 3F46A 3D3WB 1YBAA 2YQ5A 1NX6A 4BNUA 4Z3KA 2ZKLA 5BT9A 1H2BA 1GQYA 2SCUA 1WPQA 2ZTUA 4OKNA 5I9MA 1JVBA 3O26A 3AFMA 5FEUA 4H16A 4N7RA 5I9NA 3PP8A 4RZHA 5CDTA 3JCZA 2C0CA 3GEMA 1E0DA 4UREA 1C1DB 1XEAA 2CY0A 3V8BA 2FZWA 2PKQP 3JQ9C 1BHSA 2JFGA 4PLVA 2VYVD 3AU9A 3HDYA 1A71A 1MV8A 4L4XA 1BDBA 4ZGWA 5JAMA 2EIHA 1A7AA 3DL2A 2VNAA 1N7HA 1Z82A 3QW2A 4O5OA 3GG9A 3CKYA 3EHEA 1ZNQO 4IDGA 3V5NA 1CQIA 1RWBA 4AJNA 1Q7BA 4FFLA 1V6AA 2IXBA 2VT2A 4KTTE 1YGYA 1ZK2A 3EZYA 3VOSA 3ETEA 4BO4A 1KC3A 2VYNA 3ZW8A 4B79A 3QP9A 1WZEA 1JTVA 3ROKA 1UZLA 1G0OA 4KDEA 4ZQGA 3W4KA 1DSSG 2GGSA 2B36A 4CM3A 2VN8A 3GPIA 4IQ8A 4RL6A 3PHHA 4JCOA 4AFNA 1ULUA 1HE2A 1C0IA 1ONOA 1HE3A 3U49A 1WDLA 4IDAA 3JQGB 1Q7CA 1SAYA 2OBYA 4EI2A 3VPGA 2P9EA 4PLYA 3ORFA 3I3OA 3LVFO 2C2XA 4HBGA 5TC4A 1LSUA 1NHGA 4BNZA 2HJSA 4YBZA 3FR8A 2GYYA 1GYPA 2WE7A 5DBIA 1LDGA 1E3IA 2GCGA 1TB4A 4I1IA 3ST7A 5A9SA 3CMMA 4JGBA 2Q2WA 3LT1A 2Y1OA 3FR7A 2C07A 2X0JA 4XQ9A 1VI2A 3SLKA 1Y9AA 3T4XA 2QYSA 2IDZA 4A27A 1ZBQA 3IUSA 3JQAB 3IKTA 3B70A 1EVJA 3ZDFA 4XJTA 1LTHR 3KSUA 3PJFA 4FFMA 5CDSA 3NTQA 2PFGA 3QVSA 1OI7A 5JAQA 4HFNA 2LDXA 3QWAA 4K9DA 2FPPA 3JYNA 4BNGA 3JQEA 4JN6B 3RFTA 4AVYA 4B3IA 3ROPA 1BVRA 1IZ9A 4NHEA 4CUKA 4JX8A 2P5YA 4IXTA 3HG7A 4JJFA 4W9NC 4AJIA 3O8QA 4U0KA 1E1NA 4ZQFA 4XYBA 4BO2A 2O3QA 1HDGO 4TMFA 3ROMA 1GY8A 4ZHSA 3IIEA 5MDHA 3UAGA 2Q49A 1BTOA 1HDOA 4MVJE 3ETDA 3UCXA 2JD0A 4LMPA 1MP0A 4B8WA 3TFQA 1DFIA 1HLDA 3KYCA 4HX5A 2IYOA 1T25A 2YJZA 3U62A 2JJYA 2O48X 4OSPA 4RF3A 3DB2A 5EESA 2C29D 3JTMA 2X5JO 4CM6A 1OC4A 1GV1A 2NTVA 3WJ7A 2V7PA 5DT9A 5GY7A 5EQDA 5TGDA 3S1LA 2G82A 4YDRA 3CXRA 2Z1NA 4PLWA 3Q0EA 3ZHYA 4UVGA 5L95A 2X8LA 4YQYA 2WWRA 6LDHA 3JD2A 3FWZA 2EP5A 1O5IA 1A5ZA 1C0KA 4GMGA 5JDCC 3IP1A 1E5LA 3GMSA 2WD7B 1H0KA 1AGNA 1PZFA 4R69A 1PR9A 3VDQA 1N2SA 3OIFA 4UUMA 2H9IA 1LC0A 3GFBA 4J7CA 1U2GA 5JLAA 1CEQA 2YZ7A 3QVWA 3WJAA 4PN3A 1R16A 1DC4A 5TS3A 3EZLA 4GVXA 1P0FA 2PV7A 3OJLA 2QZZA 4NFHA 3JQ8A 3RAJA 1QORA 5ENVA 1PJBA 2EG9A 3RBZA 2D59A 5ILGA 2B37A 4G5HA 1EUZA 1C0LA 3LK7A 3E1KA 4BIIA 2YFQA 5CPFA 1PQPA 3VVBA 2Y1DA 4NZ9A 3OQBA 3C3XA 4RZIA 4XD2A 1V3UA 4NQZA 5DNAA 2Z95A 4D45A 1VKNA 4M86A 3LYLA 4O6VA 4PZEA 1DAPA 4BO3A 5CDGA 4GGPA 4CQMB 4D0SA 3QE3A 4DC0A 3L6OO 2DT5A 1E3WB 2VHVA 3K92A 1E7YA 3FSRA 5KVVA 4R51A 3SXPA 2D5AA 2HU2A 3M2TA 1LJ8A 3C1OA 4DL9A 1RJWA 4B7XA 4NFYA 4DYDA 4CM7A 4XB1A 3TZ6A 2DQ4A 3E9QA 1ADFA 1LRJA 4BNLA 5C5IA 3H4VA 3OJEA 3WGTA 3MOIA 3AM3A 1XU9A 2HDHA 2VRCD 4D3SA 4MP8A 4OSOA 1K6XA 5K9ZA 4BGEA 1LX6A 4MKXA 5DBGA 3HN2A 2E37A 3PJEA 4BKPA 4F3YA 1ENPA 1YVEI 4OOFA 3TPCA 4N5LA 1C14A 1N92A 1PZHA 4MIYA 1MXHA 3QVXA 3RKUA 2Q1TA 5KTKA 4BO7A 1CIVA 4KWHA 3TZKA 1O6ZA 1Q0LA 2XF8A 1V3VA 3PIDA 5DCWA 1I2BA 4XZ3A 1ULSA 3ZWAA 4XRGA 4R9RA 2H6EA 2D0IA 2G0TA 3PQFA 1ZO8A 4AJHA 1W4ZA 3P7MA 1P1JA 2NM0A 3ICPA 4M49A 4E5MA 4BKQA 1M67A 1XGKA 1ZJYA 2I65A 3ASVA 1ZIDA 1FK8A 1EDZA 1TVEA 3I52A 4UUOA 1GDHA 4PGFA 2FN7A 1DFGA 1YQXA 1ZJZA 4KP7A 1E7RA 4D46A 5DP2A 1P1HA 3JYLA 1HEUA 1E5QA 4IM7A 3EUWA 1LSOA 3DMYA 4NIMA 1R0SA 1YOVB 1PL8A 2P9CA 2GZ2A 4IXWA 3FPLA 3OA0A 1N8KA 4S1VA 1JAXA 3KZVA 3OJFA 4WE3A 2PKQO 1Q0QA 5L45A 1U4SA 1TI7A 3C7DB 4U7WA 1VJ1A 3WMXA 1T1SA 4UEJA 3L6EA 1IHXA 2UYYA 3GC6A 4OXKA 5CFZA 4JP2A 4O63O 2GUGA 3BXXA 3AK4A 2IZ1A 4UEKA 3TZHA 5ENDA 3VH2A 3KRTA 2WYVA 3GDOA 3KBOA 3QRWA 3KVOA 4K1LA 1SC6A 1XLTA 1CQJA 4IY1A 3DHNA 3DZJA 4IBOA 4WLUA 4PFJA 5JDIC 3PYXA 3VPHA 1SMKA 2BFMA 3WBBA 3PQDA 3I9JA 4BGVA 5U4QA 1ZXBA 1HLPA 4GKBA 4MP6A 1GAEO 1SOVA 3LC2O 4ZQBA 3DZGA 3JD4A 4IGEA 4NH4A 4E3ZA 4DGSA 4BNXA 2B35A 2OORA 3FRJA 3KLMX 3PQEA 2VWPA 4CMIB 2QG4A 2J3KA 1M2WA 3ZWOA 1GU7A 3EY4A 3T7EA 1JQBA 3O03A 3JQ6A 5FI3A 4WASA 3EW7A 3WWYA 2EV9A 4IQGA 4K26A 2R00C 2CUKA 3WLEA 5KJ1A 1ENOA 2DU8A 2EEZA 2WD8A 1SNYA 4IDBA 5DULA 5DCUA 1EBFA 4WGGA 3ZWCA 4HNGA 4RPHA 4BMVA 4WKGA 2ZK7A 2WYUA 5L53A 1PGQA 1I8TA 4CR7A 3I9OA 1KERA 5JSFA 4YJDA 4DMMA 4N5MA 3BMQA 3WYEA 1RYDA 3K8ZA 4RQUA 3MCVA 3CZMA 1A27A 1EK5A 4E32A 4NBRA 1NVMB 2PKRA 4PG8A 1MB4A 2VZ0A 4CLRA 5TT0A 3VZPA 5IAAA 2RIRA 4EDFA 1KY4A 2R2GA 2CVZA 1IPFA 1TXGA 2IXAA 3PIIA 2QRLA 1NBOA 2WTBA 4OOEA 4NNJA 4R4JA 5K6AA 4YJHB 1HETA 1UUFA 2VZ8A 1DDOA 1P1FA 4FFNA 5BNTA 1EVZA 3Q1LA 1V3TA 3HDQA 2IE0A 3ZU4A 3DC2A 3UVEA 3FHLA 3QSGA 4UULA 3CZRA 5HA5A 3GR6A 1BXZA 5HM8A 1T4BA 3DBRB 2NVUB 1Z74A 3PWSA 4IJKA 3GF4A 4MO2A 3FI9A 1PR3A 2GPTA 4M55A 4XIYA 3UCEA 2FMUA 4ALJA 4CUJA 1N1EA 4KTVE 1L1FA 3PZRA 3BMOA 2OHXA 4EUEA 1TLTA 4XYLA 4H15A 1LRLA 3H65A 1VLLA 1PS9A 4PCVA 4PLZA 3L4BA 1B7GO 1NASA 5TX7A 4WCFC 3FCOA 2RHCA 1X7GA 2C2YA 1ML3A 4GX5A 1ID1A 2O4UX 1BSVA 1KS9A 4F6LA 2BELA 4FS3A 2YQ4A 2OP0A 5G4LA 3JYOA 3RUCA 4FB5A 4P4NA 5JS6A 5TIIA 4AJ1A 3IOYA 2OUIA 3ZWXA 1G0NA 4ND4A 4L75A 1F12A 3STHA 2X9VA 4GLOA 1EDOA 1X7DA 2X9GA 2A92A 2PY6A 3U4HA 3WFIA 4D43A 1PEDA 1XR3A 2D5CA 2DBRA 2NTJA 5JCXA 2DBZA 4D41A 5L4SA 4RPKA 3GHHA 4NI5A 3C1TA 4ZA2A 4DTIA 5KWEA 1X0VA 2JFFA 1KEVA 5TJ9A 3BMCA 1G6KA 4AJ4A 2Q1WA 3H3JA 1E77A 4FFRA 2CDCA 4BO5A 3FNEA 3RSHA 1GPJA 4CMCA 1C1XA 4ZICA 1VRWA 4PG4A 2O2YA 2GF2A 3LT0A 4EEZA 3GVIA 2J5KA 2Q1SA 4WCFB 3EMKA 4B7CA 2P68A 1HE5A 1HYHA 1A7KA 3DBLB 5IF3A 1VPDA 2DPHA 1E6UA 2B5WA 3VDRA 1EFLA 3GZNB 1ZVMA 3JQ7B 4CM4B 3RASA 1E7QA 1GV0A 1S6YA 4FDAA 4RORA 3UKOA 5FF9A 4AJJA 4XIJA 4AG3A 2Y0CA 1YWGO 2O50A 3Q6IA 2I3GA 1W73A 2WM3A 5I9LA 2FSVA 2I67A 4II2A 1YB1A 3GVXA 3VZSA 3TDKA 5F21A 4PRLA 5FYDA 1KYQA 1E7WA 3PZBA 3ZWBA 3AU8A 5T5QA 1E7MA 4EEXA 4BO6A 3LC7O 3KV3O 1YDEA 4KZPA 5TLSA 2JD2A 2X22A 2XXJA 3D64A 3SX2A 3BA1A 3V1YA 1U28A 3EAGA 4W6ZA 1HT0A 5AXCA 3LSYA 3G1UA 3VZQA 2GDZA 1K5HA 3I6QA 5BNFA 1P44A 4RVFA 2B5VA 1RM4A 5F5LA 3I23A 3KYDB 4ALKA 1U2DA 3E48A 4TROA 3F1LA 1FMCA 3LU1A 3JYQA 1PGJA 1DHRA 3OQ6A 4OAQA 4Z0HO 2HRBA 3QQPA 2D2IA 5JCJA 2ZJ0A 4BNKA 4E6PA 5CG2A 5IDWA 5DBFA 2VNSA 4XYMA 3WBFA 4E5PA 3DEYX 3HQ4O 4W4TA 4F6CA 1LEHA 4X54A 2NUAA 3DHEA 4OQYA 3L0DA 4J43A 1HTBA 3AOEA 3INTA 1U3TA 4YR9A 1XG5A 3VHRA 5T8KA 3JD3A 1EQUA 4Z0PA 5IZCA 1KVSA 1PJ3A 4GWKA 2PGJA 5HRUA 5EPOA 1EVIA 1D1SA 3ASUA 2HMTA 3R0IA 3ANLA 1E1MA 2A9FA 1PL7A 1QYWA 3RWBA 4F45A 2VT3A 4J6FA 3GGOA 2YV1A 1UDBA 2WYWA 3N58A 4CV3A 1B26A 4BQRA 4J0EA 3T7CA 1ZSVA 3HE3A 3LLVA 4MVJD 4CMJA 5JPIA 4BO8A 5AXDA 1UH5A 4RF5A 4HFJA 5T6BA 1Y1PA 1XCBA 4OH1A 2WSBA 1I0ZA 2X1HA 4NG5A 1ZSYA 1BXGB 3MJTA 4QT0A 1RKXA 1FDTA 4GAEA 2YDYA 2O3TA 2B0JA 3AM4A 2PZKA 3P19A 4IINA 2QYTA 2TMDA 4I8XA 4LSMA 1NQTA 1QP8A 5EIOA 1PJCA 3EGOA 3ETGA 1EEHA 4HKTA 4MINA 1JN0A 1NFRA 3IJPA 2J5RA 3X2FA 2FR0A 1N9GA 3CH6A 4IPTA 1PJQA 1ZEMA 3W8FA 5JC8A 4TRRA 1PGPA 3B6ZA 3FF4A 3W4IA 2BI7A 3DBVO 4J3FA 4CM9D 3K6JA 3TF5A 4PG5A 2YW9A 4YAEA 4EBFA 3L07A 2O7SA 2FZEA 2O2SA 1P33A 3NGLA 1AHIA 1SO8A 2VUSA 1VJ0A 3UUWA 3OJOA 2W4QA 4ALNA 1DXYA 5B4TA 3AI1A 1JVSA 3E03A 4BV9A 1I2CA 3ZV4A 1GTMA 3DWFA 1ZCJA 3L4BC 3D0OA 4JQCA 3UFXA 2EXXA 1SOWA 3VPFA 1T1RA 1YJ8A 1NFFA 2HMUA 1DFHA 4NK5A 4R1UA 1J49A 3PI7A 4BVAA 3DFZA 3OA2A 1E1LA 4OMUA 1QRRA 4I08A 3NDJA 1JKFA 2O3UA 3LQFA 4UVEA 4ESOA 5BNIA 5L3ZA 5KNLA 2W90A 4G81A 3RCBA 5B1YA 3PK0A 1QYCA 3D1LA 4Z9FA 1PZEA 4Z9XA 4GBJA 3I9MA 1B15A 1H6CA 4J9UE 1UJMA 5I7EA 1JW9B 3UN1A 2QHXA 1P74A 1MG0A 4PVDA 3PHJA 3N7UA 1SB9A 2CD9A 1EUCA 1LLUA 3DXFA 2AEFA 3W8DA 1PS0A 1E3JA 3DZBA 1JU9A 3IDSA 4TZTA 2JL1A 1TT5B 3NYWA 3ROQA 6ADHA 1DBVO 2ZB3A 3OSUA 5THKA 3E6AA 3G3EA 4M54A 1GYQA 2E6UX 4W7IA 3B1FA 2ZTLA 4P8RA 4L0QA 4IJVA 4QX6A 2F1KA 1IZ0A 4R01A 1O0SA 4DYVA 1KY5A 4HFRA 3AY3A 1X1TA 5CEFA 3ZNNA 5BSHA 4W82A 2O23A 3I5MA 2C54A 2VYND 1IB6A 2W2KA 1JDJA 4BGIA 4BNFA 2I9PA 3S55A 5KIAA 2NU7A 5KVQA 3QWFA 4FFOA 2EKLA 4PIVA 4WLFA 2DC1A 3TQHA 4BNNA 3GA0A 3PVZA 3QIVA 1ADCA 1T2AA 5G2OA 4CLHA 2HO5A 1GR0A 1K6JA 1I30A 2IYPA 3AUTA 5JMWA 1YE3A 4L4RA 3ZW9A 4ILKA 4NBVA 5J23A 1QMGA 4BNYA 3PFFA 2I76A 4CLOA 2V6FA 4GSLA 3UICA 1LRKA 2UAGA 4XYGA 4BS9A 4OJNA 4R54A 3RC1A 2HK8A 3S8MA 5F5NA 3OP4A 4MIEA 1NR7A 4OGWA 2Q45A 3SLGA 2PWZA 4YQZA 4K28A 4DLLA 1IY8A 1NHWA 3AJRA 3IP3A 3TOXA 1N1GA 1HDXA 1NWHA 2BFPA 4DLAA 3BAZA 3JD1A 1LDNA 5THQA 2FR8A 3FPCA 2OP1A 4ID9A 3NUGA 2PR2A 1LU9A 3ONDA 4GSKA 2DTEA 3S2GA 4DRYA 1CYDA 4FOSA 4RDIA 3NX4A 1A9YA 4QSMA 3I4FA 3Q2KA 4HFMA 3HZZA 4I9UA 2GZ3A 5C7OO 4Q3NA 4L4SA 2VOEA 4CM8B 4DLBA 2Y68A 4NJMB 1WMBA 1UXGA 3CIFA 4GMFA 4ZD6A 4KMSA 2UVDA 3I83A 3V1UA 5DOZA 4CLXA 1G1AA 3IAHA 5DP1A 1J6UA 3OETA 2NV6A 3O9ZA 3CE6A 3K96A 4BKOA 3F4BA 4FC7A 3KUXA 2J3HA 4L73A 1QV6A 3WGZA 4Z3DA 4KQXA 5C7LO 1OFGA 4WLNA 3PGXA 1U7TA 1I01A 4EITA 5GZ3A 4W99A 3GDGA 1F8GA 5JO0A 1BW9A 1ONNA 4J91A 4DIFA 1D7OA 1HDRA 1YL6A 4FGSA 1R4MA 3RKRA 3GRPA 2GN4A 3ENKA 2W98A 1AUPA 3HFSA 5IFLA 4UAGA 2HQ1A 4QUKA 3PDUA 1YB4A 2OMEA 3FNFA 3ZWNA 4DPLA 4DPKA 4FC6A 3S2EA 1B3BA 1J5PA 4FBGA 2X5KO 2X9NA 4JK3A 4Q3AA 3RJ9A 2X5OA 1NPDA 3NTRA 4J4BA 4KUHA 4CV1A 1YDWA 3GVHA 1ISIA 3NV9A 4XDZA 2NVWA 3SBOA 4IS2A 3FN4A 4J16A 1Y8RA 5EN4A 3ZWYA 2Q50A 4HXYA 1EBUA 1FF9A 2J8ZA 5KOIA 2FOIA 4N54A 4Q3DA 3GVCA 1H9BA 1V8BA 2GD1O 3BHMA 3DMTC 2ZTVA 3GOHA 4DQUA 5A4DA 5CPBA 3RFVA 1U3WA 2EP7A 3DZHA 4WUVA 3OEWA 4RLHA 2DVMA 1Q7GA 3F6YA 1KC1A 3JQBA 2QZ9A 1V0JA 4R3NA 4YB8A 5JNLA 4UVIA 3M1AA 2BGMA 1MC4A 1NVTA 2CF5A 4Q3CA 5G4KA 5TSDA 4PVCA 2NVBA 2WEKA 4OXYA 4YAGA 1GFSA 3DTYA 5GZ1A 3O4RA 3ZNPA 3HJAA 1PGNA 4JIGA 1A9ZA 1WVGA 3GNTA 1BMDA 2BHLA 1LLQA 3UF0A 3VZRA 2ET6A 2A4KA 4BNJA 5L9AA 5A9TA 2FSSA 4A10A 4RVSA 1DHTA 3GHYA 4PLCA 4FFPA 4QFDA 4WCDA 4D7AA 4E21A 1WP4A 1LI4A 1CRWG 1NQAO 5I7FA 3H9JA 3MTGA 3MWEB 4U8GA 3DOOA 3RU7A 4B4VA 1V35A 5T67A 5JC1A 3V2HA 2VOJA 3JQ7A 1F06A 5JBIA 5L40A 1R15A 4EJ0A 2HMSA 3E5MA 4IMRA 3UHAA 2HRZA 4RVDA 4ROSA 1NFQA 1KOLA 1X7HA 1U4OA 1PJ4A 3RUIA 1GQ2A 4A5OA 4AJPA 1UAGA 3MJCA 2YYYA 2PD4A 3IS3A 4J1SA 4CM5A 4XRRA 1Y81A 2EKQA 2VCYA 4JP3A 4LRTB 2CDBA 3ZU2A 4YJGA 4BMNA 2JD1A 1Q1NA 2C5AA 4CQLA 1UZMA 1R4NA 2J3IA 4IDFA 4YRDA 2Q2VA 4GX1A 4FGWA 2DPGA 3I4CA 4MDHA 1ORRA 3RIHA 2VWGA 3WWZA 5A03A 3U09A 4PRKA 3L6DA 5LCXA 1E92A 5IN4A 4AJKA 1PGOA 3WTBA 5ITWA 1O8CA 1H94A 3D4OA 5A3JA 2C7VA 4WJZA 4E5KA 2PZLA 4K6FA 5KJEA 4KUEA 4E30A 4D79A 4TVBA 5JMPA 2NSDA 3GUCA 3CSDA 5JAIA 1QLHA 2HK7A 2EGHA 3DHYA 5A05A 3BTUA 3I6IA 2YUTA 2G17A 2ZYDA 3GAZA 5CG1A 3RVDA 2QRKA 4MJLA 1QV7A 3JQCA 4QTZA 1I3LA 5G0SA 4EUHA 4BO1A 2E4AA 3HHPA 4LISA 1W6UA 3U0BA 4D0RA 5BSEA 5TF4A 3KYBA 3RC7A 8ADHA 2AE2A 3H9QA 3NDIA 2X0RA 3ZV5A 4OL9A 2AW5A 4J1NA 5ES3A 1WMAA 4E0BA 1KEUA 1EE2A 1WW8A 1DC3A 5L4NA 1XHLA 1CF2O 1BVUA 1ZW1A 4R1TA 4Z9YA 2D3TA 3LC1O 4CR6A 3QVTA 3GZ4A 3U3XA 2Y99A 5ER9A 1GYRA 3BHIA 2AEJA 1D8AA 3OFSA 1Z75A 4C7KA 1ENZA 4J4TA 3AI2A 2D4AA 3H9UA 5B37A 1YO6A 3L9WA 4Q3EA 3V2GA 1DRWA 3QVOA 1P0CA 1Y8QA 3DO5A 3WOHA 5H81A 1NAIA 5A9SB 5FWNA 1RPNA 4MVJG 5LDGA 5KJFA 3DBHA 2A94A 4ZQHA 2O3JA 3ZHZA 1VL0A 2Q46A 1XU7A 4R41A 4TVOA 1PQWA 1E6EA 2CSUA 2IZ0A 2P5UA 4IJWA 3OHSX 4YRAA 2Y66A 4GL4A 2P4HX 1KVQA 2W2LA 3NGXA 2XOXA 3D4NA 1UAYA 3ZGYA 2DTDA 4R3WA 3ZCXA 3WICA 4XDYA 2E48A 4Y8VA 1PJTA 4RO0A 4J4HA 4QQRA 1E6WA 2VZ9A 4I9NA 3JQDA 4WLVA 4XR4A 4OM8A 2GRAA 1FJHA 1OAAA 3ZHBA 4YJFA 3C1AA 5CEJA 4QXMA 3ANNA 4O1MA 1LSJA 4RDHA 3TL3A 4I9HA 1KIFA 3KSDO 3SJ7A 3ZH2A 3VKUA 3O8QB 4ZRNA 3EYWA 3D3WA 3TSCA 5ICSA 1QLJA 3KTDA 4MIOA 1T2DA 4G65A 4TQGA 2VUTA 1QG6A 2VHXA 1LXCA 3CUKA 1DC5A 4NBUA 5CAEA 3ADOA 1C0PA 4ITUA
chains in the Genus database with same CATH superfamily
3THYA 4BNHA 2RC5A 3EOBI 5K3DA 1SXJE 3MGAA 4AZSA 4QJ3A 5I6DA 4CR8A 3ZV3A 3QYJA 2DH6A 2VHCA 2Q6IA 4G37A 2OVFA 1K3TA 5EJAA 2HR1A 2P11A 3FNBA 4EW6A 1X6VA 4BO9A 1ESDA 3B53X 1P5HA 1K2WA 1QZXA 2JDIA 2JRCA 3IVAA 5DRTA 5KVSA 1DLIA 4BJ6A 3U61B 3UG6A 3ONVA 3T9CA 1KPIA 1EXNA 5I51A 4C01A 2OGUA 3GZTB 3GRUA 4G24A 4Z9BA 2RIPA 1DQRA 3DAGA 4TLBA 3KB2A 4IH4A 1D4FA 1ZOOA 2LVBA 2OG1A 4RY0A 3OE5A 1L7BA 2QMHA 3CNEA 5HF9A 4DUYB 4TKMA 4YO8A 2DQSA 3DULA 4D9FA 1IUPA 1HDCA 4GIBA 5BVGB 1Z7GA 3D5EA 4TX1A 5FPPA 3ONEA 2DE0X 2GSDA 4OLJA 4Y18A 5KYTA 3BDIA 3COSA 1A7JA 4DWWA 2H59A 4LZAA 2FLWA 4CLEA 5FFMA 1AQLA 1T8WA 3D7NA 2NAPA 2VHEA 4D44A 5EP4A 3JQ8B 1MX9A 4Z99A 4B34A 4G2NA 5CAEA 1HNZB 3PD7A 2JIBA 1KA9H 2C94A 4IHAA 4U6QA 3JQGA 1Z6GA 3WHLA 3M89A 1JBEA 1REQA 4CV1A 4AICA 2AQ8A 2ID8A 3OM9A 5GV8A 4EBBA 1JMKC 4KIGA 1DTSA 5ALEA 3KLOA 3ZZNA 4BMZA 5IWAB 1NMZA 4IO1A 1TAUA 3HDJA 1PD0A 1C2YA 3IEIA 4CIAA 2ZTHA 2QPLA 4EJSB 2RKOA 3GT0A 1M76A 5EUCA 4H3HB 4OQMA 5LMZA 5IABA 4JA2A 4HZUA 1C4KA 1Z39A 2FGJA 4NZMA 1H9CA 1XRPA 1O8BA 2DGDA 1F14A 1NP3A 2VA9A 2W71A 3WLRA 3ER9A 4HWOA 1KSHA 3FD8A 3KAQA 3VX3A 1GZ3A 1LPOA 1WEHA 2V74B 2YHAA 3EIEA 5LOVA 3ES9A 2VR1A 4JBWA 2CW5A 2VJLA 1G9XA 1A9QA 2WLSA 3D7KA 3B6JA 3QW4B 5FO0A 2OCYC 1OH8A 4TLAA 4O4HB 1A8SA 3M5WA 3PQ5A 1VDMA 2HU5A 3TRIA 1JWAB 4ZDIA 5LR6A 4LS3A 3OEHD 3U4CA 3B82A 3GLUA 5F35A 1QOPB 4ATNA 4D99A 3CF4A 4ZOQI 3D8NA 1CNEA 4QFBA 4QDOA 1RYZA 4L3VA 5KYNA 3ZY2A 2J0SA 2IOHA 3FGOA 4RNCA 2MINB 4C4OA 4IGFA 3I2YX 3W9SA 3QMMA 1TK2A 3ZJUA 1I14A 1MMFB 1MQ8B 1P3JA 1U5BB 3NORA 1IHOA 5ALKA 5IJXA 3VUFA 3WGYA 2QRVA 3F1KA 5LYJF 1E3MA 1PR2A 4JBXA 1I1NA 1SQSA 2PVSA 2Q8QA 2ZE6A 1M66A 1QCCA 1P45A 3F47A 4I4NA 4ASUD 4HUTA 4TVSA 1XPRA 3IBFA 2CXRA 3C41J 5EJ9A 1QP4A 5ECWA 2CF6A 1VPVA 2V8BA 1KJZA 1T29A 3KSRA 1XDWA 1BMQA 4F1KA 2JHCA 1EUYA 4WOJA 1HWYA 1TTQB 2Q9BA 1EVKA 1Z4OA 4C0AC 1GA1A 4Q7MB 2XTAA 5C37A 4G63A 1DRUA 2JLQA 4EECA 1AMNA 3NFYA 3K6KA 1GAQA 3OEED 4JSYA 2OA0A 1FJGB 2RCYA 3OCCA 1THTA 4X1OA 1VP3A 1JJBA 2AN9A 2JFXA 4E07A 3LUDA 3V7WA 2WD9A 3NTOA 5A0FA 5E8RA 1QVAA 3LXRA 4GZLA 4I4TF 1FDVA 1E1KA 1NYLA 3ZR4B 2AOVA 1MHPA 1JAIA 2IP4A 4N7JA 1HG0A 1Q44A 4JMLA 3P2JA 4CLDA 1Y3FE 1J20A 3T4UA 4CF6A 3DOFA 5ELXA 3PU6A 2NOAA 4G1UC 4BRWA 5BQ3A 1RRGA 2ODEA 3KQPA 1E3EA 2DULA 3GGJA 3LQYA 3RYIA 4ZI2A 3ZLBA 4BO0A 1UIRA 2PRZA 2CYAA 821PA 4NDNE 2R8PA 4JXKA 4NFLA 1QBKC 3TL6A 3BJMA 3PKJA 4HNVA 2JCSA 2WWXA 3H1TA 4HAOA 2OO7A 2C2MA 4RKEA 3FTFA 3T4EA 1GPUA 3I6BA 3GNLA 1B0PA 1ZUD1 3RBVA 4L8GA 1ISMA 3LLUA 4GPTA 4OAPA 3RJMA 3O8NA 5JAZA 1AQIA 2NZVG 4IFIA 3TMKA 3W79A 1KAMA 1VLVA 2PK3A 3N28A 5AI5A 2LZ0A 1Y8ZA 1P6QA 1XZEA 4JGGA 3WQSB 4AJLA 3EVTA 1M0WA 1GZHB 2VPQA 3DR5A 3EDCA 3VNSA 3K73O 2IYLD 4US0R 1YB7A 2NO1A 4O1IA 3MELA 4X90A 3R9WA 1NUAA 3D2AA 3H0KA 4FFDA 4ZRMA 2Q5CA 1EH5A 2E82A 1X0XA 1I10A 1VJRA 4CEHB 2D0DA 4R7ZA 2C2HA 5BXQC 1HDYA 3D0RA 4OGLA 1FMTA 1IJBA 1RP7A 2HLDA 2Z4TA 5BN1A 2R7AA 1DKOA 3NR2A 2AQKA 3D4LA 2WMOB 5DTRA 1KE2A 3X3HA 3GCGA 5L3RA 2ZW9A 4QPDA 4ZOEA 1RQGA 1T0BA 3HY3A 4LRQA 4ZAYA 3JATB 3TGLA 4Y98A 1CQJB 4IZ6A 1M6HA 3ZE1B 2CL5A 3ZHOA 4TVKA 4AJOA 2GJKA 3L0CA 1UDXA 5A02A 4B6FA 3VH3A 3CTPA 2OHHA 4GQBA 3GLFE 2P2YA 1C30A 4WGFA 3GY0A 3T1VA 1U7PA 3SC3A 4CQMA 5KX5B 1VB3A 5F12A 4AKSA 4EUFA 4CTJA 1HFWA 1HMPA 4N65A 4U2KA 1WHTA 2P6PA 3OFJA 4K9MA 2MCFA 1FY2A 2A84A 1WV0A 2ZQZA 1SVOA 1I32A 2NTNA 4NBKA 3N9IA 4EGSA 2BF7A 1JA1A 4X24A 4BLQA 2V1UA 1AHNA 2XE8A 3H75A 1BS2A 1WZCA 1WXGA 2PLRA 2ZAMA 1BXRA 3EZXA 3P5SA 3QFSA 3EIOA 4BYMA 5JS7A 4DRZA 1IUNA 4KE6A 5FUBA 2X7XA 3N74A 4JEHA 1F6WA 1OV4A 2GVDC 2OKCA 2AR0A 2ZRDA 4M89A 5DSXA 3RD5A 4AK9A 4JLWA 2QRPA 1T0PA 5DB4A 3TCNA 1TPZA 2H1FA 1I2ZA 3H86A 1AHHA 3W5UA 3U26A 1QC5B 2NU6A 4LCEA 4PANA 4KR2A 5DGXA 1U3DA 3GEDA 1H9AA 3BSSA 4HWKA 5IHPA 2LPMA 421PA 4YUYA 3DDSA 5K0FA 3O4JA 1ECCA 3ESYA 1D7AA 1FDUA 3G2KA 3MUFA 5DXFA 5HJ7A 2C8KA 4J0QA 2QQ5A 3NJ8A 3UK2A 1VQ1A 3Q72A 2G06A 1M8KA 4IO0A 3PRJA 4GO1A 3C7TA 2WTAA 1GG5A 3C6XA 5F3RA 2XDYA 4PLGA 4BCBA 1DIAA 1QQAA 1H93A 2P62A 4CE6A 2FXIA 2HGZA 1F5NA 1R37A 1PE0A 3NCTA 5E1OA 5D2CA 1MG5A 5K51A 2NUPA 3IP6A 4DCOA 1HT3A 4HLUC 5ALNA 1XYVA 4F04A 3GGDA 1G8YA 3N3BC 4TMYA 2R6DA 3GD7A 4JDPA 5A5FA 5G0WA 3PKZA 5CXSA 4FHFA 1LVUA 1VYHA 2D5IA 4YCMA 1JKJA 2K7FA 1MQ9A 1I3CA 2XMCA 1GIAA 2CBGA 3AC0A 1DIOB 5FRDA 5FPYA 1TUBA 4HTFA 4OHUA 4P38A 1GSIA 3M9XA 4E2YA 2GMWA 4I3FA 5T3YA 4BV3A 3TVYA 4R71A 1L7DA 2P2CA 3G2IA 2FI1A 1CC1S 3OLYA 3M34A 3EK2A 1DIRA 4OL0A 3AF1A 4J0KA 2RHLA 1PJAA 1Y9EA 1Z16A 2JCYA 2QT9A 3FCYA 2PTGA 3HCFA 4HQ0A 4JFAA 4BOYA 4ZYWA 3HRIA 1VL2A 1M72A 3BSFA 3ZI7A 2H48A 2XUIA 3DMGA 1N2JA 3VNBA 4DAEA 1GCAA 3U4IA 1UWLA 5BR8B 4IDHA 3IHWA 2Z30A 2YFHA 3PFCA 4CCWA 4ARCA 4L72A 2HIHA 4L2IB 4WSOA 3P9IA 4L5AA 2H54A 2XD9A 2E5LB 3B7GA 2Q3EA 2CSXA 1RQPA 4V0QA 3WNVA 1UFRA 4MYHA 3LT4A 2QJOA 5F4BA 2WAMA 3TZLA 3W06A 3WK9A 3W04A 3RS5A 4XSGA 2IDKA 4NE7A 5JYBA 2PGNA 2NUTB 1JNXX 1WUTA 1JH9A 1D0SA 1NN3A 1W2GA 2JI7A 4UE2A 4EZBA 1OSNA 1N3LA 3NKFA 3D8HA 4UDNA 4ZP1A 1K06A 3LBIA 1D5CA 3ZXXA 4EVSA 3WAJA 2X0IA 3LDUA 1TKCA 2BKUA 2BCJQ 5EWJA 4F5DA 2FSIA 3NFRA 5JSZB 2PX3A 4IZHA 1AGRA 2BJHA 1SEPA 2JIZD 3FCXA 1EP2B 1MA0A 3KO8A 3QPAA 2PXHA 3L93A 3CF6R 2IEDA 4V3BA 2ZJ8A 2BTEA 2L2QA 2HSDA 3H4IA 5T4EA 5GONB 5FLYA 3LCRA 1F9EA 2VDMB 3QEMB 3TI7A 1PNQA 3V48A 4NX2A 3B1VA 1ADJA 4FCCA 1MLDA 4MB0A 2YVKA 5LP6C 4PPQA 2DTXA 2JFOA 1JEAA 1CUHA 1SUBA 2QY9A 3HEAA 1GQQA 3AESB 3I34X 1B8PA 4MYCA 3T61A 5F7XA 3I2GA 3PJRA 4FSHA 1TYZA 1X7XA 1YR7A 2Y1GA 1AUQA 3NHJA 3QOWA 3PNYA 4M3NA 4PYKA 3S4YA 4UVDA 3SJCA 5CA1B 2HT1A 3DDNA 1L5GB 2JLBA 3HCDA 2FPKA 1VLQA 3WK7A 1TW2A 5GADl 1T3TA 4GWGA 3BWBA 3QI7A 3WSWA 3B8EA 3G9UA 1WY5A 2HSEA 1M1NA 4HH3C 5FL7D 3ZK7A 5ICCA 4OLHA 5AW6A 1DWUA 1I5EA 2NU8A 1WMFA 3AR9A 2JCVA 4H7PA 5BQFA 3QE0A 1ZY2A 4H27A 5K8CA 4H2DA 3HXMA 1A9TA 3NC0C 5KTTA 4DADA 3BFPA 3NANA 1TZMA 1PLKA 3CMCO 2YS7A 2CLOB 3M70A 1GITA 5CT8A 2J31A 4ZVPA 3DH0A 3O9VA 2RGRA 2YXBA 4MW4A 3Q40A 4A7PA 2PCLA 2YXDA 4C2BA 2ID7A 2RBKA 3IP9A 5HFNA 1KO8A 2CT8A 1T9BA 1MC1A 4P4SA 2C1ZA 1OXMA 3PUIA 5FD8A 4EZEA 3UK1A 1WOMA 2Q3FA 5KNDH 5KYYA 3CTMA 3EF3A 2Z9BA 1EVQA 3CG0A 3OPQA 3R0ZA 1G38A 1YQDA 3HN7A 1SVKA 2RH5A 4P3NA 1KBOA 2RKBA 3QKSA 2RHRA 3ZNQA 3G82C 4Q4HA 4CG0A 4FGUA 1R66A 4C5AA 4OFBA 4B6OA 1QZUA 1VJTA 3UY4A 3ZVKA 2PBZA 4RA9A 2K6GA 4RU1A 1GSHA 3H0EA 4KR0A 3VHXB 1RQNA 4BNDA 4MKZA 2AI3A 3M7IA 1J0BA 1IBRA 1NF2A 1QKIA 4WEOA 2MMCA 4UE6A 3AVXA 3BRSA 4ZAXA 1FSSA 1I3MA 1OWOA 1VHDA 1X1BA 3N2IA 3C74A 3P9PA 4L5YA 4OQFA 1G20A 4TWIA 4YBRA 2J9GA 3NNSA 5EJFA 3ZC3A 3KFVA 2DBVO 1ECGA 3F6CA 1TFUA 2AOUA 3K35A 3IHTA 3LTEA 4OYYA 4BGUA 1G8PA 1B14A 1DXHA 2I87A 4QXQA 5AKLA 1I1OA 1PJLA 2DQZA 4OHOA 3N07A 3SIRA 1M0EA 3WDSA 3KTOA 4ZHQF 5C5CA 3RRYA 5LBIA 2QX9A 3PFNA 2D2XA 3KOOA 1G3MA 1VXOA 1D9XA 3KJNA 5EJMA 5LYJA 1ORWA 4AAYA 4NBWA 5L7TA 2BYTA 4O2LA 1WZUA 2P4QA 3Q10A 4LF6B 4UBOA 1DVRA 2VQSA 2VTDA 2V54A 1XJCA 5AVOA 4MQLA 2AXQA 2HRCA 2WI8A 3DYBA 4MKRA 4BQSA 3TR0A 5A2GA 2XVZA 4M99A 4MCHA 1IPEA 1JXQA 2FKAA 3IX7A 4HDSA 4PFSA 1ZKMA 5HS4A 1TQ8A 1XMSA 3EVBA 4FQ8A 3DFUA 1FNDA 3OBIA 3X1YA 4EG7A 4YAUA 1RTTA 5BN5B 4A1FA 4JA0A 2BISA 3DDOA 4HXEB 3QVKA 2FN9A 5M5BA 1ZD5A 4YDQA 1DC6A 3P2EA 4M8IA 5D85A 3DR3A 2ZZKA 4WPGA 4I4TA 1TF5A 5CDUA 5EJ6A 4OI2A 1QPGA 1MB9A 2W6QA 4N01A 1SXJD 2WJGA 3OQ1A 3H3XA 4D42A 2PUJA 3INGA 3LLSA 4A9AA 1UP4A 3ELYA 1XZNA 5TDHA 2C31A 2GESA 4OIMA 5J1SB 4GDFA 2A9KA 1KDTA 3ZWMA 1IE3A 1VRCA 2OVBA 4ND7A 3ICVA 3ZDCA 3EZGA 2QL7A 2FE4A 4Z4FA 3EIQA 4DLXA 4EYKA 4B3HA 4YT2A 1XI2A 2AOTB 1BA3A 2KLBA 4J3JA 4CJXA 1X8KA 4NDAA 3T3NA 1HFEL 2VHZA 4FSXA 4OREX 3O3MB 3RSGA 1NUUA 1R6DA 3WKAA 2XW6A 2RK3A 3KOWA 1XZFA 2CVQA 4EGFA 5D86A 4FOLA 3WKEA 1N9GB 1IIBA 4JKIA 5K05A 5KTNA 3NBZC 1OTYA 1OXUA 2F43A 8GPBA 4HL6A 2YICA 3LL4A 1E62A 1A9XA 1NYTA 2BVNA 3CPEA 3L8DA 3NS7A 2IX9A 1W8IA 2XDQA 2QX8A 4NZNA 4ALIA 2ACVA 1TE2A 3BGOS 2Y0EA 2E1PA 4FT2A 4AKTA 3UMVA 4QVIA 3AY0A 3RF7A 3X1DA 1ZRNA 2VQ3A 3NDPA 3WGNA 1USUA 1UXJA 1V8OA 5JOQA 5AKXA 2QR2A 4V0NA 4Q9KA 5DSTA 1EFHA 4MS3A 1AKVA 4ND8B 1XFDA 4G07A 3RU3A 2ZXFA 1NLMA 2OAEA 2W83A 3P4XA 1R4AA 4JJKA 4DV7B 1ODSA 1Y98A 2JATA 2JJQA 2XWQA 4LKOA 1QFZA 5IHXA 1DTWB 1RLTA 3G1TA 2LE0A 1PJ8A 2VYQA 3KZXA 4RPGA 3UFXB 1TZ2A 4YAIA 1EQ2A 2EWMA 4Y2UA 4D4MA 4PZZA 2LUOA 2E18A 3IVXA 4V0KA 2H63A 3ICWA 3QNWA 4HUJA 4U6NA 3B51X 2ATCA 3RBXA 4WKCA 5T57A 4JI2B 5TF0A 4QUGA 1M0SA 3OU6A 2CMDA 2FP4A 2PGAA 5M3BA 1Q57A 1ZRMA 2FOLA 1L4GA 3K8YA 4H7KA 3VR2A 1U9IC 1ZNWA 4WY2A 3HU5A 4Y1GA 5DWVA 5F2OA 3RHFA 1GEEA 3JV7A 3ZWDA 1QVVA 4Y3UA 1ZHFA 1J22A 1GQSA 3G17A 3GIWA 1UWCA 1QFXA 2G5TA 3DAFA 1DEKA 1HDZA 1NM5A 2YIDA 4JJGA 4BZZA 2GLXA 4C0WA 5JZSA 4H08A 3H9EO 3IKVA 3R20A 4M9ZA 4MW6A 1VGRA 5DF1A 3H2HA 4UHKA 3ZEAA 5B7GA 2EZ8A 3A4VA 1ZLXA 3ESXA 3PYMA 5IDQA 9LDBA 1GTG1 2HOQA 2VRBA 1J2UA 3LG2A 4HGRA 3S2SA 2WINI 2Y0BA 3FFXA 5EMHA 4B44A 2ZYIA 2BI8A 3M3DA 1ZW6A 2I6UA 3A11A 3G7UA 3MGCA 4EHAA 5CM8B 4Q1EA 4NCXA 2E4YA 1YIOA 3W9YA 5C35A 2X6QA 1N9ZA 4DSUA 5BSFA 2WKSA 2TMGA 4U2DA 4KI7A 5B1IA 3PR3A 3CLVA 3NBYC 3X2EA 2Z08A 5AQ1A 3MRVA 4RSMA 1LD3A 2CD7A 1PU2A 1V6SA 2FEAA 2I66A 1UBFA 5EA2A 1FZTA 1QHHA 4MSUA 5TQVA 4LECA 5CT6A 2WV9A 3OIYA 3HSKA 3FVVA 1I3KA 1YBMA 4Q1VA 3Q9UA 4RGBA 3CLTC 1U65A 2C97A 2DSTA 1XP5A 1UJNA 5ESWA 3QX7A 1ANKA 4DGQA 5CDYA 2BSQA 1RP1A 4QG7A 3FYDA 3CNLA 2VS1A 1ADGA 3UUEA 4B3CA 2UU9B 3AF4A 1LLDA 1IOVA 3MLEA 1NDQA 2JW5A 1NWCA 1SRQA 2I7VA 4NBTA 4QXPA 1QYIA 4DLWA 1U7WA 2O8CB 1Z73A 5L7YA 3SFVA 1NW3A 3UM9A 1BGXT 3K70B 1MJGA 1MEOA 2RHGB 4RXUA 5CT9A 4MRAA 4HAWA 2K5UA 1OYWA 5TVGA 1KVRA 5JE8A 3S2FA 2XOKA 1NR5A 1N57A 2GFIA 1G20E 1XCLA 3FZEA 4PYNA 1QNFA 2H5EA 1H2FA 3BCUA 3IE0A 3TJZA 4L5CA 1II0A 1W5EA 4QLOA 4R1MA 2C3OA 4H7DA 3E61A 1JG1A 2W2LD 3ETLA 5EEGA 5EZYF 4NH0A 3G2JA 3BCRA 2ZRMA 4V0OA 4EF5A 1PK9A 3REOA 1OLSB 3PNLA 1T6ZA 1DG3A 3QFFA 2V03A 1T1EA 1G21B 3FBTA 3H3FA 3OICA 3GOQA 2YR0A 3SM9A 4NV0A 5D01A 1PK7A 1ZXXA 4PIPA 3RIEA 4B6QA 2VXYA 3HUDA 3GRAA 5DYWA 4G2TA 1FIUA 2O1WA 2QRQA 2JB9A 3IC5A 2LKDA 3AEQA 4J49A 1P0MA 3EDRA 5DGHA 5J5AA 3RG8A 3C3PA 3U4MA 4BQQA 4G8CA 2BP7B 2WUVA 2MSWA 1OVMA 3ILVA 2P91A 4WINA 4XWGA 3JWGA 1ESCA 3TXAA 3N53A 1HZJA 4PLTA 5B3JA 5AUNB 3BL6A 3B8HA 3B36A 3FOCA 3I1FA 4DRXB 1BWSA 2WJZB 1GZ6A 4IIYA 4OHKA 5BYAA 1OBCA 4HX2A 5AVXA 1C7RA 1CE8A 4MDYA 1T1GA 3MYYA 3OHPA 1QYXA 1EUQA 5IW8A 1ZU5A 4PBTA 3KXPA 2WIDA 1T5LA 3FA2A 1QGYA 1LC3A 1MB2A 2DAPA 2HPAA 3LE8A 4YNBA 4IHJF 3W05A 2J0UA 4OB6A 5BYJA 3A36A 1JSZA 3OQVA 1BW9B 4D9GA 4Q4CA 3GNSA 4MJ3A 2VPZA 5LDHA 2Q0HA 3EXG2 1KDZA 3JSAA 2JDID 5FLXA 1N7GA 2JKYA 4LYGA 4FFBB 4QFCA 5KO2A 3C3AA 3FMIA 3VSAA 3H8SA 4YCLA 2OBLA 3IDFA 3B52X 1RE0A 5EHGA 1Z2OX 2P77A 4DIOA 1DRJA 2XMGA 2FOXA 2RHOA 3UPDA 2H3HA 4XQGA 1ZK4A 3NAZA 1U0FA 2C61A 2O2JA 2J0VA 1JQLB 4UEOA 4C0SA 3AUSA 1GEGA 3ZDQA 3E70C 1VPEA 2JLUA 3QLJA 4GFDA 4O4LB 3WMWA 2J5BA 1GKUB 1LSSA 4DBZA 5M29A 3NAGA 4ZAVA 2EEPA 4P0PB 2QTCA 3FWNA 2FRXA 2IZZA 1FUEA 4NPAA 5DHRA 3GH3A 4MMZB 2R48A 4Q7LA 4I66A 4ZJUA 3U9LA 4CKYA 1N8SA 6PFKA 2Z1MA 5KKCA 1ZYUA 4IEEA 5TT1A 4JLJA 2V7TA 1PQUA 1U7OA 2X13A 3D31A 1QRTA 2PZ8A 4TWRA 4QUAA 4TTRA 3V42A 3W6UA 3BGSA 1XCJA 1SBQA 1TCAA 3IAFA 3KNZA 1F8FA 4AO6A 4ZTUB 3K5PA 1K3FA 1A2OA 1FQWA 2XECA 3T5MA 1ZA1A 6YASA 5BSWA 4FWTA 4B48A 1E3TA 2C78A 1X2EA 3ZWVA 5TQ0A 4DAOA 5I7UA 2D00A 1EWVA 4Q5IA 4ZO9A 3VMMA 3TSYA 1B8UA 1DLJA 1GPBA 2BN4A 2H2HA 4D4IA 2QLNA 2Q4EA 5GMOA 3M3PA 2QZPA 4DM4A 3CLRC 1SUAA 4XW2A 4E1AA 2FEKA 2Q0SA 4RUKA 4I9GA 3QLTA 3SP1A 1KR2A 3VU9A 4CT0A 5CBPA 5FIUA 5IX8A 2BHNA 2BF4A 4ZOLB 4Q1BA 3AV3A 4ND2A 2ESRA 4CRWB 1VKOA 1ADBA 1J0XO 1JPNA 1S1CA 5D3KA 1XLVA 2IP2A 4JB8A 1WKVA 1AA6A 1XP8A 5MFPA 1VE9A 5IVIA 4D8UA 1KYIA 1S2MA 3HC7A 1EFPB 3OZIA 3WI7A 3NVMB 4PNEA 2YY7A 1ULHA 3LUPA 5ALWA 1JIQA 2A35A 4HJXA 5IBPA 5KYUB 4B6RA 1KU6A 3DEIA 3F5MA 5BYBA 5KNLA 3NU1A 2F48A 1L6IA 4LBZA 1LS6A 1OIXA 4LE1A 5H9VA 3X1ZA 1XNHA 1E99A 4ECAA 1U02A 1I4TD 3F6EX 3ENNA 5IJAA 4Q3LA 5J58A 4R0MA 3CYFA 3N6RA 5C7IO 1H6AA 1D9ZA 1F2TB 4FVTA 4C89A 3G9XA 3TD2A 2IW1A 2HI0A 2BGWA 1HC7A 3HU3A 4MYSA 4YACA 1FPMA 4V1CB 1LI5A 4JUAA 3PRKE 5HQJA 5KU1A 1T10A 2IRWA 5K0CA 2Q7XA 2APJA 1Q0UA 1TM7E 1FDSA 2I78A 1J06A 1XSEA 1JEQB 5SZKB 5C4MA 1CW2B 3S27A 2QB5A 5T3UA 2IH5A 3HKDA 2BEWA 2V4MA 2ZDGA 4KQ2A 3QYFA 1PWEA 2PUGA 2Q3JA 3GN1A 4YHBA 1JLRA 3LT5A 4LQLA 4NCJA 2XODA 5CFQA 4WESA 2FUEA 1RYNA 1Z4NA 3FNHA 3KOUA 4LYHA 5EFOA 1N7IA 1L4HA 1P19A 3FPJA 2FX5A 1MENA 2IA5A 4UFPA 1R9MA 3ZJ5A 4FJ0A 4EPWA 2AWOA 4HB4A 4OK5A 2OMKA 2YJ3A 4Q21A 2XKAA 3DTTA 4HQFA 4RJJA 1HE4A 4B3JA 4DC1A 4DV1B 1BDIA 4KO4S 2V1XA 1YAJA 4B7UA 3L6CA 4O4HF 2XQJA 3TX2A 3WWDA 3AHDA 2ZB8A 2X2EA 1DV2A 3DXXA 5TMEA 5AW0A 1DDGA 1ST2A 1E2FA 4LDQA 4GNKA 1GRNA 3AERB 3EGXA 3K2QA 4J7UA 4L7VA 1ZUIA 4HUQA 4K8OA 3IVMA 2HHAA 4A82A 4HWGA 1GGEA 1Z37A 5FNVF 1YQ9A 2YASA 4Y2GA 4EY8A 1OW3B 2HLHA 4PAGA 2WUWE 1R0ZA 2ECPA 5A71A 3A1VA 4GX0A 4KITB 2RBEA 1PDOA 3HWX1 4HEHA 2G1UA 5COBA 1HSOA 1Q3TA 1KS2A 5DJ5A 3SU8A 2L17A 3JAKB 3DGEC 5E7MA 1SVSA 3DL7A 3S2ZA 2YY6A 5DO9A 3ZI0A 2QE6A 3JYPA 1XA4A 1KVTA 4LYAA 2I2CA 5AW8A 2C8VA 1TQ4A 5FNZA 1DKUA 3GB9A 3UWPA 4Q7QA 3QY9A 2PQMA 4BQEA 4YRFA 3G9TA 5BW8A 3MMZA 2PYDA 1JDZA 1HY3A 2YHIA 4XEUA 3AEKB 4OP1A 5U9CA 1AE1A 1OU0A 6Q21A 3LJKA 4YP1A 1JFFA 2HLDD 3D6FA 4GI3A 3FKSA 4FHDA 5E7JA 3MJ4A 3AI3A 1Q5PA 5EIAA 4DB4A 2GCIA 1M2VB 5EI5A 2QL6A 1N5LA 5I7OA 4FR5A 1PBTA 4JL5A 4B2PA 1QK3A 3D8SA 4RCVA 4ZOCA 4WV3A 2J9ZB 4TS9A 3AXSA 4GOOD 4X1YA 4UVHA 4WNYA 3EXHA 2H7YA 1MORA 1FS4A 2OOSA 2VI5A 3CZ9A 2EFEB 4TQUS 4AF7A 2R4TA 4CQMD 4WL0A 1COZA 4NCHA 5E4YA 1GRQA 3WYAA 4N76A 1B76A 1L8QA 4MI9A 1OTHA 3H6GA 2C8LA 4EEXA 3BD8A 1LBQA 4NU6A 4ZT4A 1PKXA 4RSHA 3LS2A 1FBTA 2AHOA 1WSBA 1V5IA 1NNUA 3BAFA 1BD4A 2ZSJA 1C50A 2JGIA 1W1UA 4LHXA 4R83A 4BBJA 4DLZA 1Y4SA 1CUIA 2LNDA 4PLHA 1SIWA 2EOAA 1CJUC 3KE8A 2GEJA 1HLFA 2HWKA 2YV2A 3LGSA 1TMKA 3NIDB 2IS1A 2DQYA 4OFWA 3TPFA 1LW6E 2EW1A 2WDZA 3VHLB 4L02A 2OHFA 2RJNA 4GOLD 1ATIA 3QYAA 4AF6A 4L6CA 4R9VA 3F6SA 3IAAA 1ONPA 1G9TA 1WAMA 4B2LA 3A9WA 3CG4A 3GLRA 1ZRHA 1LDMA 2XNSA 4ZZ0A 1N7JA 1IHDA 1Q1QA 1VKZA 3EF0A 4BB5A 3PFWO 4JITA 3K1AA 2CXSA 4BWVA 4XOIA 1KI8A 1DB3A 2FQWA 2RH8A 3QKRB 1HKHA 3MWGA 4OYLA 3WHPA 3S81A 1CETA 2QRNA 4PEVA 2BJVA 4NAHA 1YH3A 5F7ZA 5ELMA 3WKCA 5HUHA 5GJVC 3AR6A 4F2GA 3AVWA 3P4UA 4CDRA 3FM9A 1A7UA 1UJ6A 2BBWA 4I1RA 2A9QA 4N03A 3UK0A 5FBHA 1GQYA 3OOSA 1ZC4A 1QHYA 4XCQA 5C34B 4RTOA 3VU3A 5KX5F 4BASA 5CAEB 4ABTA 1NYRA 3DV0A 3RAEC 1QAOA 4H16A 1A2BA 1SUSA 3PP8A 5I4IA 4RZHA 5CDTA 3A4YA 3C70A 2PWYA 4UBNA 1XA3A 1PT9A 3VDMA 3SM3A 1E0DA 2O2IA 2IPAB 3RTEA 1SXGA 1UL1X 3DNFA 1UCFA 1XEAA 1HZZC 1SCBA 2HF2A 1MEJA 2C92A 2ECQA 3JQ9C 2JGNA 4M2LA 2LCQA 5BXYA 3EGCA 1QV9A 3ZDDA 1ST3A 4S1PA 1BDBA 1ZL0A 2QUIA 1OXBB 1I9CA 3BXOA 4QXAA 4B9AA 4WXEA 2GA8A 3GG9A 5EIBC 3QEAZ 3C6KA 1WM1A 4ZO8A 1FQJA 1CQIA 1RWBA 5LC1A 4EM6A 5EZYA 2IUFA 2OAQ1 2NO0A 2XGMA 3BWEA 3DFIA 3K9BA 3LOPA 2NX2A 1YGYA 3UB3A 2DETA 3FCEA 3AT1A 3ZW8A 3R5XA 1WZEA 3IIKA 1JTVA 3K53A 3ND8A 1UZLA 4IHKA 1H3FA 5KDLA 3ND6A 1S0UA 1JEEA 4X8HA 3W2IA 4X62B 4GS5A 5EJ8A 1I80A 4M83A 3SZMA 2VN8A 4AJ9A 1P7YA 1OA1A 3CWQA 4JCOA 1KJJA 3UO8B 3OWHA 4B6PA 1ONOA 4CIXA 1DC8A 2REOA 3BX1A 1WDLA 3NWPA 1SCUB 1HQCA 3JXEA 1SAYA 4MWGA 3EVEA 5DWQA 4ERNA 4TTQA 2ZSDA 3IAM1 3RRXA 3BFJA 1G3QA 2D54A 3LVFO 2FA9A 5SZJA 1LSUA 2W2XA 4L50A 1DNPA 4BNZA 3KWJA 3OZEA 3SOPA 1QGZA 1L0BA 1TYAE 4UZFA 1GJRA 4IOJA 4YBZA 3SC2A 4S0XA 4NQRA 2BMVA 2RSLA 1MBZA 5DBIA 5IVDA 1XRLA 1CUVA 2GJ9A 2QUAA 3NHWA 1TB4A 3O1IC 3O7WA 4I1IA 2LBPA 4JJZA 4TZ6A 3CMMA 3KQLA 2Q2WA 2W2TA 3COZA 1SC3A 3FR7A 1SY7A 3LX8A 4IHJA 3OC6A 1VI2A 1C9DB 2PH1A 3WFZA 3WLHA 3VU1A 4WKBA 2QTHA 3ZOZA 1GCIA 1ZBQA 3JQAB 4F96A 3QE4A 3NZEA 5DM60 3V1NA 3PC8A 4GICA 6CHYA 4DLSA 1V2GA 5BUQA 1NJ8A 5BW4A 3PJFA 2HU8A 1F4PA 1T9ZA 3LNTA 1QHFA 5CDSA 4ZMRA 1QWSA 1QONA 1X77A 2Q3HA 1YDMA 2A7XA 1V16B 3BE5A 3QVSA 3BFXA 2LP4Y 3QWAA 1HBJA 2MSLA 2XOEA 4JN6B 4IILA 1H2ZA 5AW3A 3T7TA 4GRDA 3T94A 1A76A 3BOSA 4E51A 4ZVNA 1ABBA 3EX7C 3FPAA 3HG7A 3O8QA 3PTAA 4CWAA 1E1NA 3PGVA 4XYBA 2Q9UA 1GGJA 2IEZA 3OY7A 4LTDA 5I47A 3WL6A 1CUSA 3KD2A 4NV3A 5DK4A 3FPSA 3RRJA 3RYFA 4C7VA 3IIEA 5KYWB 1DCMA 1SBZA 4X41A 3UAGA 1XALA 1GGVA 2FCAA 3UCXA 2P4UA 3PEWA 4DJJA 4LMPA 1MP0A 4RL4A 4B8WA 2V7UA 4DYHA 3TFQA 4RK6A 3F71A 2GCEA 2OK8A 2QN7A 1TM1E 1JGTA 1W4LA 2JGKA 2JJYA 4OSPA 4R7TA 1VTKA 1XHFA 3KOMA 1M34B 4K0RA 1KAGA 2IHVA 2I2FA 2ZBRA 1L7RA 3LZCA 1RU3A 4GLJA 4HN2A 3SI7A 4EHBA 2BKXA 4KK4A 1HDIA 3WIOA 1RCTE 2AFHB 3L7JA 2XQVA 1ZI6A 4DJFC 4JOCA 4RZUA 4C4TA 2G82A 1LTKA 2Q4RA 1Y8AA 4YDRA 5FPKA 1P2VA 4AQYB 5I01A 1TQ6A 4B80A 1BNCA 3FROA 3RFFA 4MYTA 1X38A 2X8LA 3H2JA 2WWRA 2NUAB 5CA1F 4M37A 1Q17A 3JD2A 4HTAA 5CNMA 4DIEA 4P2BA 2CXTA 2XKJE 2WD7B 1H0KA 1PZFA 3DBIA 4FHCA 4R69A 5JMTA 3V8VA 3VDQA 4L4ZA 3OQNA 1PD1A 1ACMA 5AHXA 1RFLA 2OM2A 1HO3A 2PL5A 4NARA 4ZAZA 3C3EA 1KHHA 2Q2OA 4CBVA 3L18A 3O3CA 4DILA 1VFPA 4Q00A 4X7RA 3HH8A 4PN3A 1J8VA 4H4CA 4LOJA 4BFVA 2ZIEA 3G5TA 3PQCA 5J4KA 4IHQA 5HMMA 2RHDA 3NETA 4NFHA 3JQ8A 3BEOA 4MRSA 4EUNA 4DJ5X 3IQXA 3O4IA 1D0VA 3U16A 1A9SA 1CF4A 1ATZA 2JGJA 3FCUB 3LK7A 4RENA 1XDDA 3WO0A 3HWSA 2ZJ4A 3O8LA 2VJDA 2GN1A 2J3QA 2IHBA 3FVRA 1TKBA 1GPYA 3CVJA 1QAMA 3C3XA 4TWBA 1E2UA 1V1MA 1V3UA 4NQZA 1TLLA 3ISTA 2ZBVA 1O6CA 4D45A 4EJ2A 3KAJA 4M86A 3LYLA 4O6VA 2G72A 4BO3A 5EESA 5B5SA 4D0SA 1UK9A 2AFRA 3K20A 4DC0A 3HI6A 1VI5A 3TG8A 2DT5A 1E3WB 2ONKA 4EG3A 1L3BA 1MGPA 4EAAA 2ZYHA 4UTZA 1H2XA 3GBPA 9ATCA 2IQIA 2P65A 4Q01A 4I46A 2C9MA 3BZBA 4O4HA 4OJYA 2OYCA 2D5AA 1U7DA 1XDGA 5CA0B 1JIKA 5KYYB 2GCOB 5TV2A 5TGTA 2I6QA 1KO5A 4DL9A 3LP5A 2QTBA 1GOTA 4NFYA 4GPAA 3RVOA 1AG9A 1E69A 4JHXA 3TZ6A 3L7LA 4KN9S 4AS2A 5FNVA 4BNLA 2MINA 3KQSA 5C5IA 4DR3B 1OWLA 2GM5A 4AY2A 1RR6A 1U5BA 1GILA 3U37A 3AM3A 5KDOA 2EF0A 1XU9A 5KU7A 1AMUA 3B1ZA 4MP8A 3ZGNA 2PRIA 3VYUB 1LX6A 4M1MA 4CIBA 4MKXA 4XQ0A 3AFHA 1G5TA 2N3ZA 4FYMA 2E37A 4UM9D 4BKPA 1G17A 3TPCA 1G1MA 4S1WA 1YIDA 5PNTA 1RADA 1YS2X 4KQJA 1DJLA 1O3YA 1N4DA 3ESRA 4MIYA 1AVTA 5A7HA 4FM9A 5KTKA 4W5QA 3HPQA 4OU5A 3EGVA 2RDMA 3EZNA 3EUFA 3ZLUA 1L4BA 1L6RA 1Y4ZA 2XF8A 3F3YA 5FHRA 4NOLA 1V3VA 4EG0A 1UC5B 4UM5A 3B13B 2NYRA 4XZ3A 4X8OA 1GZVA 3AHCA 3FTCA 3RK4A 4A10A 2G67A 1G8GA 1DAEA 1WKBA 3PQFA 4P34A 4P9NA 1OJLA 3NHSA 5EHQA 1W4ZA 3TSAA 1RAGA 3ZBUA 1P1JA 2F1HA 3AIOA 2V4UA 1WW3A 3BERA 5A3SA 5A04A 3I0NA 5CJ2A 1R2QA 2HNAA 1ZJYA 2W2QA 1MJFA 5A5VA 3G13A 5A0TA 4ZARA 4PGFA 3JS5A 2QT1A 1DFGA 1OAOA 4JL6A 3IV9A 4F4JA 4B32A 5AW5A 2MIIA 3HJTA 4D46A 1RYBA 1VYTA 1KOJA 2VAPA 1E5QA 2ODBA 3K16A 1I4WA 4G97A 4JYMA 3PXAA 5E9QA 5GJWC 5HCUA 4BB0A 4NIMA 1H2EA 3SS9X 1RNLA 4XUGB 4KGDA 2PMKA 1J09A 3EASA 1Q7EA 3WKDA 3VR2D 4C0KA 1OIWA 5C18A 1ZWLA 4RK1A 4WE3A 1I0IA 2TMKA 1M2FA 2X6RA 2XUQA 4D0LB 1XTBA 1O08A 1L1EA 2MR5A 2W58A 3HBAA 2XEXA 1HNNA 5CFZA 1WB9A 1Z5WA 3OOJA 4ZODA 3DLAA 4WBXC 1FLAA 3AXTA 1NOKA 4JR2A 4XM1A 3ZDEA 2GUGA 4QQKA 3O84A 3LKBA 5K3FB 1O4WA 1QX3A 1SUIA 2BKVA 2H2WA 1X87A 4FLEA 3TZHA 2X2FA 3WV5A 2YJTD 3DWGA 5ENDA 2FHPA 3KRTA 3FMVA 4CEHA 1ZJWA 3KBBA 2WYVA 4FZJA 3DSRA 1YASA 1YVDA 4YUAA 1QCDA 4RGVA 3QRWA 4N82A 4DJTA 1W5BA 1WXEA 1O9HA 3EMDA 3KTFA 4JDUA 3FPBA 2QRZA 4QFMA 2VTVA 4K1LA 4UUBA 1SC6A 5K6TA 1NU6A 1GA6A 4QHTA 3JATA 2A1TR 1E61A 1CQJA 3ILYA 3O2NA 2KLHA 3DHNA 2IK8A 4IY1A 4XIGS 1DBQA 5DW0A 5CFPA 1NP6A 3TD6A 1GTRA 4KPYA 4B3GA 1QE0A 3SNKA 5JPCA 2ZRQA 4E09A 4G67A 1EHIA 3FGNA 4LFBB 1Y63A 4OA8A 5KX5A 4BGVA 1DC7A 2QY6A 2EQBA