3D3KA

Crystal structure of human edc3p
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
250
structure length
233
Chain Sequence
YRRIIVPSKEFCTDSGLVVPSISYELHKKLLSVAEKHGLTLERRLEMTGVCASQMALTLLGGPQRPTVALLCGPHVKGAQGISCGRHLANHDVQVILFLPNFVKMLESITNELSLFSKTQGQQVSSLKDLPTSPVDLVINCLDCPENVFLRDQPWYKAAVAWANQNRAPVLSIDPPVHIDAKWSLALGLPLPLGEHAGRIYLCDIGIPQQVFQEVGINYHSPFGCKFVIPLHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of human Edc3 and its functional implications
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Enhancer of mRNA-decapping protein 3
total genus 67
structure length 233
sequence length 250
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3d3kA00
3RSFA 3RREA 1JZTA 3K5WA 3RRFA 3RSGA 3RTAA 3D3JA 3RTDA 3ROGA 3RTGA 3RO7A 3RTCA 3RRJA 3RSSA 3ROXA 3RT7A 3RTEA 2DG2A 3RTBA 3ROEA 3RRBA 3RSQA 2AX3A 3RU2A 3RS8A 3RS9A 3ROZA 2O8NA 3RU3A 3D3KA 3RT9A 3RNOA
chains in the Genus database with same CATH superfamily
2Q2NA 2XNKA 3D6HA 2RGWA 1UJ4A 4JLDA 1LFAA 4WKOA 3FKQA 1OPRA 4HNTA 4UVHA 1RJ9A 1GDTA 3H2YA 4HGQA 1I3NA 3Q4GA 4D45A 3HWSA 1T10A 3HI4A 3FDIA 1SIWA 5H0IA 2OCIA 4BP9A 2NYVA 3L7CA 3V1LA 3F6PA 3T0IA 1AUOA 1LH0A 5H4GA 5MFZA 2C2MA 3CR3C 3KJZA 1O87A 4XUEA 2AZ4A 1EFTA 2GD0A 4ITRC 1GAXA 1Y3AA 1XVIA 2XJ4A 3KJIA 2V9ZA 4H1HA 1MQSA 2QPAA 3KAKA 3GNQA 1BZYA 3NHRA 4HB2A 3WZ2A 4BB6A 1EGAA 2GAOA 3GNSA 2HEIA 1GUBA 1OGIA 3F5DA 4X7PA 3OCYA 2RKOA 2QN7A 4X64B 1HRDA 4ND2A 1M2JA 5CDFE 2XB8A 4PVDA 3ZZMA 1MZPA 2E0IA 2OGZA 3GBSA 3VU0A 5A4IS 2PO7A 2C5AA 4BWVA 1P2UA 2GJKA 1LBTA 4V0OA 3FHTA 3K0BA 1CQPA 2EJTA 3K1TA 2WUFA 5CXSA 4TS4A 2JA1A 3B3GA 4B4DA 4WEOA 3SVLA 1AGPA 1N0UA 4IINA 1YWGO 2O7RA 4TKVB 1K7CA 3FF1A 5TGTA 3PNPA 2B8WA 1NONA 5AH0A 2N0SA 3DNFA 1NX9A 4JR2A 2OO5A 4KWEA 2OAGA 4M1YA 4R2XA 2F1OA 4IOJA 2AS0A 2QE7A 5GONA 1VYHA 2AE2A 3V00A 4E2FA 1FDRA 3WYCA 1E2UA 8AT1A 1F0KA 2O2ZA 3DLAA 2D3WA 4B40A 4MJXA 1WHTA 5GY7A 4UBMA 4FFPA 2EWWA 5T8KA 4TVKA 2OMEA 1CUIA 3OF2A 4PYRA 4EA8A 5DEIA 3FMGA 4ZVVA 1U5BA 4JBHA 4I08A 4YREA 3RVPA 4RD1A 1BOFA 4TTIA 4X44A 5UKDA 1ORDA 2DWUA 3EXG1 1MOZA 1WULS 3ZQUA 4MQLA 3NBFA 4S1TA 1N3BA 2GR9A 4WXPA 4M37A 1OX5A 1EFPA 5C1BA 1VGRA 1Z4IA 3VOSA 1EFCA 3FHLA 4MJLA 4XR9A 3HFRA 1J2EA 5C32A 3D7SA 2J0UB 3K6KA 4E88A 4RZIA 1XU9A 2UUPA 5K8CA 4BVLA 2FFQA 1SO8A 3ZU5A 4LRWA 3GIDA 1P2BA 5TPZA 1W5SA 4I4TF 4U2DA 2X6RA 2F8TA 2CLHB 1QCZA 4DCSA 4CUJA 2LIPA 3EG5A 1G8KA 5FB3A 2QW0X 2EKQA 3MGGA 3SLRA 3WGGA 2PMKA 3BVPA 2ZS9A 4AX8A 4RENA 4BAUA 1PR1A 2Q3FA 4QPNA 3QVXA 3NH6A 3HDHA 4TTTS 3VNBA 4BZQA 4DPLA 2V7QA 1Q92A 2BFNA 2XIJA 5B4UA 2UXBB 5EKUA 1D04A 1I7QB 1Z6AA 1KYVA 4M6WA 4L8YA 1ZZGA 3OAAA 3FPHA 4A8PA 4E46A 3ZDZB 4CM8A 1SEPA 2AD5A 4R68A 1EHIA 1KAMA 5JQWA 1K75A 4I1UA 4FZ3A 2CXQA 2CMKA 4M60A 3H9UA 4Q15A 4EPTA 2I6SA 1EGMB 3BA1A 5G0TA 3NPMA 5JZBA 3QBDA 1NVBA 4S12A 4XGQA 3WYFA 3ZIDA 3K9FC 2IXDA 1B23P 1YMQA 4FD3A 2R84A 2FMKA 2HHJA 2ZIXB 1UFQA 3PUVA 4L50A 1DEAA 1KMHB 1Y9ZA 4KQ9A 2XECA 1J8QA 4DMLA 4DUGD 2NACA 4N76A 3F8WA 3Q88A 5KQSA 1E7MA 4O29A 2WU1A 5FX2A 4DDMA 3NKFA 2XJ9A 2A67A 3MW8A 3NNNA 3FVTA 3AUKA 4ILEA 3RTBA 3THSA 4PGFA 2QX8A 2P0AA 4G25A 5IULC 5ALSA 1NNI1 5E2IA 1FFWA 4IIHA 2PQ6A 3T1NA 2Q28A 3NHKA 1EU1A 4QRDA 3CINA 4UHKA 4FCWA 1CHNA 1CSEE 1LNSA 1JVNA 3AL3A 4AIRA 2I4TA 1PJ3A 2WSSA 1O97C 1VECA 3Q1KA 5LQSA 1PSZA 2YVLA 1CUAA 4LRSB 2JFBA 4B8ZA 2QQFA 1OY1A 1ZVVA 3OQ6A 4EI8A 2HXYA 2O2EA 3OZ7A 2QZZA 1N9GB 4JASB 1KAHA 4L5JA 4MUYA 1B7GO 3IB6A 4B8YA 2AXQA 4JMLA 4O1MA 5JMOA 9LDTA 4QUKA 4LCEA 3HCWA 3TOVA 5K0EA 1SBYA 1XRNA 1ISGA 1E1QD 3TBHA 4LIPD 1JEYB 2FSIA 1J06A 1XTRA 3URKA 4TXLA 4CW7A 1PP4A 2WB4A 1XJQA 1QIIA 4Y6LA 1I3MA 3KALA 2QN2A 4RA9B 3FGOA 2OQVA 4EKIA 3IP1A 2WVHA 1BVRA 4TMVA 2FG7C 3I6MA 1U8EA 5DYYA 4N1AA 3PGKA 3T0FA 2CF5A 4EA9A 5JVDB 3KV3O 3SIWA 3FFWA 3JSXA 3ZXIA 3GFOA 2NQ8A 2W58A 2VSQA 4X20B 4BNDB 2H3HA 1LXCA 1A2BA 1AKYA 2XRFA 3CE9A 3JQBC 4BKMA 5AW7A 4QM6A 3R8FA 3ZLTA 3DEFA 3GVPA 3ZDYB 3V2UA 3IE1A 2EZ8A 2AYZA 4JWKA 1WZ2A 1OC4A 5HQ3A 2XUZA 1Z12A 2C94A 1ECJA 1VE7A 4UNIA 4WD3A 3WYDA 3ICQB 3THWA 4PNEA 1RC1A 1Y7IA 2V5AA 4ZI2A 3HB1A 1KOLA 1ZRMA 3AIMA 5J3JA 2H08A 2AV6A 1KAEA 2RAFA 4B3FX 1RJWA 2D74A 1KWGA 3MXOA 2WHPB 3F5SA 1NUTA 3SJBA 4WH0A 4QG3A 1WUKS 8OHMA 2ZRAA 3MJFA 5GTDA 5BNFA 5CCBA 2PRJA 4CM8B 2BKLA 4DJDC 1H9CA 1I8TA 3W34A 1AS2A 1NTRA 3CO0S 2UYYA 4HP8A 4R7ZA 5AI0A 1WKCA 3VH1A 4JBWA 2N9UA 3GJXC 2JJMA 3JX9A 4FBLA 1W1UA 2WFLA 1FVFA 3A1NA 4N01A 3ST7A 1PLLA 3WYBA 1F20A 1VRCA 3E9NA 1P33A 1EWTA 1R27A 3MS2A 3PUXA 3PENA 1XAIA 2ILVA 3UUEA 3X1DA 4A5OA 3L4BA 4LQLA 3FOAA 1Z18A 5GJWC 3X1ZA 4N12A 2I2DA 3TSWA 1FNBA 3AQ4A 1HQDA 5ESRA 4UOEA 1E2GA 5IC4A 5HQJA 3RFCA 4YJ2B 3OUUA 3QVUA 4GLFA 4Q4CA 2GTIA 3G9ZA 3KLNA 2YCLA 4W1RA 3GROA 3E2IA 2HMTA 2TYSB 1FRVA 2J5XA 4Z3KA 1OFTA 4I5DA 4TGLA 3IAS1 2OM6A 5C4GB 1RHRA 3B13B 1WW2A 1X7WA 1FBNA 2BMJA 3E7FA 5J1TB 4RHFA 3PXEA 2YWXA 3SK0A 4B6EA 5C1DA 1EA5A 4FZJA 4H1TA 3WRYC 1RQXA 4M3NA 1TKRA 2FWAA 4PNHA 1U02A 3T1TA 1X1DA 2YHAA 2O19A 4C0HA 1BS1A 1CZOA 2OQIA 4AMZA 2IZ1A 2HBRA 4KLZA 1D03A 2XAUA 4MQ6A 3MJHA 1PQUA 3PC8A 1C81A 3FKSD 4WKBA 3TLKA 3UAYA 3KYBA 3W3AH 4YUXA 4E94A 2XUFA 3P5SA 4KXVA 4OMCA 1L8QA 2OOKA 3IAXA 4G0YA 1BXGA 2O8EA 1N75A 5AKXA 2F3QA 3A05A 1TK2A 3FLAA 3VPHA 2YDYA 2XXAB 4HFJA 4R98A 4D56A 3MUEA 2H4FA 1TVCA 1WY7A 2NAPA 4OFZA 1VIDA 4PQYA 4RVCA 3K31A 3RF7A 1L7MA 3GOHA 3IBCA 5E4FA 4E5VA 3GA5A 1AKNA 1KJWA 1YBAA 3HJGA 1NASA 3O8LA 3QU7A 5A4MS 2AOXA 2VL7A 1K9VF 1P5RA 4I55B 3DXYA 1U2ZA 5KX5F 1LV7A 2Z95A 5D3ZA 4RK6A 5ALGA 2P9ZA 2EJBA 4Z0TA 5FL3A 2I1WA 4LQ4A 2FEKA 3W3AD 4C0QC 1XDBA 3O90A 4I36A 2VOEA 3ULKA 5KNDD 2ZQ5A 3H65A 4HAWA 3SFZA 1EXMA 2P6OA 2R6JA 1VP3A 1ZXXA 1NW3A 3FWYA 2BJHA 5L7YA 3FVQA 2CL7X 3I23A 1QYRA 4XUDA 5JMWA 1MAVA 1QZ3A 1IXKA 2PZ8A 1Y98A 3PNYA 3RAGA 5LQAA 4D0LB 2IYFA 121PA 5JCPA 4QQFA 1EESA 4NMWA 1S1CA 1WZCA 3P4UA 1ZVMA 1E20A 4RH3A 1BDJA 3CQ9A 4XYEA 2NUTA 2VTBA 3CE6A 4UQOA 3UFXA 1KERA 5EXTA 4X9XA 1BXRA 3P0HA 1PO7A 1SC1A 2YYYA 2R751 3MWKA 5CYFA 4F93B 2P11A 3MTBA 1P2DA 1LV8A 2EG5A 4FKBA 1M5UA 2FJ0A 4RZHA 4S2UA 4ZQEA 3R0JA 5ADHA 4CQMB 4JU8A 5IBPA 1K8XB 2HREA 3I45A 1UP4A 3PFWO 4NEHB 2RHTA 4DUYB 3K0CC 1IJFA 2WV7A 1TA4A 3B5JA 1XMIA 1HQCA 3NXKA 1NF3A 2Q3CA 1U90A 5I7EA 2A0UA 3Q3GE 1NBME 3TEFA 3U19A 4NDAA 2Y92A 3ZEAA 1V16A 2Q2QA 4OH7A 1GM5A 1V4VA 4G5HA 3FYCA 2QKYA 2QAGA 4KQCA 3VHXA 5DCLA 1QANA 2G88A 2JIBA 4WCVA 3W5IA 2ZYTX 3N07A 4IIUA 3WLTA 1GDHA 2C07A 2TS1A 4GRIA 4MLCA 4E11A 2C0QA 4V1CB 4DNQA 2A4MA 4K9QA 5DGIA 1PNQA 3Q7IA 1PWXA 1Q0SA 1S2OA 3MD0A 3HRIA 4Y0VA 3VYTB 4DUZB 3ZWBA 2X7XA 2WVAA 5LBUA 1R0BA 3SSAA 5CM9C 3TI9A 4LRXA 3P97A 3C3YA 1PJBA 1H0RA 2HNKA 1XIVA 2QRJA 4DJFC 4QLBA 3CRVA 1HFWA 4R6XA 4CKBB 2HRRA 3J81k 1PWZA 3THYB 4X63A 1PL6A 2NO5A 1GZ7A 3JD2A 3IC5A 2PBRA 4ND8B 3T5MA 2W2MA 1XROA 1Z2AA 3ISTA 4KVFA 3WZLA 1K5HA 4NYIQ 1L4KA 3B6ZA 3T7DA 2CCGA 1ND5A 5JNTA 1VJ5A 2VHWA 1CRLA 1FS5A 1MRZA 1NBAA 5L53A 2EGUA 1N2ZA 1Y6ZA 1DQZA 2A9RA 4HXFB 1L7EA 3A2MA 4ZVQA 3RV4A 2WW8A 4ZAXA 5IM4A 3Q8MA 2B7LA 2ZKIA 2HRQA 1T0BA 3KS9A 3UJHA 3A28A 4NG5A 2G5TA 2ZG6A 2GN2A 3ZHRA 4OLBA 4EH1A 3EVTA 3JQ8B 3NYIA 4DC0A 1OTYA 2GF0A 3TTWA 3ZHTA 3DCYA 3AKEA 4NP6A 4TUYB 3GCXA 4LXYA 4C4SA 4AZWA 1PFUA 2PUGA 4MLDA 5TMBA 3RAJA 4NBVA 5J59A 1G2QA 3EF0A 5FA5A 4G1BA 4MW9A 2J6CA 3UT5A 2WNHA 2ZE5A 4Y6PA 5GADl 2ISQA 1Y6RA 4MPJA 3ES9A 5KSZA 4I1IA 4Y9RA 1D2GA 4WLNA 3H6GA 1U1IA 1VOTA 4NG4A 4NWIA 3OPYA 1KZ6A 3VZBA 4BV2A 3WWEA 4B6OA 1D2MA 1HO3A 2GZRA 4DV5B 1ULZA 3THOA 3TWOA 2PFSA 2NUPB 2HU2A 2IEAA 3U56A 4IJVA 2O8FA 2B2CA 3UMFA 3F2IA 5DNDA 4PFJA 1EFKA 4YYEA 5B3AA 4Q3KA 2YHSA 1GQRA 4WKPA 5EWJB 5BN5B 2F43B 5ALNA 3ZBPA 4AULA 4IDOA 1I36A 4KPFC 3LU1A 621PA 2XMSA 1WLSA 3BKXA 4MCJA 3KD3A 1OFUX 1XMSA 4ZT7A 1RCFA 4GGPA 3ZI7A 1SVNA 2QR5A 1G9TA 3R5XA 2IYZA 4P81A 3EDMA 5JZSA 4NBSA 3PPWA 2JAPA 1JSXA 4JI1B 1L3BA 2NQ2C 3VKGA 2NU6B 1U4OA 2PWBA 1LTQA 4ZXPA 3CH4B 3V42A 3WQHA 2O8CB 1IONA 2NPIA 2QSZA 1P60A 3EZLA 3LKVA 1F6BA 4KE6A 4N5MA 2FRVA 4WXMA 5J5AA 5C0OE 4RTLA 3QYPA 2A57A 3BD9A 3DGEC 5FNVF 1RYHA 4DDHA 2OWEA 1VKHA 3BUSA 3UGJA 3HSYA 4BEWA 1T1GA 5P8WA 2Z30A 1JHPA 3ZC3A 4AJPA 5IWCA 1ORTA 1WEHA 1RWWA 1GPH1 1IRIA 4FU0A 1HUQA 4R1NA 4XX0A 5A9TA 9ATCA 3ZW9A 4JJFA 1XX6A 2R4QA 4EYEA 1CJSA 3FTCA 4WY5A 2GAJA 3ROKA 4YHBA 4B9AA 4EPVA 2HW8A 1C5KA 2NP7A 3WLEA 5C8ZA 1A71A 1Y6QA 1I2BA 2V9PA 4KSBA 4QWWA 3ZY2A 5KJFA 3CX6A 1FJ2A 1HA3A 1S2NA 3DKRA 2G04A 1ZI8A 1WXEA 4RIIA 5AM2A 3RYIB 1U98A 1BXGB 1SUPA 2FCAA 3WK7A 3T0GA 4RK1A 1W5BA 1OASA 3DUWA 3OLZA 4YV0A 2IQ5A 2NTYC 3JU3A 1C80A 4U7WA 2MHCA 3DDSA 1AQLA 1KF0A 2MYPA 3N87A 4U2KA 4ZRNA 5K0LA 4YV1A 1P9LA 2VPPA 4EKNB 2VXOA 4R8KA 3VO1A 1X14A 4WGGA 4RQBA 5HFAA 4IKOA 4JXJA 1V3TA 4FYIA 1IAVA 5D86A 3V5NA 1TZBA 3I9LA 3L1JA 3MIIA 4A91A 3RIMA 4MP8A 2BM0A 2I78A 3C8UA 4JX9A 3SI7A 3VZPA 1F8GA 3DAOA 3L8GA 4DFDA 4F4JA 5A7FA 1YJ5A 3OCXA 1SKUA 3T9CA 4Z0NA 2O7QA 3GWZA 3IULA 3O75A 4UVGA 4NX2A 3R7BA 2VRCD 1M34B 4LECA 5HS6A 1OLSA 3WKCA 4EWLA 2WUDA 3L77A 4B3CA 1UT6A 1YZHA 4QQKA 5A9RA 4X3CA 4LDQA 3PEWA 2WU8A 3PD0A 1YUBA 4RW0A 2VCHA 5L3QA 1Q1GA 1R9JA 3A06A 4OP2A 4XIGS 3BE5A 1A8UA 3EGCA 3STHA 2VEOA 2DB3A 4YJ2F 3ZY5A 1V8DA 1Z4NA 1KR5A 2GARA 1N0VC 3K4QA 4TWRA 4NS4A 3AHIA 1XQ1A 4PX3A 4JQOA 5ALFA 3H2IA 4TL8A 4GS5A 3TLZA 1SWVA 1DNPA 4Z99A 2I2WA 4JBIA 5EZYA 1SUFA 5B4VA 1X8KA 3P71T 1WQ4A 2FW7A 3O38A 3GGSA 5AJHA 1AUXA 5ILGA 4ER3A 5CD1A 1KNXA 3F96A 5CLJA 4MH0R 2V54A 1IEVA 3T7IA 3QMMA 1NXPA 4Y1RB 2QR2A 3NRCA 2XHZA 1PGNA 4WSOA 5IW8A 4F71A 1DIOB 2VNJA 3PDUA 3D6VA 1REQB 4NV3A 3W2IA 3ZWKA 5IKXA 2AFHB 2R8XA 2ZVQX 2WF5A 4RXTA 5U4XA 4MW1A 2Q5FA 1F2UA 3PR1A 5ALYA 3EFEA 5KOYA 1MO6A 1P31A 1JFFB 2HTEA 2IHJA 2XPCA 1RXUA 4KPUA 3VR1A 2QRUA 4IIGA 1O5IA 1XC7A 2X1LA 3FYUA 1Z4QA 2X86A 1X3LA 5IN4A 3KVVA 3SZLA 1J8DA 3AHDA 2BCEA 1OI4A 5KTYA 2WT8A 1D1PA 2O52A 4ADSG 3IHTA 1P1JA 1QYCA 4MVJP 4DDWA 4DQVA 2WLTA 3PHIA 2C4MA 2VPQA 1XNHA 1HYQA 2QMYA 3BQMB 4I1PA 1DWPA 1F8UA 1PTJA 2AXNA 1OZHA 4KNYA 4LQDA 1I1NA 3CRRA 1M6NA 4JHXA 4YTEA 3RKRA 3DFUA 5J4VA 4I46A 1Z0DA 2H85A 1YZGA 3BF8A 5BNIA 3O93A 4Q1AA 5JJBA 1QQAA 4RLHA 5KOHB 4Q4HA 4I55F 1ZC4A 4V0ME 1FTGA 2ZXUA 4XWKA 1JDUA 3KEGA 3R0VA 1CY2A 1OAOC 1KHTA 1Y1RA 4HVAA 4ZVPA 4BLQA 1HE4A 4QAQA 4X1OA 1WMDA 4LDRA 4LDAA 1M2NA 1OAKA 4IPTA 4PZAA 2P2SA 3HEMA 3HABA 3QW4B 4L3VA 2C04A 2CFCA 3P9YA 1YFKA 4LVUA 1R6BX 2QJWA 4V0LA 3EXEB 4F8EA 1QRSA 2VDNB 4UU0A 2CF6A 3BD7A 1WX1A 2ZSFA 1SBCA 1XCLA 3WMXA 4UUMA 5EWMB 5JS2A 2RGRA 1RVDA 1PS0A 1HZZA 1VE3A 2AXPA 3FCUB 4HATA 4RF3A 4YMSA 4TS9A 4WJZA 4EX6A 3K96A 5HF5A 4CI0B 3RQIA 5EP1A 2O2SA 1CUCA 3DW1X 3TIGA 5K0BA 1U0RA 2F8SA 5DNVA 2HSZA 2O23A 5ETJA 3D7RA 2HCJB 1G6KA 5EGSA 1KS9A 1SBHA 3H7AA 1QZXA 3RBXA 4EHFA 2G3YA 2ZB3A 1SXJA 1S0UA 1VPLA 2C4VA 2E4WA 4GBJA 4DARA 5CT8A 1UQUA 2WIJA 3G2PA 2E82A 1T1IA 2GBFA 4BNTA 2EKBA 2QY6A 1DC8A 5K0CA 2OHXA 2OCGA 2ZJOA 1QQ6A 1J7KA 3H5IA 2VBGA 3MT9A 4X95A 3AHHA 2EL9A 3LDUA 2KPOA 4WOPA 3TPFA 2GBLC 3DDWA 3LC7O 4Q7QA 2ZXFA 3RF6A 1FNCA 4DJAA 3T9EA 1JA1A 1N8KA 1DKPA 1WVIA 5BRAA 4N6GA 3EPHA 4HDKB 2MIIA 4R54A 1C1DB 1PFYA 4PYNA 4EY7A 3BB1A 1HYHA 1T36B 1YQTA 4OVKA 4U63A 5T8KC 1SY7A 5H83A 2IS6A 2J9ZB 3SC3A 4XB1A 3QE3A 1NMYA 5IFKA 2ZB2A 2ATCA 1MG0A 1RQGA 1BIFA 4UZFA 4DEVA 1WO8A 1WEKA 2HWYA 2XD9A 4C3ZA 1NUUA 1KZ1A 2D7JA 2GZHA 4CYMA 4RTNA 3HG7A 3P2JA 4WE3A 2A8YA 1G5RA 4I5EA 5CLIA 3LRPA 2WJJA 1U0OC 4K7JA 3WRVA 4U7DA 4GAEA 2J32A 3S2FA 2PS9A 3FR8A 1C29B 4JT8A 4BMCA 3FROA 1URPA 1OKKA 1WUYA 2N42A 1ZH8A 5FI0B 2X2PA 4X24A 4YT8A 2P6PA 3T52A 4BO6A 2CFTA 2QRHA 1UJ5A 4KQ1A 2KWIA 2FZ4A 3G02A 3EMKA 5H3LA 2XTNA 1GQFA 1AVTA 2VP2A 3KV1A 3UXEA 2CLMB 2ODTX 3GEHA 2L0XA 4HWKA 4UPEA 1ID1A 3SQOA 4NTZA 4ZI7F 2C03A 3D6NB 3P96A 5INTA 2WD7B 3AINA 2NN3C 2QN8A 3LHIA 3SBXA 5FOQA 3A6GA 3KKLA 1FJHA 3VDQA 3V33A 4TMXA 4AIIA 4Z5XA 4KNVA 1LA2A 5AD1A 4F4CA 3H4VA 1JDBC 3H8VA 4G2NA 2IYPA 1XN1A 4WNYA 5ALTA 3EXHA 2CK3D 1KOFA 2CZQA 2JJ1A 3MJSA 4N4AA 5GONB 3MCZA 3QOWA 3VR2A 1MJ5A 5FBVB 1A9YA 4L9AA 2GZ2A 2PKWA 1O95A 5DP1A 5KC8A 2YXLA 5SY6A 2WJYA 4OXNA 3I6QA 2ANCA 1K5PA 3CLUD 1V7QA 4LBWA 4DLPA 5A5VA 1ZEJA 3WK5A 5JI3E 1JG4A 1NLMA 2BC9A 1TUIA 3PFNA 3ZD7A 1E8DA 3LV8A 1AZTA 2O7NA 4MKIA 1KXJA 1OLXA 1N6OA 2ZR0A 4CTNA 5CEFA 1MJFA 2EARA 2HRBA 3B3QA 5JZVA 1Z0AA 3HGQA 4NICA 4EA6A 5CHEA 3ROGA 2YFQA 4IICA 4DHWA 2C9BA 2IP4A 4LV8B 2CFRA 4ZAZA 3EULA 4WZBB 1VMDA 3O4RA 2B25A 1QK4A 3O4VA 1XF9A 1U2GA 4OJKA 3QMWA 1M7BA 2HUPA 3G9TA 3HJAA 2VUHB 2WUVA 4J43A 4TZKA 1QNFA 5EZYB 3GRCA 3E82A 1GXSA 1N0WA 1M8KA 3M6VA 1CDOA 1E7RA 5A0FA 4IGIA 3N5CA 1Q7EA 4J29A 1DBVO 4J0GA 1IN1A 1COWD 1WM1A 4TQ9A 3RGWS 2XUKA 2GPNA 2BFCB 1R6XA 1SIBE 3G17A 4BMVA 4EAQA 3OOSA 2PA3A 3FZEA 5EZ6B 3MCVA 1EPUA 2WC1A 4P32A 1G64A 1ZHHA 5DDIP 5AXBA 3R8XA 2VF5X 3IE2A 1FTSA 3RNLA 3SQWA 4BO0A 1QHGA 3LPNA 4BIMA 4PCAA 1M34A 4Q3AA 1GKYA 3LKBA 1NX6A 2ZP1A 1G9XA 5FNVB 4GNKA 4D0NA 5TR9A 4G8DA 1D3AA 2Q7XA 4CV1A 1DIAA 3PXAA 2SICE 4JL5A 1J8MF 1TUBB 5F5LA 1NULA 2OO3A 4PY2A 2I7VA 5JR3A 1Y3CE 4WOBA 1OXBB 1M6EX 2WWGA 1G6HA 4PSAA 4MRNA 4Q12A 1VJ0A 4UKDA 1U7ZA 3CNOA 3MTJA 3NFYA 3FHOA 3NIWA 3PGLA 1GRQA 5D5PA 1AA6A 3HXLA 2G9VA 4H0CA 2Z3ZA 1L5SA 3WQRA 1CULC 4R5HA 4QRIA 1Q0PA 1QHYA 4FONA 3ACBA 1Z4LA 2O1WA 2ZYRA 1U8XX 3IQGX 5BQ3A 3LTNC 3C43A 1ECGA 1K7XB 1KVUA 4G65A 4EHAA 1BTOA 3EC7A 4MV6A 1JIKA 4RGVA 4U2EA 3RYIA 2PKRA 3A25A 4OHMA 2ZFUA 4Y7DA 2AN3A 5DRYA 1ZRNA 2PTHA 4LMPA 5DGXA 3V80A 2HN9A 3STYA 5DPMA 4AG3A 5B7QA 3S1SA 2PN1A 3FOWA 2OV3A 3ZJYA 1SR8A 1T35A 1B3RA 3IEIA 4KO1S 5CTJA 4Z0HO 4DXHA 2UVDA 4TTSA 3U1VA 4K03A 2C9DA 4HDSB 4XM2A 2ZYDA 2ZBDA 3OIFA 5L6MB 4FZVA 1NJSA 2NTNA 3I4FA 1FEZA 2Z04A 3OOEA 4N40A 3IMKA 2YYSA 1Q0TA 3R7FA 3AVWA 2ZLBA 2ANBA 3OX2A 5DJ5A 1A1SA 3LMKA 1DBRA 4BOYA 4UAGA 5JSYA 1F9EA 2E4AA 3HEBA 3AY6A 4X7BA 4ENRA 2Q49A 5KVQA 2BLNA 1G8YA 3HH8A 4KVGA 4MGEA 3TMAA 1HYBA 1NW6A 3FNGA 4GVLA 4O0MA 4PV7A 4XH9B 4MPPA 4HNSA 2VA8A 2LW7A 2WPDA 5BWMA 1EK5A 5JH7F 1QGED 4A82A 1EX7A 4IQ0A 4ARBA 2ZYVX 4CXMA 4ZEXA 4BO4A 2WZDA 3FLMA 1HEIA 3ZQJA 3ODPA 1BS2A 1XMPA 5ADWA 1KEEB 3NIGB 1UKBA 3M83A 1JBKA 1UMKA 3QXHA 1WDLA 2BYTA 1JJBA 1MD9A 1MA3A 5DI9A 2XRMA 3D2BA 5AXDA 2I33A 3AUXA 4L28A 3O03A 1CE8B 2PGXA 2J6IA 1JIJA 1L1RA 2O7SA 4QYMA 4U7FA 1ENZA 4OQQA 3TB4A 3W6OA 3WL3A 5BWBA 5ERXA 2E6KA 5KTMA 2Q1SA 1P75A 2PYDA 3TNLA 3WLNA 5JZMA 2GZAA 4O4HB 2EW1A 3E8MA 2LCQA 1DAGA 2IL1A 1Y8RA 1DSSG 1ANKA 1BAPA 4X1KB 2JIQA 5AJUA 5F2KA 3W04A 1SCBA 1MEOA 3CMCO 1E2PA 3F1KA 3HMQA 2BHNA 4PONA 5CPFA 4HGZA 4D4MA 3G0HA 4NFYA 4K9MA 3IQZA 1NPTO 3G9QA 3HI6A 4PQFA 3V6MA 2NMVA 5CDGA 2WOOA 5CFQA 2PKCA 1X9HA 3UMVA 3OQ1A 1V96A 5A7HA 2C95A 2OK7A 3IH5A 3UYLA 1N2GA 1NURA 1P2TA 5CBPB 3OQBA 1LY1A 2OCXA 5AW2A 1DZ3A 1HORA 3TW8B 4B83A 1GKKA 1LJUA 1Z75A 2VRWA 2P1RA 3SS9X 5JADA 3BDIA 2OB2A 5CRIA 2W93A 3A1EA 5DNEA 1OAOA 2PY6A 4YP9A 1I2DA 2OC9A 3HVKA 3S27A 2VRNA 1YK1A 4GWKA 3SIRA 1KJYA 3QPCA 1J1IA 3SSNA 3WLKX 3KUKA 3LVFO 2D2EA 3RW9A 3SMVA 3EUEA 2HH9A 4KVZA 1Q7CA 1Q3KA 4TV8F 3SR3A 4GOMD 1P91A 1V8PA 3K8ZA 4F2GA 4PTZA 2XGGA 1ABBA 4G0WA 3AJRA 3CCFA 4LJ4A 3KE9A 4ZCPA 4FINA 3ZJ5A 1TJ4A 4BE7B 2IPXA 5EYPA 4EGSA 2W83A 1P2SA 1CF4A 3SS7X 1C8LA 3OD1A 3C1TA 3WADA 4GKKB 3TQOA 1L7DA 3Q0IA 1DKUA 1ZG3A 5BVHA 3RSSA 2R1VA 4MUNA 3UF0A 2DG2A 2W2LD 2ZRQA 3BDAA 3LYAA 1DLIA 3GVCA 3VYWA 3ZGYA 3GLIA 4ZJUA 2CHEA 4JT2A 1SVUA 1G21B 3DZ8A 1X2EA 3EW7A 2GA8A 4Z7OB 2C9OA 2OOSA 2GWRA 3ZBUA 1L5GB 4PS1A 5LPNA 1V4NA 1EWQA 1LPPA 2OVFA 4O4JA 2Q6VA 4P9NA 1ZH6A 1ZJJA 1XD9A 1H2FA 2BR3A 4Z54A 5F7OA 2X6TA 2W8ZA 5TT0A 2PLNA 3VR4D 2ONYA 4X54A 3T9DA 4D3ZA 1QTNA 2OXTA 5LJIA 4DQKA 2YJ6A 3CKKA 1ISSA 1FFHA 2C3MA 4PC7A 1MH1A 1R0LA 2WF7A 1XZAA 4O4IA 4XSHA 2OXIA 2E18A 5BUZA 2HQSA 1JU4A 1TFUA 2YR0A 4U8GA 5T4BA 4MIOA 2Z0MA 5KNDA 4FR5A 1XTJA 521PA 1O6CA 2YY6A 5EJ6A 3DDOA 4PAGA 1NE7A 4NABA 4UTVA 5DCWA 4DQLA 4LF8B 4A6PA 3OJOA 3RC7A 3L1UA 5DI3B 4NQRA 1P4AA 4OOFA 4OI1A 4B09A 4P5DA 5AQEA 3ZWPA 4CQMA 4ECAA 2JZCA 4PLCA 4DWVA 3U26A 1H1LB 3WLIA 1KQ3A 2JNWA 4DC9A 1U1CA 1CJCA 1FP2A 5BV7A 3VNAA 2GPSA 4G0QA 1YE8A 2YJTD 2XVAA 2MINA 3AI1A 3HDYA 1NPYA 3N7TA 4CL8A 1DU4A 4IX9A 1E1CA 1AGXA 2ZITA 3T7AA 3AF3A 3D3NA 4I0WB 1BWRA 2ZYIA 1QX3A 1R5BA 1STOA 1U04A 3FPBA 3IKMB 4RQAA 3VU9A 4ZOLF 5K3BA 1H6AA 2ZR8A 4ZYUA 4I4TA 2JCYA 1ESNA 3NOXA 1PKEA 3QPBA 5COQA 2CMGA 2ZRGA 4JA0A 2W98A 1M1ZA 5G4LA 4B80A 3MJEA 1N5LA 3JR7A 2JATA 1J21A 1O97D 3AB7A 1F6DA 1H69A 1ZD9A 4P33A 4QDOA 1A5SB 1YA8A 3IQHX 4GMHA 2GNPA 4L07A 2BGTA 4U7TB 2KB0A 5BSKA 1Q7RA 1J5EB 1E9EA 4HC4A 2PSJA 1RCTE 1XL1A 3IVXA 3LIIA 1VM6A 4HHEA 4CF7A 3LXXA 2C61A 2VH1A 6GPBA 2AUMA 1G5HA 3U61B 3O74A 2FEWB 1CP2A 4HN2A 3D8TA 4MV1A 4Y2SA 4DE5A 3CJRA 2Z4SA 1EUQA 3NYWA 1RABA 2X8LA 3KSDO 1ESDA 1PR6A 4TLLB 3SLGA 4CLHA 4EENA 1WCV1 2JIRA 1LPAB 3LQ1A 4EVSA 3OMLA 2A33A 2YC2C 4J0EA 1WNFA 4RPKA 4BXOA 3HP1A 2CCKA 3YASA 3RC1A 4F84A 1QZTA 3EF3A 2B2XA 1LS1A 1RYEA 3C2QA 5I45A 2HA6A 5GONF 2Q27A 3NTXA 1KMMA 2H2GA 2VPYA 2BAGA 5EIEA 3RU2A 1N2OA 5TMDA 2ACVA 2B1JA 4II3A 1XAJA 4PU0A 5AKKA 4QNMA 1IDOA 1S4MA 4OD0A 4PZZA 3TUJC 4EKEA 1T3HA 2IZ0A 1GGHA 2P5UA 1R0KA 2PHZA 4MR8A 4RYLA 1IVYA 2MYUA 2A1UB 1PEKE 3AIIA 1WP9A 1EJ6A 1ZMRA 2E1RA 2PLWA 2F6RA 3BK1A 3C3WA 3CF0A 4GRAA 4F2PA 3KEMA 1ZCAA 1Y8AA 1IFXA 1Z62A 1YBVA 2FN9A 1JEOA 3L0YA 3QHPA 3QW2A 1JVBA 4WKNA 5K3AA 4Z4HA 4N5LA 3M4NA 1ZCJA 3QUTA 4RKYA 5CAEA 4J0CA 1F48A 3U7RA 2GBCA 2OV1A 1UR5A 3LZCA 1TJ5A 3FI9A 2R8YA 5G3ZA 2R86A 4BMNA 3ITNA 4ZO4A 4YRCA 5B36A 4D0GA 3RB8A 2VQDA 3DFZA 2QL7A 2BDTA 3GZ4A 3QZUA 4EL5A 4KGVA 2XKAA 2Q9CA 5JYEA 1CJTC 2W6OA 1O94A 1TNDA 2RC6A 5L95A 1THZA 3QVMA 1ZVKA 3G88A 3Q15C 1B6GA 1LB1B 1WXFA 3CLTD 2H1LA 1LX6A 1NF8A 1IULA 4WZAE 3G8BA 4TYWA 3JALB 4EHIA 2DQZA 4OP1A 3KYIB 2I71A 2FZGA 2UZ1B 4W5WA 1KMCA 2FPIB 4DA8A 3O31A 3P9XA 5DGDA 2YV3A 1T1JA 1TZCA 5JWHA 5AM5A 2BI8A 1QOPB 2UZ0A 3BM5A 5IKEA 5K8UA 2SKCA 3S2ZA 1UXGA 1M5TA 3U3XA 2VWPA 4R2MA 1YZVA 2KI5A 2FWJA 2VHTA 3PRYA 5LZ8A 3WJ2A 3ZXYA 3RYCA 3NUZA 5B37A 1GV0A 1ZHFA 1N33B 3VSAA 4ZOEA 3CVJA 4AJOA 2MYNA 3FDJA 3LXUX 4MWOA 1OT3A 5ICSA 3WHLA 1IQUA 3PSAA 1CZUA 4L72A 1BO6A 1WCYA 3U62A 4YRQA 4PO8A 1B2LA 1G3QA 1KI1A 2H59A 3N75A 4BMZA 4OI0A 3EVNA 1V5FA 3BL8A 4C06A 2XCQA 1B6TA 1EQAA 4G4SO 1VMAA 3CKLA 1JLLB 1WB9A 2WSMA 4NYIR 3W2HA 5AVKA 4ZCIA 1BXRB 3CVXA 1XNQB 4MJ7A 1SQ0A 1FFBA 5JH7A 5LU8A 4X20A 5EIXA 1SU4A 1Q0LA 1IWPB 2IYVA 1D6SA 3PHGA 1ZUWA 2II6A 4RK4A 5DISB 3TQQA 4GE3A 2FR1A 4CFYA 3JZAA 4CDMA 4KITB 4FGSA 4GKBA 1HKUA 1Y7HA 3K9BA 3KVRA 2VYCA 4G89A 3TDKA 4KQXA 1Z2DA 3ERCA 2Z3VA 5CXXA 4EYQA 3I09A 4YRZA 3SJUA 5GQSA 5E2AA 4F5WA 3OICA 1ZIOA 2OZLB 4JEIA 1KAGA 1PW7A 2YUTA 5B3JA 5JYCA 3MCUA 4RDCA 2HRDA 1OVMA 4C07A 4L85A 1ZONA 4W9NC 3RRZA 3ZVMA 1Z9BA 4BB0A 4ND4A 4OTZA 3M4XA 1HDYA 1CVIA 1ND6A 4B3TB 3HZZA 4EG5A 2WJ6A 1Z6TA 4D57A 1RM3A 1BKDR 5B7GA 2C9YA 4NBWA 3SYLA 2EX1A 4WA7A 4NK5A 4KWCA 1W1IA 4OLAA 2O5VA 1NR7A 5KNBH 3KSUA 3EIXA 4DMCA 3T1YB 1AS3A 2B9EA 1AO0A 3HCRA 3HWWA 3K53A 1L8LA 5DX8A 2DEUA 3PB3A 3N76A 4FFWA 5EJ8A 5IT4A 1KU0A 1E59A 1PGPA 2JGIA 4OYYA 4BZZA 4G5OA 1IYZA 4LYFA 3A6HA 1FVXA 3Q12A 2Q8NA 5IEJA 1G59A 2EX0A 2IEBA 2FW1A 3Q5GA 2I3ZA 3VOBA 5DTMA 4E3WA 5JCXA 5EQFA 1L8AA 4HUQA 2LDXA 2OECA 3ZHCA 4F3RA 2JCSA 2BLLA 3JARA 5K9ZA 3DE0X 3ZDXB 3OTOB 3M2TA 4ZGWA 3R7SA 2PKYX 2YOFA 3EOAI 1H0SA 3NR2A 4JN6B 2FR0A 4MARA 1DOZA 2H4YA 1M0WA 5CIQA 3SF8B 2ODNA 4KVAA 4UUNA 5JCOC 3GT0A 1WOMA 4WW0A 2OA0A 1R4AA 2CVFA 2WG1A 1O6ZA 3EAFA 1EUYA 1K7FB 2O48X 2PFKA 3AJDA 3EXIA 2CNWA 3IAEA 1G7CA 2R79A 4R2JA 1LQUA 4YX9A 3OX4A 4JBXA 4XQCA 5I7SA 1SHZA 5H4HA 4C7VA 2IHBA 2JI4A 3LT0A 2XYVA 3MC1A 1W581 1C3JA 3A3PA 4ZT2A 5LBIA 1A9XB 1AKTA 3EOZA 4ZHQF 3V8VA 2VK2A 1JFTA 3JWGA 1I4EB 4OGGA 1A9TA 2D2IA 1I80A 2VHJA 4M1EA 2VNHA 3A9RA 1WCIA 1KJIA 1X74A 1AE1A 4PWYA 4EUSA 1YNOA 5BSTA 1C9DB 1KI6A 3U4AA 4DWOA 1JHOA 1LK5A 1ZOLA 2D5AA 2R5NA 3EEQA 4M1SA 4R1TA 1YR9A 4H0NA 3WBFA 4OFXA 1GGFA 3A36A 3O94A 2IUEA 3JQAB 4BZPA 3LQKA 2XLCA 3V4RA 4AKIA 4RU1A 4K86A 1UEJA 3FBTA 4V0KA 3KHKA 3T06B 4W5QA 1PNOA 1IZ7A 1WZNA 3GJZA 3HFSA 4Z9BA 2PAAA 2PS0A 4JVNA 1EVZA 4N8SA 3LY5A 3TEJA 4IIFA 3UT6A 3HYCA 3DCNA 2AG1A 5HNKA 2VS1A 3FPEA 4LK3A 1EM6A 1W8DA 2AHRA 2GXQA 1NZDA 2ZCJA 4G5GA 3MMNA 1U4NA 1W0CA 3LI2A 1NVXQ 2WJ4A 1UOOA 4GDMA 1HOXA 1VJCA 1WHTB 1VKRA 2XW6A 3EDYA 3IXQA 3KUUA 3M3HA 4I9UA 1K7YA 1DQSA 2DC1A 3DMTA 5KO2A 1YI8A 3M6XA 4ZP1A 1BE0A 1KYXA 3BE6A 4RV9A 4UARA 1DCTA 2BRUC 4UCFA 1W29A 1DCFA 2JAOA 5GOTA 4S04A 3MLEA 2B69A 3EA5A 4WJLA 5F7XA 2GKOA 1PJRA 4KXXA 1P4GA 3DV9A 4R31A 1NW4A 2ZYHA 3B1WA 1SG9A 1W34A 2AZDA 1W46A 4GM4A 4FWBA 1Q0HA 2DCUA 1WMBA 4MR7B 1JQDA 1FUEA 3D6JA 3N74A 4Y0NA 4RPCA 3HNPA 5BW8A 4FBGA 2VZ9A 1QG6A 3BFPA 1T3TA 2F2TA 4IDCA 2CD9A 3NOVA 1WG8A 4IVPA 1KE1A 3THRA 1Z07A 1ZSYA 3M3PA 3GU3A 5ITZA 5KYTA 1N8SA 1CZHA 4K0RA 1DLJA 3A3KA 2GZ3A 3PJDA 1QKJA 4AJ2A 1BEUB 3CEPB 4QUDA 2ACEA 4QVKA 4M38A 2WTBA 1UXOA 2CK3A 4ZOLA 3I53A 4HI0E 4NCAA 1XI2A 1IUOA 5KTNA 3B78A 1XTBA 2FI1A 4M9UA 4OH1A 2IH5A 3U0BA 2QP3A 2OYCA 4O2BA 3EEOA 2JAWA 3OPXA 4ENTA 2IYOA 4Q03A 4V02A 3PJGA 3WGHA 2ZATA 2QSUA 1XEFA 4JOCA 1MENA 1XPJA 1UJBA 2XMPA 3PC3A 4QPDA 3RBAA 5JAPA 1MIHA 2YFHA 1VG0B 2FMHA 4PZ0A 4J1TC 3VR3D 1HMYA 4OLHA 4RHEA 4UD6A 4XASA 2HSWA 1N34B 4GR9A 4XARA 3H05A 1BCRB 4B71A 2ZWMA 3C70A 3CW8X 4MR7A 5H3CA 4LISA 1SWWA 3HP7A 4BBPA 2XR1A 3PWKA 4NCIA 3ROMA 1ZN9A 3ICWA 4HCJA 2AMVA 1P7YA 3DVSX 4D6XA 2DCMA 2XE7A 2I7TA 4HQRA 2O8BB 1WXHA 1ZW1A 3JD4A 3KOMA 2G83A 4B7UA 5BR1A 2B4RO 4K1LA 1GNSA 3C4QA 4BYMA 1LLUA 2HA3A 1XZKA 2AWOA 4C14A 5ALUA 4YY3B 1ZU4A 1TT7A 2VK4A 3WRXA 1GUDA 3NEPX 4FKMA 3ZS9A 1R0CA 2Q3DA 2OAQ1 3QP9A 4M83A 2IY7A 1AXRA 3AVPA 5FHQA 3EJWA 4EG3A 4PLWA 4A4DA 4QELA 4ZJPA 4F04A 821PA 1EFHA 1ELOA 1QVWA 4IFTA 4FYYA 4LNUA 2VDQB 4ZYYA 2XMDA 1RP7A 1RQPA 4MQFA 3G2IA 2A5DA 2H2AA 2QTRA 3DPIA 3FCOA 3M1IA 5HKKD 2JJ2D 1T5HX 1YJXA 3OIDA 4TYYA 4S1PA 1NXXA 3L1VA 4BO8A 4B4VA 3OQMA 1H2EA 4RM2A 1ZMOA 3IL2A 1WDWB 5JTUA 2WICA 2Z4RA 1HURA 4I8DA 2HJRA 1UPFA 3WGNA 3RK1A 4RJKA 3B1JA 4Q34A 4EABA 4S3MA 1XKLA 2CEAA 1Z5ZA 3CH7A 1FFXA 3FVRA 4G24A 5B2FA 2WYOA 6LDHA 1E6KA 1BDIA 3J7TA 4M89A 2CDBA 3BCSA 5CT6A 1A9XA 1SCIA 1EB9A 3LVRE 1DXOA 4U2GA 5BMVA 1DELA 1GZ4A 1EFPB 1NJ1A 2QUKA 1VL1A 4UM9D 4G1VA 2Q0HA 1AU9A 4IWYA 3DDCA 2JRLA 3LL4A 4NBKA 2FQQA 3MINA 1C1XB 1TYCA 4RFVA 4ZC1A 2J3MA 4XB6B 2E21A 5CNIA 2G9RA 3B2EA 3UUFA 5L3SB 2VJPA 4QPZA 1GILA 4UPVA 3N2YA 3LLCA 2HBYA 3AKCA 2WM8A 3B85A 4JGGA 4ROSA 4X5OA 3BJRA 2OHGA 5BR8B 3WGIA 2QDXA 1YHYA 3G8CA 2ZJ4A 3VHLB 4YRNA 1SVWA 4KWHA 5FYQA 3ANMA 2JEZA 1Y33E 2IXEA 3FB1A 4PYLA 4XVCA 2Q8QA 2VJOA 4KJXA 2YWCA 3BSWA 2YV2A 3NUGA 4YDQA 5JG7A 1CB7A 1MV8A 4ZU6X 3N53A 3D1JA 3OMXA 1QIJA 1Y5LA 4UFOA 2X3FA 2X41A 2FMUA 2CHUA 3LFUA 5BY2A 3GRRA 1KJ9A 3LGSA 1G2IA 3P8ZA 1TCCA 2XNDA 3TZQA 3ESZA 2UVPA 1ZX1A 4J94A 2AVNA 3P0JA 2NGRA 4X3OA 5DU2A 1SC3A 3IKLA 4CFSA 2UUOA 5FPQA 2XITA 3KZ1E 4WESB 1A04A 1GL7A 2FSFA 2QTWB 3KT3A 1ARZA 2VYNA 1E1RD 2H17A 2CT8A 4GPD1 3ANLA 1H4SA 3LQQA 3AFIA 4HFRA 4YMWA 4ZQHA 3RFFA 1G7TA 2QT1A 3NT5A 3MINB 1ECLA 1FRZA 3UHJA 1QYDA 1XPRA 3HADA 2P77A 2CV0A 3I05A 2I6QA 3O9MA 1KA9H 4RBNA 1U8UA 1EFVB 1ZGCA 3EMBA 4S35A 5IHXA 6ABPA 1YDFA 3WDKA 1UMDA 1OBOA 2WUGA 2OZLA 4KKVA 4F4DA 4M53A 3SWWA 1N6NA 3KC2A 1JR3E 3OO0A 3PQ6A 5FWAA 3EPKA 4BFUA 2OGSA 4HF7A 2Q5EA 5I6DA 3SLKA 3WRWA 1TEVA 4HD8A 3TM5A 3RTCA 2XYPA 3H2ZA 5TLSA 1QB7A 4L1KA 3ENWA 4RL6A 4NZYA 2I2AA 2R00A 4HDNB 3W1EA 1IOZA 5EP3A 4PZDA 4BU0A 4CNBA 4HVCA 3MT7A 4LPSA 4D92A 1Y6FA 5E8RA 3HFJA 1PYDA 4DMRA 3V4FA 3GVXA 1H1TA 5ENZA 5IXSA 2WM2A 1XZ8A 2BJVA 2XV1A 2BMDA 4HMPA 4BB5A 4Z4CA 3OIWA 3T3MB 1A82A 1XB2A 5KOJA 1L5MA 3U17A 1GA1A 1I5RA 4I50A 3S8EA 3C7KA 1Z47A 2HF8A 4MKRA 4DV1B 3TR0A 1OJ7A 1XLWA 1XXHB 3BMCA 3FM9A 4FGUA 5JFTA 2WWVD 5FOTA 1YB4A 3HA2A 3JVUA 3DLPX 4EB8A 3HN7A 4B46A 1UKEA 4GOXA 2BGKA 2P4EA 5FHRA 1F12A 3TQSA 5JT1A 3OE4A 2BKAA 2H2DA 1NXWA 3HO8A 1CKEA 1M8GA 2F00A 1PFGA 2PZGA 3LUBA 4O4LF 4P4SB 1U5AA 3KKQA 5TJ9A 1DCMA 1LKZA 1UT5A 2O8BA 1SMKA 4FCCA 2AC4A 4GQIA 3EGDA 3ETGA 1YS4A 4I50F 3WYEA 5FUMA 2KLHA 1PEAA 2XD4A 1VLHA 3B82A 2FK8A 3CLHA 5F98A 4UZSA 3TECE 3HBLA 2HA0A 2GM5A 3H1PA 4OIFA 3GEPA 3BWYA 4BE9A 4XLTA 1O9HA 2Y0PA 1XLUA 4BX8A 3KAQA 4DV6B 3GZNB 1J9GA 4YRMA 1EP2B 1X38A 1HKHA 1A8QA 1F17A 3EZ2A 1U1DA 3LCUA 1V8ZA 2V5UA 4IXNA 1FDOA 1GPAA 1J2YA 2WAYA 4OCZA 3MGKA 1LK0A 1QYIA 2H51A 1UQTA 3W2TA 5EJEA 4MGIR 2BHLA 4ZJYA 2FEXA 3H3FA 3VOTA 3TTXA 1E1YA 3VPFA 4CLRA 1T4MA 2O9JA 1QO9A 1U0FA 1MAUA 2P9FA 2P3SA 5ALQA 1M10A 4KRFA 2HMYB 2PFGA 1C7RA 2DR0A 2ZKLA 4IH9A 4RA6A 5ABPA 3UK7A 2BHRA 3IA7A 4PXYA 4DS3A 1X1CA 1CDZA 1GNPA 5EI5A 4ZYWA 1GPYA 3E1SA 3QF4A 4H4DA 2BR4A 1PVDA 3Q8WA 1K8YB 3GQBB 4RLFA 2BMVA 3HBFA 3OEHD 2IS2A 1BMFA 1QYXA 4K88A 1JAYA 1JKJA 3CLKA 1Z17A 3L6EA 4KN9S 4Z53A 2DBRA 3R40A 1X70A 4H4CA 3K73O 1E79A 1C0EA 4LBYA 2GDJA 1T8YA 2IEGA 3DL4A 3F4BA 2C97A 1ESMA 3N2NA 3I3SR 5B1YA 1I3CA 4Z8XA 2JZNA 2JPDA 4RVSA 5I9LA 3RC8A 3PGA1 3A6EA 1UZNA 2IYRA 1LFDB 1V1JA 2XHEA 2RDMA 3LPAA 1FDVA 4JH0A 16PKA 3LOQA 3R5TA 1A5TA 1EG2A 1F51E 1RWVA 3ZJ4A 2HC9A 2D8AA 2DBQA 3LWNA 1RRVA 1YBHA 4CCYB 4F4FA 3BQNB 3B52X 2OENG 5KHOC 3DHEA 1X7ZB 3JWHA 4JJ4A 4I1RA 4YCMA 4FOPA 4ZXFA 4ZMSA 1JU3A 3VJLA 3ZWNA 1HOTA 4H3HB 3VH2A 2Q1YA 1T3SA 3VAAA 4DLTA 1ZJ4A 3IBYA 5JC1A 2PPLA 1P0QA 4X8LA 2FW0A 3U40A 5DNAA 2LKCA 3CEJA 2LCFA 3GLVA 3VPSA 4BNMA 5JEDA 2W42A 1PR3A 5A0TA 3NVDA 4A2WA 4Q7EA 1YBFA 3FZYA 3RWOA 2WF6A 3DKIA 4H7IA 4FS8A 4M87A 2XQKA 2QTBA 1DQYA 1OHHA 1DINA 1R6DA 2H54A 4A5SA 3G2NA 3W9SA 2J4DA 1J99A 4DANA 1ZN7A 3TCNA 2R7LA 3ESYA 1OLUA 2CKMA 2QRVA 2VJLA 3GCDA 4EOGA 3JAMA 3DOEA 2NV0A 4MROA 3PFIA 4TS1A 4XQGA 5I7AA 5A1TA 5AR1A 4DCNA 3U09A 1OWNA 1H1LA 3HKBB 1WTAA 4XUGB 4YAFA 3WAKA 1C3OB 2H18A 1T6BY 2F7SA 5J2TA 4I3GA 4PW0A 3AQIA 1LZKA 3HN6A 3BXFA 5LIRA 3UPTA 5FQOA 1L5RA 1I1QB 1DC7A 3VSEA 1XRRA 2XMZA 1L5QA 1YVEI 3BRQA 3R0XA 1PGJA 1WSWA 1GIAA 3DQQA 4JQYA 4UHFA 3TRFA 3JYHA 5C8VA 4O2AB 4C29A 2A4KA 1PJ2A 5FTJA 1K88A 3MAGA 3B2NA 4D8VA 4V38A 1A9SA 2LV8A 2VHYA 1KZGB 3BN3A 2DGDA 1QK3A 1A4RA 2YJ5A 1GYQA 3NIDB 4GMFA 3WWYA 3ZIAD 4DM3A 4PN7A 2YDXA 3GEGA 4ARAA 1E60A 2V74B 3K1AB 2ECQA 3NHYA 5A5GA 5ED0A 3WIEA 4Q7LA 1OIWA 2IKSA 1SZJG 3TAXA 3TS1A 5CDSA 4QKQA 3PEFA 1O1YA 5CITA 3QV1A 1CF9A 1DKNA 4ZCQA 3RVBA 3CLSD 4R8LA 1SXJD 3ZLBA 2XWSA 3B6IA 3GC6A 1E79D 1RYZA 4DJJA 5KQMA 2VHQA 2XUPA 3QU5A 4QOHA 3Q87B 2YZGA 4XLZA 2LZ0A 1GZSA 3CV3A 1MB4A 1W2WB 2AKAB 2EAUA 2H1CA 4GMGA 4JSYA 4P53A 4RV4A 1UFRA 2JVKA 4CG1A 3WKAA 1Y1SA 4EDFA 2JLVA 2EZ9A 2QVYX 1M0SA 2NAFA 1R4NB 4HG2A 4R8MA 2C5EA 1PK8A 4Y2UA 2GCNA 4UEJA 3U44A 1DE0A 5CXQA 1QX4A 1CR2A 1UBKS 4EB6A 2HR1A 2CMFA 4BVEA 3H3JA 4KR7A 3FYUC 2YJ3A 1E4EB 4GL4A 2YXEA 1GQSA 1YL5A 2FNAA 2QVGA 4Y2VA 5DM0A 1YS6A 1FQJA 3D0RA 5THXA 2OHFA 1U2EA 2C8KA 2TSYB 3T5BA 1MDFA 2CNOA 1EAYA 2X0IA 4DAEA 5IAOA 1NJ6A 2IU4A 1M76A 5CH8A 5A9SA 2H4ZA 3O8QB 3SF0A 5HZMA 4Q1FA 4QGFA 4BLTA 4L6AA 4CJXA 1G1AA 4Z7NB 3OQPA 5J2UA 3TIVA 5JD4A 4IXMA 1YJ8A 2ZUTA 1IN6A 2FUG6 3LHKA 4IHJA 1K7EB 1T9DA 1ZOIA 2IW1A 5FI3A 5IU6A 5FRDA 1ZPDA 2GHRA 1LDNA 1ZIXA 1VJ1A 1W0JD 1XA0A 1DXHA 1E5TA 2O20A 3LPMA 4NE2A 1JQLB 1ZRHA 3QVJA 3OFNA 5ARBA 4QL3A 3WLRA 4QWMA 2Q21A 4TMZA 4ZVSA 5C8YB 3GXOA 3O47A 2YJ4A 3A1CA 3FKJA 4HGRA 5KJ6A 3HACA 4B6GA 2OO7A 3CJTA 4OHOA 2P4QA 1RLJA 4S1VA 4AX4A 2I0FA 5LZ9A 3VVMA 4GFDA 1GNRA 2YBDA 5KMGA 2DR2A 1USUA 5ELMA 1Q1ZA 4FFRA 2WKQA 3HPQA 4X6YA 2PMCA 4HWPA 2BP7A 2YQ5A 2JL1A 1QYWA 3D3QA 4CG2A 2ZBVA 3DOFA 3H5RA 4M21A 4OI2A 1R8SA 4F46A 4J1TA 4CUZA 2WWXA 1KFBB 3FCAA 3FETA 4Z1MD 1N77A 1IOVA 2Z2YA 1L5ZA 4DNXA 3QELA 3CF2A 4C4XA 4R6WA 3C1UA 3FCCA 1XMVA 1T0IA 1RVV1 3E22A 1NVVR 3DEAA 3ELUA 3ZX5A 4AICA 4GI7A 2V45A 4IMRA 4HQ6A 1ZUIA 2RAUA 3ENQA 4BC1A 1RPNA 1ZU5A 1C30A 5KNCD 3QE4A 4WZBE 4MV5A 4WXYB 1EVIA 1DAMA 1E2NA 2YIJA 4TTVA 1UANA 4YJDA 1WQ1R 2Q29A 2AFIE 3ZXUB 2DSTA 5DTEA 5JO0A 2O8DB 3ONEA 1JECA 4FGKA 1Q1QA 1YT5A 2ZJ8A 4ENUA 3E58A 3I2YX 4L2IA 2HDNB 5JRDS 3GLIE 2ZB4A 1TVKA 4TZTA 4WADA 4M46A 4YXWA 2YHBA 1BEEA 2NVUB 3UJNA 4I1SA 2QWXA 4YRDA 1W44A 4ZHQA 2GFIA 1G9SA 1JR3A 3LUFA 4BP8A 1M2GA 3HGMA 5JXJA 2XSZD 3RKUA 3A1DA 4JYAB 4IIVA 3DA8A 3G0IA 4GHWA 5F3DA 1W4ZA 3IPLA 1VLVA 2YN4A 3MWEA 2FWIA 5FWXA 1Q2XA 5IVKA 2XUJA 1TXGA 5K20A 4DJEC 4A2QA 1SXQA 2GM4A 1X1RA 3GFVA 3W9UA 5JSZB 2C2BA 3DVRX 1IAQA 2F3UA 3P4XA 1L7NA 5JLJA 3HRHA 1EVYA 3EBOA 1R6TA 2YVKA 3RREA 4BGVA 4IZIA 2C4HA 2GA9A 3N3BC 4JVSB 2HTFA 4E30A 4GF5A 1CB0A 3AG6A 2JARA 3IVCA 4G4GA 4LKRA 4P54A 4KMOA 5GJVC 3E05A 1EVJA 1KK0A 2PUHA 1FYWA 4HNHA 4O33A 3S2YA 1I4DD 1P0MA 5D3QA 4UUQA 3EASA 4GDFA 2Q45A 2QTNA 5CB0A 3H2GA 1I2AA 4ZTBA 1PQWA 1OF1A 4QJIA 5K8JB 1DDIA 1E3SA 3BX1A 4M7RA 1G4UR 3AW9A 4TXMA 1OAAA 3KQNA 2F55A 4Z2YA 5E4JA 4B6SA 4BFVA 3GDGA 1BA2A 1YZNA 4CR8A 1AH2A 3SQLA 1PFQA 1G8MA 4D5EA 4K3VA 4MO9A 4HUTA 1PVOA 1ZUD1 4EVQA 1LRJA 3DTTA 2HY7A 3UGKA 4LHVA 2J7PA 3U1TA 1T4CA 5B30A 2VWQA 1EFLA 4RXUA 3PNVA 3PQCA 3TDNA 4IHQA 2CJFA 3IP3A 4MUEA 4TTAA 2DQ4A 2C99A 3IVAA 1YVRA 4XQ0A 1JHQA 4UHEA 5FTWA 4MYSA 3TQHA 4WZAB 3OKCA 5CLLA 2XEXA 4HAIA 2CFIA 3E9QA 4LVNA 1LVHA 4P7GA 1VE9A 1AB6A 2PMDA 3GLRA 3IOEA 4JC0A 5HFNA 2YIDA 5DO9A 3EVZA 4ETMA 4BNKA 1MC1A 3L6BA 3IEMA 3TG8A 2XTAA 5AM0A 1E5XA 1T1SA 4GBED 2D00A 2P6NA 1FNMA 4RGYA 1G7RA 3VU9B 4QM7A 1FX0A 1MDBA 1RI5A 1EP3B 2QTHA 2ZRCA 3P2OA 3WGYA 5FOXA 4TKMA 4PICA 3ZS8A 4UNPA 3EUWA 1JZTA 5HF9A 4Q7JB 2CUZA 1H93A 2QTCA 3NV9A 3R77A 2IELA 3AUSA 2RAPA 2WILA 2Q2VA 6NULA 1XEWY 4IQFA 4Y2QA 1SHLA 4DSZA 4FWTA 3IIMA 1K68A 3AU9A 2WKSA 3KYCB 4R2HA 3W06A 2EZUA 3LC2O 3ZY3A 5IASA 3X1JA 4AM8A 4BQOA 4C21A 1UPBA 3PCRB 1JMVA 2GCOA 4ZN6A 2GT1A 2Q6KA 5CEJA 3C1OA 8ADHA 3IELA 1UH5A 4J90A 4RE5A 5KU1A 4C7BA 1VPVA 2PUVA 3H2KA 3PHCA 1XMJA 5LXTF 4JELA 1E3LA 2J87A 2WMNB 4G0NA 2QUZA 1ZGJA 4BNIA 1TRKA 1WSAA 5IMSA 4QDKA 1AF7A 2PU5A 4OXYA 3DZGA 2OVBA 5DHAA 1NSTA 5AUQA 4RKRA 3BA6A 3D8HA 3CY6A 3UV6A 5EHZA 3X1WA 1N8NA 1XYVA 2WD7A 3R23A 3COPA 5FUQA 2VIIA 1P4SA 4X6LA 3BZUA 4DPKA 1Q0RA 3ZHVA 2EV9A 2QJOA 2ZJ0A 2ARKA 4MYHA 1TL7C 4PZUA 4WZ6A 1J0BA 2FZCA 1Z6QA 1N7IA 2QLMA 3P9CA 4X71A 1DRKA 4ANFA 4DCMA 1FRNA 4Z1MA 3LKDA 2MU1A 1CRWG 4FYKA 2V0CA 4CM3A 1D1SA 2XYRA 3N0WA 4TTQA 2VSFA 5TS2A 1EJ2A 1GP2A 1KMNA 3QYFA 1TM7E 4WZAA 1IM5A 3ZWOA 1FMFA 3RVJA 4LJ8A 3V8PA 2IBSA 3NWJA 1SXPA 3IBSA 5NULA 1BHSA 2IVFA 4HLUC 3C6KA 1V0JA 4HDRB 4X8MA 4RL4A 1XZPA 4ARUA 4P0TA 3MWGA 3WV4A 1Y4DE 2GCPA 3IP7A 3WNCA 4FX5A 5DGHA 3TIIA 3ZCVA 2F9LA 5BNZA 1PLJA 2CE7A 3RJ5A 3PF8A 4FHGA 1D07A 2EL7A 2B1IA 3PX2A 3W2EA 5GINE 2CNBA 1KP3A 2KHZA 4O3FA 4O4LA 3OX1A 4GZ6A 3HN2A 3F67A 3I6BA 5T6BA 4HDAA 2X22A 3LWDA 3BAZA 3RR2A 4WN3A 2B4KA 4BRSA 1G42A 4REQB 1H2HA 4CM5A 3KUCA 4B3SB 1TLLA 2G1JA 3FI0A 3KQSA 1M1YB 1KMIY 1TQ2A 3N86A 2V6BA 1MAWA 5EMJA 1V9LA 4MSUA 4K9PA 3SJAA 4Z51A 2Y6UA 3HCFA 4JUDX 4ND6A 3VH4A 2QJFA 4Q9NA 4XQEA 5FBQB 5JSZA 4FZ5A 1LS6A 2WF8A 3K16A 3JW8A 3AOEA 2AF3C 1QGOA 3T7KA 3TLCA 1OWMA 5D5QA 1SURA 2GRJA 3QEMB 2GZDA 3WBJA 5FPTA 4QQ8A 1O03A 2PL1A 1WDMA 2XGOA 1R5OA 3OCUA 1QV7A 2D0IA 2NXWA 3I4LA 3LDAA 3O92A 3PNQA 4P3YA 3SHFA 4B48A 5CA1B 1YDEA 1P6UA 2VH5R 3WAGA 2P91A 2BDUA 1VA4A 5LA6F 1S2LA 2OLKA 5IJZA 3KQTA 1HG1A 2ORIA 3L7OA 3RPEA 4LZAA 5LB2A 3IVRA 4R41A 1EA7A 5GJBA 1TVKB 2RHRA 4BJ5A 4DV2B 1TTPB 2WZCA 4OAPA 5F23A 2GF2A 5AW6A 1N1DA 4EQ6B 5BYAA 3KQPA 3WE7A 5BOSA 3L0PA 3NVMB 4TTRA 2WG0A 2XADA 5DK4A 2EEPA 4N7BA 1PHPA 2REQB 4EMTA 2VJYA 2PL5A 2RMKA 3ASUA 4GRDA 3LX4A 5D7NA 3I5YA 1NYQA 1FTQA 3S2SA 1NT2A 3NC4A 5I7VA 3CX8A 1U28A 4PVCA 2J6BA 1A3CA 5LDDC 1KJNA 2VT7A 2XTMA 3RFXA 3ZQKA 5BOSB 3WVNA 1Z2PX 1BXZA 5AI9A 5F33A 1HZZC 3ZVKA 3PDIB 5KYUB 4AY2A 2B4YA 1V7ZA 4MS1B 1YDMA 1MJNA 4U6QA 4XTRA 2I3GA 4BO1A 4XGRA 4Z6KA 3QUSA 1E2JA 4HYYA 1U6IA 4DVGA 3IEXA 1GAEO 5CB4A 1IEXA 2BP7B 3A7DA 3I9OA 5B6PA 3RFVA 3L0BA 1TUGA 2EKDA 3PPYA 2C20A 1IG0A 3V4PB 3OCWA 1U8FO 1M2HA 1AQUA 4W99A 1ZM4A 1M0EA 3NBYC 2P65A 3DE1X 3AUAA 3NVAA 2QD5A 1B4DA 4FSDA 1KAOA 4J1NA 4RIHA 1F2UB 1EFUA 1LDMA 4YLYA 1VC2A 2W37A 4IUDS 3SZUA 4IYRA 2RKBA 2D8MA 1TCUA 4A8TA 4URYR 3TLGA 2D4AA 1CQIB 3OWHA 1R6UA 3BSSA 3IHLA 2PXHA 3ZE0B 4AFNA 1NI4B 3F2VA 1QG2A 1H9AA 2D2FA 2Q8PA 1Z45A 1XVAA 5AHOA 2WIGA 3HJRA 3CKMA 2JGFA 1XZCA 4ZT4A 4ZI5A 1N32B 2WHEA 5KNCA 1B16A 5REQB 4Q1BA 4UTXA 1V4BA 4DDUA 2BOVA 5BUQA 4TL7A 3RHZA 2ZRMA 4AYWA 1J9ZA 3QJ5A 4M7OA 4MYUA 1SUSA 2HM7A 3AWIA 4KO4S 2KW5A 2PE5A 2R2GA 3V9AA 5KYNA 1VBMA 1I7NA 2O50A 5JHGB 5C4IA 4F4IA 1HFJA 2XZPA 2BI7A 3KZVA 3PE4A 3L0ZA 2R66A 5BSHA 1UZMA 4K05A 1WZEA 3PHJA 3GAZA 2G9UA 3U44B 4BX9A 1FU7A 2P5SA 3CZCA 4Y2TA 3QJGA 2BM1A 5HWSA 2P62A 1OLSB 1A1VA 2BKVA 1XRJA 1CUJA 1RQ2A 1VP9A 5KCMA 3N70A 5FTLA 3W7BA 3DNMA 1SCAA 2VF8A 3KDSE 4JOQA 1W36B 1SVIA 1VCOA 1JVSA 3IDFA 1DJMA 2OFFA 4A8JA 1YUMA 5CUQA 2A59A 3R3ZA 2R1TA 4UULA 1VB5A 2FSGA 5HHTA 5THKA 4LZPA 4QU0A 4A6EA 3KD2A 1AIPA 1EX1A 3QOFA 3I62A 5ADUS 4AS1A 2ZWOA 1Z7BA 5EE3A 4DGSA 3W5BA 3JYQA 4EF5A 3V7NA 1Z5OA 3WB2A 1DX4A 2O57A 3K1AA 2M6KA 3KETA 1CK4A 3LDGA 3QIAA 1W4BA 3UUWA 2VOJA 4H7PA 4XX1A 3UXYA 4YLGA 3GX1A 3I52A 1N5IA 1FUIA 3ILVA 5ITWA 3RC9A 3FTPA 1HXHA 3SGLA 1GZ5A 1JJ7A 5CDUA 3M82A 2PWAA 1QU3A 2L2QA 4CT5A 1GFIA 2OC4A 2D1SA 4ZV4A 4TMWA 4L4YA 2G80A 3UWKA 2BGWA 4EGJA 4ARIA 3KEFA 2X7JA 3A2LA 1SM4A 1VCHA 1XG5A 1XWIA 4JU9A 1EVEA 2H00A 2XIQA 2WD9A 2GM3A 4PQRA 3EXFA 5EJIA 5JAUA 2PBLA 2EP5A 2LBPA 2M1XA 1T5DX 1U2DA 4Y2XA 2PLAA 2HA7A 1EK1A 4MVJA 4WFKA 1FX0B 4KZKA 3F78A 4WCFC 3V4SA 4G5XA 1I7LA 1NP7A 3ZTTA 2O2IA 1ACMA 4YPOA 3AZQA 1NDQA 4KXYA 3HLYA 5E4TA 3ZYCA 1IK6A 1B74A 2C4NA 5AFSA 1DP4A 2C1ZA 4RD0A 2H65A 2ZANA 5LOVB 4RK0A 1E1MA 3VUEA 1KOGA 1VGQA 2GSWA 2I4IA 1HDCA 4TWBA 1HY3A 4OB8A 5IT5A 1QZUA 3ZHOA 5JXIA 2Z8YM 5SYNA 5EIBC 3X2FA 4RD3A 3QNMA 2YHIA 4YACA 4JS0A 4WY8A 4R01A 1Y81A 1AZWA 4YRFA 1R64A 4ZRDA 3SR4A 4ALJA 1WSDA 4BNJA 5BV1A 2R62A 4U8HA 1RKQA 1QH8A 1SUWA 2QIOA 2BTQA 4OQMA 3A70A 3V2HA 3I72A 3G7SA 1M72A 2QF7A 4G67A 5DK6A 3VKWA 3T5PA 1H2ZA 2JJ8A 1A5BB 1MF7A 4A1OA 1NUSA 1DPGA 3AK4A 1CFZA 1KYZA 5AKJA 4C43A 5E6RA 3WO0A 1E9FA 3JRXA 2I34A 1C1DA 1LPBB 3B3FA 4BLVA 3GLTA 3Q3CA 4BLOA 1NLFA 1NYLA 3WWDA 2BEUB 5KHAA 2X8JA 5IANA 2I6TA 3OSZA 3L7YA 3SYNA 4IFBA 1LQTA 4UVEA 3S2GA 4E14A 1BD3A 1T1EA 4BEBA 3IPRA 2K7ZA 4MLPA 2NZ8A 3E5RA 4I14A 4RHYA 5JYDA 4MV0A 3GPLA 3A4VA 4TUYA 1THGA 4KRYA 4Z8YA 4UOZA 2PTGA 3JQ8A 1VBFA 1A7KA 1OIVA 1VCMA 2HOQA 5DGTA 3ZU4A 3GUCA 4K5QA 1L4HA 2Z1DA 4QX6A 1U5CA 2OPHA 2X9LA 3D7LA 1CEYA 4N8EA 2EFDB 5COBA 1DAFA 2P30A 1Z8DA 5KKNB 3N2KA 4IEIA 3EFOA 3IKTA 1DPFA 4HAOA 5HCIA 3MMXA 1LVGA 4RA6B 1QP4A 1V8FA 2CXHA 1J8FA 4L6CA 3GCZA 3FJYA 4U7GA 2X40A 4FHZA 3PJFA 4LE0A 3DFIA 1R0YA 3RASA 5C7OO 1DKMA 2WK1A 2QIPA 4LYDA 5L4LA 1R3DA 2FPGB 4TTJA 5KNBA 1CNEA 4CL0A 2OCLA 3PWZA 3IB3A 4PWZA 1FC0A 3K8YA 1R5JA 2X2FA 4QEKA 3RSZA 1O9BA 3DWFA 1FDWA 1QVVA 1P6XA 3QG1A 4FFVA 4H6VA 3DPUA 3TOXA 5DSXA 5LC1A 4QRHA 3Q7RA 4URWR 1E5DA 4ZZIA 5JS7A 4V39A 1PG2A 5JCOA 4UEWA 3DXXA 3AFHA 4HPJB 4QG7A 3OMWA 4DBZA 1NKTA 4IW3B 3WSTA 1RJFA 3CUUA 1XK6A 4JP2A 1H2YA 3UWMA 4PC6A 2AKEA 3DWIA 3H5NA 1ZH4A 3PFFA 1E5QA 2ODPA 3ANTA 5A1JA 4YRPA 4NJMB 5IUJC 5HM6A 4FYPA 4BP1A 5KJ1A 4GI1A 3PQ7A 4C7OA 2CNWD 5LSAA 4RY8A 5CX4A 4GYYA 4XXHA 4PIPA 4HB3A 3AETB 5I7FA 3ZWXA 1ZINA 2R6GA 3IBGA 4RY2A 2FUCA 2I1QA 1JQAA 1DHRA 3OLVA 1EE9A 4BQIA 5J58A 2PDAA 1MTOA 1F1BA 1U4SA 2C42A 4PO1A 4R83A 2X5KO 3CURA 2JZOA 2V96A 3PCXA 4Q9IA 2ZBPA 4EYKA 1QV6A 1U8YA 2G77B 1BSVA 1IH8A 3OT4A 3TN7A 4C5BA 3REOA 4EBFA 3S5JA 3H2SA 4AMGA 3M6MD 2D1TA 4LGMA 3R9IA 3ETJA 2FEPA 2RH5A 1Y7LA 2PH3A 2MDTA 1X77A 1JQBA 3UFXB 4Y1RA 5DX1A 4GC9A 4WIAA 5HILA 4B2LA 3MJCA 1K5DA 5LA6B 1RRMA 4W1SA 1A4UA 3IPYA 3Q10A 1PE0A 2EFGA 4J9VA 4MMZB 4TVOA 4Y2GA 2QTGA 3TFQA 3TJZA 3TPZA 3DVLA 3QU9A 2QROA 1OXTA 4O6VA 4OREX 3ZTYA 2X9GA 4ZZ2A 5I7RA 2B8JA 1T0HB 2JHGA 1ZD2P 1SBZA 5EAIA 1W4RA 3ZUGA 3A10A 2WJZB 4BASA 1A9PA 2MOKA 4BKUA 1ORRA 1GUFA 2H06A 1NMSA 2AN5A 2JGEA 3L9XA 4E13A 4ZK6A 3SZ3A 4Z4GA 5HUQA 5JRZA 3TAUA 1C9MA 3BCUA 3HUTA 1XF1A 2PUWA 1V48A 5L3VA 1U2TA 2E87A 1CUYA 3G7UA 1RBMA 4GIBA 4NHOA 1QIGA 1R4NA 4Q3CA 4BNNA 5BURA 4OQLA 3TZCA 4U9IS 2BZ1A 5I7OA 1PU2A 1T1RA 1ZXLA 3M2PA 4BLRA 1U6KA 3Q0EA 4J3FA 1WDKA 4JJEA 4GKAA 4RTRA 1L8OA 2F8LA 3QFHA 3VVLA 4HXYA 13PKA 2D54A 4KDRA 5D84A 1KDYA 4QXPA 1Z4KA 5K0JA 5LYJF 3PE6A 3TQCA 2ZUVA 4TROA 5ILOA 7MHTA 4ZIRB 2Q7DA 2O14A 3W5JA 4D8TA 3AHGA 5DYNA 2GEVA 4A0GA 5LMCA 4S05A 1TUEA 1UBLS 1OV6A 3HZOA 1JLSA 4LOLA 4YWHA 1W5FA 3TYXA 4GE0A 3VPDA 3ZBTA 4D0SA 1T3ZA 2HKIA 1O5OA 1Q44A 3NGXA 4LHEA 4X84A 5FFMA 3VDXA 1UOPA 4COKA 3S6JA 3DR5A 5IXJA 3PGMA 1XOIA 1P62B 5EY5B 1RAAA 3S7TA 3VZRA 2BDEA 2EC5A 1AN0A 1ORVA 2GCGA 1GT91 1NBIA 5HIKA 3E3LA 2JHFA 1NN5A 3MM4A 3PXUA 2NYRA 2EBHX 2QGNA 3MWDA 3ADKA 5D1HA 3ADBA 1IM8A 3N6RA 3VOAA 2HO4A 4RDXA 1RS0A 4IZOA 4NNOA 4GT1A 3JD3A 4ZVKA 2ZE6A 2OXEA 3E0QA 2B3TA 3KUXA 3ZKWB 2Y0DA 3DFMA 4DJ5X 5J2TB 1L5WA 3TSZA 3HB5X 3ZWQA 1V41E 4QU5A 1QDEA 3DV0A 2FPRA 3P1JA 3T61A 5JAMA 4DLWA 4W8OA 4QOEA 1NVTA 4UHCA 4IRUB 5AKLA 2VHXA 4ZYTA 1QF9A 2ZCUA 3G5AA 4REMA 2ADFA 1F38A 1B8VA 1D09A 4GMDA 3L6UA 4D9KA 1WBDA 5FEMA 2OO5C 1B76A 3GEBA 4ALMA 1WF6A 2DT5A 1UAGA 5E6UB 1VSTA 2Q3BA 5EG5A 1DTEA 3ONNA 4LXGA 3U3JA 4ESEA 4P82A 4ZMBA 4D9IA 4KREA 2JCGA 3FCXA 2NUAA 1OFVA 1OKKD 4GQBA 3UYKA 1T15A 5J4HA 1WMFA 1EK2A 3K9HA 4ARVA 2IH2A 3ZWDA 1I32A 4JFRA 4DIBA 1G3RA 2PSDA 3ZU3A 4EPWA 3UHAA 1NHWA 4LAFA 5BQ5A 4EDHA 4QT4A 3A2NA 5MN5A 2IDJA 3L8CA 3P9PA 2XY4A 5B2ZA 1IDN1 4P98A 4K9NA 4A3SA 3VHQA 3IPAA 3G2LA 1PN3A 1EMDA 3NBMA 1LWOA 1DZIA 2OHVA 1XD2B 4NARA 4M22A 3KELA 4BVJA 4IV5A 3OQOA 4CCYA 1IWOA 3MWFA 1DJPA 2V59A 3DD5A 5CB8A 4FK8A 1OD6A 1JWAB 3T5DA 4UNRA 5KTOA 3LX8A 2BJWA 2DERA 2EFYA 5IJWA 1SZCA 2OBXA 4NBRA 3R76A 1IY2A 1VPWA 4A26A 1GA6A 3RARA 1KRXA 1ZESA 3HDGA 1A88A 1M9NA 4LF7B 2VDWA 2X5NA 1OWPA 2IPAB 3NANA 4Q9KA 2ZJ1A 3WI7A 4NC9A 1E6CA 3NHJA 2CCJA 2J85A 2B1QA 3FPAA 1Y9AA 2NPFA 1YK0A 2QLBA 4YQFA 2RD2A 4UE2A 4GUAA 1X7YA 2P35A 4PPYA 2P9CA 1O4WA 1T5LA 1YR3A 4FHFA 5GJCA 1NATA 3IXLA 3DOUA 4MV8A 3ROZA 1UCFA 5DBFA 2Q7OE 1N57A 4O2BB 3EXHC 3P9RA 4DYVA 2GAFA 3OP1A 2JFHA 4EGCB 4MUXA 2ZJ7A 5TGDA 3HE3A 4BN0A 4UM7A 3SX0A 1K27A 2P9HA 4YAUA 4LE1A 2ORWA 1YDWA 3KOOA 2NP6A 4G81A 1FVHA 4AW9A 4E70A 3G9XA 3RYHA 4KLRA 2JF0A 3H1AA 3RUCA 3L7LA 4QYIB 5IWAB 1SXJE 3L40A 4NZZA 4OM7A 2CBXA 5G40A 1Z36A 4PO9A 4YGXB 1YAJA 1LBSA 3JQ6A 1M5RA 2WU3A 3SZRA 4ARSA 1ONBA 2ZEJA 4HTAA 2F1RA 1ZISA 2R8EA 5F5XA 2ZBUA 2R8BA 3RD5A 3H1BA 5AK5A 3PWSA 4DKJA 1YI1A 3JQ7B 5ICFA 3L06A 1GRNA 1WRBA 1U99A 3GLQA 2P2ZA 2J9RA 3QF7A 4PBRA 4MEJA 4MPDA 5JI2E 2D06A 2GHTA 2VK8A 5HS4A 1UPCA 2WDZA 4KK3A 3A3OA 1O0CA 5T6MA 1DAOA 2MYTA 4Y2JA 1DAEA 1RPJA 3NLLA 2R44A 4NENA 2EDCA 4AZSA 2HMSA 3GLUA 4CLXA 1C8BA 4CIWA 4DR4B 1NQXA 1ZGZA 2GYWA 5JEEA 4YRAA 3QNUA 2JKZA 1ENYA 4XFKA 5IFLA 3ZV6A 4EEKA 2PA0A 1KC1A 5EUCA 4L3OA 4PTLA 5EMNA 3NATA 2XQVA 3UOAB 4C7KA 1EX6A 4O4IF 3SQDA 2GPYA 4QULA 1FYVA 1RYFA 2AEFA 3CEHA 3MBOA 3VZQA 1IOLA 2WM3A 4HQNA 4H17A 1U2RA 1RIIA 4EG4A 3DMYA 4KL8S 5FULA 1QCYA 5BWNA 1MRSA 1H23A 1LSOA 3ID6C 3BMCB 4HLDA 5AW3A 3V3KA 2BEWB 4TVSA 2DBYA 5A6SA 5IHPA 2XUGA 4UFPA 1JEEA 1MJHA 3I8SA 4B4UA 3RAEC 4XZ3A 3MUOA 2RHJA 2CVQA 3VQTA 4DQ0A 1EGQA 2O5RA 2B0CA 1SQSA 4J1QA 3GQVA 1QH0A 5CG1A 2Z8XA 5ITVA 2I8LA 3ZNOA 3GHHA 3MTEA 1L7PA 2BCGY 1BXKA 4EBBA 4M9SA 4N82A 3UV7A 3IA2A 4CIXA 2AHOA 4TMFA 5JSHA 2CNKA 1E77A 3AR5A 1UBFA 1EE2A 3WMRA 4DA7A 2G40A 1QIEA 3QKRA 4PPFA 4BPRA 1TMYA 2FETA 4YJFB 4CCWA 4QUBA 2ECOA 2WQZA 2ERCA 3RT9A 2O06A 3KZMA 2Z5FA 2QV0A 4ZA2A 1U6JA 4R71A 4TV8A 4IJWA 3WLJA 1JDJA 3WG9A 3H87A 1J1ZA 4HEJA 2QBYA 1ZYUA 5AO9A 4PHGA 4UTZA 2YH2A 2GYYA 3G82C 1LW6E 1JSZA 3H1FA 3OM1A 4URUR 1WPGA 3UJDA 3X44A 3HUFA 4HADA 3GEEA 1JIIA 3IALA 1D2NA 1INLA 1R00A 1ZLYA 3GG2A 3KR1A 2BH9A 3JWIA 3NWOA 1RXCA 4JKOA 4RIEA 4CQJA 5IJ0B 1PT5A 4JJ6A 2WVJA 3D4LA 2FWBA 3LX6A 4RKFA 3QBJA 2XI4A 3JARB 1XZDA 5CDFA 3W5SA 4OFWA 2DF8A 5AVJA 4HUQB 5BT9A 4C6RA 4RTOA 5K0NA 5DFAA 3ZHUA 3BHJA 4YRRA 3UXHA 2D0PB 3RJZA 2XNDD 2VPXA 3FFXA 4YS6A 5CYGA 2DHRA 2FZ5A 3K05A 4GZ3A 5LN1A 4QSHA 2Q2WA 1ONPA 4OMUA 4QUAA 3WKDA 5EUMA 1H8ED 1SAYA 4TV9F 4K3UA 1VRWA 4IJQA 4WN9B 1R18A 3E9DA 1YDHA 3NJRA 4RO0A 4OUKX 3HJCA 4Q48A 3NONA 3TF5A 1VFNA 2BI4A 1VZ3A 3OHMA 5GP1A 2VG8A 2YQ4A 2FKAA 4FC7A 4X41A 2B7CA 2BFBB 2IY8A 2QGFA 2TECE 4LA4A 4EUKA 4GOKA 3ASVA 1V7CA 2A3RA 4XFDA 4DB2A 4TM7A 3GPIA 5LUAA 1GEGA 1T26A 4F5DA 1FXSA 2ZRHA 3ZGZA 3ZNQA 3SCZA 2IP2A 4TV8B 1G20A 1M74A 1ZITA 3U49A 4I2VA 5DYTA 2Z43A 2BKEA 1ZUNA 2WF9A 5EIOA 1B26A 2NNLD 2FSHA 5C5DA 1ZRSA 3H4IA 3QPAA 4XWAA 2DFNA 5KAPA 3PUKA 2NXJA 1US8B 1BU8A 1LWNA 2RK6A 3IBTA 5IX8A 3D3WA 1A8IA 2NUBA 4YJ2A 1KI4A 4YMVA 1MXHA 2VI5A 3MFYA 2O0MA 5CCEA 2Z2KA 1WIWA 5KWVA 3BGIA 1ZD8A 3BAFA 3A1VA 2H9YA 4NU5A 5EJ7A 3VU8A 3RYFA 3SD7A 3LWBA 2WFLB 4MVJH 4ZVTA 2VP6A 3IGFA 4A6XA 5BNTA 3QKTA 2E85A 4X00A 5AK3A 5M34A 1IMJA 1JJIA 5E0OA 2QM8A 4QVGA 3K6SB 3MJRA 1I9GA 2JW5A 1VLJA 4MQFB 4RJJA 1VKOA 2C2WA 2GX6A 2C7VA 2A3NA 2UVQA 4I5GA 4EHLA 4H3SA 3Q98A 2WHPA 2HPAA 1U7XA 1XHLA 1TCBA 3ZX4A 5FDFA 5AVTA 1TTTA 4BV9A 4LJKA 4AXXA 3NM5A 4D3SA 4P2BA 1BX0A 4C5CA 3IRVA 1AXGA 4RWEA 2OQRA 1OMOA 3BXHA 5A4FS 1SVLA 5JU6A 1L7QA 1Y5IA 3K09C 3RBZA 5I7UA 1DT3A 2FP3A 3BCRA 1UL1X 2NVWA 3LM8A 1BN6A 2VTDA 3N0XA 3ZLUA 5BMOA 3E70C 4D99A 3K6SA 1FQOA 3D4NA 3IAFA 4EHJA 4TT3D 3WP1B 2IZZA 1HNXB 3AEKB 3G13A 3I76A 5K5EA 1MR3F 1RC8A 3B36A 1UJNA 1N4DA 1J07A 3INNA 2FLKA 4EHKA 3DOJA 4N0QA 4YAJA 2XB9A 2GBGA 1TQ6A 3BBPA 3E48A 3DFFA 5JVDA 1PT7A 2AG5A 1PD1A 1T9GR