3D3MA

The crystal structure of the c-terminal region of death associated protein 5(dap5)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
168
structure length
161
Chain Sequence
b'LLKLEKELLKQIKLDPSPQTIYKWIKDNISPKLHVDKGFVNILMTSFLQYISSEVNPPSAPSKEQLEQEKQLLLSFKPVMQKFLHDHVDLQVSALYALQVHCYNSNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQWLTWLETA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Eukaryotic translation initiation factor 4 gamma 2
publication title The crystal structure of the C-terminal DAP5/p97 domain sheds light on the molecular basis for its processing by caspase cleavage.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
total genus 64
structure length 161
sequence length 168
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3d3mA00
2IU1A 3D3MA 4GMJA 4LUNU 5ANRA 1PAQA 4CRWA 2IONA 1H6KA 2I2OA 1N52A 2KZTB 1H2TC 2VSOE 3EIQC 4GMLA 4IULA 1UG3A 2IOLA 2GGFA 2VSXE 2RG8A 3FEXA 2KZTA 4C9BB 2ZU6B 4JHKA 4CEMA 4CT4A 1H2VC 2FULA 4B8AA 4B89A 4B8CB 3JUIA 1N54A 3FEYA 3L6AA 1UW4B 2HM8A 1H2UA 3EIJA 3RK6A 1HU3A 2IOSA 2NSZA 4JHJA
chains in the Genus database with same CATH superfamily
1Q2ZA 3ZYMA 2Q7FA 3T5XA 4HNAD 4DI4A 3FTZA 3LXUX 3FUNA 3CSFA 4GMLA 2J07A 2RKKA 3ZVVA 4LG6A 4AVXA 2V5FA 2XEVA 3E37A 1NL4A 4WNDA 3T5VA 2DYRE 4XX5A 1HX8A 1X5BA 5T4YA 5CRUA 2FO7A 4Y6WA 4BT8A 1Z6TA 5FQ8A 3VTYA 3T8MA 4JZYA 5AARA 1HS6A 1N11A 1AP7A 3NOCD 5FIOA 2Y3AA 2WPVA 4MLPA 4EZJA 4J6IA 3RSEG 5FZRA 4H7YA 4B0ZA 5CCMA 2NC9A 3LYAA 3ZHEA 3PE4A 4XKCA 3TXNA 4OVUA 4NACA 2XGMA 4GZ3A 2ZXWE 5AYWD 3FUKA 3UMVA 2JABA 5EX3A 5T3RA 3IXEA 5BV1A 4V3IA 4O1PA 2V4LA 3G2TA 3B13A 2C2LA 5AAOA 4GTRA 3V31A 1TJFA 2KCVA 4ABNA 4EZLA 3VLDA 3ASHA 2ZGGA 3QWWA 2ETAA 3Q4AB 4F7AA 3T9KA 3LVRE 2F0YA 4W9RA 2X38A 4UI9C 5EKQD 3FH8A 1V55E 1GW6A 3ML8A 3Q47B 3Q78A 3L13A 3E32A 3I4GA 3UKRG 3ONLA 3TWQA 1TYQG 3EHMA 3MA5A 3ISMC 3EHQA 3UTMA 2RFMA 1IXVA 5EYPF 1WY6A 1KLXA 3RO2A 4G25A 3CVWA 3CHOA 3EHNA 3D9PA 1PAQA 1D8DA 1ELKA 2XCBA 2DZOA 3DSTA 4JB8P 2LO6A 1QNFA 3WXXA 5LOZA 3N71A 2AXVA 5BPPA 3D9HA 2FEZA 1KT1A 3ZHEB 4PDXA 2FF4A 4N39A 3UKUG 1IYGA 5CRVA 2P2CP 4K5CA 3LJNA 5ITZF 1S64A 3HDXA 4TUMA 4GCNA 3ULQA 3KS2A 3ABLE 4Y6CA 1WG0A 3EJNA 2ETBA 5D66A 3FUJA 4FU3A 4G24A 4PS8A 2IU1A 3FY4A 4HB5A 2YINA 3BUAA 2PM6A 4I1MA 5FZSA 4UUCA 3UT7A 2EIJE 4BERA 1B89A 2PNNA 1MJ0A 3UX4A 1EYHA 3CK7A 5FWQA 1BI8B 4RG9A 3CQCB 4Q94A 4GTSA 3B7TA 5M72A 2OCCE 3UM1A 2QFCA 4UI9K 4EBAG 3PZ4A 3UIPC 2X6JA 3G2SA 4N3BA 3DEPA 2M63A 2OVFA 4N3CA 4L2YA 4WNFA 3EUVA 3JXIA 2J09A 2H6FA 1E8WA 3SFXA 1Y8MA 3AJIA 3TXMA 3TAXA 3TL5A 4P29A 4A1GA 5FQ6A 1DCEA 5AN8A 2VTBA 4KVOA 3Q75A 3ZIMA 4CEMA 2GROB 4G11A 2WQHA 4J8SA 4PUCA 4GZCA 5ENPD 1LF8A 1BLXB 1N4RA 1Z3YA 3MYVA 2XEHA 5ARGA 3FHEA 3CVQA 3JXJA 3BG0B 5JJ7A 4U8VD 4GYWA 3NZUA 4K03A 1JPLA 5C1DA 1OUVA 4F53A 4B89A 5EILA 3Q79A 3RJVA 2LSVA 3ZFWA 1JCSA 1IKND 4GYYA 2H6GA 5BUZA 3ASGA 4HVBA 3ZW3A 2R05A 2A5UA 2LSUA 2P9UG 5JA4D 4NIKA 3I4RB 1O1TA 2NXPA 2LUHA 3GZ1A 2L6BA 1N4SA 5AIJA 3L16A 3HG0D 3JQ1A 5ENQD 4JD2G 5KJMA 3V2OA 3FUDA 3HXCA 3KEAA 4F3VA 4YNDA 4ANWA 4BX8A 3E34A 2QZAA 3ASFA 4G2VA 1SQMA 3ZRHA 2BTDA 1N9AA 3VTXA 4OVVA 3SFYA 2ILRA 3C5RA 4HRNA 3DPYA 1P5QA 4UWLA 2DIWA 1QQEA 1N54A 4LRZA 4JW1A 2Y4TA 5EX0A 3ZEFA 5B1BE 2CFUA 4IYPA 2BF0X 1SA4A 3CVPA 4XE0A 2AWIA 2KCLA 4GTTA 4L7TA 2VSYA 3CHQA 4TRQA 1H6PA 3KSQA 4J8EA 3FTSA 4J8DA 3DSUA 4GZ6A 2AXUA 2H6IA 2I1KA 3ESLA 5J90A 3L9TA 3RRMB 2EINE 2ZGDA 2CFZA 2E0IA 4EZKA 1UN9A 3Q73A 3DXKG 4ANVA 4LSZE 5G2NA 1UJKA 1K1AA 4JA7A 2WMNA 4G23A 1ELRA 4MKTA 1PC2A 2OOEA 5AQ9A 1IHGA 4ZFHA 4F6RD 2HM8A 3APDA 1N94A 4ATZD 3SO8A 4FA6A 2OV8A 3EU9A 4H7XA 1N4PA 1TN7A 3Q15A 2ZISA 2VQ2A 5KNHD 4G8LA 3S7DA 4KMOA 3GZSA 1XNFA 1Z5SC 4Q96A 2J8SD 3C98A 2GRRB 2YHCA 2GW1A 4L1BA 5CBOA 2WQ7A 3KEZA 4U0UA 4U8HA 5B3SE 4O60A 4AY6A 3EIJA 2EIKE 4BSZB 1IQUA 3G2UA 1RZ4A 1XGWA 3V30A 4I9CA 2UY1B 3EIQC 3CR3A 3C3QA 4XI9A 2WB2A 5FQ7A 1TNYA 4ACLA 1O5MA 4B93B 5D0OD 2I6HA 3MV2B 4HFGA 1DVPA 3U4TA 1MYOA 3CK8A 4JVSA 4DX1A 1KT0A 3FUIA 3UT8A 2KZTA 3TWSA 4HOTA 3AS4A 2XS1A 2NYJA 1OWMA 4HLLA 2V4HC 3QAQA 2P9SG 1YYHA 3FDHA 5BV0A 4HBDA 2XRZA 1BU9A 2XEEA 1S70B 1UOHA 4M3OA 3CV0A 4IN3B 2XS8A 4KZ0A 2ETCA 2V5QC 5G05J 4HXIA 3AG1E 1HE8A 4U95D 4XKBA 1N52A 2XPIA 2VSOE 3DBSA 3FTVA 3MV3B 4HOUA 2ZU6B 3TWWA 4GB9A 4X8QA 4DK5A 4PS3A 3ASDA 3PH0C 4TUUA 3R9MA 3R9AB 4APFA 4F1PA 4GZDA 5FINA 3L54A 1OY3D 4HORA 4PH4B 5KJNA 4I6EA 4MBGA 3B95A 2PM7A 2C0MA 3PRZA 2CHWA 3DSWA 4L23A 3GZ2A 2UWJG 1D8EA 5G55A 1YMPA 4I1OB 3TG5A 3ZN3A 3FTYA 3FU3A 4JHRA 5CEAA 4Q69A 1SVXA 5KWDA 4DLOA 3ZPJA 4YVQC 4GMJA 4U7EB 1JWGA 1ZB1A 1HZ4A 3CQGB 5KCMA 2KZTB 4NRHB 1FVFA 3FFLA 3QNKA 4OAUC 3CEQA 3PZDA 2P58C 3CIAA 1KZOA 4F1SA 5CEDB 4GU5A 4RG6A 3PEUB 1MX2A 4A63B 1HXIA 4FHJA 4J8FA 2IF4A 1E7VA 3D9NA 3WG7E 3SZ7A 3FTUA 4QFVA 5HQ8A 1Z3XA 2L0TB 2HR2A 3SQVA 4C48B 3AS8A 3DSSA 1TEZA 4HOSA 4BTBA 4TXPA 4YDWA 5AQAA 3PUKA 2GRLA 3L22A 5FQ4A 3FH7A 5CMWA 5G05C 2XCCA 2XPYA 2VJ8A 5G04J 4A55A 4J8YA 5JMND 1JCRA 4IRUA 2R02A 4CT0A 3VLEA 2AXZA 1HU3A 2GRMA 1HO8A 1X81A 3CVXA 2F37A 1E8YA 4XZ4A 3QWVA 1FPPA 4ANXA 3D9IA 1DC2A 2VSNA 1D9SA 3JUIA 5J08A 3HXDA 3IV0A 5CECB 3FU6A 3CVUA 3IBEA 1IHBA 2CHXA 2JEKA 2QYJA 2P9NG 3PDNA 3UM3A 4UQZA 2J49A 1FT1A 4BSXA 2PQRA 2GRQB 5CCLA 5HS0A 3K9IA 5JJ6A 4FADA 2Y4UA 3CHMA 3QJZA 2WXGA 3ASNE 3ZUVB 4CRWA 3MGBA 2IONA 3QK0A 3HIZA 2WXNA 4GTQA 3BG1B 1YCSB 3MCXA 3S7BA 2WXFA 3NB2A 3Q7AA 3LY9A 2IQCA 3L6AA 3FUMA 4RQIA 2BUGA 3V2XA 5EYLA 4NQ0A 1QZ2A 4RVBA 3J5QB 3QWPA 1TJCA 3EHRA 3FH5A 2XGOA 4XI0A 5HI7A 4N3AA 3CVNA 3SY2A 1QBQA 3G2VA 4CGWA 3O48A 5AJDA 1UN8A 4D10C 4UWKA 1A5EA 3AG3E 3LY7A 2A4ZA 1DNPA 2P9LG 4JC8A 4BESA 3QB2A 2J9QA 1O1SA 4AJWA 1K3ZD 3AS5A 3PS6A 4CCAA 3D9JA 5BXUA 5CMYA 1QYMA 4FP7A 4HQDA 4KXKB 2XZDG 3MZLB 2YNQA 4K5AB 1LD8A 2DYSE 4GTMA 1EDUA 3HXFA 5G04C 3TJPA 4HOQA 5AJLA 2KCKA 1ZBPA 4DX2A 4UQYA 5A23A 5FZQA 1HG2A 1N4QA 1UJJA 2EQXA 1U2VG 4CZ2D 4HLEA 2WM9A 3LEWA 1H2TC 4B94A 4IULA 4FLHA 2XPZA 4GPMA 3MJWA 4WWOA 2UY1A 4DX5D 2WVIA 3C3OA 1WDYA 2ONDA 4ILIA 3W9FA 3P1UA 3QARA 1TNBA 3UT4A 3LS8A 5KBAA 4ANUA 1OCOE 3TWUA 2XHEA 2X6FA 4UQXA 3ABME 4OYSA 3SFZA 3HVEA 1SZAA 4GCOA 1NA0A 2B6CA 5ENRD 5AQBA 4DX7D 3APFA 3GYZA 2DCPA 4KT6B 4G8KA 2WXLA 4HI9A 1OWOA 1OCCE 3I5PA 4TXRA 4HS2A 4KVMA 4EBAA 2LXMA 5JHBA 4JPSA 4YDYA 3B7RL 1UG3A 2J4DA 4JHKA 4DUIA 4DRXE 2AVPA 3CLJA 4GA1A 3RAUA 3UIOC 2PZIA 3FTWA 5DIZA 2J4BA 4EECA 2JLBA 3NQPA 2Y1LE 3LPZA 2PQNA 2VGXB 3BQOA 3JQ0A 3FU0A 4QQIA 4HI8A 3UPVA 1TNOA 5HRYA 3AG4E 1HG5A 2Y69E 1NA3A 3NAWA 5ENTD 5BNWA 3HYMB 5CBNA 1W3BA 3PVLA 2RG8A 1H0AA 2WXPA 3CKCA 5EIBE 4GPKA 2DZNA 3KSLA 3D9MA 2L9BA 1UW4B 1EF1C 4A3TA 3APCA 1SZ9A 2KATA 2OEVA 3R7QA 1MX6A 2EIME 4HRLA 2I2OA 4ACKA 2R2LA 2VGEA 4U0ZA 4UI9J 3ESKA 4UWFA 3UM0A 4FC8A 3RKVA 3BU8A 3LCAA 3RO3A 1L5JA 2IY0C 4XIFA 1N0QA 4RSYA 4DPRA 3ASOE 4BTAA 1E7UA 2AW6A 2LAHA 4BFRA 3RRUA 5JHAA 4G26A 4FHKA 3HVEB 5ENNA 1WM5A 5AENA 5KJLA 4CGVA 1EPUA 3I3NA 4LNBA 4C0EA 2P9IG 3Q9NC 3UQ3A 2IFUA 4APOA 4GTPA 3ZXPA 5BT1A 4ME2A 4I1AA 1E8XA 5LFAA 2F8YA 1MZCA 2X6IA 3CSTA 3CVVA 2HE0A 2B0OE 5EN5D 4BT9A 2NSZA 2OVBA 5A7DB 2MHKA 3ML9A 3DSXA 2P9PG 4ZHBA 3DSVA 3RIBA 1DCQA 2GRPB 3IKOB 2R17C 4KZCA 3OXGA 2F8XK 5LX8A 4E85A 3J5PA 4UWHA 3OXLA 3FUEA 4EHMA 3D9KA 3FEYA 5HKPA 3URZA 4YVOA 2CHZA 3MEKA 2BKGA 3ZXSA 2QC9A 3P2BA 1FVHA 4K0RA 3FU5A 3SNXA 2WXOA 2YQ8A 1OWPA 4GMRA 1LTXA 3SBTB 2BEDA 3MKRA 4BY6A 2P9KG 3E4BA 4LUNU 4I43A 1O1RA 3D9LA 2H6HA 2C0LA 4I6JA 3ABKE 3FUFA 3BEEA 3CHSA 3PNLB 3TWRA 2RFAA 4WAFA 2BKKB 1H2VC 2FULA 2DVWA 4I2ZA 5EDSA 3OAWA 1INZA 1BPOA 1NFIE 3G2WA 3IHYA 4AXHA 3QKYA 4FULA 1V54E 3JUEA 4JXTA 2WXHA 2VSXE 4U0SA 3LKUA 2MRIA 2I1JA 4WWPA 5D2MC 5ENSD 3AG2E 4I9EA 4L9PA 1OT8A 2HO1A 4O1OA 2LXLA 5JJTA 1YA0A 3PE3A 4BEPA 4TV3A 4YDEA 4WUYA 3U66A 3TWVA 1OCRE 4CT4A 5D0QD 4ILHB 2I9CA 4AOFA 4BWRA 3MKQA 4AV7A 3NOGD 3S7JA 2R03A 2L6JA 1PY1A 1N95A 4AM9A 2KC7A 4CDNA 1TN8A 3TGOA 5FTPA 4AY5A 3X2QE 4U04A 1HF8A 3ZYKA 3ZYQA 1SA5A 1MX4A 3PZ1A 3FWVA 5C2YA 3IHVA 3PEVB 1Y6IA 1FCHA 4WWNA 2IEJA 4E6HA 4CYMD 2E2EA 2MYOA 1WAO1 3ZGQA 5ENOD 3UI2A 2R59A 3ENEA 1HFAA 3C72A 4ILGA 2CG3A 5H7PA 4LNUD 4C0MA 4URKA 3L82A 4MS6A 1H19A 3CVYA 5ARFA 3OTNA 2WQ6A 5ANLA 2DWZA 5E75A 4EQFA 1TNZA 5IY5E 2V8SE 3D9OA 3Q5MA 1NZNA 4I17A 3CHPA 4GA0A 3UXGA 3TWTA 3E33A 4U63A 1JCQA 3LVQE 5KJKA 2IO3C 4JEUA 4AP2A 4JEHA 3SBSA 4N5CA 4AEZC 4M7CA 4JL0A 3V79K 3FEXA 1ZU2A 2L0IA 2LNIA 3TWXA 1VDYA 4WNEA 3MKQB 3ZU7B 3S2AA 4PS7A 1JWFA 3SD5A 1H6KA 1AWCB 4J7WA 3T8KA 2IOLA 2ZIRA 3ULYA 3NZSA 1IQRA 4TXQA 1H6OA 1ELWA 4DJAA 4B8CB 2XZTG 1MHQA 3QDNA 4FJZA 4LERA 4LCTA 4NURA 4FLBA 4R7LA 3ZNGA 2IO2C 5T8IA 2GRNB 4HRMB 3CVLA 3PZ3A 1K1BA 1OWNA 3RRNB 2VGXA 2WXRA 4N5QA 3PUJA 3CKBA 4JHJA 3DXMG 3B7BA 2FI7A 2VYIA 5KNGA 3JYSA 5FJYA 3RU0A 1TNUA 2DBAA 2WXQA 2LAIA 4GTOA 4A1SA 3E30A 4O6FA 4G1TA 3FUHA 3EU5A 3O4ZA 5LP0A 3TG4A 3SGHA 2RD0A 1NP7A 4GZ5A 1JUQA 4U8YD 3F6QA 1H2UA 2WXMA 3FP3A 4OAVB 2FBNA 3SHFA 1U3DA 2XGSA 5CHEE 2V0PA 3S7FA 4CDRA 1KPSB 1E8ZA 3PREA 4EPZA 1OCZE 4GTVA 5BXOA 3FTXA 3HXEA 5LCWJ 5CERB 2WMOA 3KAEA 2CG2A 4U07A 3L08A 3QOUA 4J0UA 3MX3A 3VLFA 2MOWA 3LY8A 5EIDA 5FT9A 4ATGA 2VTBB 4K5BA 4U96D 3EDTB 4XEIG 3LJ3A 4I6GA 3DPDA 4GA2A 3SF4A 2HYZA 2XENA 2PL2A 4RLYA 3PZ2A 4JA9A 3U3WA 3RK6A 1SW6A 3DRAA 4L2LA 3D3MA 2VGYA 1S63A 3UUXA 3PNTB 2QY7A 2R5SA 4A3VA 1N0RA 3ONKA 4DLQA 2YHEA 4N2SA 4UWGA 3Q7FA 5DBKA 1BI7B 4FJYA 3L17A 3JCKC 3UM2A 3NF1A 3ULEG 4BX9A 4AIFA 3ZKJA 2WXKA 3HRAA 1BD8A 1NI1A 1KZPA 1A17A 4YDOA 2IOSA 2KXPC 3R7RA 3U64A 3CHRA 2FO1E 2XRYA 4WNGA 4CDMA 1G3NB 3U9WA 1HH8A 3C3RA 4GAAA 2EILE 2X6KA 1OWLA 3KD7A 4LEUA 4C9BB 3HXBA 3QC1A 1RW2A 4BETA 3NBNB 1TN6A 2XQ0A 3SI5A 3AAAC 4GYOA 3HHMA 3LDZA 3DEOA 4MRUA 2IJGX 3Q9UC 5BW8C 2QYUA 3OXFA 5ANRA 3FULA 4LNGA 2AJAA 1E90A 5A6CA 3AU5A 3CGHA 1K8KG 4DX6D 4Z68A 3AU4A 3B7UX 1U3CA 2X3MA 1FT2A 2KM4A 1MQSA 3W9GA 5AQ7A 2Y0BG 2KBXA 3Q49B 3ZYLA 3CK9A 1TR4A 1LD7A 2X6HA 3UINC 3IEGA 3DWLG 2GGFA 4I2WA 4N2QA 3B7SA 3GW4A 5E76A 2A5EA 4KYOB 4B8AA 1OXJA 2WXJA 5LCWC 4KBQA 2WXIA 2J08A 2OEWA 4DI3A 1E96B 5B1AE 1S0PA
chains in the Genus database with same CATH topology
2I9CA 4AOFA 4BWRA 3ZYMA 2Q7FA 3T5XA 3MKQA 4AV7A 4NQ0A 1QZ2A 3S7JA 2I1KA 4DI4A 3FTZA 3LXUX 4RVBA 2L6JA 3FUNA 3ESLA 5J90A 3CSFA 1PY1A 4GMLA 2J07A 3QWPA 4AM9A 2KC7A 1TJCA 3RRMB 4CDNA 3FH5A 3ZVVA 2CFZA 2E0IA 4EZKA 4AVXA 2XGOA 2V5FA 2XEVA 4XI0A 5HI7A 3TGOA 1UN9A 5FTPA 4AY5A 4U04A 4N3AA 4ANVA 3CVNA 4WNDA 3T5VA 4XX5A 1HX8A 1HF8A 3G2VA 3ZYKA 1X5BA 5T4YA 5G2NA 3ZYQA 4CGWA 2FO7A 1UJKA 4Y6WA 4BT8A 4JA7A 1Z6TA 3O48A 3FWVA 5AJDA 1UN8A 2WMNA 5C2YA 4D10C 5FQ8A 3IHVA 4UWKA 3VTYA 3PEVB 1Y6IA 3LY7A 1FCHA 4G23A 4WWNA 3T8MA 1ELRA 4JZYA 4MKTA 2A4ZA 4E6HA 1DNPA 1HS6A 1PC2A 4JC8A 2OOEA 3QB2A 2E2EA 2J9QA 1IHGA 4AJWA 1WAO1 3AS5A 3ZGQA 2HM8A 2WPVA 2Y3AA 3APDA 3PS6A 4MLPA 4EZJA 4CCAA 2R59A 4J6IA 3D9JA 5FZRA 4H7YA 3ENEA 1HFAA 4FA6A 2OV8A 4B0ZA 4H7XA 4ILGA 2CG3A 4C0MA 5CCMA 2NC9A 3LYAA 5CMYA 3ZHEA 3PE4A 4XKCA 4URKA 3Q15A 3TXNA 4FP7A 4OVUA 2VQ2A 3S7DA 4KMOA 4NACA 3GZSA 1XNFA 4KXKB 2XGMA 3MZLB 4GZ3A 4MS6A 4Q96A 1H19A 2YNQA 3CVYA 3C98A 2YHCA 4L1BA 2GW1A 5AYWD 3FUKA 5ARFA 3UMVA 2WQ7A 1EDUA 3KEZA 4U0UA 5EX3A 4U8HA 3OTNA 2WQ6A 5G04C 3TJPA 4HOQA 5ANLA 5T3RA 5AJLA 5BV1A 2KCKA 4V3IA 4AY6A 1ZBPA 3EIJA 2V4LA 5E75A 4UQYA 1IQUA 4EQFA 5A23A 3G2UA 5FZQA 1XGWA 1HG2A 1UJJA 2EQXA 2V8SE 3D9OA 3G2TA 1NZNA 3Q5MA 3CHPA 4GA0A 4I17A 4I9CA 3B13A 4HLEA 2C2LA 2WM9A 3LEWA 1H2TC 2UY1B 3EIQC 3CR3A 4IULA 4B94A 4XI9A 1TJFA 4FLHA 2WB2A 2XPZA 2KCVA 4U63A 4ABNA 5FQ7A 3MJWA 4WWOA 3VLDA 3ASHA 4EZLA 2UY1A 3QWWA 3LVQE 3Q4AB 4F7AA 4ACLA 5KJKA 3LVRE 4JEUA 2WVIA 4W9RA 4AP2A 2X38A 2ONDA 4UI9C 4JEHA 4ILIA 5EKQD 3SBSA 5D0OD 4N5CA 3P1UA 4AEZC 3FH8A 3QARA 2I6HA 3MV2B 4JL0A 3UT4A 3LS8A 4HFGA 4ANUA 1DVPA 1GW6A 3ML8A 3U4TA 3CK8A 3Q47B 4JVSA 3L13A 2XHEA 3I4GA 1KT0A 2X6FA 3FUIA 3FEXA 4UQXA 3UT8A 2KZTA 1ZU2A 3ONLA 4OYSA 3SFZA 3HVEA 2L0IA 1SZAA 4HOTA 2LNIA 4GCOA 1NA0A 3APFA 3GYZA 2DCPA 3AS4A 4KT6B 2WXLA 1VDYA 1OWOA 3EHMA 3MA5A 4WNEA 3MKQB 3S2AA 1OWMA 4PS7A 1JWFA 3I5PA 3SD5A 4HS2A 4KVMA 3QAQA 4EBAA 3FDHA 5JHBA 1H6KA 4JPSA 5BV0A 3B7RL 1UG3A 2IOLA 1WY6A 2XRZA 2J4DA 3NZSA 1KLXA 1IQRA 4JHKA 3RO2A 1ELWA 4DJAA 2AVPA 4B8CB 4G25A 3CLJA 4GA1A 1MHQA 3CV0A 3QDNA 4FJZA 4M3OA 3CVWA 4LERA 3CHOA 4IN3B 4LCTA 4NURA 3EHNA 4KZ0A 4FLBA 4R7LA 5G05J 2PZIA 4HXIA 5T8IA 3FTWA 5DIZA 2J4BA 3CVLA 4EECA 2JLBA 3NQPA 3D9PA 1PAQA 1HE8A 3LPZA 2PQNA 1ELKA 2XCBA 4XKBA 1N52A 2VGXB 2XPIA 2VSOE 3DBSA 3FTVA 3JQ0A 2LO6A 3FU0A 1QNFA 3MV3B 3WXXA 1OWNA 5LOZA 3N71A 2ZU6B 4HOUA 2VGXA 3RRNB 4GB9A 2WXRA 2AXVA 4DK5A 5BPPA 3UPVA 4PS3A 3ASDA 3PH0C 1HG5A 4TUUA 2FEZA 3PUJA 1KT1A 3ZHEB 4PDXA 2FF4A 3CKBA 4JHJA 4N39A 1NA3A 3R9AB 1IYGA 4APFA 4GZDA 2FI7A 3L54A 2VYIA 3JYSA 5BNWA 4HORA 4PH4B 5FJYA 3HDXA 3RU0A 3HYMB 5KJNA 4I6EA 2DBAA 1W3BA 3PVLA 4GCNA 2PM7A 2RG8A 1H0AA 2WXQA 3KS2A 3ULQA 2WXPA 2C0MA 3CKCA 4Y6CA 3EJNA 3PRZA 4GPKA 2LAIA 2CHWA 3D9MA 4L23A 3FUJA 3GZ2A 2UWJG 2L9BA 1UW4B 4FU3A 1EF1C 4G24A 4PS8A 4A1SA 4A3TA 5G55A 3APCA 1SZ9A 4O6FA 2KATA 2IU1A 4I1OB 3FY4A 4G1TA 3R7QA 2YINA 2PM6A 4I1MA 5FZSA 3UT7A 3FUHA 3TG5A 2I2OA 3O4ZA 4ACKA 1B89A 3ZN3A 3FTYA 5LP0A 3FU3A 4JHRA 3TG4A 3UX4A 1EYHA 3CK7A 2RD0A 1NP7A 3SGHA 4U0ZA 4UI9J 3ESKA 5FWQA 4Q69A 4GZ5A 1JUQA 4RG9A 4UWFA 3CQCB 4Q94A 1H2UA 2WXMA 3FP3A 3B7TA 4FC8A 3RKVA 5M72A 3LCAA 2FBNA 3SHFA 2QFCA 3RO3A 4UI9K 1L5JA 1U3DA 4XIFA 4DLOA 4RSYA 4DPRA 3ZPJA 4BTAA 4EBAG 1E7UA 2XGSA 5CHEE 2V0PA 4GMJA 2AW6A 1JWGA 4YVQC 3S7FA 2LAHA 1HZ4A 3CQGB 2X6JA 4CDRA 4BFRA 3G2SA 1E8ZA 3PREA 3RRUA 4N3BA 5KCMA 5JHAA 2M63A 4G26A 2KZTB 4FHKA 4EPZA 2OVFA 3HVEB 5ENNA 1WM5A 5AENA 3FTXA 5KJLA 5LCWJ 4CGVA 4NRHB 4N3CA 4L2YA 2WMOA 1EPUA 3KAEA 3I3NA 4WNFA 2CG2A 4U07A 1FVFA 3L08A 3QOUA 2J09A 3MX3A 4J0UA 3VLFA 3FFLA 4C0EA 2MOWA 1E8WA 3LY8A 1Y8MA 3QNKA 3TXMA 5FT9A 4ATGA 3CEQA 3PZDA 3TAXA 3UQ3A 2IFUA 2P58C 3CIAA 3TL5A 4APOA 2VTBB 4P29A 4A1GA 5FQ6A 5BT1A 3EDTB 4F1SA 4ME2A 3LJ3A 2VTBA 4I6GA 4I1AA 3DPDA 4GA2A 3SF4A 1E8XA 4GU5A 2HYZA 4KVOA 5LFAA 4RG6A 3PEUB 2X6IA 3CSTA 3ZIMA 4CEMA 3CVVA 4G11A 2WQHA 2PL2A 4J8SA 4PUCA 4GZCA 1LF8A 1Z3YA 4BT9A 4JA9A 3U3WA 3MYVA 3RK6A 2NSZA 2OVBA 5ARGA 2MHKA 3FHEA 5A7DB 3ML9A 3CVQA 3BG0B 4L2LA 3D3MA 2VGYA 5JJ7A 1HXIA 4FHJA 4J8FA 3RIBA 2IF4A 4GYWA 1E7VA 3D9NA 3UUXA 3SZ7A 3IKOB 2R17C 3FTUA 3PNTB 4KZCA 2QY7A 3NZUA 3OXGA 4QFVA 4K03A 5HQ8A 1Z3XA 1JPLA 2HR2A 2L0TB 5LX8A 3AS8A 4E85A 5C1DA 2R5SA 4UWHA 3OXLA 1TEZA 4A3VA 3FUEA 1OUVA 4F53A 4B89A 4HOSA 4BTBA 3D9KA 3FEYA 3URZA 4YVOA 3RJVA 3ONKA 4DLQA 2LSVA 3PUKA 3ZFWA 2CHZA 2GRLA 2YHEA 4GYYA 5BUZA 3L22A 3MEKA 4N2SA 3ASGA 4HVBA 4UWGA 3ZXSA 5FQ4A 3ZW3A 3P2BA 3FH7A 5DBKA 5CMWA 4FJYA 3L17A 2A5UA 2LSUA 2XCCA 5G05C 2XPYA 3JCKC 1FVHA 2VJ8A 3NF1A 4K0RA 5G04J 3FU5A 3SNXA 4BX9A 3I4RB 4AIFA 2NXPA 2WXOA 2AXUA 4A55A 2WXKA 2YQ8A 1OWPA 3SBTB 3GZ1A 4IRUA 4CT0A 3VLEA 5AIJA 2AXZA 3L16A 1A17A 3JQ1A 1HU3A 2IOSA 3MKRA 4BY6A 2GRMA 3R7RA 1HO8A 3U64A 3CHRA 2XRYA 3E4BA 4LUNU 4WNGA 5KJMA 3CVXA 4I43A 4CDMA 3D9LA 3U9WA 1HH8A 1E8YA 4GAAA 3FUDA 3QWVA 4XZ4A 2C0LA 4I6JA 4F3VA 2X6KA 3FUFA 1OWLA 3BEEA 3CHSA 3D9IA 3PNLB 4YNDA 4ANXA 3KD7A 4LEUA 4WAFA 4ANWA 4BX8A 4C9BB 3QC1A 1H2VC 2FULA 2VSNA 2XQ0A 3SI5A 4GYOA 3ASFA 3HHMA 3JUIA 4G2VA 5J08A 3IV0A 3LDZA 3FU6A 1SQMA 4I2ZA 4MRUA 3ZRHA 5EDSA 3CVUA 2BTDA 3IBEA 1BPOA 2CHXA 2IJGX 3OAWA 3VTXA 3G2WA 1INZA 4OVVA 3IHYA 4AXHA 2JEKA 3QKYA 3PDNA 5BW8C 2ILRA 4UQZA 3OXFA 5ANRA 2J49A 4FULA 3FULA 4BSXA 2PQRA 5CCLA 1E90A 4JXTA 5A6CA 2WXHA 3AU5A 2VSXE 4U0SA 1P5QA 3CGHA 3K9IA 3LKUA 5JJ6A 2MRIA 4UWLA 4FADA 2I1JA 2DIWA 2Y4UA 3AU4A 1QQEA 3B7UX 3CHMA 3QJZA 4WWPA 1U3CA 2X3MA 1N54A 4LRZA 2KM4A 4I9EA 1MQSA 4JW1A 2Y4TA 5EX0A 3ZEFA 2HO1A 2CFUA 2WXGA 3Q49B 4IYPA 3ZYLA 2BF0X 4CRWA 5JJTA 3CK9A 1YA0A 3CVPA 3MGBA 3PE3A 4TV3A 2IONA 4XE0A 2X6HA 3QK0A 2AWIA 3IEGA 3HIZA 4WUYA 2GGFA 2KCLA 2WXNA 4I2WA 3U66A 4N2QA 3BG1B 4L7TA 3MCXA 3S7BA 2VSYA 2WXFA 3CHQA 4TRQA 4CT4A 3B7SA 3GW4A 3LY9A 5E76A 4KYOB 4B8AA 5D0QD 2WXJA 5LCWC 4KBQA 2IQCA 3L6AA 3FTSA 2WXIA 4J8EA 2J08A 4J8DA 4DI3A 4GZ6A 3FUMA 1E96B 4ILHB 1S0PA 2BUGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IU1 A;  3D3M A;  4GMJ A;  4LUN U;  5ANR A;  1PAQ A;  4CRW A;  2ION A;  1H6K A;  2I2O A;  1N52 A;  2KZT B;  1H2T C;  2VSO E;  3EIQ C;  4GML A;  4IUL A;  1UG3 A;  2IOL A;  2GGF A;  2VSX E;  2RG8 A;  3FEX A;  2KZT A;  4C9B B;  2ZU6 B;  4JHK A;  4CEM A;  4CT4 A;  1H2V C;  2FUL A;  4B8A A;  4B89 A;  4B8C B;  3JUI A;  1N54 A;  3FEY A;  3L6A A;  1UW4 B;  2HM8 A;  1H2U A;  3EIJ A;  3RK6 A;  1HU3 A;  2IOS A;  2NSZ A;  4JHJ A; 
#chains in the Genus database with same CATH topology
 1Q2Z A;  3ZYM A;  2Q7F A;  3T5X A;  4HNA D;  4DI4 A;  3FTZ A;  3LXU X;  3FUN A;  3CSF A;  4GML A;  2J07 A;  2RKK A;  3ZVV A;  4LG6 A;  4AVX A;  2V5F A;  2XEV A;  3E37 A;  1NL4 A;  4WND A;  3T5V A;  2DYR E;  4XX5 A;  1HX8 A;  1X5B A;  5T4Y A;  5CRU A;  2FO7 A;  4Y6W A;  4BT8 A;  1Z6T A;  5FQ8 A;  3VTY A;  3T8M A;  4JZY A;  5AAR A;  1HS6 A;  1N11 A;  1AP7 A;  3NOC D;  5FIO A;  2Y3A A;  2WPV A;  4MLP A;  4EZJ A;  4J6I A;  3RSE G;  5FZR A;  4H7Y A;  4B0Z A;  5CCM A;  2NC9 A;  3LYA A;  3ZHE A;  3PE4 A;  4XKC A;  3TXN A;  4OVU A;  4NAC A;  2XGM A;  4GZ3 A;  2ZXW E;  5AYW D;  3FUK A;  3UMV A;  2JAB A;  5EX3 A;  5T3R A;  3IXE A;  5BV1 A;  4V3I A;  4O1P A;  2V4L A;  3G2T A;  3B13 A;  2C2L A;  5AAO A;  4GTR A;  3V31 A;  1TJF A;  2KCV A;  4ABN A;  4EZL A;  3VLD A;  3ASH A;  2ZGG A;  3QWW A;  2ETA A;  3Q4A B;  4F7A A;  3T9K A;  3LVR E;  2F0Y A;  4W9R A;  2X38 A;  4UI9 C;  5EKQ D;  3FH8 A;  1V55 E;  1GW6 A;  3ML8 A;  3Q47 B;  3Q78 A;  3L13 A;  3E32 A;  3I4G A;  3UKR G;  3ONL A;  3TWQ A;  1TYQ G;  3EHM A;  3MA5 A;  3ISM C;  3EHQ A;  3UTM A;  2RFM A;  1IXV A;  5EYP F;  1WY6 A;  1KLX A;  3RO2 A;  4G25 A;  3CVW A;  3CHO A;  3EHN A;  3D9P A;  1PAQ A;  1D8D A;  1ELK A;  2XCB A;  2DZO A;  3DST A;  4JB8 P;  2LO6 A;  1QNF A;  3WXX A;  5LOZ A;  3N71 A;  2AXV A;  5BPP A;  3D9H A;  2FEZ A;  1KT1 A;  3ZHE B;  4PDX A;  2FF4 A;  4N39 A;  3UKU G;  1IYG A;  5CRV A;  2P2C P;  4K5C A;  3LJN A;  5ITZ F;  1S64 A;  3HDX A;  4TUM A;  4GCN A;  3ULQ A;  3KS2 A;  3ABL E;  4Y6C A;  1WG0 A;  3EJN A;  2ETB A;  5D66 A;  3FUJ A;  4FU3 A;  4G24 A;  4PS8 A;  2IU1 A;  3FY4 A;  4HB5 A;  2YIN A;  3BUA A;  2PM6 A;  4I1M A;  5FZS A;  4UUC A;  3UT7 A;  2EIJ E;  4BER A;  1B89 A;  2PNN A;  1MJ0 A;  3UX4 A;  1EYH A;  3CK7 A;  5FWQ A;  1BI8 B;  4RG9 A;  3CQC B;  4Q94 A;  4GTS A;  3B7T A;  5M72 A;  2OCC E;  3UM1 A;  2QFC A;  4UI9 K;  4EBA G;  3PZ4 A;  3UIP C;  2X6J A;  3G2S A;  4N3B A;  3DEP A;  2M63 A;  2OVF A;  4N3C A;  4L2Y A;  4WNF A;  3EUV A;  3JXI A;  2J09 A;  2H6F A;  1E8W A;  3SFX A;  1Y8M A;  3AJI A;  3TXM A;  3TAX A;  3TL5 A;  4P29 A;  4A1G A;  5FQ6 A;  1DCE A;  5AN8 A;  2VTB A;  4KVO A;  3Q75 A;  3ZIM A;  4CEM A;  2GRO B;  4G11 A;  2WQH A;  4J8S A;  4PUC A;  4GZC A;  5ENP D;  1LF8 A;  1BLX B;  1N4R A;  1Z3Y A;  3MYV A;  2XEH A;  5ARG A;  3FHE A;  3CVQ A;  3JXJ A;  3BG0 B;  5JJ7 A;  4U8V D;  4GYW A;  3NZU A;  4K03 A;  1JPL A;  5C1D A;  1OUV A;  4F53 A;  4B89 A;  5EIL A;  3Q79 A;  3RJV A;  2LSV A;  3ZFW A;  1JCS A;  1IKN D;  4GYY A;  2H6G A;  5BUZ A;  3ASG A;  4HVB A;  3ZW3 A;  2R05 A;  2A5U A;  2LSU A;  2P9U G;  5JA4 D;  4NIK A;  3I4R B;  1O1T A;  2NXP A;  2LUH A;  3GZ1 A;  2L6B A;  1N4S A;  5AIJ A;  3L16 A;  3HG0 D;  3JQ1 A;  5ENQ D;  4JD2 G;  5KJM A;  3V2O A;  3FUD A;  3HXC A;  3KEA A;  4F3V A;  4YND A;  4ANW A;  4BX8 A;  3E34 A;  2QZA A;  3ASF A;  4G2V A;  1SQM A;  3ZRH A;  2BTD A;  1N9A A;  3VTX A;  4OVV A;  3SFY A;  2ILR A;  3C5R A;  4HRN A;  3DPY A;  1P5Q A;  4UWL A;  2DIW A;  1QQE A;  1N54 A;  4LRZ A;  4JW1 A;  2Y4T A;  5EX0 A;  3ZEF A;  5B1B E;  2CFU A;  4IYP A;  2BF0 X;  1SA4 A;  3CVP A;  4XE0 A;  2AWI A;  2KCL A;  4GTT A;  4L7T A;  2VSY A;  3CHQ A;  4TRQ A;  1H6P A;  3KSQ A;  4J8E A;  3FTS A;  4J8D A;  3DSU A;  4GZ6 A;  2AXU A;  2H6I A;  2I1K A;  3ESL A;  5J90 A;  3L9T A;  3RRM B;  2EIN E;  2ZGD A;  2CFZ A;  2E0I A;  4EZK A;  1UN9 A;  3Q73 A;  3DXK G;  4ANV A;  4LSZ E;  5G2N A;  1UJK A;  1K1A A;  4JA7 A;  2WMN A;  4G23 A;  1ELR A;  4MKT A;  1PC2 A;  2OOE A;  5AQ9 A;  1IHG A;  4ZFH A;  4F6R D;  2HM8 A;  3APD A;  1N94 A;  4ATZ D;  3SO8 A;  4FA6 A;  2OV8 A;  3EU9 A;  4H7X A;  1N4P A;  1TN7 A;  3Q15 A;  2ZIS A;  2VQ2 A;  5KNH D;  4G8L A;  3S7D A;  4KMO A;  3GZS A;  1XNF A;  1Z5S C;  4Q96 A;  2J8S D;  3C98 A;  2GRR B;  2YHC A;  2GW1 A;  4L1B A;  5CBO A;  2WQ7 A;  3KEZ A;  4U0U A;  4U8H A;  5B3S E;  4O60 A;  4AY6 A;  3EIJ A;  2EIK E;  4BSZ B;  1IQU A;  3G2U A;  1RZ4 A;  1XGW A;  3V30 A;  4I9C A;  2UY1 B;  3EIQ C;  3CR3 A;  3C3Q A;  4XI9 A;  2WB2 A;  5FQ7 A;  1TNY A;  4ACL A;  1O5M A;  4B93 B;  5D0O D;  2I6H A;  3MV2 B;  4HFG A;  1DVP A;  3U4T A;  1MYO A;  3CK8 A;  4JVS A;  4DX1 A;  1KT0 A;  3FUI A;  3UT8 A;  2KZT A;  3TWS A;  4HOT A;  3AS4 A;  2XS1 A;  2NYJ A;  1OWM A;  4HLL A;  2V4H C;  3QAQ A;  2P9S G;  1YYH A;  3FDH A;  5BV0 A;  4HBD A;  2XRZ A;  1BU9 A;  2XEE A;  1S70 B;  1UOH A;  4M3O A;  3CV0 A;  4IN3 B;  2XS8 A;  4KZ0 A;  2ETC A;  2V5Q C;  5G05 J;  4HXI A;  3AG1 E;  1HE8 A;  4U95 D;  4XKB A;  1N52 A;  2XPI A;  2VSO E;  3DBS A;  3FTV A;  3MV3 B;  4HOU A;  2ZU6 B;  3TWW A;  4GB9 A;  4X8Q A;  4DK5 A;  4PS3 A;  3ASD A;  3PH0 C;  4TUU A;  3R9M A;  3R9A B;  4APF A;  4F1P A;  4GZD A;  5FIN A;  3L54 A;  1OY3 D;  4HOR A;  4PH4 B;  5KJN A;  4I6E A;  4MBG A;  3B95 A;  2PM7 A;  2C0M A;  3PRZ A;  2CHW A;  3DSW A;  4L23 A;  3GZ2 A;  2UWJ G;  1D8E A;  5G55 A;  1YMP A;  4I1O B;  3TG5 A;  3ZN3 A;  3FTY A;  3FU3 A;  4JHR A;  5CEA A;  4Q69 A;  1SVX A;  5KWD A;  4DLO A;  3ZPJ A;  4YVQ C;  4GMJ A;  4U7E B;  1JWG A;  1ZB1 A;  1HZ4 A;  3CQG B;  5KCM A;  2KZT B;  4NRH B;  1FVF A;  3FFL A;  3QNK A;  4OAU C;  3CEQ A;  3PZD A;  2P58 C;  3CIA A;  1KZO A;  4F1S A;  5CED B;  4GU5 A;  4RG6 A;  3PEU B;  1MX2 A;  4A63 B;  1HXI A;  4FHJ A;  4J8F A;  2IF4 A;  1E7V A;  3D9N A;  3WG7 E;  3SZ7 A;  3FTU A;  4QFV A;  5HQ8 A;  1Z3X A;  2L0T B;  2HR2 A;  3SQV A;  4C48 B;  3AS8 A;  3DSS A;  1TEZ A;  4HOS A;  4BTB A;  4TXP A;  4YDW A;  5AQA A;  3PUK A;  2GRL A;  3L22 A;  5FQ4 A;  3FH7 A;  5CMW A;  5G05 C;  2XCC A;  2XPY A;  2VJ8 A;  5G04 J;  4A55 A;  4J8Y A;  5JMN D;  1JCR A;  4IRU A;  2R02 A;  4CT0 A;  3VLE A;  2AXZ A;  1HU3 A;  2GRM A;  1HO8 A;  1X81 A;  3CVX A;  2F37 A;  1E8Y A;  4XZ4 A;  3QWV A;  1FPP A;  4ANX A;  3D9I A;  1DC2 A;  2VSN A;  1D9S A;  3JUI A;  5J08 A;  3HXD A;  3IV0 A;  5CEC B;  3FU6 A;  3CVU A;  3IBE A;  1IHB A;  2CHX A;  2JEK A;  2QYJ A;  2P9N G;  3PDN A;  3UM3 A;  4UQZ A;  2J49 A;  1FT1 A;  4BSX A;  2PQR A;  2GRQ B;  5CCL A;  5HS0 A;  3K9I A;  5JJ6 A;  4FAD A;  2Y4U A;  3CHM A;  3QJZ A;  2WXG A;  3ASN E;  3ZUV B;  4CRW A;  3MGB A;  2ION A;  3QK0 A;  3HIZ A;  2WXN A;  4GTQ A;  3BG1 B;  1YCS B;  3MCX A;  3S7B A;  2WXF A;  3NB2 A;  3Q7A A;  3LY9 A;  2IQC A;  3L6A A;  3FUM A;  4RQI A;  2BUG A;  3V2X A;  5EYL A;  4NQ0 A;  1QZ2 A;  4RVB A;  3J5Q B;  3QWP A;  1TJC A;  3EHR A;  3FH5 A;  2XGO A;  4XI0 A;  5HI7 A;  4N3A A;  3CVN A;  3SY2 A;  1QBQ A;  3G2V A;  4CGW A;  3O48 A;  5AJD A;  1UN8 A;  4D10 C;  4UWK A;  1A5E A;  3AG3 E;  3LY7 A;  2A4Z A;  1DNP A;  2P9L G;  4JC8 A;  4BES A;  3QB2 A;  2J9Q A;  1O1S A;  4AJW A;  1K3Z D;  3AS5 A;  3PS6 A;  4CCA A;  3D9J A;  5BXU A;  5CMY A;  1QYM A;  4FP7 A;  4HQD A;  4KXK B;  2XZD G;  3MZL B;  2YNQ A;  4K5A B;  1LD8 A;  2DYS E;  4GTM A;  1EDU A;  3HXF A;  5G04 C;  3TJP A;  4HOQ A;  5AJL A;  2KCK A;  1ZBP A;  4DX2 A;  4UQY A;  5A23 A;  5FZQ A;  1HG2 A;  1N4Q A;  1UJJ A;  2EQX A;  1U2V G;  4CZ2 D;  4HLE A;  2WM9 A;  3LEW A;  1H2T C;  4B94 A;  4IUL A;  4FLH A;  2XPZ A;  4GPM A;  3MJW A;  4WWO A;  2UY1 A;  4DX5 D;  2WVI A;  3C3O A;  1WDY A;  2OND A;  4ILI A;  3W9F A;  3P1U A;  3QAR A;  1TNB A;  3UT4 A;  3LS8 A;  5KBA A;  4ANU A;  1OCO E;  3TWU A;  2XHE A;  2X6F A;  4UQX A;  3ABM E;  4OYS A;  3SFZ A;  3HVE A;  1SZA A;  4GCO A;  1NA0 A;  2B6C A;  5ENR D;  5AQB A;  4DX7 D;  3APF A;  3GYZ A;  2DCP A;  4KT6 B;  4G8K A;  2WXL A;  4HI9 A;  1OWO A;  1OCC E;  3I5P A;  4TXR A;  4HS2 A;  4KVM A;  4EBA A;  2LXM A;  5JHB A;  4JPS A;  4YDY A;  3B7R L;  1UG3 A;  2J4D A;  4JHK A;  4DUI A;  4DRX E;  2AVP A;  3CLJ A;  4GA1 A;  3RAU A;  3UIO C;  2PZI A;  3FTW A;  5DIZ A;  2J4B A;  4EEC A;  2JLB A;  3NQP A;  2Y1L E;  3LPZ A;  2PQN A;  2VGX B;  3BQO A;  3JQ0 A;  3FU0 A;  4QQI A;  4HI8 A;  3UPV A;  1TNO A;  5HRY A;  3AG4 E;  1HG5 A;  2Y69 E;  1NA3 A;  3NAW A;  5ENT D;  5BNW A;  3HYM B;  5CBN A;  1W3B A;  3PVL A;  2RG8 A;  1H0A A;  2WXP A;  3CKC A;  5EIB E;  4GPK A;  2DZN A;  3KSL A;  3D9M A;  2L9B A;  1UW4 B;  1EF1 C;  4A3T A;  3APC A;  1SZ9 A;  2KAT A;  2OEV A;  3R7Q A;  1MX6 A;  2EIM E;  4HRL A;  2I2O A;  4ACK A;  2R2L A;  2VGE A;  4U0Z A;  4UI9 J;  3ESK A;  4UWF A;  3UM0 A;  4FC8 A;  3RKV A;  3BU8 A;  3LCA A;  3RO3 A;  1L5J A;  2IY0 C;  4XIF A;  1N0Q A;  4RSY A;  4DPR A;  3ASO E;  4BTA A;  1E7U A;  2AW6 A;  2LAH A;  4BFR A;  3RRU A;  5JHA A;  4G26 A;  4FHK A;  3HVE B;  5ENN A;  1WM5 A;  5AEN A;  5KJL A;  4CGV A;  1EPU A;  3I3N A;  4LNB A;  4C0E A;  2P9I G;  3Q9N C;  3UQ3 A;  2IFU A;  4APO A;  4GTP A;  3ZXP A;  5BT1 A;  4ME2 A;  4I1A A;  1E8X A;  5LFA A;  2F8Y A;  1MZC A;  2X6I A;  3CST A;  3CVV A;  2HE0 A;  2B0O E;  5EN5 D;  4BT9 A;  2NSZ A;  2OVB A;  5A7D B;  2MHK A;  3ML9 A;  3DSX A;  2P9P G;  4ZHB A;  3DSV A;  3RIB A;  1DCQ A;  2GRP B;  3IKO B;  2R17 C;  4KZC A;  3OXG A;  2F8X K;  5LX8 A;  4E85 A;  3J5P A;  4UWH A;  3OXL A;  3FUE A;  4EHM A;  3D9K A;  3FEY A;  5HKP A;  3URZ A;  4YVO A;  2CHZ A;  3MEK A;  2BKG A;  3ZXS A;  2QC9 A;  3P2B A;  1FVH A;  4K0R A;  3FU5 A;  3SNX A;  2WXO A;  2YQ8 A;  1OWP A;  4GMR A;  1LTX A;  3SBT B;  2BED A;  3MKR A;  4BY6 A;  2P9K G;  3E4B A;  4LUN U;  4I43 A;  1O1R A;  3D9L A;  2H6H A;  2C0L A;  4I6J A;  3ABK E;  3FUF A;  3BEE A;  3CHS A;  3PNL B;  3TWR A;  2RFA A;  4WAF A;  2BKK B;  1H2V C;  2FUL A;  2DVW A;  4I2Z A;  5EDS A;  3OAW A;  1INZ A;  1BPO A;  1NFI E;  3G2W A;  3IHY A;  4AXH A;  3QKY A;  4FUL A;  1V54 E;  3JUE A;  4JXT A;  2WXH A;  2VSX E;  4U0S A;  3LKU A;  2MRI A;  2I1J A;  4WWP A;  5D2M C;  5ENS D;  3AG2 E;  4I9E A;  4L9P A;  1OT8 A;  2HO1 A;  4O1O A;  2LXL A;  5JJT A;  1YA0 A;  3PE3 A;  4BEP A;  4TV3 A;  4YDE A;  4WUY A;  3U66 A;  3TWV A;  1OCR E;  4CT4 A;  5D0Q D;  4ILH B;  2I9C A;  4AOF A;  4BWR A;  3MKQ A;  4AV7 A;  3NOG D;  3S7J A;  2R03 A;  2L6J A;  1PY1 A;  1N95 A;  4AM9 A;  2KC7 A;  4CDN A;  1TN8 A;  3TGO A;  5FTP A;  4AY5 A;  3X2Q E;  4U04 A;  1HF8 A;  3ZYK A;  3ZYQ A;  1SA5 A;  1MX4 A;  3PZ1 A;  3FWV A;  5C2Y A;  3IHV A;  3PEV B;  1Y6I A;  1FCH A;  4WWN A;  2IEJ A;  4E6H A;  4CYM D;  2E2E A;  2MYO A;  1WAO 1;  3ZGQ A;  5ENO D;  3UI2 A;  2R59 A;  3ENE A;  1HFA A;  3C72 A;  4ILG A;  2CG3 A;  5H7P A;  4LNU D;  4C0M A;  4URK A;  3L82 A;  4MS6 A;  1H19 A;  3CVY A;  5ARF A;  3OTN A;  2WQ6 A;  5ANL A;  2DWZ A;  5E75 A;  4EQF A;  1TNZ A;  5IY5 E;  2V8S E;  3D9O A;  3Q5M A;  1NZN A;  4I17 A;  3CHP A;  4GA0 A;  3UXG A;  3TWT A;  3E33 A;  4U63 A;  1JCQ A;  3LVQ E;  5KJK A;  2IO3 C;  4JEU A;  4AP2 A;  4JEH A;  3SBS A;  4N5C A;  4AEZ C;  4M7C A;  4JL0 A;  3V79 K;  3FEX A;  1ZU2 A;  2L0I A;  2LNI A;  3TWX A;  1VDY A;  4WNE A;  3MKQ B;  3ZU7 B;  3S2A A;  4PS7 A;  1JWF A;  3SD5 A;  1H6K A;  1AWC B;  4J7W A;  3T8K A;  2IOL A;  2ZIR A;  3ULY A;  3NZS A;  1IQR A;  4TXQ A;  1H6O A;  1ELW A;  4DJA A;  4B8C B;  2XZT G;  1MHQ A;  3QDN A;  4FJZ A;  4LER A;  4LCT A;  4NUR A;  4FLB A;  4R7L A;  3ZNG A;  2IO2 C;  5T8I A;  2GRN B;  4HRM B;  3CVL A;  3PZ3 A;  1K1B A;  1OWN A;  3RRN B;  2VGX A;  2WXR A;  4N5Q A;  3PUJ A;  3CKB A;  4JHJ A;  3DXM G;  3B7B A;  2FI7 A;  2VYI A;  5KNG A;  3JYS A;  5FJY A;  3RU0 A;  1TNU A;  2DBA A;  2WXQ A;  2LAI A;  4GTO A;  4A1S A;  3E30 A;  4O6F A;  4G1T A;  3FUH A;  3EU5 A;  3O4Z A;  5LP0 A;  3TG4 A;  3SGH A;  2RD0 A;  1NP7 A;  4GZ5 A;  1JUQ A;  4U8Y D;  3F6Q A;  1H2U A;  2WXM A;  3FP3 A;  4OAV B;  2FBN A;  3SHF A;  1U3D A;  2XGS A;  5CHE E;  2V0P A;  3S7F A;  4CDR A;  1KPS B;  1E8Z A;  3PRE A;  4EPZ A;  1OCZ E;  4GTV A;  5BXO A;  3FTX A;  3HXE A;  5LCW J;  5CER B;  2WMO A;  3KAE A;  2CG2 A;  4U07 A;  3L08 A;  3QOU A;  4J0U A;  3MX3 A;  3VLF A;  2MOW A;  3LY8 A;  5EID A;  5FT9 A;  4ATG A;  2VTB B;  4K5B A;  4U96 D;  3EDT B;  4XEI G;  3LJ3 A;  4I6G A;  3DPD A;  4GA2 A;  3SF4 A;  2HYZ A;  2XEN A;  2PL2 A;  4RLY A;  3PZ2 A;  4JA9 A;  3U3W A;  3RK6 A;  1SW6 A;  3DRA A;  4L2L A;  3D3M A;  2VGY A;  1S63 A;  3UUX A;  3PNT B;  2QY7 A;  2R5S A;  4A3V A;  1N0R A;  3ONK A;  4DLQ A;  2YHE A;  4N2S A;  4UWG A;  3Q7F A;  5DBK A;  1BI7 B;  4FJY A;  3L17 A;  3JCK C;  3UM2 A;  3NF1 A;  3ULE G;  4BX9 A;  4AIF A;  3ZKJ A;  2WXK A;  3HRA A;  1BD8 A;  1NI1 A;  1KZP A;  1A17 A;  4YDO A;  2IOS A;  2KXP C;  3R7R A;  3U64 A;  3CHR A;  2FO1 E;  2XRY A;  4WNG A;  4CDM A;  1G3N B;  3U9W A;  1HH8 A;  3C3R A;  4GAA A;  2EIL E;  2X6K A;  1OWL A;  3KD7 A;  4LEU A;  4C9B B;  3HXB A;  3QC1 A;  1RW2 A;  4BET A;  3NBN B;  1TN6 A;  2XQ0 A;  3SI5 A;  3AAA C;  4GYO A;  3HHM A;  3LDZ A;  3DEO A;  4MRU A;  2IJG X;  3Q9U C;  5BW8 C;  2QYU A;  3OXF A;  5ANR A;  3FUL A;  4LNG A;  2AJA A;  1E90 A;  5A6C A;  3AU5 A;  3CGH A;  1K8K G;  4DX6 D;  4Z68 A;  3AU4 A;  3B7U X;  1U3C A;  2X3M A;  1FT2 A;  2KM4 A;  1MQS A;  3W9G A;  5AQ7 A;  2Y0B G;  2KBX A;  3Q49 B;  3ZYL A;  3CK9 A;  1TR4 A;  1LD7 A;  2X6H A;  3UIN C;  3IEG A;  3DWL G;  2GGF A;  4I2W A;  4N2Q A;  3B7S A;  3GW4 A;  5E76 A;  2A5E A;  4KYO B;  4B8A A;  1OXJ A;  2WXJ A;  5LCW C;  4KBQ A;  2WXI A;  2J08 A;  2OEW A;  4DI3 A;  1E96 B;  5B1A E;  1S0P A; 
#chains in the Genus database with same CATH homology
 2I9C A;  4AOF A;  4BWR A;  3ZYM A;  2Q7F A;  3T5X A;  3MKQ A;  4AV7 A;  4NQ0 A;  1QZ2 A;  3S7J A;  2I1K A;  4DI4 A;  3FTZ A;  3LXU X;  4RVB A;  2L6J A;  3FUN A;  3ESL A;  5J90 A;  3CSF A;  1PY1 A;  4GML A;  2J07 A;  3QWP A;  4AM9 A;  2KC7 A;  1TJC A;  3RRM B;  4CDN A;  3FH5 A;  3ZVV A;  2CFZ A;  2E0I A;  4EZK A;  4AVX A;  2XGO A;  2V5F A;  2XEV A;  4XI0 A;  5HI7 A;  3TGO A;  1UN9 A;  5FTP A;  4AY5 A;  4U04 A;  4N3A A;  4ANV A;  3CVN A;  4WND A;  3T5V A;  4XX5 A;  1HX8 A;  1HF8 A;  3G2V A;  3ZYK A;  1X5B A;  5T4Y A;  5G2N A;  3ZYQ A;  4CGW A;  2FO7 A;  1UJK A;  4Y6W A;  4BT8 A;  4JA7 A;  1Z6T A;  3O48 A;  3FWV A;  5AJD A;  1UN8 A;  2WMN A;  5C2Y A;  4D10 C;  5FQ8 A;  3IHV A;  4UWK A;  3VTY A;  3PEV B;  1Y6I A;  3LY7 A;  1FCH A;  4G23 A;  4WWN A;  3T8M A;  1ELR A;  4JZY A;  4MKT A;  2A4Z A;  4E6H A;  1DNP A;  1HS6 A;  1PC2 A;  4JC8 A;  2OOE A;  3QB2 A;  2E2E A;  2J9Q A;  1IHG A;  4AJW A;  1WAO 1;  3AS5 A;  3ZGQ A;  2HM8 A;  2WPV A;  2Y3A A;  3APD A;  3PS6 A;  4MLP A;  4EZJ A;  4CCA A;  2R59 A;  4J6I A;  3D9J A;  5FZR A;  4H7Y A;  3ENE A;  1HFA A;  4FA6 A;  2OV8 A;  4B0Z A;  4H7X A;  4ILG A;  2CG3 A;  4C0M A;  5CCM A;  2NC9 A;  3LYA A;  5CMY A;  3ZHE A;  3PE4 A;  4XKC A;  4URK A;  3Q15 A;  3TXN A;  4FP7 A;  4OVU A;  2VQ2 A;  3S7D A;  4KMO A;  4NAC A;  3GZS A;  1XNF A;  4KXK B;  2XGM A;  3MZL B;  4GZ3 A;  4MS6 A;  4Q96 A;  1H19 A;  2YNQ A;  3CVY A;  3C98 A;  2YHC A;  4L1B A;  2GW1 A;  5AYW D;  3FUK A;  5ARF A;  3UMV A;  2WQ7 A;  1EDU A;  3KEZ A;  4U0U A;  5EX3 A;  4U8H A;  3OTN A;  2WQ6 A;  5G04 C;  3TJP A;  4HOQ A;  5ANL A;  5T3R A;  5AJL A;  5BV1 A;  2KCK A;  4V3I A;  4AY6 A;  1ZBP A;  3EIJ A;  2V4L A;  5E75 A;  4UQY A;  1IQU A;  4EQF A;  5A23 A;  3G2U A;  5FZQ A;  1XGW A;  1HG2 A;  1UJJ A;  2EQX A;  2V8S E;  3D9O A;  3G2T A;  1NZN A;  3Q5M A;  3CHP A;  4GA0 A;  4I17 A;  4I9C A;  3B13 A;  4HLE A;  2C2L A;  2WM9 A;  3LEW A;  1H2T C;  2UY1 B;  3EIQ C;  3CR3 A;  4IUL A;  4B94 A;  4XI9 A;  1TJF A;  4FLH A;  2WB2 A;  2XPZ A;  2KCV A;  4U63 A;  4ABN A;  5FQ7 A;  3MJW A;  4WWO A;  3VLD A;  3ASH A;  4EZL A;  2UY1 A;  3QWW A;  3LVQ E;  3Q4A B;  4F7A A;  4ACL A;  5KJK A;  3LVR E;  4JEU A;  2WVI A;  4W9R A;  4AP2 A;  2X38 A;  2OND A;  4UI9 C;  4JEH A;  4ILI A;  5EKQ D;  3SBS A;  5D0O D;  4N5C A;  3P1U A;  4AEZ C;  3FH8 A;  3QAR A;  2I6H A;  3MV2 B;  4JL0 A;  3UT4 A;  3LS8 A;  4HFG A;  4ANU A;  1DVP A;  1GW6 A;  3ML8 A;  3U4T A;  3CK8 A;  3Q47 B;  4JVS A;  3L13 A;  2XHE A;  3I4G A;  1KT0 A;  2X6F A;  3FUI A;  3FEX A;  4UQX A;  3UT8 A;  2KZT A;  1ZU2 A;  3ONL A;  4OYS A;  3SFZ A;  3HVE A;  2L0I A;  1SZA A;  4HOT A;  2LNI A;  4GCO A;  1NA0 A;  3APF A;  3GYZ A;  2DCP A;  3AS4 A;  4KT6 B;  2WXL A;  1VDY A;  1OWO A;  3EHM A;  3MA5 A;  4WNE A;  3MKQ B;  3S2A A;  1OWM A;  4PS7 A;  1JWF A;  3I5P A;  3SD5 A;  4HS2 A;  4KVM A;  3QAQ A;  4EBA A;  3FDH A;  5JHB A;  1H6K A;  4JPS A;  5BV0 A;  3B7R L;  1UG3 A;  2IOL A;  1WY6 A;  2XRZ A;  2J4D A;  3NZS A;  1KLX A;  1IQR A;  4JHK A;  3RO2 A;  1ELW A;  4DJA A;  2AVP A;  4B8C B;  4G25 A;  3CLJ A;  4GA1 A;  1MHQ A;  3CV0 A;  3QDN A;  4FJZ A;  4M3O A;  3CVW A;  4LER A;  3CHO A;  4IN3 B;  4LCT A;  4NUR A;  3EHN A;  4KZ0 A;  4FLB A;  4R7L A;  5G05 J;  2PZI A;  4HXI A;  5T8I A;  3FTW A;  5DIZ A;  2J4B A;  3CVL A;  4EEC A;  2JLB A;  3NQP A;  3D9P A;  1PAQ A;  1HE8 A;  3LPZ A;  2PQN A;  1ELK A;  2XCB A;  4XKB A;  1N52 A;  2VGX B;  2XPI A;  2VSO E;  3DBS A;  3FTV A;  3JQ0 A;  2LO6 A;  3FU0 A;  1QNF A;  3MV3 B;  3WXX A;  1OWN A;  5LOZ A;  3N71 A;  2ZU6 B;  4HOU A;  2VGX A;  3RRN B;  4GB9 A;  2WXR A;  2AXV A;  4DK5 A;  5BPP A;  3UPV A;  4PS3 A;  3ASD A;  3PH0 C;  1HG5 A;  4TUU A;  2FEZ A;  3PUJ A;  1KT1 A;  3ZHE B;  4PDX A;  2FF4 A;  3CKB A;  4JHJ A;  4N39 A;  1NA3 A;  3R9A B;  1IYG A;  4APF A;  4GZD A;  2FI7 A;  3L54 A;  2VYI A;  3JYS A;  5BNW A;  4HOR A;  4PH4 B;  5FJY A;  3HDX A;  3RU0 A;  3HYM B;  5KJN A;  4I6E A;  2DBA A;  1W3B A;  3PVL A;  4GCN A;  2PM7 A;  2RG8 A;  1H0A A;  2WXQ A;  3KS2 A;  3ULQ A;  2WXP A;  2C0M A;  3CKC A;  4Y6C A;  3EJN A;  3PRZ A;  4GPK A;  2LAI A;  2CHW A;  3D9M A;  4L23 A;  3FUJ A;  3GZ2 A;  2UWJ G;  2L9B A;  1UW4 B;  4FU3 A;  1EF1 C;  4G24 A;  4PS8 A;  4A1S A;  4A3T A;  5G55 A;  3APC A;  1SZ9 A;  4O6F A;  2KAT A;  2IU1 A;  4I1O B;  3FY4 A;  4G1T A;  3R7Q A;  2YIN A;  2PM6 A;  4I1M A;  5FZS A;  3UT7 A;  3FUH A;  3TG5 A;  2I2O A;  3O4Z A;  4ACK A;  1B89 A;  3ZN3 A;  3FTY A;  5LP0 A;  3FU3 A;  4JHR A;  3TG4 A;  3UX4 A;  1EYH A;  3CK7 A;  2RD0 A;  1NP7 A;  3SGH A;  4U0Z A;  4UI9 J;  3ESK A;  5FWQ A;  4Q69 A;  4GZ5 A;  1JUQ A;  4RG9 A;  4UWF A;  3CQC B;  4Q94 A;  1H2U A;  2WXM A;  3FP3 A;  3B7T A;  4FC8 A;  3RKV A;  5M72 A;  3LCA A;  2FBN A;  3SHF A;  2QFC A;  3RO3 A;  4UI9 K;  1L5J A;  1U3D A;  4XIF A;  4DLO A;  4RSY A;  4DPR A;  3ZPJ A;  4BTA A;  4EBA G;  1E7U A;  2XGS A;  5CHE E;  2V0P A;  4GMJ A;  2AW6 A;  1JWG A;  4YVQ C;  3S7F A;  2LAH A;  1HZ4 A;  3CQG B;  2X6J A;  4CDR A;  4BFR A;  3G2S A;  1E8Z A;  3PRE A;  3RRU A;  4N3B A;  5KCM A;  5JHA A;  2M63 A;  4G26 A;  2KZT B;  4FHK A;  4EPZ A;  2OVF A;  3HVE B;  5ENN A;  1WM5 A;  5AEN A;  3FTX A;  5KJL A;  5LCW J;  4CGV A;  4NRH B;  4N3C A;  4L2Y A;  2WMO A;  1EPU A;  3KAE A;  3I3N A;  4WNF A;  2CG2 A;  4U07 A;  1FVF A;  3L08 A;  3QOU A;  2J09 A;  3MX3 A;  4J0U A;  3VLF A;  3FFL A;  4C0E A;  2MOW A;  1E8W A;  3LY8 A;  1Y8M A;  3QNK A;  3TXM A;  5FT9 A;  4ATG A;  3CEQ A;  3PZD A;  3TAX A;  3UQ3 A;  2IFU A;  2P58 C;  3CIA A;  3TL5 A;  4APO A;  2VTB B;  4P29 A;  4A1G A;  5FQ6 A;  5BT1 A;  3EDT B;  4F1S A;  4ME2 A;  3LJ3 A;  2VTB A;  4I6G A;  4I1A A;  3DPD A;  4GA2 A;  3SF4 A;  1E8X A;  4GU5 A;  2HYZ A;  4KVO A;  5LFA A;  4RG6 A;  3PEU B;  2X6I A;  3CST A;  3ZIM A;  4CEM A;  3CVV A;  4G11 A;  2WQH A;  2PL2 A;  4J8S A;  4PUC A;  4GZC A;  1LF8 A;  1Z3Y A;  4BT9 A;  4JA9 A;  3U3W A;  3MYV A;  3RK6 A;  2NSZ A;  2OVB A;  5ARG A;  2MHK A;  3FHE A;  5A7D B;  3ML9 A;  3CVQ A;  3BG0 B;  4L2L A;  3D3M A;  2VGY A;  5JJ7 A;  1HXI A;  4FHJ A;  4J8F A;  3RIB A;  2IF4 A;  4GYW A;  1E7V A;  3D9N A;  3UUX A;  3SZ7 A;  3IKO B;  2R17 C;  3FTU A;  3PNT B;  4KZC A;  2QY7 A;  3NZU A;  3OXG A;  4QFV A;  4K03 A;  5HQ8 A;  1Z3X A;  1JPL A;  2HR2 A;  2L0T B;  5LX8 A;  3AS8 A;  4E85 A;  5C1D A;  2R5S A;  4UWH A;  3OXL A;  1TEZ A;  4A3V A;  3FUE A;  1OUV A;  4F53 A;  4B89 A;  4HOS A;  4BTB A;  3D9K A;  3FEY A;  3URZ A;  4YVO A;  3RJV A;  3ONK A;  4DLQ A;  2LSV A;  3PUK A;  3ZFW A;  2CHZ A;  2GRL A;  2YHE A;  4GYY A;  5BUZ A;  3L22 A;  3MEK A;  4N2S A;  3ASG A;  4HVB A;  4UWG A;  3ZXS A;  5FQ4 A;  3ZW3 A;  3P2B A;  3FH7 A;  5DBK A;  5CMW A;  4FJY A;  3L17 A;  2A5U A;  2LSU A;  2XCC A;  5G05 C;  2XPY A;  3JCK C;  1FVH A;  2VJ8 A;  3NF1 A;  4K0R A;  5G04 J;  3FU5 A;  3SNX A;  4BX9 A;  3I4R B;  4AIF A;  2NXP A;  2WXO A;  2AXU A;  4A55 A;  2WXK A;  2YQ8 A;  1OWP A;  3SBT B;  3GZ1 A;  4IRU A;  4CT0 A;  3VLE A;  5AIJ A;  2AXZ A;  3L16 A;  1A17 A;  3JQ1 A;  1HU3 A;  2IOS A;  3MKR A;  4BY6 A;  2GRM A;  3R7R A;  1HO8 A;  3U64 A;  3CHR A;  2XRY A;  3E4B A;  4LUN U;  4WNG A;  5KJM A;  3CVX A;  4I43 A;  4CDM A;  3D9L A;  3U9W A;  1HH8 A;  1E8Y A;  4GAA A;  3FUD A;  3QWV A;  4XZ4 A;  2C0L A;  4I6J A;  4F3V A;  2X6K A;  3FUF A;  1OWL A;  3BEE A;  3CHS A;  3D9I A;  3PNL B;  4YND A;  4ANX A;  3KD7 A;  4LEU A;  4WAF A;  4ANW A;  4BX8 A;  4C9B B;  3QC1 A;  1H2V C;  2FUL A;  2VSN A;  2XQ0 A;  3SI5 A;  4GYO A;  3ASF A;  3HHM A;  3JUI A;  4G2V A;  5J08 A;  3IV0 A;  3LDZ A;  3FU6 A;  1SQM A;  4I2Z A;  4MRU A;  3ZRH A;  5EDS A;  3CVU A;  2BTD A;  3IBE A;  1BPO A;  2CHX A;  2IJG X;  3OAW A;  3VTX A;  3G2W A;  1INZ A;  4OVV A;  3IHY A;  4AXH A;  2JEK A;  3QKY A;  3PDN A;  5BW8 C;  2ILR A;  4UQZ A;  3OXF A;  5ANR A;  2J49 A;  4FUL A;  3FUL A;  4BSX A;  2PQR A;  5CCL A;  1E90 A;  4JXT A;  5A6C A;  2WXH A;  3AU5 A;  2VSX E;  4U0S A;  1P5Q A;  3CGH A;  3K9I A;  3LKU A;  5JJ6 A;  2MRI A;  4UWL A;  4FAD A;  2I1J A;  2DIW A;  2Y4U A;  3AU4 A;  1QQE A;  3B7U X;  3CHM A;  3QJZ A;  4WWP A;  1U3C A;  2X3M A;  1N54 A;  4LRZ A;  2KM4 A;  4I9E A;  1MQS A;  4JW1 A;  2Y4T A;  5EX0 A;  3ZEF A;  2HO1 A;  2CFU A;  2WXG A;  3Q49 B;  4IYP A;  3ZYL A;  2BF0 X;  4CRW A;  5JJT A;  3CK9 A;  1YA0 A;  3CVP A;  3MGB A;  3PE3 A;  4TV3 A;  2ION A;  4XE0 A;  2X6H A;  3QK0 A;  2AWI A;  3IEG A;  3HIZ A;  4WUY A;  2GGF A;  2KCL A;  2WXN A;  4I2W A;  3U66 A;  4N2Q A;  3BG1 B;  4L7T A;  3MCX A;  3S7B A;  2VSY A;  2WXF A;  3CHQ A;  4TRQ A;  4CT4 A;  3B7S A;  3GW4 A;  3LY9 A;  5E76 A;  4KYO B;  4B8A A;  5D0Q D;  2WXJ A;  5LCW C;  4KBQ A;  2IQC A;  3L6A A;  3FTS A;  2WXI A;  4J8E A;  2J08 A;  4J8D A;  4DI3 A;  4GZ6 A;  3FUM A;  1E96 B;  4ILH B;  1S0P A;  2BUG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...