3D3MA

The crystal structure of the c-terminal region of death associated protein 5(dap5)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
168
structure length
161
Chain Sequence
LLKLEKELLKQIKLDPSPQTIYKWIKDNISPKLHVDKGFVNILMTSFLQYISSEVNPPSAPSKEQLEQEKQLLLSFKPVMQKFLHDHVDLQVSALYALQVHCYNSNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQWLTWLETA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Eukaryotic translation initiation factor 4 gamma 2
publication title The crystal structure of the C-terminal DAP5/p97 domain sheds light on the molecular basis for its processing by caspase cleavage.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
total genus 64
structure length 161
sequence length 168
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3d3mA00
1HU3A 2GGFA 3EIJA 4CT4A 3EIQC 4CEMA 4GMJA 3L6AA 2HM8A 4IULA 2IOLA 1UG3A 1UW4B 1N54A 2KZTA 3FEYA 2KZTB 4C9BB 4JHKA 2IOSA 1H2UA 3RK6A 4B89A 4B8CB 1H2VC 2IONA 2IU1A 4B8AA 1PAQA 3D3MA 2I2OA 2RG8A 4JHJA 2NSZA 1H2TC 2VSOE 2ZU6B 1N52A 3JUIA 3FEXA 2FULA 4LUNU 4GMLA 5ANRA 4CRWA 2VSXE 1H6KA
chains in the Genus database with same CATH superfamily
5J90A 2H6HA 5EN5D 4G2VA 5FTPA 3E34A 1JUQA 3U66A 1MX2A 1S63A 2PQNA 3FTYA 3F6QA 4RQIA 1ELWA 3CHRA 3QC1A 2LXMA 4JPSA 3FUKA 2PNNA 2P9NG 4BERA 2X38A 1D8EA 4GA0A 2KZTA 1ZB1A 3HDXA 4AP2A 1DC2A 4FULA 2RG8A 2EIKE 5D66A 2UY1B 3ZUVB 1BPOA 4FJZA 2R02A 3L13A 1EPUA 3W9FA 5BPPA 2NXPA 3UM1A 4N3CA 1UN9A 1OXJA 3HVEB 3ZGQA 2VYIA 4I43A 3VTYA 2B0OE 3FU6A 4CZ2D 2WQHA 5LFAA 3Q75A 4Q94A 2VSNA 2F0YA 4UQYA 5G04C 3ASHA 3OTNA 3VLFA 4I1OB 2MRIA 3OXFA 2R5SA 5LCWC 4UI9K 3ABLE 1AP7A 3E32A 3BUAA 2E0IA 3QK0A 3UQ3A 3ONKA 4AIFA 3L22A 2PM7A 2GRPB 3MEKA 4DUIA 3ZNGA 5T4YA 3E30A 3ISMC 4XI0A 4A3VA 3J5PA 5CEAA 3RRUA 3FEXA 2LAIA 1Z3XA 5D0OD 5J08A 5CCMA 1NFIE 3ASNE 2BF0X 5FJYA 4HLLA 4ILGA 4U07A 3WG7E 3UM2A 3BU8A 3KS2A 3UIOC 3QAQA 3CEQA 3JQ0A 3ABME 3B7SA 1SQMA 3PUJA 3CVVA 4YDOA 2GW1A 3AG4E 4HORA 4U8HA 3UINC 2IO2C 3C3QA 3CV0A 3OAWA 3C98A 4J8EA 1U2VG 3PEUB 3FUFA 4JXTA 5AYWD 5CHEE 5EILA 1YYHA 5ARGA 5AQAA 4K5CA 4WNEA 2OCCE 4HOTA 3QB2A 4GTVA 4HOUA 3ZIMA 2WXKA 4LNGA 1H6PA 3CQCB 2Q7FA 4U0SA 1FVHA 2WXRA 2EQXA 3CVXA 1TNUA 1E7VA 4RVBA 3DSUA 4GTMA 4EQFA 4A55A 4WNDA 4HLEA 1N4SA 1OUVA 4NRHB 2KZTB 4AOFA 4MS6A 3ZW3A 1HO8A 1S0PA 2A5EA 5HKPA 1K1BA 4I1MA 4L1BA 1A17A 4KZCA 4GTTA 5M72A 3QDNA 3HHMA 4ABNA 2X6FA 4U0ZA 4DX5D 3UXGA 2WXIA 4JA7A 1L5JA 1TNOA 4F53A 1TNBA 2WPVA 4TV3A 2IY0C 3FUDA 4ANUA 5CMWA 3IKOB 3G2UA 3UTMA 3ASDA 3I4RB 2Y0BG 1UN8A 1UG3A 2PZIA 2BEDA 1E8ZA 3D9MA 3HYMB 3DBSA 2WXJA 3G2WA 5BUZA 1QQEA 1MHQA 1HF8A 4RSYA 3FHEA 5BV0A 2ZXWE 1FPPA 4G11A 4H7XA 2WB2A 3ZPJA 4ANXA 1N9AA 3D9HA 1IQRA 1Z5SC 3RRMB 5EIDA 5FWQA 3UM0A 5D0QD 4DX2A 4GYWA 1SZ9A 4RG9A 3EJNA 3KEAA 4I9EA 3ZYKA 4AV7A 4C0MA 3LYAA 3Q78A 3SBTB 4APOA 3ZU7B 3HXEA 5G05J 5CBNA 3VLDA 5FQ4A 3CVNA 4BX8A 2RKKA 4C9BB 4LNBA 3AU5A 1XNFA 2OVBA 3EUVA 5BW8C 3ZKJA 4JEUA 4YDEA 3HG0D 1N4RA 1QNFA 2HYZA 4LCTA 3FFLA 4U8VD 3EHNA 4OVUA 3HXCA 3FWVA 3B7RL 4JVSA 2VSYA 4EZLA 3MGBA 3OXLA 2J4DA 4GYOA 4AJWA 3MX3A 3O48A 4ANWA 3FTXA 4P29A 1JCQA 3OXGA 4G23A 2WXFA 2RD0A 4JZYA 2WQ6A 4YNDA 3TWRA 4U63A 3AJIA 2V4LA 3PDNA 4U04A 4B0ZA 5HRYA 3D9JA 3FUNA 4EPZA 3Q9UC 3TWSA 3K9IA 3KSLA 4GZ5A 1JWGA 5EYLA 4UUCA 3DPYA 2UY1A 1OWPA 5FQ8A 2AJAA 1BD8A 4BWRA 1O5MA 2WXQA 4I17A 3FDHA 3EHRA 3PRZA 4K5AB 2P9PG 1P5QA 3HVEA 3NF1A 3UX4A 4GB9A 2VTBB 1SA4A 2BKGA 4HB5A 3VLEA 2Y1LE 3HXBA 2KM4A 2J07A 4WNFA 3DSSA 4Q96A 4J8DA 1JCSA 4N5CA 2J09A 3LY9A 4CDRA 3ULQA 3PVLA 4BESA 4G8KA 2F8XK 4ACLA 3QWPA 1X5BA 4PUCA 4BEPA 3MCXA 2GRLA 3R7QA 2IOLA 2DZOA 4JA9A 4DPRA 3RAUA 4E6HA 4BSXA 3TWQA 2P9UG 3ASFA 5FQ6A 1JCRA 1KPSB 4UI9J 4HVBA 2KC7A 1N95A 5KNHD 2I9CA 4ATZD 1S70B 4B89A 1UJJA 2VGEA 3JXIA 5ENTD 4CDMA 2CG3A 1IHGA 2HE0A 4JW1A 3UUXA 3P1UA 4GZ3A 5JHAA 3UPVA 5ENQD 4B94A 3G2VA 5KJMA 2VGYA 1H2VC 1OCCE 2PM6A 1N94A 3LEWA 2IFUA 2KCLA 3CSFA 3PUKA 3HXDA 4FHJA 5ENSD 2I6HA 4N2QA 4FC8A 3W9GA 1H0AA 4HRMB 4KBQA 3LVQE 4FLBA 4A1GA 3I4GA 4PS7A 1E8WA 3TWVA 4O1PA 5JMND 3CR3A 3L82A 1E96B 4DX7D 4HXIA 5CECB 3LCAA 5ARFA 1D8DA 3PNTB 3FY4A 5CCLA 4L7TA 2WXHA 3SD5A 5KCMA 2ETAA 1N0RA 3RK6A 1WDYA 2X6JA 4GTPA 2LO6A 3NB2A 1KT1A 2J4BA 2MOWA 1H2UA 1TR4A 2DZNA 3ZVVA 3GZSA 1HFAA 3E37A 2VSOE 2I1JA 2KCVA 2WMNA 4LUNU 4PDXA 2GRRB 2CHWA 4UQXA 2DBAA 4JB8P 2Y4TA 3D9PA 3FU0A 2E2EA 2YHEA 1TJCA 2MHKA 4Q69A 1U3CA 2ZISA 4XKBA 4DX1A 1N52A 1KZPA 4GMLA 3CIAA 4GA2A 3U64A 2H6GA 4CYMD 4O6FA 4HI9A 4O60A 1ZBPA 3TWXA 4F6RD 5KJLA 5ENRD 3JQ1A 3AS4A 1D9SA 4JHRA 5BXOA 2GRQB 3TXNA 5HQ8A 4KVMA 4UI9C 4IYPA 1G3NB 2KATA 3TWUA 1OWNA 2R59A 3FTZA 5ENOD 1N4QA 1IKND 2ZGDA 4G25A 2ILRA 5FIOA 2J8SD 4I2WA 3AAAC 1FVFA 2I2OA 4XI9A 4C0EA 3AG1E 3LY7A 5E75A 3SFXA 5EIBE 1UOHA 4PS8A 2AXUA 4GTQA 2IO3C 3FH7A 3LKUA 4LRZA 3V79K 3IV0A 2WVIA 5EX3A 4F7AA 4LERA 3DXMG 3EHQA 3EU5A 3PH0C 4EBAG 3ASOE 2C0MA 3CVWA 4JC8A 3URZA 2QZAA 3L08A 4GCNA 4HFGA 5FQ7A 3ZFWA 2FF4A 2XPYA 3LJNA 3KAEA 2VQ2A 4AXHA 5T8IA 4LEUA 2FBNA 2IQCA 3ZXPA 2C2LA 4GCOA 1TNZA 1N0QA 4I9CA 3U3WA 1MJ0A 3E33A 4G1TA 2WXLA 1HXIA 2XPZA 3HRAA 4GYYA 3Q5MA 3D3MA 2JEKA 4UWHA 1H19A 2JLBA 4I2ZA 4XEIG 4U8YD 5KJNA 1H6KA 4UWGA 4EZKA 4TXQA 2Y69E 2EIME 3APCA 2XCBA 4I1AA 2HO1A 4FJYA 3TJPA 1QYMA 1OWMA 3KSQA 3P2BA 3FTUA 1OCOE 1HX8A 3C3RA 1PAQA 3Q4AB 3KD7A 5CEDB 3IBEA 3CSTA 3ZHEB 3U9WA 2XS1A 1EDUA 4I6GA 4WNGA 2J08A 2VTBA 5EYPF 5JA4D 4XE0A 1FT2A 4N2SA 2UWJG 2QFCA 3V2OA 2YNQA 3RO3A 2R03A 4RLYA 3L9TA 1IHBA 4JHJA 2AXZA 3FUEA 4L23A 1MYOA 3RO2A 4BETA 2IF4A 3QWVA 3MKQB 1E7UA 2HM8A 3MV3B 5D2MC 3Q47B 4AY5A 4WWOA 1E90A 4FADA 4YVQC 3C5RA 2YQ8A 5LX8A 4ACKA 4FHKA 4K5BA 2MYOA 2ZIRA 4GZDA 5C2YA 4F1SA 3D9LA 4Y6WA 3FULA 3ULEG 4WWPA 4B93B 2DYSE 2IU1A 3CGHA 3L16A 4BTAA 4GMRA 2EILE 3ML8A 1IXVA 4NURA 4GPKA 3HIZA 3TXMA 2OVFA 5EX0A 2XEHA 3X2QE 4Z68A 1BI8B 5G55A 2V5QC 2IJGX 4B8AA 5A7DB 2ONDA 5JJ7A 3FH5A 2AWIA 2XENA 5KWDA 3CHSA 3RRNB 3S7JA 4YVOA 4HOQA 2F8YA 3S7FA 2AXVA 4A1SA 2X3MA 3L17A 3EU9A 3NZSA 5JJTA 5AAOA 3SFYA 4U96D 1RZ4A 3B7BA 3Q7AA 3NBNB 5CRVA 3TWWA 2WM9A 4DJAA 4UQZA 1Y8MA 4IN3B 4XZ4A 4U95D 1DVPA 2L0TB 4B8CB 2XPIA 1U3DA 3QWWA 1MX6A 1HG2A 4HNAD 4XX5A 1LF8A 3CKCA 4R7LA 4KXKB 2XQ0A 4U0UA 3FUHA 4XIFA 4KT6B 3HXFA 4G8LA 1K8KG 4KVOA 4TUMA 1JPLA 5ENPD 3DWLG 5AN8A 1EYHA 3R9MA 3S2AA 4PS3A 2CHZA 2PQRA 3D9IA 3AS8A 1TN7A 5JJ6A 4EBAA 2QYUA 3T9KA 3DSVA 2RFAA 4DI4A 3T8MA 2LUHA 1HG5A 2DWZA 4NACA 3E4BA 3EHMA 1H6OA 1K3ZD 2EINE 2V0PA 1SZAA 5B1BE 4MBGA 1WAO1 2IONA 4DI3A 4X8QA 3JUIA 4BFRA 3UIPC 3C3OA 4HS2A 4V3IA 4CGVA 4RG6A 3RU0A 2J49A 1V55E 1HS6A 2LXLA 4GZ6A 1DCEA 2VGXB 4TUUA 2XEVA 5G04J 4DK5A 3G2TA 3KEZA 2Y3AA 2DIWA 2ZGGA 3GW4A 3BG0B 5FINA 3SF4A 3UMVA 5LCWJ 5CRUA 3ZYLA 1S64A 2P2CP 2ETCA 5G2NA 1B89A 4WWNA 3UKUG 3FU5A 5FZQA 5DIZA 1LD8A 1FCHA 4H7YA 2YHCA 2WMOA 4N5QA 4ATGA 1MQSA 3APFA 1NI1A 2B6CA 2XGSA 2F37A 4FLHA 3TL5A 3B95A 5G05C 1TEZA 2LNIA 2DVWA 3I3NA 5B1AE 3FUMA 5IY5E 4U7EB 1KT0A 5AIJA 4FP7A 3TWTA 2V8SE 1DNPA 3UT4A 1NZNA 2DYRE 2Y4UA 1O1RA 3JXJA 2XCCA 5LOZA 4I6EA 4G24A 1N54A 4APFA 2PL2A 4AM9A 3PE4A 4GTRA 3AS5A 3BG1B 3DXKG 3ESLA 5FT9A 3V31A 3EDTB 1INZA 3ULYA 5BXUA 2NYJA 2GGFA 4TXRA 3ZRHA 4FA6A 3IHVA 3Q7FA 1K1AA 4TXPA 1OWOA 3FEYA 4E85A 3T8KA 3D9KA 3CVUA 3FTWA 3CHPA 3LJ3A 1BU9A 3MZLB 1XGWA 3I5PA 3SI5A 3DEPA 3GZ2A 4C48B 3SY2A 3Q15A 3T5XA 1YCSB 3EIJA 3DSXA 3IXEA 3DSWA 2XRYA 3Q9NC 5AARA 1NA0A 3FU3A 3BQOA 3NAWA 3Q79A 3CLJA 3B7TA 3ZHEA 2CG2A 2XRZA 2XEEA 2R2LA 4O1OA 3CHOA 3SBSA 3NOGD 4OAUC 3LDZA 4Y6CA 5T3RA 3N71A 3JYSA 1QZ2A 3WXXA 3NQPA 3U4TA 2FO7A 1N4PA 3ZN3A 1YMPA 4UWLA 3GZ1A 1HH8A 3SFZA 1UJKA 3MKQA 3Q73A 5FZRA 2WXPA 4CT0A 1N11A 4J8FA 3UM3A 3CKBA 5DBKA 4JHKA 2WXNA 3QOUA 2XGOA 1AWCB 1NL4A 5ANLA 2KCKA 5KJKA 2J9QA 4IRUA 5CERB 4K0RA 4G26A 4URKA 3D9NA 4D10C 4LNUD 5E76A 4DRXE 1E8XA 3RKVA 2DCPA 4GZCA 3PS6A 3S7BA 4OAVB 3UI2A 4YDYA 3CK9A 1WM5A 3NOCD 4JD2G 3L6AA 5KBAA 1BI7B 3V2XA 2YINA 3CQGB 2XGMA 4ANVA 1TYQG 1W3BA 2P58C 4L2YA 4NIKA 4XKCA 4DLOA 1JWFA 2I1KA 1PY1A 4FU3A 3SZ7A 2LAHA 2EIJE 3DPDA 2FI7A 3ONLA 2XS8A 3FUIA 4HBDA 5HS0A 3B7UX 3UT8A 3APDA 3PZ4A 3RJVA 4EHMA 3MA5A 1SVXA 4CCAA 3PZDA 2WXGA 3MV2B 2CHXA 4BY6A 1HE8A 4M7CA 3EIQC 3V30A 4L9PA 5FZSA 5C1DA 4HQDA 2RFMA 3DSTA 3CVQA 3SQVA 4HI8A 3IEGA 4CRWA 4ZHBA 4QFVA 1EF1C 3CK8A 4M3OA 4OYSA 3R9AB 4CEMA 4BTBA 1WG0A 3CK7A 3CHMA 5H7PA 1ZU2A 4GTSA 4BSZB 5A6CA 2XZTG 3Q49B 4EZJA 1A5EA 2VSXE 1IQUA 2X6IA 4AY6A 4WAFA 3L54A 1V54E 5AQ9A 3PZ3A 3SO8A 4KMOA 1TN8A 3S7DA 4LG6A 1TJFA 2FULA 5BT1A 4GA1A 4F1PA 2L6BA 4EECA 2VGXA 5JHBA 3PZ1A 2V4HC 3ZYMA 2GRNB 3UKRG 1KLXA 2BTDA 3B13A 4PH4B 4MRUA 2WXOA 4ME2A 1OCZE 3TG5A 4W9RA 3AG2E 4IULA 2X6KA 4J6IA 4J8SA 4ILHB 2KXPC 3TGOA 3SHFA 1Z3YA 3TG4A 3ML9A 3DEOA 2ETBA 4LSZE 3T5VA 1OT8A 4HRLA 4J0UA 1LD7A 1O1TA 3IHYA 2L6JA 4ZFHA 3MKRA 4F3VA 3CVYA 4QQIA 2H6IA 3O4ZA 5EKQD 2P9IG 2ZU6B 4KYOB 1PC2A 1TNYA 4NQ0A 4J8YA 4WUYA 1NP7A 1BLXB 3AG3E 4GMJA 5HI7A 3SGHA 1QBQA 4A3TA 1HZ4A 3FUJA 1OWLA 1OCRE 1ELKA 4CGWA 3DRAA 2AVPA 3VTXA 3QARA 5A23A 3BEEA 3PE3A 1VDYA 4DX6D 3ABKE 2GROB 3PREA 1GW6A 2OEWA 4N3BA 4K03A 5BV1A 3G2SA 2FEZA 3LS8A 4N3AA 3LPZA 5AENA 2FO1E 3ASGA 4JL0A 1Z6TA 1HU3A 1FT1A 5BNWA 4MKTA 2P9SG 5ENNA 2QC9A 2KBXA 2L0IA 4UWFA 4GAAA 2QYJA 3PZ2A 5KNGA 4A63B 1WY6A 5ANRA 3NZUA 3ESKA 1RW2A 3SNXA 2XZDG 4OVVA 4TRQA 2CFZA 1OY3D 3ENEA 1IYGA 2BUGA 3D9OA 2P9KG 1MZCA 4BT9A 4ILIA 2A4ZA 1KZOA 2OEVA 3CVPA 2M63A 3QJZA 3CHQA 4N39A 5CBOA 4MLPA 4GTOA 4JEHA 4CT4A 3CVLA 4CDNA 3FTVA 5CMYA 4YDWA 2IOSA 1YA0A 4BX9A 2WQ7A 3ZYQA 3TAXA 1Q2ZA 3ZXSA 3FH8A 1E8YA 5AJLA 4AEZC 4L2LA 2GRMA 3MJWA 2R05A 4J7WA 2LSVA 1SW6A 1LTXA 2XHEA 5AJDA 3UT7A 3J5QB 5EDSA 5AQ7A 1X81A 3LXUX 4AVXA 3C72A 2WXMA 1UW4B 2OOEA 3RIBA 2C0LA 4UWKA 1SA5A 2R17C 1O1SA 1DCQA 3FP3A 2V5FA 2P9LG 2LSUA 4BT8A 3FTSA 4KZ0A 2HR2A 4HRNA 3PNLB 2L9BA 3GYZA 2X6HA 3PEVB 5AQBA 3R7RA 3QKYA 2A5UA 3ZEFA 3RSEG 2NSZA 3JCKC 3LVRE 2JABA 4DLQA 4GU5A 1TN6A 2IEJA 2BKKB 3LY8A 2VJ8A 1ELRA 5LP0A 2H6FA 5B3SE 2CFUA 2AW6A 1Y6IA 3MYVA 3AU4A 1MX4A 3JUEA 3QNKA 2NC9A 2QY7A 4I6JA 5ITZF 1H2TC 4HOSA 1NA3A 2OV8A 4GPMA
chains in the Genus database with same CATH topology
5J90A 3RO2A 2IF4A 2UY1A 3QWVA 1OWPA 5FQ8A 4BWRA 4G2VA 5FTPA 3L6AA 3MKQB 1E7UA 2HM8A 3MV3B 1JUQA 2YINA 3CQGB 3U66A 2WXQA 2XGMA 3FDHA 3Q47B 4I17A 4ANVA 4AY5A 2PQNA 3PRZA 4WWOA 3FTYA 1E90A 1ELWA 1W3BA 1P5QA 2P58C 3HVEA 4L2YA 3CHRA 4XKCA 2YQ8A 3QC1A 4YVQC 4DLOA 4FADA 5LX8A 4ACKA 1JWFA 4FHKA 3NF1A 2I1KA 1PY1A 4FU3A 4JPSA 3SZ7A 3UX4A 4GB9A 3FUKA 2VTBB 2LAHA 4GZDA 3DPDA 3VLEA 5C2YA 4F1SA 2FI7A 3ONLA 4AV7A 2X38A 3D9LA 2KM4A 2J07A 3FUIA 4WNFA 4GA0A 2KZTA 4Y6WA 3FULA 4WWPA 4Q96A 3B7UX 3UT8A 3APDA 4J8DA 3HDXA 2IU1A 4AP2A 4N5CA 3RJVA 2J09A 3CGHA 3L16A 3LY9A 4FULA 3MA5A 4BTAA 3ULQA 4CDRA 3PVLA 2RG8A 4CCAA 3PZDA 4ACLA 2WXGA 3QWPA 3ML8A 3MV2B 2UY1B 2CHXA 4NURA 4BY6A 1HE8A 1BPOA 3HIZA 4FJZA 3TXMA 4GPKA 2OVFA 1X5BA 4PUCA 3EIQC 3MCXA 5EX0A 2GRLA 3L13A 1EPUA 5FZSA 3R7QA 2IOLA 5C1DA 4JA9A 5BPPA 2NXPA 4DPRA 5G55A 4E6HA 4N3CA 4BSXA 1UN9A 3HVEB 3ZGQA 3CVQA 2IJGX 4B8AA 5A7DB 2VYIA 4I43A 2ONDA 5JJ7A 3FH5A 3IEGA 3VTYA 3ASFA 3FU6A 5FQ6A 2AWIA 4CRWA 4QFVA 1EF1C 2WQHA 3CHSA 3CK8A 5LFAA 4UI9J 4Q94A 3RRNB 3S7JA 2VSNA 4M3OA 4OYSA 4UQYA 4YVOA 3R9AB 5G04C 4CEMA 4HVBA 4HOQA 2KC7A 4BTBA 3ASHA 3CK7A 2I9CA 3OTNA 3CHMA 3S7FA 3VLFA 2AXVA 4A1SA 1ZU2A 2X3MA 3L17A 4B89A 1UJJA 4I1OB 2MRIA 5A6CA 3NZSA 4CDMA 3OXFA 2CG3A 2R5SA 5LCWC 4UI9K 1IHGA 5JJTA 3Q49B 4EZJA 2VSXE 4HLEA 1IQUA 4JW1A 2E0IA 2X6IA 3UUXA 3P1UA 3QK0A 4GZ3A 3UQ3A 3ONKA 5JHAA 4AY6A 3UPVA 4WAFA 4AIFA 3L22A 2WM9A 3L54A 4DJAA 2PM7A 4UQZA 1Y8MA 3MEKA 5T4YA 4XI0A 4B94A 3G2VA 4IN3B 4XZ4A 5KJMA 4A3VA 2VGYA 1DVPA 2L0TB 4B8CB 4KMOA 2XPIA 1H2VC 2PM6A 1U3DA 3QWWA 3LEWA 3S7DA 1HG2A 2IFUA 3RRUA 1TJFA 2KCLA 3FEXA 1LF8A 2FULA 2LAIA 3CSFA 3PUKA 4XX5A 5BT1A 4FHJA 2I6HA 3CKCA 4N2QA 4FC8A 4R7LA 1H0AA 1Z3XA 4GA1A 5D0OD 5J08A 5CCMA 4KXKB 2XQ0A 4EECA 4U0UA 2VGXA 3FUHA 4KT6B 4XIFA 5JHBA 2BF0X 4KBQA 5FJYA 3LVQE 4KVOA 4FLBA 3ZYMA 4A1GA 1JPLA 1KLXA 3I4GA 4ILGA 4PS7A 4U07A 1E8WA 2BTDA 1EYHA 3B13A 3S2AA 3CR3A 4PH4B 3KS2A 4PS3A 2CHZA 4MRUA 2WXOA 3QAQA 3CEQA 3JQ0A 2PQRA 3B7SA 1SQMA 3D9IA 3PUJA 3AS8A 3CVVA 2GW1A 4ME2A 5JJ6A 4EBAA 1E96B 3TG5A 4HXIA 4DI4A 3T8MA 4HORA 1HG5A 4U8HA 4W9RA 4NACA 3E4BA 3CV0A 3EHMA 3LCAA 4IULA 2X6KA 3OAWA 5ARFA 4J6IA 4J8SA 2V0PA 3C98A 1SZAA 4ILHB 4J8EA 3PEUB 1WAO1 2IONA 3FUFA 4JXTA 3PNTB 5AYWD 3TGOA 5CHEE 3FY4A 3SHFA 1Z3YA 4DI3A 5CCLA 5ARGA 4L7TA 3TG4A 3JUIA 4BFRA 4HS2A 3ML9A 2WXHA 4V3IA 3SD5A 4CGVA 5KCMA 3RK6A 4WNEA 4RG6A 3RU0A 2J49A 2X6JA 3QB2A 4HOTA 3T5VA 1HS6A 4HOUA 2LO6A 4GZ6A 3ZIMA 2VGXB 4J0UA 4TUUA 2XEVA 5G04J 4DK5A 3G2TA 3KEZA 2WXKA 1KT1A 2Y3AA 3IHYA 2L6JA 2DIWA 2J4BA 3MKRA 3CQCB 4F3VA 3CVYA 2MOWA 1H2UA 2Q7FA 4U0SA 3GW4A 3BG0B 3O4ZA 5EKQD 3ZVVA 3SF4A 3GZSA 1HFAA 3UMVA 2ZU6B 2VSOE 2I1JA 1FVHA 2KCVA 2WMNA 2WXRA 4LUNU 4PDXA 3ZYLA 5LCWJ 2EQXA 3CVXA 2CHWA 4KYOB 1PC2A 4UQXA 1E7VA 2DBAA 4NQ0A 4RVBA 2Y4TA 3D9PA 4WUYA 1NP7A 3FU0A 4GMJA 5HI7A 4EQFA 5G2NA 3SGHA 4A55A 4WNDA 2E2EA 2YHEA 1OUVA 1TJCA 2MHKA 1B89A 4Q69A 4WWNA 4NRHB 4A3TA 1HZ4A 2KZTB 4AOFA 3FUJA 4MS6A 1OWLA 1U3CA 3ZW3A 4XKBA 3FU5A 5FZQA 5DIZA 1HO8A 1ELKA 1FCHA 4CGWA 1S0PA 4H7YA 1N52A 2AVPA 2WMOA 2YHCA 3VTXA 4ATGA 3QARA 4GMLA 1MQSA 5A23A 3APFA 3CIAA 4GA2A 4I1MA 2XGSA 4FLHA 4L1BA 3TL5A 5G05C 1TEZA 3BEEA 3PE3A 1VDYA 2LNIA 1A17A 3I3NA 3U64A 4KZCA 3FUMA 3PREA 4O6FA 1GW6A 5M72A 3QDNA 4N3BA 4K03A 3HHMA 1KT0A 1ZBPA 5BV1A 4ABNA 5AIJA 5KJLA 3G2SA 4FP7A 2X6FA 4U0ZA 2FEZA 3AS4A 3JQ1A 3LS8A 2WXIA 2V8SE 4N3AA 4JHRA 1DNPA 3LPZA 4JA7A 3TXNA 1L5JA 3ASGA 5AENA 4JL0A 5HQ8A 4KVMA 4UI9C 3UT4A 1Z6TA 4F53A 4IYPA 2WPVA 4TV3A 1HU3A 1NZNA 2KATA 3FUDA 4ANUA 2Y4UA 5BNWA 5CMWA 1OWNA 2R59A 4MKTA 2XCCA 3FTZA 5LOZA 3IKOB 3G2UA 4I6EA 5ENNA 3ASDA 3I4RB 1UN8A 1UG3A 4G24A 2PZIA 1N54A 2L0IA 4APFA 1E8ZA 4UWFA 2PL2A 3D9MA 2ILRA 4G25A 3HYMB 4GAAA 4AM9A 3PE4A 3AS5A 4I2WA 1FVFA 3BG1B 3ESLA 2I2OA 5FT9A 3DBSA 4XI9A 3EDTB 4C0EA 1WY6A 1INZA 5ANRA 3NZUA 3LY7A 2WXJA 3ESKA 3SNXA 4OVVA 4TRQA 5E75A 3G2WA 2CFZA 3ENEA 4CT0A 5BUZA 1IYGA 2BUGA 1QQEA 2GGFA 3D9OA 4PS8A 3ZRHA 1MHQA 3IHVA 4FA6A 2AXUA 4BT9A 3FH7A 3LKUA 4LRZA 1HF8A 3IV0A 2WVIA 5EX3A 4F7AA 4ILIA 1OWOA 4RSYA 4LERA 3FEYA 2A4ZA 3FHEA 4E85A 3PH0C 5BV0A 4EBAG 3D9KA 3CVUA 3FTWA 2C0MA 4G11A 3CVWA 3CHPA 4H7XA 2WB2A 3LJ3A 4JC8A 3CVPA 3ZPJA 3URZA 2M63A 3QJZA 4ANXA 3CHQA 3L08A 4N39A 3MZLB 1XGWA 4MLPA 3I5PA 3SI5A 3GZ2A 1IQRA 3Q15A 4GCNA 3RRMB 3T5XA 4HFGA 3EIJA 4JEHA 5FQ7A 5FWQA 4CT4A 3ZFWA 2XRYA 3CVLA 4CDNA 2FF4A 1NA0A 2XPYA 3FU3A 3KAEA 3FTVA 5CMYA 2VQ2A 5D0QD 4AXHA 5T8IA 2IOSA 1YA0A 4BX9A 2WQ7A 4GYWA 1SZ9A 3ZYQA 4RG9A 3TAXA 3ZXSA 3FH8A 1E8YA 4LEUA 5AJLA 3EJNA 4AEZC 3CLJA 2FBNA 3B7TA 2IQCA 4L2LA 3ZHEA 2GRMA 4I9EA 3MJWA 2CG2A 3ZYKA 2LSVA 2C2LA 4GCOA 3LYAA 2XHEA 5AJDA 3UT7A 4I9CA 3SBTB 4APOA 4C0MA 2XRZA 3U3WA 5EDSA 5G05J 3CHOA 3SBSA 3LXUX 4G1TA 4AVXA 2WXMA 3VLDA 1UW4B 2OOEA 3RIBA 2WXLA 5FQ4A 3CVNA 3LDZA 4BX8A 4Y6CA 5T3RA 4C9BB 1HXIA 2XPZA 3AU5A 2C0LA 3N71A 4UWKA 1XNFA 2OVBA 3JYSA 1QZ2A 4GYYA 5BW8C 2R17C 3Q5MA 4JEUA 3D3MA 3WXXA 2JEKA 4UWHA 1H19A 3NQPA 2JLBA 4I2ZA 3U4TA 2FO7A 1QNFA 2HYZA 5KJNA 1H6KA 4UWGA 3FP3A 4EZKA 4LCTA 2V5FA 3FFLA 3EHNA 3ZN3A 4UWLA 2LSUA 3GZ1A 4OVUA 1HH8A 2XCBA 3APCA 1UJKA 3FWVA 3SFZA 3MKQA 5FZRA 2WXPA 3B7RL 2HO1A 4I1AA 4BT8A 4FJYA 3FTSA 4J8FA 4KZ0A 2HR2A 4JVSA 2VSYA 3PNLB 4EZLA 2L9BA 3GYZA 3CKBA 3MGBA 3OXLA 2X6HA 4JHKA 2J4DA 5DBKA 3TJPA 2WXNA 3PEVB 1OWMA 3P2BA 3FTUA 4GYOA 1HX8A 4AJWA 3MX3A 3O48A 3R7RA 3QKYA 3QOUA 1PAQA 2A5UA 3ZEFA 3Q4AB 3FTXA 3KD7A 4ANWA 4P29A 3IBEA 3CSTA 2NSZA 3JCKC 3ZHEB 2XGOA 3OXGA 3LVRE 3U9WA 4G23A 2WXFA 4DLQA 1EDUA 2RD0A 4GU5A 4JZYA 2WQ6A 4I6GA 5ANLA 4WNGA 4YNDA 2J08A 2VTBA 2KCKA 3LY8A 5KJKA 4U63A 2VJ8A 2J9QA 4IRUA 1ELRA 5LP0A 4XE0A 4N2SA 4K0RA 2CFUA 4G26A 2AW6A 2V4LA 4URKA 1Y6IA 2UWJG 2QFCA 3D9NA 4D10C 3MYVA 5E76A 2YNQA 1E8XA 3AU4A 3PDNA 4U04A 3RKVA 3RO3A 2DCPA 4GZCA 3QNKA 4B0ZA 2NC9A 2QY7A 3D9JA 3PS6A 3FUNA 3S7BA 4EPZA 4I6JA 3K9IA 3CK9A 4JHJA 1H2TC 4HOSA 4GZ5A 1NA3A 1JWGA 2AXZA 2OV8A 1WM5A 3FUEA 4L23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HU3 A;  2GGF A;  3EIJ A;  4CT4 A;  3EIQ C;  4CEM A;  4GMJ A;  3L6A A;  2HM8 A;  4IUL A;  2IOL A;  1UG3 A;  1UW4 B;  1N54 A;  2KZT A;  3FEY A;  2KZT B;  4C9B B;  4JHK A;  2IOS A;  1H2U A;  3RK6 A;  4B89 A;  4B8C B;  1H2V C;  2ION A;  2IU1 A;  4B8A A;  1PAQ A;  3D3M A;  2I2O A;  2RG8 A;  4JHJ A;  2NSZ A;  1H2T C;  2VSO E;  2ZU6 B;  1N52 A;  3JUI A;  3FEX A;  2FUL A;  4LUN U;  4GML A;  5ANR A;  4CRW A;  2VSX E;  1H6K A; 
#chains in the Genus database with same CATH topology
 5J90 A;  2H6H A;  5EN5 D;  4G2V A;  5FTP A;  3E34 A;  1JUQ A;  3U66 A;  1MX2 A;  1S63 A;  2PQN A;  3FTY A;  3F6Q A;  4RQI A;  1ELW A;  3CHR A;  3QC1 A;  2LXM A;  4JPS A;  3FUK A;  2PNN A;  2P9N G;  4BER A;  2X38 A;  1D8E A;  4GA0 A;  2KZT A;  1ZB1 A;  3HDX A;  4AP2 A;  1DC2 A;  4FUL A;  2RG8 A;  2EIK E;  5D66 A;  2UY1 B;  3ZUV B;  1BPO A;  4FJZ A;  2R02 A;  3L13 A;  1EPU A;  3W9F A;  5BPP A;  2NXP A;  3UM1 A;  4N3C A;  1UN9 A;  1OXJ A;  3HVE B;  3ZGQ A;  2VYI A;  4I43 A;  3VTY A;  2B0O E;  3FU6 A;  4CZ2 D;  2WQH A;  5LFA A;  3Q75 A;  4Q94 A;  2VSN A;  2F0Y A;  4UQY A;  5G04 C;  3ASH A;  3OTN A;  3VLF A;  4I1O B;  2MRI A;  3OXF A;  2R5S A;  5LCW C;  4UI9 K;  3ABL E;  1AP7 A;  3E32 A;  3BUA A;  2E0I A;  3QK0 A;  3UQ3 A;  3ONK A;  4AIF A;  3L22 A;  2PM7 A;  2GRP B;  3MEK A;  4DUI A;  3ZNG A;  5T4Y A;  3E30 A;  3ISM C;  4XI0 A;  4A3V A;  3J5P A;  5CEA A;  3RRU A;  3FEX A;  2LAI A;  1Z3X A;  5D0O D;  5J08 A;  5CCM A;  1NFI E;  3ASN E;  2BF0 X;  5FJY A;  4HLL A;  4ILG A;  4U07 A;  3WG7 E;  3UM2 A;  3BU8 A;  3KS2 A;  3UIO C;  3QAQ A;  3CEQ A;  3JQ0 A;  3ABM E;  3B7S A;  1SQM A;  3PUJ A;  3CVV A;  4YDO A;  2GW1 A;  3AG4 E;  4HOR A;  4U8H A;  3UIN C;  2IO2 C;  3C3Q A;  3CV0 A;  3OAW A;  3C98 A;  4J8E A;  1U2V G;  3PEU B;  3FUF A;  4JXT A;  5AYW D;  5CHE E;  5EIL A;  1YYH A;  5ARG A;  5AQA A;  4K5C A;  4WNE A;  2OCC E;  4HOT A;  3QB2 A;  4GTV A;  4HOU A;  3ZIM A;  2WXK A;  4LNG A;  1H6P A;  3CQC B;  2Q7F A;  4U0S A;  1FVH A;  2WXR A;  2EQX A;  3CVX A;  1TNU A;  1E7V A;  4RVB A;  3DSU A;  4GTM A;  4EQF A;  4A55 A;  4WND A;  4HLE A;  1N4S A;  1OUV A;  4NRH B;  2KZT B;  4AOF A;  4MS6 A;  3ZW3 A;  1HO8 A;  1S0P A;  2A5E A;  5HKP A;  1K1B A;  4I1M A;  4L1B A;  1A17 A;  4KZC A;  4GTT A;  5M72 A;  3QDN A;  3HHM A;  4ABN A;  2X6F A;  4U0Z A;  4DX5 D;  3UXG A;  2WXI A;  4JA7 A;  1L5J A;  1TNO A;  4F53 A;  1TNB A;  2WPV A;  4TV3 A;  2IY0 C;  3FUD A;  4ANU A;  5CMW A;  3IKO B;  3G2U A;  3UTM A;  3ASD A;  3I4R B;  2Y0B G;  1UN8 A;  1UG3 A;  2PZI A;  2BED A;  1E8Z A;  3D9M A;  3HYM B;  3DBS A;  2WXJ A;  3G2W A;  5BUZ A;  1QQE A;  1MHQ A;  1HF8 A;  4RSY A;  3FHE A;  5BV0 A;  2ZXW E;  1FPP A;  4G11 A;  4H7X A;  2WB2 A;  3ZPJ A;  4ANX A;  1N9A A;  3D9H A;  1IQR A;  1Z5S C;  3RRM B;  5EID A;  5FWQ A;  3UM0 A;  5D0Q D;  4DX2 A;  4GYW A;  1SZ9 A;  4RG9 A;  3EJN A;  3KEA A;  4I9E A;  3ZYK A;  4AV7 A;  4C0M A;  3LYA A;  3Q78 A;  3SBT B;  4APO A;  3ZU7 B;  3HXE A;  5G05 J;  5CBN A;  3VLD A;  5FQ4 A;  3CVN A;  4BX8 A;  2RKK A;  4C9B B;  4LNB A;  3AU5 A;  1XNF A;  2OVB A;  3EUV A;  5BW8 C;  3ZKJ A;  4JEU A;  4YDE A;  3HG0 D;  1N4R A;  1QNF A;  2HYZ A;  4LCT A;  3FFL A;  4U8V D;  3EHN A;  4OVU A;  3HXC A;  3FWV A;  3B7R L;  4JVS A;  2VSY A;  4EZL A;  3MGB A;  3OXL A;  2J4D A;  4GYO A;  4AJW A;  3MX3 A;  3O48 A;  4ANW A;  3FTX A;  4P29 A;  1JCQ A;  3OXG A;  4G23 A;  2WXF A;  2RD0 A;  4JZY A;  2WQ6 A;  4YND A;  3TWR A;  4U63 A;  3AJI A;  2V4L A;  3PDN A;  4U04 A;  4B0Z A;  5HRY A;  3D9J A;  3FUN A;  4EPZ A;  3Q9U C;  3TWS A;  3K9I A;  3KSL A;  4GZ5 A;  1JWG A;  5EYL A;  4UUC A;  3DPY A;  2UY1 A;  1OWP A;  5FQ8 A;  2AJA A;  1BD8 A;  4BWR A;  1O5M A;  2WXQ A;  4I17 A;  3FDH A;  3EHR A;  3PRZ A;  4K5A B;  2P9P G;  1P5Q A;  3HVE A;  3NF1 A;  3UX4 A;  4GB9 A;  2VTB B;  1SA4 A;  2BKG A;  4HB5 A;  3VLE A;  2Y1L E;  3HXB A;  2KM4 A;  2J07 A;  4WNF A;  3DSS A;  4Q96 A;  4J8D A;  1JCS A;  4N5C A;  2J09 A;  3LY9 A;  4CDR A;  3ULQ A;  3PVL A;  4BES A;  4G8K A;  2F8X K;  4ACL A;  3QWP A;  1X5B A;  4PUC A;  4BEP A;  3MCX A;  2GRL A;  3R7Q A;  2IOL A;  2DZO A;  4JA9 A;  4DPR A;  3RAU A;  4E6H A;  4BSX A;  3TWQ A;  2P9U G;  3ASF A;  5FQ6 A;  1JCR A;  1KPS B;  4UI9 J;  4HVB A;  2KC7 A;  1N95 A;  5KNH D;  2I9C A;  4ATZ D;  1S70 B;  4B89 A;  1UJJ A;  2VGE A;  3JXI A;  5ENT D;  4CDM A;  2CG3 A;  1IHG A;  2HE0 A;  4JW1 A;  3UUX A;  3P1U A;  4GZ3 A;  5JHA A;  3UPV A;  5ENQ D;  4B94 A;  3G2V A;  5KJM A;  2VGY A;  1H2V C;  1OCC E;  2PM6 A;  1N94 A;  3LEW A;  2IFU A;  2KCL A;  3CSF A;  3PUK A;  3HXD A;  4FHJ A;  5ENS D;  2I6H A;  4N2Q A;  4FC8 A;  3W9G A;  1H0A A;  4HRM B;  4KBQ A;  3LVQ E;  4FLB A;  4A1G A;  3I4G A;  4PS7 A;  1E8W A;  3TWV A;  4O1P A;  5JMN D;  3CR3 A;  3L82 A;  1E96 B;  4DX7 D;  4HXI A;  5CEC B;  3LCA A;  5ARF A;  1D8D A;  3PNT B;  3FY4 A;  5CCL A;  4L7T A;  2WXH A;  3SD5 A;  5KCM A;  2ETA A;  1N0R A;  3RK6 A;  1WDY A;  2X6J A;  4GTP A;  2LO6 A;  3NB2 A;  1KT1 A;  2J4B A;  2MOW A;  1H2U A;  1TR4 A;  2DZN A;  3ZVV A;  3GZS A;  1HFA A;  3E37 A;  2VSO E;  2I1J A;  2KCV A;  2WMN A;  4LUN U;  4PDX A;  2GRR B;  2CHW A;  4UQX A;  2DBA A;  4JB8 P;  2Y4T A;  3D9P A;  3FU0 A;  2E2E A;  2YHE A;  1TJC A;  2MHK A;  4Q69 A;  1U3C A;  2ZIS A;  4XKB A;  4DX1 A;  1N52 A;  1KZP A;  4GML A;  3CIA A;  4GA2 A;  3U64 A;  2H6G A;  4CYM D;  4O6F A;  4HI9 A;  4O60 A;  1ZBP A;  3TWX A;  4F6R D;  5KJL A;  5ENR D;  3JQ1 A;  3AS4 A;  1D9S A;  4JHR A;  5BXO A;  2GRQ B;  3TXN A;  5HQ8 A;  4KVM A;  4UI9 C;  4IYP A;  1G3N B;  2KAT A;  3TWU A;  1OWN A;  2R59 A;  3FTZ A;  5ENO D;  1N4Q A;  1IKN D;  2ZGD A;  4G25 A;  2ILR A;  5FIO A;  2J8S D;  4I2W A;  3AAA C;  1FVF A;  2I2O A;  4XI9 A;  4C0E A;  3AG1 E;  3LY7 A;  5E75 A;  3SFX A;  5EIB E;  1UOH A;  4PS8 A;  2AXU A;  4GTQ A;  2IO3 C;  3FH7 A;  3LKU A;  4LRZ A;  3V79 K;  3IV0 A;  2WVI A;  5EX3 A;  4F7A A;  4LER A;  3DXM G;  3EHQ A;  3EU5 A;  3PH0 C;  4EBA G;  3ASO E;  2C0M A;  3CVW A;  4JC8 A;  3URZ A;  2QZA A;  3L08 A;  4GCN A;  4HFG A;  5FQ7 A;  3ZFW A;  2FF4 A;  2XPY A;  3LJN A;  3KAE A;  2VQ2 A;  4AXH A;  5T8I A;  4LEU A;  2FBN A;  2IQC A;  3ZXP A;  2C2L A;  4GCO A;  1TNZ A;  1N0Q A;  4I9C A;  3U3W A;  1MJ0 A;  3E33 A;  4G1T A;  2WXL A;  1HXI A;  2XPZ A;  3HRA A;  4GYY A;  3Q5M A;  3D3M A;  2JEK A;  4UWH A;  1H19 A;  2JLB A;  4I2Z A;  4XEI G;  4U8Y D;  5KJN A;  1H6K A;  4UWG A;  4EZK A;  4TXQ A;  2Y69 E;  2EIM E;  3APC A;  2XCB A;  4I1A A;  2HO1 A;  4FJY A;  3TJP A;  1QYM A;  1OWM A;  3KSQ A;  3P2B A;  3FTU A;  1OCO E;  1HX8 A;  3C3R A;  1PAQ A;  3Q4A B;  3KD7 A;  5CED B;  3IBE A;  3CST A;  3ZHE B;  3U9W A;  2XS1 A;  1EDU A;  4I6G A;  4WNG A;  2J08 A;  2VTB A;  5EYP F;  5JA4 D;  4XE0 A;  1FT2 A;  4N2S A;  2UWJ G;  2QFC A;  3V2O A;  2YNQ A;  3RO3 A;  2R03 A;  4RLY A;  3L9T A;  1IHB A;  4JHJ A;  2AXZ A;  3FUE A;  4L23 A;  1MYO A;  3RO2 A;  4BET A;  2IF4 A;  3QWV A;  3MKQ B;  1E7U A;  2HM8 A;  3MV3 B;  5D2M C;  3Q47 B;  4AY5 A;  4WWO A;  1E90 A;  4FAD A;  4YVQ C;  3C5R A;  2YQ8 A;  5LX8 A;  4ACK A;  4FHK A;  4K5B A;  2MYO A;  2ZIR A;  4GZD A;  5C2Y A;  4F1S A;  3D9L A;  4Y6W A;  3FUL A;  3ULE G;  4WWP A;  4B93 B;  2DYS E;  2IU1 A;  3CGH A;  3L16 A;  4BTA A;  4GMR A;  2EIL E;  3ML8 A;  1IXV A;  4NUR A;  4GPK A;  3HIZ A;  3TXM A;  2OVF A;  5EX0 A;  2XEH A;  3X2Q E;  4Z68 A;  1BI8 B;  5G55 A;  2V5Q C;  2IJG X;  4B8A A;  5A7D B;  2OND A;  5JJ7 A;  3FH5 A;  2AWI A;  2XEN A;  5KWD A;  3CHS A;  3RRN B;  3S7J A;  4YVO A;  4HOQ A;  2F8Y A;  3S7F A;  2AXV A;  4A1S A;  2X3M A;  3L17 A;  3EU9 A;  3NZS A;  5JJT A;  5AAO A;  3SFY A;  4U96 D;  1RZ4 A;  3B7B A;  3Q7A A;  3NBN B;  5CRV A;  3TWW A;  2WM9 A;  4DJA A;  4UQZ A;  1Y8M A;  4IN3 B;  4XZ4 A;  4U95 D;  1DVP A;  2L0T B;  4B8C B;  2XPI A;  1U3D A;  3QWW A;  1MX6 A;  1HG2 A;  4HNA D;  4XX5 A;  1LF8 A;  3CKC A;  4R7L A;  4KXK B;  2XQ0 A;  4U0U A;  3FUH A;  4XIF A;  4KT6 B;  3HXF A;  4G8L A;  1K8K G;  4KVO A;  4TUM A;  1JPL A;  5ENP D;  3DWL G;  5AN8 A;  1EYH A;  3R9M A;  3S2A A;  4PS3 A;  2CHZ A;  2PQR A;  3D9I A;  3AS8 A;  1TN7 A;  5JJ6 A;  4EBA A;  2QYU A;  3T9K A;  3DSV A;  2RFA A;  4DI4 A;  3T8M A;  2LUH A;  1HG5 A;  2DWZ A;  4NAC A;  3E4B A;  3EHM A;  1H6O A;  1K3Z D;  2EIN E;  2V0P A;  1SZA A;  5B1B E;  4MBG A;  1WAO 1;  2ION A;  4DI3 A;  4X8Q A;  3JUI A;  4BFR A;  3UIP C;  3C3O A;  4HS2 A;  4V3I A;  4CGV A;  4RG6 A;  3RU0 A;  2J49 A;  1V55 E;  1HS6 A;  2LXL A;  4GZ6 A;  1DCE A;  2VGX B;  4TUU A;  2XEV A;  5G04 J;  4DK5 A;  3G2T A;  3KEZ A;  2Y3A A;  2DIW A;  2ZGG A;  3GW4 A;  3BG0 B;  5FIN A;  3SF4 A;  3UMV A;  5LCW J;  5CRU A;  3ZYL A;  1S64 A;  2P2C P;  2ETC A;  5G2N A;  1B89 A;  4WWN A;  3UKU G;  3FU5 A;  5FZQ A;  5DIZ A;  1LD8 A;  1FCH A;  4H7Y A;  2YHC A;  2WMO A;  4N5Q A;  4ATG A;  1MQS A;  3APF A;  1NI1 A;  2B6C A;  2XGS A;  2F37 A;  4FLH A;  3TL5 A;  3B95 A;  5G05 C;  1TEZ A;  2LNI A;  2DVW A;  3I3N A;  5B1A E;  3FUM A;  5IY5 E;  4U7E B;  1KT0 A;  5AIJ A;  4FP7 A;  3TWT A;  2V8S E;  1DNP A;  3UT4 A;  1NZN A;  2DYR E;  2Y4U A;  1O1R A;  3JXJ A;  2XCC A;  5LOZ A;  4I6E A;  4G24 A;  1N54 A;  4APF A;  2PL2 A;  4AM9 A;  3PE4 A;  4GTR A;  3AS5 A;  3BG1 B;  3DXK G;  3ESL A;  5FT9 A;  3V31 A;  3EDT B;  1INZ A;  3ULY A;  5BXU A;  2NYJ A;  2GGF A;  4TXR A;  3ZRH A;  4FA6 A;  3IHV A;  3Q7F A;  1K1A A;  4TXP A;  1OWO A;  3FEY A;  4E85 A;  3T8K A;  3D9K A;  3CVU A;  3FTW A;  3CHP A;  3LJ3 A;  1BU9 A;  3MZL B;  1XGW A;  3I5P A;  3SI5 A;  3DEP A;  3GZ2 A;  4C48 B;  3SY2 A;  3Q15 A;  3T5X A;  1YCS B;  3EIJ A;  3DSX A;  3IXE A;  3DSW A;  2XRY A;  3Q9N C;  5AAR A;  1NA0 A;  3FU3 A;  3BQO A;  3NAW A;  3Q79 A;  3CLJ A;  3B7T A;  3ZHE A;  2CG2 A;  2XRZ A;  2XEE A;  2R2L A;  4O1O A;  3CHO A;  3SBS A;  3NOG D;  4OAU C;  3LDZ A;  4Y6C A;  5T3R A;  3N71 A;  3JYS A;  1QZ2 A;  3WXX A;  3NQP A;  3U4T A;  2FO7 A;  1N4P A;  3ZN3 A;  1YMP A;  4UWL A;  3GZ1 A;  1HH8 A;  3SFZ A;  1UJK A;  3MKQ A;  3Q73 A;  5FZR A;  2WXP A;  4CT0 A;  1N11 A;  4J8F A;  3UM3 A;  3CKB A;  5DBK A;  4JHK A;  2WXN A;  3QOU A;  2XGO A;  1AWC B;  1NL4 A;  5ANL A;  2KCK A;  5KJK A;  2J9Q A;  4IRU A;  5CER B;  4K0R A;  4G26 A;  4URK A;  3D9N A;  4D10 C;  4LNU D;  5E76 A;  4DRX E;  1E8X A;  3RKV A;  2DCP A;  4GZC A;  3PS6 A;  3S7B A;  4OAV B;  3UI2 A;  4YDY A;  3CK9 A;  1WM5 A;  3NOC D;  4JD2 G;  3L6A A;  5KBA A;  1BI7 B;  3V2X A;  2YIN A;  3CQG B;  2XGM A;  4ANV A;  1TYQ G;  1W3B A;  2P58 C;  4L2Y A;  4NIK A;  4XKC A;  4DLO A;  1JWF A;  2I1K A;  1PY1 A;  4FU3 A;  3SZ7 A;  2LAH A;  2EIJ E;  3DPD A;  2FI7 A;  3ONL A;  2XS8 A;  3FUI A;  4HBD A;  5HS0 A;  3B7U X;  3UT8 A;  3APD A;  3PZ4 A;  3RJV A;  4EHM A;  3MA5 A;  1SVX A;  4CCA A;  3PZD A;  2WXG A;  3MV2 B;  2CHX A;  4BY6 A;  1HE8 A;  4M7C A;  3EIQ C;  3V30 A;  4L9P A;  5FZS A;  5C1D A;  4HQD A;  2RFM A;  3DST A;  3CVQ A;  3SQV A;  4HI8 A;  3IEG A;  4CRW A;  4ZHB A;  4QFV A;  1EF1 C;  3CK8 A;  4M3O A;  4OYS A;  3R9A B;  4CEM A;  4BTB A;  1WG0 A;  3CK7 A;  3CHM A;  5H7P A;  1ZU2 A;  4GTS A;  4BSZ B;  5A6C A;  2XZT G;  3Q49 B;  4EZJ A;  1A5E A;  2VSX E;  1IQU A;  2X6I A;  4AY6 A;  4WAF A;  3L54 A;  1V54 E;  5AQ9 A;  3PZ3 A;  3SO8 A;  4KMO A;  1TN8 A;  3S7D A;  4LG6 A;  1TJF A;  2FUL A;  5BT1 A;  4GA1 A;  4F1P A;  2L6B A;  4EEC A;  2VGX A;  5JHB A;  3PZ1 A;  2V4H C;  3ZYM A;  2GRN B;  3UKR G;  1KLX A;  2BTD A;  3B13 A;  4PH4 B;  4MRU A;  2WXO A;  4ME2 A;  1OCZ E;  3TG5 A;  4W9R A;  3AG2 E;  4IUL A;  2X6K A;  4J6I A;  4J8S A;  4ILH B;  2KXP C;  3TGO A;  3SHF A;  1Z3Y A;  3TG4 A;  3ML9 A;  3DEO A;  2ETB A;  4LSZ E;  3T5V A;  1OT8 A;  4HRL A;  4J0U A;  1LD7 A;  1O1T A;  3IHY A;  2L6J A;  4ZFH A;  3MKR A;  4F3V A;  3CVY A;  4QQI A;  2H6I A;  3O4Z A;  5EKQ D;  2P9I G;  2ZU6 B;  4KYO B;  1PC2 A;  1TNY A;  4NQ0 A;  4J8Y A;  4WUY A;  1NP7 A;  1BLX B;  3AG3 E;  4GMJ A;  5HI7 A;  3SGH A;  1QBQ A;  4A3T A;  1HZ4 A;  3FUJ A;  1OWL A;  1OCR E;  1ELK A;  4CGW A;  3DRA A;  2AVP A;  3VTX A;  3QAR A;  5A23 A;  3BEE A;  3PE3 A;  1VDY A;  4DX6 D;  3ABK E;  2GRO B;  3PRE A;  1GW6 A;  2OEW A;  4N3B A;  4K03 A;  5BV1 A;  3G2S A;  2FEZ A;  3LS8 A;  4N3A A;  3LPZ A;  5AEN A;  2FO1 E;  3ASG A;  4JL0 A;  1Z6T A;  1HU3 A;  1FT1 A;  5BNW A;  4MKT A;  2P9S G;  5ENN A;  2QC9 A;  2KBX A;  2L0I A;  4UWF A;  4GAA A;  2QYJ A;  3PZ2 A;  5KNG A;  4A63 B;  1WY6 A;  5ANR A;  3NZU A;  3ESK A;  1RW2 A;  3SNX A;  2XZD G;  4OVV A;  4TRQ A;  2CFZ A;  1OY3 D;  3ENE A;  1IYG A;  2BUG A;  3D9O A;  2P9K G;  1MZC A;  4BT9 A;  4ILI A;  2A4Z A;  1KZO A;  2OEV A;  3CVP A;  2M63 A;  3QJZ A;  3CHQ A;  4N39 A;  5CBO A;  4MLP A;  4GTO A;  4JEH A;  4CT4 A;  3CVL A;  4CDN A;  3FTV A;  5CMY A;  4YDW A;  2IOS A;  1YA0 A;  4BX9 A;  2WQ7 A;  3ZYQ A;  3TAX A;  1Q2Z A;  3ZXS A;  3FH8 A;  1E8Y A;  5AJL A;  4AEZ C;  4L2L A;  2GRM A;  3MJW A;  2R05 A;  4J7W A;  2LSV A;  1SW6 A;  1LTX A;  2XHE A;  5AJD A;  3UT7 A;  3J5Q B;  5EDS A;  5AQ7 A;  1X81 A;  3LXU X;  4AVX A;  3C72 A;  2WXM A;  1UW4 B;  2OOE A;  3RIB A;  2C0L A;  4UWK A;  1SA5 A;  2R17 C;  1O1S A;  1DCQ A;  3FP3 A;  2V5F A;  2P9L G;  2LSU A;  4BT8 A;  3FTS A;  4KZ0 A;  2HR2 A;  4HRN A;  3PNL B;  2L9B A;  3GYZ A;  2X6H A;  3PEV B;  5AQB A;  3R7R A;  3QKY A;  2A5U A;  3ZEF A;  3RSE G;  2NSZ A;  3JCK C;  3LVR E;  2JAB A;  4DLQ A;  4GU5 A;  1TN6 A;  2IEJ A;  2BKK B;  3LY8 A;  2VJ8 A;  1ELR A;  5LP0 A;  2H6F A;  5B3S E;  2CFU A;  2AW6 A;  1Y6I A;  3MYV A;  3AU4 A;  1MX4 A;  3JUE A;  3QNK A;  2NC9 A;  2QY7 A;  4I6J A;  5ITZ F;  1H2T C;  4HOS A;  1NA3 A;  2OV8 A;  4GPM A; 
#chains in the Genus database with same CATH homology
 5J90 A;  3RO2 A;  2IF4 A;  2UY1 A;  3QWV A;  1OWP A;  5FQ8 A;  4BWR A;  4G2V A;  5FTP A;  3L6A A;  3MKQ B;  1E7U A;  2HM8 A;  3MV3 B;  1JUQ A;  2YIN A;  3CQG B;  3U66 A;  2WXQ A;  2XGM A;  3FDH A;  3Q47 B;  4I17 A;  4ANV A;  4AY5 A;  2PQN A;  3PRZ A;  4WWO A;  3FTY A;  1E90 A;  1ELW A;  1W3B A;  1P5Q A;  2P58 C;  3HVE A;  4L2Y A;  3CHR A;  4XKC A;  2YQ8 A;  3QC1 A;  4YVQ C;  4DLO A;  4FAD A;  5LX8 A;  4ACK A;  1JWF A;  4FHK A;  3NF1 A;  2I1K A;  1PY1 A;  4FU3 A;  4JPS A;  3SZ7 A;  3UX4 A;  4GB9 A;  3FUK A;  2VTB B;  2LAH A;  4GZD A;  3DPD A;  3VLE A;  5C2Y A;  4F1S A;  2FI7 A;  3ONL A;  4AV7 A;  2X38 A;  3D9L A;  2KM4 A;  2J07 A;  3FUI A;  4WNF A;  4GA0 A;  2KZT A;  4Y6W A;  3FUL A;  4WWP A;  4Q96 A;  3B7U X;  3UT8 A;  3APD A;  4J8D A;  3HDX A;  2IU1 A;  4AP2 A;  4N5C A;  3RJV A;  2J09 A;  3CGH A;  3L16 A;  3LY9 A;  4FUL A;  3MA5 A;  4BTA A;  3ULQ A;  4CDR A;  3PVL A;  2RG8 A;  4CCA A;  3PZD A;  4ACL A;  2WXG A;  3QWP A;  3ML8 A;  3MV2 B;  2UY1 B;  2CHX A;  4NUR A;  4BY6 A;  1HE8 A;  1BPO A;  3HIZ A;  4FJZ A;  3TXM A;  4GPK A;  2OVF A;  1X5B A;  4PUC A;  3EIQ C;  3MCX A;  5EX0 A;  2GRL A;  3L13 A;  1EPU A;  5FZS A;  3R7Q A;  2IOL A;  5C1D A;  4JA9 A;  5BPP A;  2NXP A;  4DPR A;  5G55 A;  4E6H A;  4N3C A;  4BSX A;  1UN9 A;  3HVE B;  3ZGQ A;  3CVQ A;  2IJG X;  4B8A A;  5A7D B;  2VYI A;  4I43 A;  2OND A;  5JJ7 A;  3FH5 A;  3IEG A;  3VTY A;  3ASF A;  3FU6 A;  5FQ6 A;  2AWI A;  4CRW A;  4QFV A;  1EF1 C;  2WQH A;  3CHS A;  3CK8 A;  5LFA A;  4UI9 J;  4Q94 A;  3RRN B;  3S7J A;  2VSN A;  4M3O A;  4OYS A;  4UQY A;  4YVO A;  3R9A B;  5G04 C;  4CEM A;  4HVB A;  4HOQ A;  2KC7 A;  4BTB A;  3ASH A;  3CK7 A;  2I9C A;  3OTN A;  3CHM A;  3S7F A;  3VLF A;  2AXV A;  4A1S A;  1ZU2 A;  2X3M A;  3L17 A;  4B89 A;  1UJJ A;  4I1O B;  2MRI A;  5A6C A;  3NZS A;  4CDM A;  3OXF A;  2CG3 A;  2R5S A;  5LCW C;  4UI9 K;  1IHG A;  5JJT A;  3Q49 B;  4EZJ A;  2VSX E;  4HLE A;  1IQU A;  4JW1 A;  2E0I A;  2X6I A;  3UUX A;  3P1U A;  3QK0 A;  4GZ3 A;  3UQ3 A;  3ONK A;  5JHA A;  4AY6 A;  3UPV A;  4WAF A;  4AIF A;  3L22 A;  2WM9 A;  3L54 A;  4DJA A;  2PM7 A;  4UQZ A;  1Y8M A;  3MEK A;  5T4Y A;  4XI0 A;  4B94 A;  3G2V A;  4IN3 B;  4XZ4 A;  5KJM A;  4A3V A;  2VGY A;  1DVP A;  2L0T B;  4B8C B;  4KMO A;  2XPI A;  1H2V C;  2PM6 A;  1U3D A;  3QWW A;  3LEW A;  3S7D A;  1HG2 A;  2IFU A;  3RRU A;  1TJF A;  2KCL A;  3FEX A;  1LF8 A;  2FUL A;  2LAI A;  3CSF A;  3PUK A;  4XX5 A;  5BT1 A;  4FHJ A;  2I6H A;  3CKC A;  4N2Q A;  4FC8 A;  4R7L A;  1H0A A;  1Z3X A;  4GA1 A;  5D0O D;  5J08 A;  5CCM A;  4KXK B;  2XQ0 A;  4EEC A;  4U0U A;  2VGX A;  3FUH A;  4KT6 B;  4XIF A;  5JHB A;  2BF0 X;  4KBQ A;  5FJY A;  3LVQ E;  4KVO A;  4FLB A;  3ZYM A;  4A1G A;  1JPL A;  1KLX A;  3I4G A;  4ILG A;  4PS7 A;  4U07 A;  1E8W A;  2BTD A;  1EYH A;  3B13 A;  3S2A A;  3CR3 A;  4PH4 B;  3KS2 A;  4PS3 A;  2CHZ A;  4MRU A;  2WXO A;  3QAQ A;  3CEQ A;  3JQ0 A;  2PQR A;  3B7S A;  1SQM A;  3D9I A;  3PUJ A;  3AS8 A;  3CVV A;  2GW1 A;  4ME2 A;  5JJ6 A;  4EBA A;  1E96 B;  3TG5 A;  4HXI A;  4DI4 A;  3T8M A;  4HOR A;  1HG5 A;  4U8H A;  4W9R A;  4NAC A;  3E4B A;  3CV0 A;  3EHM A;  3LCA A;  4IUL A;  2X6K A;  3OAW A;  5ARF A;  4J6I A;  4J8S A;  2V0P A;  3C98 A;  1SZA A;  4ILH B;  4J8E A;  3PEU B;  1WAO 1;  2ION A;  3FUF A;  4JXT A;  3PNT B;  5AYW D;  3TGO A;  5CHE E;  3FY4 A;  3SHF A;  1Z3Y A;  4DI3 A;  5CCL A;  5ARG A;  4L7T A;  3TG4 A;  3JUI A;  4BFR A;  4HS2 A;  3ML9 A;  2WXH A;  4V3I A;  3SD5 A;  4CGV A;  5KCM A;  3RK6 A;  4WNE A;  4RG6 A;  3RU0 A;  2J49 A;  2X6J A;  3QB2 A;  4HOT A;  3T5V A;  1HS6 A;  4HOU A;  2LO6 A;  4GZ6 A;  3ZIM A;  2VGX B;  4J0U A;  4TUU A;  2XEV A;  5G04 J;  4DK5 A;  3G2T A;  3KEZ A;  2WXK A;  1KT1 A;  2Y3A A;  3IHY A;  2L6J A;  2DIW A;  2J4B A;  3MKR A;  3CQC B;  4F3V A;  3CVY A;  2MOW A;  1H2U A;  2Q7F A;  4U0S A;  3GW4 A;  3BG0 B;  3O4Z A;  5EKQ D;  3ZVV A;  3SF4 A;  3GZS A;  1HFA A;  3UMV A;  2ZU6 B;  2VSO E;  2I1J A;  1FVH A;  2KCV A;  2WMN A;  2WXR A;  4LUN U;  4PDX A;  3ZYL A;  5LCW J;  2EQX A;  3CVX A;  2CHW A;  4KYO B;  1PC2 A;  4UQX A;  1E7V A;  2DBA A;  4NQ0 A;  4RVB A;  2Y4T A;  3D9P A;  4WUY A;  1NP7 A;  3FU0 A;  4GMJ A;  5HI7 A;  4EQF A;  5G2N A;  3SGH A;  4A55 A;  4WND A;  2E2E A;  2YHE A;  1OUV A;  1TJC A;  2MHK A;  1B89 A;  4Q69 A;  4WWN A;  4NRH B;  4A3T A;  1HZ4 A;  2KZT B;  4AOF A;  3FUJ A;  4MS6 A;  1OWL A;  1U3C A;  3ZW3 A;  4XKB A;  3FU5 A;  5FZQ A;  5DIZ A;  1HO8 A;  1ELK A;  1FCH A;  4CGW A;  1S0P A;  4H7Y A;  1N52 A;  2AVP A;  2WMO A;  2YHC A;  3VTX A;  4ATG A;  3QAR A;  4GML A;  1MQS A;  5A23 A;  3APF A;  3CIA A;  4GA2 A;  4I1M A;  2XGS A;  4FLH A;  4L1B A;  3TL5 A;  5G05 C;  1TEZ A;  3BEE A;  3PE3 A;  1VDY A;  2LNI A;  1A17 A;  3I3N A;  3U64 A;  4KZC A;  3FUM A;  3PRE A;  4O6F A;  1GW6 A;  5M72 A;  3QDN A;  4N3B A;  4K03 A;  3HHM A;  1KT0 A;  1ZBP A;  5BV1 A;  4ABN A;  5AIJ A;  5KJL A;  3G2S A;  4FP7 A;  2X6F A;  4U0Z A;  2FEZ A;  3AS4 A;  3JQ1 A;  3LS8 A;  2WXI A;  2V8S E;  4N3A A;  4JHR A;  1DNP A;  3LPZ A;  4JA7 A;  3TXN A;  1L5J A;  3ASG A;  5AEN A;  4JL0 A;  5HQ8 A;  4KVM A;  4UI9 C;  3UT4 A;  1Z6T A;  4F53 A;  4IYP A;  2WPV A;  4TV3 A;  1HU3 A;  1NZN A;  2KAT A;  3FUD A;  4ANU A;  2Y4U A;  5BNW A;  5CMW A;  1OWN A;  2R59 A;  4MKT A;  2XCC A;  3FTZ A;  5LOZ A;  3IKO B;  3G2U A;  4I6E A;  5ENN A;  3ASD A;  3I4R B;  1UN8 A;  1UG3 A;  4G24 A;  2PZI A;  1N54 A;  2L0I A;  4APF A;  1E8Z A;  4UWF A;  2PL2 A;  3D9M A;  2ILR A;  4G25 A;  3HYM B;  4GAA A;  4AM9 A;  3PE4 A;  3AS5 A;  4I2W A;  1FVF A;  3BG1 B;  3ESL A;  2I2O A;  5FT9 A;  3DBS A;  4XI9 A;  3EDT B;  4C0E A;  1WY6 A;  1INZ A;  5ANR A;  3NZU A;  3LY7 A;  2WXJ A;  3ESK A;  3SNX A;  4OVV A;  4TRQ A;  5E75 A;  3G2W A;  2CFZ A;  3ENE A;  4CT0 A;  5BUZ A;  1IYG A;  2BUG A;  1QQE A;  2GGF A;  3D9O A;  4PS8 A;  3ZRH A;  1MHQ A;  3IHV A;  4FA6 A;  2AXU A;  4BT9 A;  3FH7 A;  3LKU A;  4LRZ A;  1HF8 A;  3IV0 A;  2WVI A;  5EX3 A;  4F7A A;  4ILI A;  1OWO A;  4RSY A;  4LER A;  3FEY A;  2A4Z A;  3FHE A;  4E85 A;  3PH0 C;  5BV0 A;  4EBA G;  3D9K A;  3CVU A;  3FTW A;  2C0M A;  4G11 A;  3CVW A;  3CHP A;  4H7X A;  2WB2 A;  3LJ3 A;  4JC8 A;  3CVP A;  3ZPJ A;  3URZ A;  2M63 A;  3QJZ A;  4ANX A;  3CHQ A;  3L08 A;  4N39 A;  3MZL B;  1XGW A;  4MLP A;  3I5P A;  3SI5 A;  3GZ2 A;  1IQR A;  3Q15 A;  4GCN A;  3RRM B;  3T5X A;  4HFG A;  3EIJ A;  4JEH A;  5FQ7 A;  5FWQ A;  4CT4 A;  3ZFW A;  2XRY A;  3CVL A;  4CDN A;  2FF4 A;  1NA0 A;  2XPY A;  3FU3 A;  3KAE A;  3FTV A;  5CMY A;  2VQ2 A;  5D0Q D;  4AXH A;  5T8I A;  2IOS A;  1YA0 A;  4BX9 A;  2WQ7 A;  4GYW A;  1SZ9 A;  3ZYQ A;  4RG9 A;  3TAX A;  3ZXS A;  3FH8 A;  1E8Y A;  4LEU A;  5AJL A;  3EJN A;  4AEZ C;  3CLJ A;  2FBN A;  3B7T A;  2IQC A;  4L2L A;  3ZHE A;  2GRM A;  4I9E A;  3MJW A;  2CG2 A;  3ZYK A;  2LSV A;  2C2L A;  4GCO A;  3LYA A;  2XHE A;  5AJD A;  3UT7 A;  4I9C A;  3SBT B;  4APO A;  4C0M A;  2XRZ A;  3U3W A;  5EDS A;  5G05 J;  3CHO A;  3SBS A;  3LXU X;  4G1T A;  4AVX A;  2WXM A;  3VLD A;  1UW4 B;  2OOE A;  3RIB A;  2WXL A;  5FQ4 A;  3CVN A;  3LDZ A;  4BX8 A;  4Y6C A;  5T3R A;  4C9B B;  1HXI A;  2XPZ A;  3AU5 A;  2C0L A;  3N71 A;  4UWK A;  1XNF A;  2OVB A;  3JYS A;  1QZ2 A;  4GYY A;  5BW8 C;  2R17 C;  3Q5M A;  4JEU A;  3D3M A;  3WXX A;  2JEK A;  4UWH A;  1H19 A;  3NQP A;  2JLB A;  4I2Z A;  3U4T A;  2FO7 A;  1QNF A;  2HYZ A;  5KJN A;  1H6K A;  4UWG A;  3FP3 A;  4EZK A;  4LCT A;  2V5F A;  3FFL A;  3EHN A;  3ZN3 A;  4UWL A;  2LSU A;  3GZ1 A;  4OVU A;  1HH8 A;  2XCB A;  3APC A;  1UJK A;  3FWV A;  3SFZ A;  3MKQ A;  5FZR A;  2WXP A;  3B7R L;  2HO1 A;  4I1A A;  4BT8 A;  4FJY A;  3FTS A;  4J8F A;  4KZ0 A;  2HR2 A;  4JVS A;  2VSY A;  3PNL B;  4EZL A;  2L9B A;  3GYZ A;  3CKB A;  3MGB A;  3OXL A;  2X6H A;  4JHK A;  2J4D A;  5DBK A;  3TJP A;  2WXN A;  3PEV B;  1OWM A;  3P2B A;  3FTU A;  4GYO A;  1HX8 A;  4AJW A;  3MX3 A;  3O48 A;  3R7R A;  3QKY A;  3QOU A;  1PAQ A;  2A5U A;  3ZEF A;  3Q4A B;  3FTX A;  3KD7 A;  4ANW A;  4P29 A;  3IBE A;  3CST A;  2NSZ A;  3JCK C;  3ZHE B;  2XGO A;  3OXG A;  3LVR E;  3U9W A;  4G23 A;  2WXF A;  4DLQ A;  1EDU A;  2RD0 A;  4GU5 A;  4JZY A;  2WQ6 A;  4I6G A;  5ANL A;  4WNG A;  4YND A;  2J08 A;  2VTB A;  2KCK A;  3LY8 A;  5KJK A;  4U63 A;  2VJ8 A;  2J9Q A;  4IRU A;  1ELR A;  5LP0 A;  4XE0 A;  4N2S A;  4K0R A;  2CFU A;  4G26 A;  2AW6 A;  2V4L A;  4URK A;  1Y6I A;  2UWJ G;  2QFC A;  3D9N A;  4D10 C;  3MYV A;  5E76 A;  2YNQ A;  1E8X A;  3AU4 A;  3PDN A;  4U04 A;  3RKV A;  3RO3 A;  2DCP A;  4GZC A;  3QNK A;  4B0Z A;  2NC9 A;  2QY7 A;  3D9J A;  3PS6 A;  3FUN A;  3S7B A;  4EPZ A;  4I6J A;  3K9I A;  3CK9 A;  4JHJ A;  1H2T C;  4HOS A;  4GZ5 A;  1NA3 A;  1JWG A;  2AXZ A;  2OV8 A;  1WM5 A;  3FUE A;  4L23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...