3D3MA

The crystal structure of the c-terminal region of death associated protein 5(dap5)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
168
structure length
161
Chain Sequence
LLKLEKELLKQIKLDPSPQTIYKWIKDNISPKLHVDKGFVNILMTSFLQYISSEVNPPSAPSKEQLEQEKQLLLSFKPVMQKFLHDHVDLQVSALYALQVHCYNSNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQWLTWLETA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of the C-terminal DAP5/p97 domain sheds light on the molecular basis for its processing by caspase cleavage.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
molecule keywords Eukaryotic translation initiation factor 4 gamma 2
total genus 64
structure length 161
sequence length 168
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3d3mA00
1UW4B 4CEMA 3FEYA 2FULA 4CT4A 4JHJA 4B89A 2ZU6B 3FEXA 1HU3A 4B8AA 2I2OA 4JHKA 2IU1A 2KZTB 4GMJA 5ANRA 4B8CB 1N54A 4LUNU 1UG3A 3EIQC 2GGFA 1H2TC 2IONA 2IOSA 1H2UA 1H2VC 3EIJA 2NSZA 2IOLA 4CRWA 1PAQA 2KZTA 2VSXE 4GMLA 3D3MA 3JUIA 2HM8A 4C9BB 3RK6A 2RG8A 1H6KA 3L6AA 4IULA 2VSOE 1N52A
chains in the Genus database with same CATH superfamily
5HKPA 2AVPA 5FWQA 2L6JA 4U8VD 3L16A 5BPPA 2X6FA 5BXUA 1HFAA 3ASFA 3U9WA 4WNEA 2LAIA 4WWOA 4UWLA 1TEZA 3ZW3A 3URZA 4X8QA 1H19A 3RRMB 3PUJA 1K1BA 3C3QA 2XENA 4JA9A 3DSTA 2X38A 4HLEA 2BKGA 1LD7A 5CHEE 5CMWA 4IN3B 5A6CA 1B89A 5LCWC 2CFUA 2WMNA 3MJWA 4L23A 3UQ3A 4DX6D 3RAUA 4JHJA 2GRRB 5BV0A 5JJTA 5KJKA 5ANRA 1VDYA 3CLJA 3B13A 2XRZA 3CSFA 2X6JA 4HLLA 1XGWA 1X5BA 4GB9A 1MQSA 5J90A 1H6PA 2GRPB 2WXQA 2IEJA 1RZ4A 3OXLA 5LOZA 4CT0A 1G3NB 3FTVA 1MX6A 1MHQA 4JVSA 2WVIA 1TJCA 2C0LA 4CDNA 4H7YA 1UN9A 3QOUA 2P9UG 3C98A 5FQ6A 4H7XA 1N4PA 3RRNB 1N52A 3IXEA 4GTPA 3UPVA 2VSNA 4B8AA 3ULEG 4I2ZA 3S7BA 3X2QE 4PS8A 1N0RA 3P1UA 4K0RA 1TNYA 1W3BA 3RO3A 5FZSA 4AM9A 3ZXPA 5AYWD 1TNOA 1S0PA 3ZRHA 1E7UA 2J4DA 5KCMA 1DVPA 2ZGGA 3ZHEB 4N3CA 3SD5A 3V2XA 4Y6WA 4G2VA 3LJ3A 2PL2A 3RO2A 2E2EA 2KXPC 1OCCE 2IO2C 2C0MA 4N5QA 2YNQA 1A5EA 3J5PA 4DX7D 1N54A 3FU3A 5J08A 3WXXA 3TGOA 1O5MA 3KD7A 2VJ8A 3CR3A 4DX1A 4FC8A 2QZAA 1ZBPA 4EECA 5ANLA 3UM0A 4B89A 3MYVA 2J9QA 1HU3A 4U8YD 4A55A 1N4RA 1JWFA 1N9AA 3Q78A 4UQZA 4GZDA 1U2VG 5BUZA 4I1OB 5FZRA 3PNTB 4JC8A 4PDXA 3AU4A 5EDSA 3BUAA 4APOA 4N3BA 4JZYA 1AP7A 3ZHEA 4LNGA 3G2VA 2LO6A 3ASNE 4CRWA 5JJ7A 4CYMD 4QQIA 2QFCA 4M7CA 3DPYA 2LNIA 3QWWA 2CG3A 4KZCA 3CVUA 1TR4A 4DX2A 3TJPA 4HRLA 2WXPA 4F1SA 5KNGA 4ABNA 3SBSA 2EILE 3CGHA 2VTBA 3FP3A 2PM6A 2YQ8A 3RK6A 4I9CA 4AJWA 3OTNA 3HVEA 2XS1A 3VLDA 4GPMA 5E76A 2XEHA 1UOHA 4TRQA 4WNDA 3ISMC 4UQXA 3EUVA 3E33A 4KXKB 1Y8MA 5FQ4A 5EX3A 3TWQA 5KJNA 3CEQA 3PDNA 2J8SD 3CK7A 4I1AA 2Y3AA 4OAUC 3RU0A 2GRQB 3AU5A 4PUCA 1P5QA 4GCNA 3ZEFA 5G04J 2J4BA 1MJ0A 4O1PA 1OCOE 1IYGA 4DLQA 3U66A 1N95A 3IBEA 4JL0A 3SFZA 3R7RA 3CVNA 4A63B 4XKBA 1N4SA 3ZGQA 4YDOA 3VTYA 1PC2A 2R59A 2AXZA 3FEYA 3PZDA 4GYYA 2RFAA 4GTMA 2HE0A 4U0UA 3DEPA 3ULYA 3FHEA 4BETA 2KCKA 4RG6A 2ZXWE 3SHFA 4FA6A 2IY0C 4HBDA 3IV0A 2OVFA 1H6OA 2VYIA 4MKTA 3FUFA 3HYMB 3DWLG 2UY1A 2L0TB 4KT6B 4U8HA 2XPZA 3TWWA 2WQ7A 1IQRA 2EIJE 5D0QD 4C9BB 2OEVA 3IKOB 3OXGA 1JUQA 2ILRA 2H6IA 2YINA 4GZ3A 5ENOD 4DLOA 4U07A 3PRZA 3UT4A 4FHJA 5FTPA 2X6HA 2VGEA 5HI7A 3DXMG 2XEEA 5IY5E 3RSEG 4DK5A 4L2LA 4ME2A 3CKCA 4EBAG 1SQMA 4CDRA 2VGXA 1EF1C 1S64A 5FINA 3SY2A 3T5XA 3C5RA 4WUYA 1MYOA 1H0AA 4G8KA 2FO7A 3QNKA 2B0OE 4GTQA 4DX5D 5D0OD 3D9JA 2XEVA 2I2OA 2QYUA 3T8KA 3SBTB 1WG0A 3JYSA 2CG2A 1HXIA 4BWRA 4JB8P 3NAWA 2UWJG 3HVEB 3SI5A 5FZQA 3EHQA 3JUEA 4J8YA 2LUHA 2IQCA 4N5CA 5T3RA 1FVHA 2J09A 4KZ0A 4Q96A 2KM4A 2UY1B 4MLPA 5AQ9A 4DPRA 3BQOA 3ASDA 1TNUA 1D8DA 5JHAA 4GA0A 4F7AA 3T8MA 3VTXA 3TAXA 5KJLA 4HORA 4CGVA 2LSUA 4L9PA 4W9RA 5BV1A 1Z3YA 4HRMB 3EIQC 3CHSA 3QB2A 1HZ4A 2WXHA 2DBAA 4HOQA 4EPZA 3JCKC 2MYOA 5CECB 2KATA 3QDNA 4I6JA 4AVXA 3SZ7A 4FHKA 2A5UA 4GA2A 4U7EB 3AG1E 3BG0B 4O1OA 3AS5A 2MHKA 3FWVA 4I43A 4N2QA 1DCQA 3UT7A 3C72A 1MZCA 4YDYA 3LY7A 3PREA 2HR2A 5AQBA 3TXNA 1FCHA 5CRUA 3UI2A 2I1KA 4U0SA 2EQXA 3MKRA 2WXLA 4HRNA 3TWTA 3LVRE 3UIOC 3Q7FA 4A1SA 3DRAA 4KMOA 3TG4A 2QY7A 4RLYA 4MS6A 3L6AA 4IULA 2J08A 4NURA 4J8FA 4XKCA 3CK8A 2IJGX 4FLHA 2GRMA 3ESKA 1E7VA 1IXVA 4HOUA 2BF0X 4ANWA 4JW1A 5ENRD 2NSZA 1MX4A 2P9LG 3CQGB 4F3VA 4ANUA 3JUIA 3L13A 3GZ1A 4Z68A 1N94A 5CBNA 4TXRA 2WXGA 3ABKE 4UWFA 4B94A 4LCTA 2C2LA 4WAFA 2LAHA 1TJFA 4C0MA 3ABME 3DPDA 4J7WA 4EHMA 2PM7A 1Z6TA 4OVUA 4GMLA 3D9LA 2RFMA 5CMYA 1OWMA 3DSXA 3UM3A 4F6RD 4B0ZA 3FH7A 3B7UX 2DWZA 4UWKA 1QYMA 3B7TA 3CSTA 3FY4A 1FT1A 3ZXSA 2X3MA 1MX2A 4I6GA 4XEIG 3ZKJA 4RVBA 2V5FA 4J6IA 1TN7A 2J49A 2V4HC 3ZYMA 3FTUA 3LY8A 3OXFA 4J0UA 2BTDA 4I2WA 1JCSA 4UWGA 4K5CA 2GW1A 1JWGA 4GZ5A 2FO1E 2IF4A 2Q7FA 2NYJA 1YMPA 2XRYA 4BTAA 4GZCA 3PZ3A 1LD8A 3CHRA 4DRXE 4FP7A 3N71A 3FUHA 4NACA 3DSWA 4F1PA 4CEMA 4GZ6A 4GPKA 1K1AA 4A1GA 4JHRA 3MEKA 3E34A 3HXCA 4XI0A 3CHQA 1HG2A 3CIAA 3I5PA 3Q5MA 4XI9A 1TNBA 3NBNB 1DCEA 4KVOA 1SZAA 3CHMA 3KEZA 3PE4A 2R05A 3NF1A 3PZ2A 3I4RB 4GTTA 3GZ2A 4CGWA 4L1BA 2R03A 5AJLA 3Q9UC 1RW2A 4BX9A 3GYZA 1FVFA 5FQ8A 3UXGA 2I9CA 3CVQA 3K9IA 5HRYA 1OY3D 3LVQE 3Q7AA 1LTXA 3LKUA 4FADA 4GTRA 5T8IA 3UM2A 4GYWA 4OVVA 4KYOB 4CZ2D 1N11A 4PS7A 3FH8A 2Y4UA 2XCCA 1E8YA 3AJIA 4BX8A 2WQHA 4ANXA 4JD2G 3ASGA 2VQ2A 1A17A 2AJAA 3L82A 3L08A 4BTBA 2IU1A 2KZTB 3ZN3A 3G2UA 2GRLA 5FT9A 4UI9K 3QWVA 5JMND 4AEZC 4HI8A 2RG8A 1NFIE 3E4BA 4JEUA 3UX4A 2GRNB 3V31A 1IKND 4V3IA 3CVVA 4UQYA 3QWPA 4B8CB 3MCXA 4I9EA 1QZ2A 4L7TA 2EIKE 4JEHA 3KEAA 3IEGA 1SW6A 5LFAA 2P2CP 2NXPA 1D9SA 3WG7E 5ARGA 2B6CA 3DEOA 1GW6A 4DUIA 2WXOA 1Y6IA 3QARA 1O1RA 2WXKA 5H7PA 4ANVA 3LEWA 4ZFHA 5C1DA 1ELWA 3BG1B 3L9TA 3AG2E 2OCCE 2Y1LE 2XGMA 2IOLA 5LX8A 4GTOA 5BW8C 3AG4E 2FEZA 3HHMA 1QBQA 3VLFA 2PQNA 3LXUX 4LG6A 4OAVB 1SZ9A 1OWOA 3CQCB 2H6GA 2FBNA 2MRIA 1JCQA 2EIME 2RD0A 2WXFA 4E85A 3F6QA 4E6HA 4G23A 3R9MA 2AXUA 4TV3A 1OCZE 1TN8A 3PS6A 3LY9A 3TWXA 4GA1A 2ETCA 4J8DA 1HO8A 3VLEA 3D9IA 1PAQA 2XHEA 3TXMA 2PNNA 3D9PA 1H6KA 5CBOA 1HE8A 1V54E 3ZPJA 2CHZA 3JQ0A 5AARA 5B1BE 3AG3E 2V0PA 4YDWA 1KZPA 3NQPA 2CFZA 3ABLE 3MKQA 5G2NA 5EN5D 2ZU6B 2LXLA 4Q94A 4XE0A 3FUIA 3SF4A 3E30A 3EU5A 3IHYA 3RIBA 4BERA 1KLXA 4UI9C 4EZKA 3V30A 2XPIA 5EIDA 3EHNA 2KC7A 1Z3XA 4NRHB 4XX5A 4HXIA 3L17A 2WXRA 1DC2A 3UKRG 2OEWA 3U4TA 2X6IA 3PVLA 5HQ8A 1IHGA 4DI3A 1KPSB 4GU5A 3MV2B 4CT4A 2P9KG 3FUDA 3PNLB 2DZOA 2MOWA 2R2LA 3JXJA 4RG9A 5G04C 4O60A 2WXIA 4K5BA 3TWUA 1HX8A 1E8XA 4MBGA 2YHCA 3UMVA 1SA4A 3CKBA 5JJ6A 3HXEA 3LS8A 3G2WA 5ITZF 2DIWA 3S7FA 1BI8B 2XS8A 2H6HA 4WWPA 4BFRA 4GCOA 1H2UA 3HXDA 4U95D 3KS2A 3ASHA 4OYSA 4B93B 5AENA 3D9KA 3ONLA 4ACKA 4HVBA 3G2SA 1WAO1 3PE3A 1UJKA 4FLBA 3Q79A 4AV7A 4KBQA 3CVPA 3MA5A 3L54A 1BLXB 2ETAA 5EX0A 3APCA 3O48A 4ATGA 4N2SA 3B95A 5EYLA 2HM8A 2XPYA 5AN8A 3ZYQA 3ZU7B 4BT9A 5E75A 3DSUA 1H2TC 1TN6A 1KT0A 2AXVA 2IOSA 2Y69E 2V5QC 1PY1A 3Q47B 4ILGA 3E32A 1OWNA 2R17C 3EDTB 3AAAC 2KCVA 3FU5A 3ENEA 5M72A 4CCAA 3P2BA 3TL5A 5KWDA 3IHVA 3UTMA 4UI9J 3CK9A 5EYPF 3MGBA 2WM9A 3S7JA 1UJJA 4Q69A 4BESA 2XGSA 4N3AA 2F37A 2PQRA 2VSYA 3NZUA 2CHXA 4LSZE 1E96B 4NIKA 5BXOA 1YCSB 4LUNU 3T9KA 2P9PG 2IONA 3FUMA 1ZU2A 1V55E 2JABA 5DIZA 1S63A 3APDA 3R9AB 1FPPA 1OCRE 4HB5A 5ARFA 3Q4AB 4AY5A 3ZFWA 1Z5SC 1AWCB 2RKKA 3QC1A 2QYJA 2LXMA 2XQ0A 4EQFA 1JCRA 1FT2A 2R02A 3CHPA 2P9NG 1HH8A 2I6HA 3TWVA 4YVOA 3GW4A 3SGHA 4R7LA 4D10C 4GTVA 5JHBA 3HRAA 1EPUA 3V79K 4JHKA 3D9HA 4URKA 1KT1A 3CHOA 3W9GA 2X6KA 3QAQA 4TUUA 4WNGA 1IQUA 3FU0A 3NOGD 3ZYKA 2JEKA 2L6BA 1E8WA 2VSXE 3NB2A 4F53A 3SNXA 3PH0C 4XZ4A 1SVXA 4A3VA 3UUXA 4BSZB 4KVMA 4GMJA 1BD8A 3NZSA 2WPVA 3EIJA 3ZUVB 3HXFA 3UIPC 5AQ7A 3HIZA 5ENPD 2FF4A 2P58C 1E8ZA 3ONKA 1ELKA 3FEXA 4YNDA 3B7BA 4ZHBA 3KSQA 4HS2A 1Q2ZA 4A3TA 4G1TA 1LF8A 4HFGA 4GYOA 3UM1A 4G26A 2AW6A 3DXKG 3D3MA 1KZOA 3DSSA 3T5VA 2F8YA 4J8EA 2DYRE 3BEEA 3HG0D 2L0IA 5G05J 4BSXA 3V2OA 2DYSE 1WM5A 1O1SA 1IHBA 4NQ0A 3W9FA 5JA4D 2BKKB 4M3OA 3TWRA 5FJYA 4GAAA 5KNHD 4EBAA 5B3SE 3FTZA 3FFLA 4EZJA 3Q75A 3RKVA 3RJVA 2KBXA 5ENQD 4HOTA 1UW4B 5ENSD 3CVXA 4HQDA 2F0YA 5T4YA 3APFA 1U3CA 4XIFA 1SA5A 2ZIRA 3BU8A 3CVWA 3HXBA 3DSVA 3S2AA 4RSYA 5KBAA 3FH5A 4I1MA 3DBSA 2OOEA 1TNZA 2V4LA 3C3OA 1UG3A 4TXPA 1XNFA 1BI7B 1NP7A 2A5EA 2CHWA 4AIFA 3TG5A 1HS6A 4EZLA 2QC9A 4APFA 5EILA 1D8EA 3JQ1A 4P29A 4RQIA 2IFUA 1QQEA 4I17A 5ENTD 4YDEA 4BEPA 3ASOE 4LEUA 5B1AE 3FUKA 2LSVA 4ACLA 3FU6A 3CV0A 2FULA 3LDZA 5G55A 4O6FA 2H6FA 1JPLA 1WDYA 1DNPA 3FUNA 4ILIA 3OAWA 1OWPA 2GGFA 4L2YA 2OVBA 2R5SA 2ZGDA 3R7QA 2F8XK 3LYAA 5ENNA 3FTSA 4CDMA 4DJAA 1NA3A 5CERB 4U63A 3JXIA 1O1TA 4FULA 4FJYA 4AY6A 1ELRA 4JA7A 2JLBA 4QFVA 3B7RL 3E37A 1EYHA 3PZ4A 4LNUD 4J8SA 3L22A 3I4GA 3PEVB 5CRVA 3KAEA 3EU9A 5EKQD 3KSLA 5A7DB 2KCLA 2I1JA 4WNFA 4ILHB 5D2MC 3HDXA 2E0IA 3PUKA 2WQ6A 5LP0A 2WXNA 4BY6A 4PS3A 2BEDA 1YA0A 2GROB 4GMRA 4U96D 3LPZA 2WXJA 4IRUA 4JPSA 3ML9A 3D9NA 3Q49B 2HYZA 3J5QB 3QK0A 4LERA 4C48B 4HOSA 1NA0A 3EHMA 4PH4B 3UT8A 3ESLA 4BT8A 3FDHA 4AXHA 5D66A 3ZIMA 3EJNA 3Q15A 4HI9A 3SQVA 1NL4A 3D9OA 5BT1A 2AWIA 1EDUA 3FTXA 4FU3A 3QKYA 4G8LA 2ZISA 3NOCD 1N0QA 3CVYA 2NC9A 4AP2A 1U3DA 5AAOA 4AOFA 3MX3A 2FI7A 1ZB1A 5AJDA 5C2YA 2ETBA 3B7SA 3SO8A 4G25A 4IYPA 2OV8A 1NZNA 2Y0BG 2WXMA 4N39A 5CCMA 1OXJA 3TWSA 1X81A 1HF8A 4JXTA 2M63A 5AIJA 2DVWA 1INZA 2VSOE 3S7DA 3PEUB 1YYHA 5CEAA 3AS4A 3Q73A 3UKUG 2Y4TA 4GTSA 5FQ7A 1H2VC 1OUVA 5CCLA 2XZDG 4C0EA 1BPOA 4LRZA 5EIBE 4UWHA 3D9MA 3SFYA 5AQAA 2V8SE 1E90A 4U0ZA 2EINE 3MV3B 4Y6CA 5G05C 2J07A 4DI4A 1UN8A 2IO3C 2L9BA 2HO1A 3GZSA 5KJMA 3AS8A 2WMOA 3Q9NC 4TXQA 2VTBB 1NI1A 3ZVVA 3QJZA 3UINC 2DZNA 3G2TA 2P9SG 1OWLA 5FIOA 5BNWA 1HG5A 3RRUA 3FUJA 4UUCA 5A23A 4K03A 4U04A 3I3NA 3FUEA 4K5AB 3C3RA 5HS0A 4I6EA 5DBKA 5CEDB 2A4ZA 4G24A 1BU9A 5LCWJ 2XCBA 2KZTA 4HNAD 3ZNGA 2BUGA 1L5JA 4ATZD 3ZYLA 3FTYA 3SFXA 3U64A 3EHRA 2VGYA 3ML8A 2WB2A 1WY6A 1QNFA 3FTWA 3ULQA 1K8KG 2VGXB 4G11A 2PZIA 3FULA 3LJNA 2P9IG 1TYQG 1OT8A 4TUMA 4LNBA 2DCPA 1N4QA 2YHEA 2XGOA 4FJZA 3CVLA 4YVQC 4MRUA 1K3ZD 3O4ZA 3PZ1A 3MZLB 3LCAA 1S70B 2XZTG 3MKQB 4WWNA 3U3WA 2ONDA
chains in the Genus database with same CATH topology
5ARGA 4DK5A 3T5VA 4J8EA 1GW6A 2WXOA 1Y6IA 3BEEA 2AVPA 3QARA 4L2LA 5FWQA 2L0IA 5G05J 4BSXA 2WXKA 2L6JA 3CKCA 4ME2A 3LEWA 4ANVA 4EBAG 1SQMA 3L16A 4CDRA 1ELWA 5BPPA 3BG1B 5C1DA 2X6FA 2VGXA 1EF1C 1WM5A 1HFAA 4NQ0A 2XGMA 3ASFA 3U9WA 4WNEA 3T5XA 4WUYA 2IOLA 5LX8A 1H0AA 5BW8C 2FEZA 2LAIA 3HHMA 4M3OA 4WWOA 2FO7A 3QNKA 5FJYA 3VLFA 2PQNA 4GAAA 4UWLA 3LXUX 5D0OD 4EBAA 1TEZA 3D9JA 2XEVA 3ZW3A 3URZA 1H19A 3FTZA 1SZ9A 1OWOA 2I2OA 3RRMB 3FFLA 3CQCB 3PUJA 3SBTB 4EZJA 3JYSA 2CG2A 4JA9A 3RKVA 2FBNA 2X38A 1HXIA 4HLEA 3RJVA 2MRIA 4BWRA 5CHEE 5CMWA 4IN3B 5A6CA 2RD0A 2WXFA 1B89A 4E85A 4HOTA 2UWJG 5LCWC 3HVEB 3SI5A 2CFUA 2WMNA 3MJWA 4G23A 4L23A 1UW4B 3UQ3A 4E6HA 3CVXA 4JHJA 5BV0A 2AXUA 5FZQA 5JJTA 4TV3A 5T4YA 5KJKA 3APFA 1U3CA 4XIFA 5ANRA 2IQCA 4N5CA 1VDYA 3CLJA 5T3RA 3B13A 3PS6A 1FVHA 2XRZA 3LY9A 3CSFA 2J09A 2X6JA 1XGWA 4KZ0A 4GA1A 1X5BA 3CVWA 4GB9A 4J8DA 4Q96A 1HO8A 3VLEA 2KM4A 2UY1B 4MLPA 3D9IA 4RSYA 3S2AA 1MQSA 1PAQA 4DPRA 5J90A 2XHEA 3FH5A 2WXQA 3ASDA 3TXMA 3D9PA 1H6KA 5JHAA 4I1MA 4GA0A 3OXLA 5LOZA 3DBSA 4CT0A 2OOEA 1HE8A 4F7AA 3T8MA 3VTXA 3TAXA 5KJLA 4HORA 4CGVA 2LSUA 3FTVA 3ZPJA 1MHQA 4W9RA 2V4LA 5BV1A 2CHZA 1Z3YA 3JQ0A 1UG3A 3EIQC 2V0PA 1XNFA 3CHSA 3QB2A 4JVSA 2WVIA 1TJCA 2C0LA 4CDNA 1HZ4A 2WXHA 1NP7A 2DBAA 4HOQA 4EPZA 3NQPA 3JCKC 2CFZA 4H7YA 1UN9A 3QOUA 3C98A 5FQ6A 2CHWA 4H7XA 4AIFA 3MKQA 3TG5A 2KATA 1HS6A 3QDNA 3RRNB 1N52A 4EZLA 4I6JA 4AVXA 5G2NA 4APFA 3SZ7A 2ZU6B 4Q94A 4XE0A 4FHKA 3UPVA 3FUIA 2VSNA 2A5UA 3JQ1A 4GA2A 4P29A 4B8AA 4I2ZA 3S7BA 2IFUA 3BG0B 3SF4A 3AS5A 3IHYA 3RIBA 2MHKA 3FWVA 1QQEA 4I17A 4I43A 4PS8A 3P1UA 4N2QA 1KLXA 4UI9C 4EZKA 4K0RA 3UT7A 1W3BA 3RO3A 5FZSA 2XPIA 4LEUA 4AM9A 3FUKA 3LY7A 2LSVA 3PREA 4ACLA 2HR2A 3FU6A 3EHNA 3CV0A 3TXNA 1FCHA 2FULA 2KC7A 3LDZA 5AYWD 2I1KA 4U0SA 5G55A 2EQXA 4O6FA 1Z3XA 4NRHB 1S0PA 4XX5A 4HXIA 1JPLA 3L17A 3MKRA 2WXRA 3ZRHA 1DNPA 3FUNA 4ILIA 3OAWA 2WXLA 1E7UA 1OWPA 2GGFA 2J4DA 4L2YA 3U4TA 5KCMA 1DVPA 3LVRE 2X6IA 2OVBA 3PVLA 2R5SA 5HQ8A 3R7QA 4A1SA 4KMOA 3ZHEB 3TG4A 2QY7A 1IHGA 4N3CA 3SD5A 3LYAA 4Y6WA 4DI3A 4G2VA 5ENNA 3LJ3A 3FTSA 4MS6A 2PL2A 4GU5A 3L6AA 4IULA 3RO2A 3MV2B 2J08A 2E2EA 4NURA 4CDMA 4DJAA 4J8FA 1NA3A 4CT4A 4XKCA 4U63A 3FUDA 2C0MA 3PNLB 2YNQA 2MOWA 3CK8A 4FULA 2IJGX 1N54A 4FJYA 4RG9A 3FU3A 4AY6A 1ELRA 4FLHA 5G04C 5J08A 3WXXA 2GRMA 3ESKA 1E7VA 4HOUA 4ANWA 2BF0X 2WXIA 4JA7A 3TGOA 1HX8A 4JW1A 2JLBA 4QFVA 1E8XA 3KD7A 2VJ8A 2NSZA 3CR3A 2YHCA 3B7RL 3UMVA 1EYHA 3CKBA 5JJ6A 4FC8A 3CQGB 4J8SA 4ANUA 4F3VA 3JUIA 3L13A 1ZBPA 3GZ1A 4EECA 3LS8A 3G2WA 3L22A 2DIWA 5ANLA 3I4GA 3PEVB 3S7FA 4B89A 3MYVA 2WXGA 4UWFA 2J9QA 3KAEA 1HU3A 5EKQD 5A7DB 2KCLA 4A55A 1JWFA 2I1JA 4B94A 4LCTA 2C2LA 4WNFA 4ILHB 4UQZA 2LAHA 4WWPA 3HDXA 4WAFA 4BFRA 1TJFA 4GZDA 4C0MA 2E0IA 4GCOA 3PUKA 5BUZA 4I1OB 3DPDA 1H2UA 5FZRA 2WQ6A 3PNTB 5LP0A 2WXNA 4JC8A 3KS2A 2PM7A 3ASHA 4OYSA 4BY6A 4PS3A 1Z6TA 4PDXA 4OVUA 1YA0A 4GMLA 5AENA 3D9KA 3ONLA 3AU4A 4ACKA 3D9LA 4HVBA 5EDSA 3LPZA 3G2SA 1WAO1 2WXJA 3PE3A 1UJKA 4IRUA 4APOA 4JPSA 4JZYA 4N3BA 4FLBA 5CMYA 3ZHEA 4AV7A 1OWMA 4KBQA 3CVPA 3ML9A 4B0ZA 3D9NA 3G2VA 3Q49B 2HYZA 2LO6A 3FH7A 3MA5A 3B7UX 3QK0A 3L54A 4LERA 4UWKA 4HOSA 1NA0A 3EHMA 5EX0A 3B7TA 4PH4B 3UT8A 4CRWA 3ESLA 5JJ7A 3APCA 3CSTA 3O48A 2QFCA 4BT8A 4ATGA 3FDHA 3FY4A 4N2SA 2HM8A 3ZXSA 4AXHA 2XPYA 3ZIMA 2X3MA 4I6GA 3EJNA 3ZYQA 4BT9A 2LNIA 4RVBA 2V5FA 3Q15A 4J6IA 5E75A 3QWWA 3D9OA 5BT1A 2CG3A 4KZCA 2AWIA 3CVUA 2J49A 3ZYMA 3FTUA 3LY8A 1EDUA 3FTXA 4FU3A 1H2TC 3OXFA 3TJPA 2AXVA 1KT0A 2IOSA 4J0UA 2WXPA 2BTDA 4I2WA 4F1SA 4ABNA 1PY1A 3Q47B 3QKYA 4ILGA 3SBSA 3CGHA 1OWNA 2VTBA 2R17C 3CVYA 3EDTB 2NC9A 2KCVA 3FP3A 3FU5A 4AP2A 1U3DA 3ENEA 5M72A 2PM6A 2YQ8A 4UWGA 4AOFA 3RK6A 4I9CA 4CCAA 3P2BA 3TL5A 2GW1A 3MX3A 2FI7A 1JWGA 4AJWA 5AJDA 4GZ5A 5C2YA 3OTNA 3B7SA 3IHVA 3HVEA 4G25A 4IYPA 2IF4A 3VLDA 4UI9J 2OV8A 2Q7FA 5E76A 1NZNA 2WXMA 4N39A 2XRYA 3CK9A 4BTAA 4TRQA 4GZCA 4WNDA 5CCMA 3CHRA 3MGBA 2WM9A 3S7JA 4FP7A 1UJJA 3N71A 4UQXA 1HF8A 4Q69A 4JXTA 2M63A 5AIJA 1INZA 3FUHA 4NACA 2VSOE 4CEMA 4GZ6A 4KXKB 4GPKA 3S7DA 2XGSA 4A1GA 1Y8MA 4JHRA 3PEUB 4N3AA 3MEKA 2PQRA 2VSYA 5EX3A 5FQ4A 3NZUA 2CHXA 4XI0A 5KJNA 1E96B 3CEQA 3AS4A 3PDNA 3CHQA 4LUNU 3CK7A 1HG2A 3CIAA 2IONA 3FUMA 4I1AA 2Y3AA 3I5PA 2Y4TA 1ZU2A 3Q5MA 1H2VC 1OUVA 5FQ7A 5CCLA 4XI9A 5DIZA 3APDA 4C0EA 1BPOA 4LRZA 4UWHA 3RU0A 3D9MA 2V8SE 3AU5A 1E90A 1SZAA 3CHMA 4KVOA 4PUCA 4U0ZA 1P5QA 3R9AB 4GCNA 3MV3B 3KEZA 4Y6CA 5G05C 2J07A 3ZEFA 4DI4A 3PE4A 2J4BA 5G04J 1UN8A 5ARFA 3Q4AB 3NF1A 4AY5A 2L9BA 3ZFWA 2HO1A 3GZSA 1IYGA 4DLQA 5KJMA 3AS8A 3U66A 2WMOA 3IBEA 3I4RB 4JL0A 3GZ2A 2VTBB 4CGWA 4L1BA 3SFZA 5AJLA 3R7RA 3CVNA 3QC1A 4XKBA 3ZVVA 2XQ0A 3QJZA 4BX9A 4EQFA 3GYZA 3CHPA 3ZGQA 1HH8A 2I6HA 3G2TA 3VTYA 1PC2A 4YVOA 1FVFA 1OWLA 3GW4A 3SGHA 2R59A 4R7LA 5FQ8A 2AXZA 3FEYA 4D10C 2I9CA 3PZDA 5JHBA 3CVQA 4GYYA 3K9IA 1EPUA 5BNWA 1HG5A 3LVQE 3RRUA 4JHKA 3FUJA 4URKA 1KT1A 3CHOA 4U0UA 2X6KA 3QAQA 4TUUA 4WNGA 3FHEA 1IQUA 5A23A 3LKUA 3FU0A 4K03A 2KCKA 4RG6A 4U04A 3I3NA 4FADA 5T8IA 3FUEA 4GYWA 4OVVA 3ZYKA 4KYOB 2JEKA 3SHFA 4I6EA 4PS7A 5DBKA 3FH8A 2Y4UA 2A4ZA 4G24A 1E8WA 4FA6A 5LCWJ 2XCCA 2XCBA 1E8YA 2KZTA 2VSXE 4BX8A 2WQHA 4F53A 3SNXA 4ANXA 3IV0A 2OVFA 3ASGA 2VQ2A 1A17A 2VYIA 2BUGA 3PH0C 1L5JA 4XZ4A 3ZYLA 4A3VA 3L08A 3UUXA 4MKTA 4BTBA 3FUFA 2IU1A 2KZTB 3FTYA 4GMJA 4KVMA 3HYMB 3U64A 2UY1A 3ZN3A 2L0TB 2VGYA 3G2UA 3ML8A 4KT6B 2WB2A 3NZSA 2GRLA 2WPVA 4U8HA 3EIJA 2XPZA 4UI9K 3QWVA 5FT9A 1WY6A 2WQ7A 1IQRA 1QNFA 3FTWA 5D0QD 3ULQA 2VGXB 4G11A 2PZIA 3FULA 4C9BB 4AEZC 3HIZA 3IKOB 2RG8A 1JUQA 3OXGA 2FF4A 2ILRA 1E8ZA 2P58C 3ONKA 2DCPA 2YHEA 2XGOA 3E4BA 4JEUA 3UX4A 2YINA 1ELKA 4GZ3A 4FJZA 3CVVA 4V3IA 4UQYA 3FEXA 4YNDA 3CVLA 4YVQC 3QWPA 4B8CB 3MCXA 4DLOA 4I9EA 4U07A 1QZ2A 4HS2A 4MRUA 4L7TA 3PRZA 4JEHA 3O4ZA 3UT4A 4A3TA 4FHJA 3IEGA 3MZLB 5FTPA 2X6HA 3LCAA 4G1TA 5LFAA 1LF8A 3MKQB 2NXPA 4HFGA 4GYOA 5HI7A 4WWNA 4G26A 2AW6A 3D3MA 3U3WA 2ONDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UW4 B;  4CEM A;  3FEY A;  2FUL A;  4CT4 A;  4JHJ A;  4B89 A;  2ZU6 B;  3FEX A;  1HU3 A;  4B8A A;  2I2O A;  4JHK A;  2IU1 A;  2KZT B;  4GMJ A;  5ANR A;  4B8C B;  1N54 A;  4LUN U;  1UG3 A;  3EIQ C;  2GGF A;  1H2T C;  2ION A;  2IOS A;  1H2U A;  1H2V C;  3EIJ A;  2NSZ A;  2IOL A;  4CRW A;  1PAQ A;  2KZT A;  2VSX E;  4GML A;  3D3M A;  3JUI A;  2HM8 A;  4C9B B;  3RK6 A;  2RG8 A;  1H6K A;  3L6A A;  4IUL A;  2VSO E;  1N52 A; 
#chains in the Genus database with same CATH topology
 5HKP A;  2AVP A;  5FWQ A;  2L6J A;  4U8V D;  3L16 A;  5BPP A;  2X6F A;  5BXU A;  1HFA A;  3ASF A;  3U9W A;  4WNE A;  2LAI A;  4WWO A;  4UWL A;  1TEZ A;  3ZW3 A;  3URZ A;  4X8Q A;  1H19 A;  3RRM B;  3PUJ A;  1K1B A;  3C3Q A;  2XEN A;  4JA9 A;  3DST A;  2X38 A;  4HLE A;  2BKG A;  1LD7 A;  5CHE E;  5CMW A;  4IN3 B;  5A6C A;  1B89 A;  5LCW C;  2CFU A;  2WMN A;  3MJW A;  4L23 A;  3UQ3 A;  4DX6 D;  3RAU A;  4JHJ A;  2GRR B;  5BV0 A;  5JJT A;  5KJK A;  5ANR A;  1VDY A;  3CLJ A;  3B13 A;  2XRZ A;  3CSF A;  2X6J A;  4HLL A;  1XGW A;  1X5B A;  4GB9 A;  1MQS A;  5J90 A;  1H6P A;  2GRP B;  2WXQ A;  2IEJ A;  1RZ4 A;  3OXL A;  5LOZ A;  4CT0 A;  1G3N B;  3FTV A;  1MX6 A;  1MHQ A;  4JVS A;  2WVI A;  1TJC A;  2C0L A;  4CDN A;  4H7Y A;  1UN9 A;  3QOU A;  2P9U G;  3C98 A;  5FQ6 A;  4H7X A;  1N4P A;  3RRN B;  1N52 A;  3IXE A;  4GTP A;  3UPV A;  2VSN A;  4B8A A;  3ULE G;  4I2Z A;  3S7B A;  3X2Q E;  4PS8 A;  1N0R A;  3P1U A;  4K0R A;  1TNY A;  1W3B A;  3RO3 A;  5FZS A;  4AM9 A;  3ZXP A;  5AYW D;  1TNO A;  1S0P A;  3ZRH A;  1E7U A;  2J4D A;  5KCM A;  1DVP A;  2ZGG A;  3ZHE B;  4N3C A;  3SD5 A;  3V2X A;  4Y6W A;  4G2V A;  3LJ3 A;  2PL2 A;  3RO2 A;  2E2E A;  2KXP C;  1OCC E;  2IO2 C;  2C0M A;  4N5Q A;  2YNQ A;  1A5E A;  3J5P A;  4DX7 D;  1N54 A;  3FU3 A;  5J08 A;  3WXX A;  3TGO A;  1O5M A;  3KD7 A;  2VJ8 A;  3CR3 A;  4DX1 A;  4FC8 A;  2QZA A;  1ZBP A;  4EEC A;  5ANL A;  3UM0 A;  4B89 A;  3MYV A;  2J9Q A;  1HU3 A;  4U8Y D;  4A55 A;  1N4R A;  1JWF A;  1N9A A;  3Q78 A;  4UQZ A;  4GZD A;  1U2V G;  5BUZ A;  4I1O B;  5FZR A;  3PNT B;  4JC8 A;  4PDX A;  3AU4 A;  5EDS A;  3BUA A;  4APO A;  4N3B A;  4JZY A;  1AP7 A;  3ZHE A;  4LNG A;  3G2V A;  2LO6 A;  3ASN E;  4CRW A;  5JJ7 A;  4CYM D;  4QQI A;  2QFC A;  4M7C A;  3DPY A;  2LNI A;  3QWW A;  2CG3 A;  4KZC A;  3CVU A;  1TR4 A;  4DX2 A;  3TJP A;  4HRL A;  2WXP A;  4F1S A;  5KNG A;  4ABN A;  3SBS A;  2EIL E;  3CGH A;  2VTB A;  3FP3 A;  2PM6 A;  2YQ8 A;  3RK6 A;  4I9C A;  4AJW A;  3OTN A;  3HVE A;  2XS1 A;  3VLD A;  4GPM A;  5E76 A;  2XEH A;  1UOH A;  4TRQ A;  4WND A;  3ISM C;  4UQX A;  3EUV A;  3E33 A;  4KXK B;  1Y8M A;  5FQ4 A;  5EX3 A;  3TWQ A;  5KJN A;  3CEQ A;  3PDN A;  2J8S D;  3CK7 A;  4I1A A;  2Y3A A;  4OAU C;  3RU0 A;  2GRQ B;  3AU5 A;  4PUC A;  1P5Q A;  4GCN A;  3ZEF A;  5G04 J;  2J4B A;  1MJ0 A;  4O1P A;  1OCO E;  1IYG A;  4DLQ A;  3U66 A;  1N95 A;  3IBE A;  4JL0 A;  3SFZ A;  3R7R A;  3CVN A;  4A63 B;  4XKB A;  1N4S A;  3ZGQ A;  4YDO A;  3VTY A;  1PC2 A;  2R59 A;  2AXZ A;  3FEY A;  3PZD A;  4GYY A;  2RFA A;  4GTM A;  2HE0 A;  4U0U A;  3DEP A;  3ULY A;  3FHE A;  4BET A;  2KCK A;  4RG6 A;  2ZXW E;  3SHF A;  4FA6 A;  2IY0 C;  4HBD A;  3IV0 A;  2OVF A;  1H6O A;  2VYI A;  4MKT A;  3FUF A;  3HYM B;  3DWL G;  2UY1 A;  2L0T B;  4KT6 B;  4U8H A;  2XPZ A;  3TWW A;  2WQ7 A;  1IQR A;  2EIJ E;  5D0Q D;  4C9B B;  2OEV A;  3IKO B;  3OXG A;  1JUQ A;  2ILR A;  2H6I A;  2YIN A;  4GZ3 A;  5ENO D;  4DLO A;  4U07 A;  3PRZ A;  3UT4 A;  4FHJ A;  5FTP A;  2X6H A;  2VGE A;  5HI7 A;  3DXM G;  2XEE A;  5IY5 E;  3RSE G;  4DK5 A;  4L2L A;  4ME2 A;  3CKC A;  4EBA G;  1SQM A;  4CDR A;  2VGX A;  1EF1 C;  1S64 A;  5FIN A;  3SY2 A;  3T5X A;  3C5R A;  4WUY A;  1MYO A;  1H0A A;  4G8K A;  2FO7 A;  3QNK A;  2B0O E;  4GTQ A;  4DX5 D;  5D0O D;  3D9J A;  2XEV A;  2I2O A;  2QYU A;  3T8K A;  3SBT B;  1WG0 A;  3JYS A;  2CG2 A;  1HXI A;  4BWR A;  4JB8 P;  3NAW A;  2UWJ G;  3HVE B;  3SI5 A;  5FZQ A;  3EHQ A;  3JUE A;  4J8Y A;  2LUH A;  2IQC A;  4N5C A;  5T3R A;  1FVH A;  2J09 A;  4KZ0 A;  4Q96 A;  2KM4 A;  2UY1 B;  4MLP A;  5AQ9 A;  4DPR A;  3BQO A;  3ASD A;  1TNU A;  1D8D A;  5JHA A;  4GA0 A;  4F7A A;  3T8M A;  3VTX A;  3TAX A;  5KJL A;  4HOR A;  4CGV A;  2LSU A;  4L9P A;  4W9R A;  5BV1 A;  1Z3Y A;  4HRM B;  3EIQ C;  3CHS A;  3QB2 A;  1HZ4 A;  2WXH A;  2DBA A;  4HOQ A;  4EPZ A;  3JCK C;  2MYO A;  5CEC B;  2KAT A;  3QDN A;  4I6J A;  4AVX A;  3SZ7 A;  4FHK A;  2A5U A;  4GA2 A;  4U7E B;  3AG1 E;  3BG0 B;  4O1O A;  3AS5 A;  2MHK A;  3FWV A;  4I43 A;  4N2Q A;  1DCQ A;  3UT7 A;  3C72 A;  1MZC A;  4YDY A;  3LY7 A;  3PRE A;  2HR2 A;  5AQB A;  3TXN A;  1FCH A;  5CRU A;  3UI2 A;  2I1K A;  4U0S A;  2EQX A;  3MKR A;  2WXL A;  4HRN A;  3TWT A;  3LVR E;  3UIO C;  3Q7F A;  4A1S A;  3DRA A;  4KMO A;  3TG4 A;  2QY7 A;  4RLY A;  4MS6 A;  3L6A A;  4IUL A;  2J08 A;  4NUR A;  4J8F A;  4XKC A;  3CK8 A;  2IJG X;  4FLH A;  2GRM A;  3ESK A;  1E7V A;  1IXV A;  4HOU A;  2BF0 X;  4ANW A;  4JW1 A;  5ENR D;  2NSZ A;  1MX4 A;  2P9L G;  3CQG B;  4F3V A;  4ANU A;  3JUI A;  3L13 A;  3GZ1 A;  4Z68 A;  1N94 A;  5CBN A;  4TXR A;  2WXG A;  3ABK E;  4UWF A;  4B94 A;  4LCT A;  2C2L A;  4WAF A;  2LAH A;  1TJF A;  4C0M A;  3ABM E;  3DPD A;  4J7W A;  4EHM A;  2PM7 A;  1Z6T A;  4OVU A;  4GML A;  3D9L A;  2RFM A;  5CMY A;  1OWM A;  3DSX A;  3UM3 A;  4F6R D;  4B0Z A;  3FH7 A;  3B7U X;  2DWZ A;  4UWK A;  1QYM A;  3B7T A;  3CST A;  3FY4 A;  1FT1 A;  3ZXS A;  2X3M A;  1MX2 A;  4I6G A;  4XEI G;  3ZKJ A;  4RVB A;  2V5F A;  4J6I A;  1TN7 A;  2J49 A;  2V4H C;  3ZYM A;  3FTU A;  3LY8 A;  3OXF A;  4J0U A;  2BTD A;  4I2W A;  1JCS A;  4UWG A;  4K5C A;  2GW1 A;  1JWG A;  4GZ5 A;  2FO1 E;  2IF4 A;  2Q7F A;  2NYJ A;  1YMP A;  2XRY A;  4BTA A;  4GZC A;  3PZ3 A;  1LD8 A;  3CHR A;  4DRX E;  4FP7 A;  3N71 A;  3FUH A;  4NAC A;  3DSW A;  4F1P A;  4CEM A;  4GZ6 A;  4GPK A;  1K1A A;  4A1G A;  4JHR A;  3MEK A;  3E34 A;  3HXC A;  4XI0 A;  3CHQ A;  1HG2 A;  3CIA A;  3I5P A;  3Q5M A;  4XI9 A;  1TNB A;  3NBN B;  1DCE A;  4KVO A;  1SZA A;  3CHM A;  3KEZ A;  3PE4 A;  2R05 A;  3NF1 A;  3PZ2 A;  3I4R B;  4GTT A;  3GZ2 A;  4CGW A;  4L1B A;  2R03 A;  5AJL A;  3Q9U C;  1RW2 A;  4BX9 A;  3GYZ A;  1FVF A;  5FQ8 A;  3UXG A;  2I9C A;  3CVQ A;  3K9I A;  5HRY A;  1OY3 D;  3LVQ E;  3Q7A A;  1LTX A;  3LKU A;  4FAD A;  4GTR A;  5T8I A;  3UM2 A;  4GYW A;  4OVV A;  4KYO B;  4CZ2 D;  1N11 A;  4PS7 A;  3FH8 A;  2Y4U A;  2XCC A;  1E8Y A;  3AJI A;  4BX8 A;  2WQH A;  4ANX A;  4JD2 G;  3ASG A;  2VQ2 A;  1A17 A;  2AJA A;  3L82 A;  3L08 A;  4BTB A;  2IU1 A;  2KZT B;  3ZN3 A;  3G2U A;  2GRL A;  5FT9 A;  4UI9 K;  3QWV A;  5JMN D;  4AEZ C;  4HI8 A;  2RG8 A;  1NFI E;  3E4B A;  4JEU A;  3UX4 A;  2GRN B;  3V31 A;  1IKN D;  4V3I A;  3CVV A;  4UQY A;  3QWP A;  4B8C B;  3MCX A;  4I9E A;  1QZ2 A;  4L7T A;  2EIK E;  4JEH A;  3KEA A;  3IEG A;  1SW6 A;  5LFA A;  2P2C P;  2NXP A;  1D9S A;  3WG7 E;  5ARG A;  2B6C A;  3DEO A;  1GW6 A;  4DUI A;  2WXO A;  1Y6I A;  3QAR A;  1O1R A;  2WXK A;  5H7P A;  4ANV A;  3LEW A;  4ZFH A;  5C1D A;  1ELW A;  3BG1 B;  3L9T A;  3AG2 E;  2OCC E;  2Y1L E;  2XGM A;  2IOL A;  5LX8 A;  4GTO A;  5BW8 C;  3AG4 E;  2FEZ A;  3HHM A;  1QBQ A;  3VLF A;  2PQN A;  3LXU X;  4LG6 A;  4OAV B;  1SZ9 A;  1OWO A;  3CQC B;  2H6G A;  2FBN A;  2MRI A;  1JCQ A;  2EIM E;  2RD0 A;  2WXF A;  4E85 A;  3F6Q A;  4E6H A;  4G23 A;  3R9M A;  2AXU A;  4TV3 A;  1OCZ E;  1TN8 A;  3PS6 A;  3LY9 A;  3TWX A;  4GA1 A;  2ETC A;  4J8D A;  1HO8 A;  3VLE A;  3D9I A;  1PAQ A;  2XHE A;  3TXM A;  2PNN A;  3D9P A;  1H6K A;  5CBO A;  1HE8 A;  1V54 E;  3ZPJ A;  2CHZ A;  3JQ0 A;  5AAR A;  5B1B E;  3AG3 E;  2V0P A;  4YDW A;  1KZP A;  3NQP A;  2CFZ A;  3ABL E;  3MKQ A;  5G2N A;  5EN5 D;  2ZU6 B;  2LXL A;  4Q94 A;  4XE0 A;  3FUI A;  3SF4 A;  3E30 A;  3EU5 A;  3IHY A;  3RIB A;  4BER A;  1KLX A;  4UI9 C;  4EZK A;  3V30 A;  2XPI A;  5EID A;  3EHN A;  2KC7 A;  1Z3X A;  4NRH B;  4XX5 A;  4HXI A;  3L17 A;  2WXR A;  1DC2 A;  3UKR G;  2OEW A;  3U4T A;  2X6I A;  3PVL A;  5HQ8 A;  1IHG A;  4DI3 A;  1KPS B;  4GU5 A;  3MV2 B;  4CT4 A;  2P9K G;  3FUD A;  3PNL B;  2DZO A;  2MOW A;  2R2L A;  3JXJ A;  4RG9 A;  5G04 C;  4O60 A;  2WXI A;  4K5B A;  3TWU A;  1HX8 A;  1E8X A;  4MBG A;  2YHC A;  3UMV A;  1SA4 A;  3CKB A;  5JJ6 A;  3HXE A;  3LS8 A;  3G2W A;  5ITZ F;  2DIW A;  3S7F A;  1BI8 B;  2XS8 A;  2H6H A;  4WWP A;  4BFR A;  4GCO A;  1H2U A;  3HXD A;  4U95 D;  3KS2 A;  3ASH A;  4OYS A;  4B93 B;  5AEN A;  3D9K A;  3ONL A;  4ACK A;  4HVB A;  3G2S A;  1WAO 1;  3PE3 A;  1UJK A;  4FLB A;  3Q79 A;  4AV7 A;  4KBQ A;  3CVP A;  3MA5 A;  3L54 A;  1BLX B;  2ETA A;  5EX0 A;  3APC A;  3O48 A;  4ATG A;  4N2S A;  3B95 A;  5EYL A;  2HM8 A;  2XPY A;  5AN8 A;  3ZYQ A;  3ZU7 B;  4BT9 A;  5E75 A;  3DSU A;  1H2T C;  1TN6 A;  1KT0 A;  2AXV A;  2IOS A;  2Y69 E;  2V5Q C;  1PY1 A;  3Q47 B;  4ILG A;  3E32 A;  1OWN A;  2R17 C;  3EDT B;  3AAA C;  2KCV A;  3FU5 A;  3ENE A;  5M72 A;  4CCA A;  3P2B A;  3TL5 A;  5KWD A;  3IHV A;  3UTM A;  4UI9 J;  3CK9 A;  5EYP F;  3MGB A;  2WM9 A;  3S7J A;  1UJJ A;  4Q69 A;  4BES A;  2XGS A;  4N3A A;  2F37 A;  2PQR A;  2VSY A;  3NZU A;  2CHX A;  4LSZ E;  1E96 B;  4NIK A;  5BXO A;  1YCS B;  4LUN U;  3T9K A;  2P9P G;  2ION A;  3FUM A;  1ZU2 A;  1V55 E;  2JAB A;  5DIZ A;  1S63 A;  3APD A;  3R9A B;  1FPP A;  1OCR E;  4HB5 A;  5ARF A;  3Q4A B;  4AY5 A;  3ZFW A;  1Z5S C;  1AWC B;  2RKK A;  3QC1 A;  2QYJ A;  2LXM A;  2XQ0 A;  4EQF A;  1JCR A;  1FT2 A;  2R02 A;  3CHP A;  2P9N G;  1HH8 A;  2I6H A;  3TWV A;  4YVO A;  3GW4 A;  3SGH A;  4R7L A;  4D10 C;  4GTV A;  5JHB A;  3HRA A;  1EPU A;  3V79 K;  4JHK A;  3D9H A;  4URK A;  1KT1 A;  3CHO A;  3W9G A;  2X6K A;  3QAQ A;  4TUU A;  4WNG A;  1IQU A;  3FU0 A;  3NOG D;  3ZYK A;  2JEK A;  2L6B A;  1E8W A;  2VSX E;  3NB2 A;  4F53 A;  3SNX A;  3PH0 C;  4XZ4 A;  1SVX A;  4A3V A;  3UUX A;  4BSZ B;  4KVM A;  4GMJ A;  1BD8 A;  3NZS A;  2WPV A;  3EIJ A;  3ZUV B;  3HXF A;  3UIP C;  5AQ7 A;  3HIZ A;  5ENP D;  2FF4 A;  2P58 C;  1E8Z A;  3ONK A;  1ELK A;  3FEX A;  4YND A;  3B7B A;  4ZHB A;  3KSQ A;  4HS2 A;  1Q2Z A;  4A3T A;  4G1T A;  1LF8 A;  4HFG A;  4GYO A;  3UM1 A;  4G26 A;  2AW6 A;  3DXK G;  3D3M A;  1KZO A;  3DSS A;  3T5V A;  2F8Y A;  4J8E A;  2DYR E;  3BEE A;  3HG0 D;  2L0I A;  5G05 J;  4BSX A;  3V2O A;  2DYS E;  1WM5 A;  1O1S A;  1IHB A;  4NQ0 A;  3W9F A;  5JA4 D;  2BKK B;  4M3O A;  3TWR A;  5FJY A;  4GAA A;  5KNH D;  4EBA A;  5B3S E;  3FTZ A;  3FFL A;  4EZJ A;  3Q75 A;  3RKV A;  3RJV A;  2KBX A;  5ENQ D;  4HOT A;  1UW4 B;  5ENS D;  3CVX A;  4HQD A;  2F0Y A;  5T4Y A;  3APF A;  1U3C A;  4XIF A;  1SA5 A;  2ZIR A;  3BU8 A;  3CVW A;  3HXB A;  3DSV A;  3S2A A;  4RSY A;  5KBA A;  3FH5 A;  4I1M A;  3DBS A;  2OOE A;  1TNZ A;  2V4L A;  3C3O A;  1UG3 A;  4TXP A;  1XNF A;  1BI7 B;  1NP7 A;  2A5E A;  2CHW A;  4AIF A;  3TG5 A;  1HS6 A;  4EZL A;  2QC9 A;  4APF A;  5EIL A;  1D8E A;  3JQ1 A;  4P29 A;  4RQI A;  2IFU A;  1QQE A;  4I17 A;  5ENT D;  4YDE A;  4BEP A;  3ASO E;  4LEU A;  5B1A E;  3FUK A;  2LSV A;  4ACL A;  3FU6 A;  3CV0 A;  2FUL A;  3LDZ A;  5G55 A;  4O6F A;  2H6F A;  1JPL A;  1WDY A;  1DNP A;  3FUN A;  4ILI A;  3OAW A;  1OWP A;  2GGF A;  4L2Y A;  2OVB A;  2R5S A;  2ZGD A;  3R7Q A;  2F8X K;  3LYA A;  5ENN A;  3FTS A;  4CDM A;  4DJA A;  1NA3 A;  5CER B;  4U63 A;  3JXI A;  1O1T A;  4FUL A;  4FJY A;  4AY6 A;  1ELR A;  4JA7 A;  2JLB A;  4QFV A;  3B7R L;  3E37 A;  1EYH A;  3PZ4 A;  4LNU D;  4J8S A;  3L22 A;  3I4G A;  3PEV B;  5CRV A;  3KAE A;  3EU9 A;  5EKQ D;  3KSL A;  5A7D B;  2KCL A;  2I1J A;  4WNF A;  4ILH B;  5D2M C;  3HDX A;  2E0I A;  3PUK A;  2WQ6 A;  5LP0 A;  2WXN A;  4BY6 A;  4PS3 A;  2BED A;  1YA0 A;  2GRO B;  4GMR A;  4U96 D;  3LPZ A;  2WXJ A;  4IRU A;  4JPS A;  3ML9 A;  3D9N A;  3Q49 B;  2HYZ A;  3J5Q B;  3QK0 A;  4LER A;  4C48 B;  4HOS A;  1NA0 A;  3EHM A;  4PH4 B;  3UT8 A;  3ESL A;  4BT8 A;  3FDH A;  4AXH A;  5D66 A;  3ZIM A;  3EJN A;  3Q15 A;  4HI9 A;  3SQV A;  1NL4 A;  3D9O A;  5BT1 A;  2AWI A;  1EDU A;  3FTX A;  4FU3 A;  3QKY A;  4G8L A;  2ZIS A;  3NOC D;  1N0Q A;  3CVY A;  2NC9 A;  4AP2 A;  1U3D A;  5AAO A;  4AOF A;  3MX3 A;  2FI7 A;  1ZB1 A;  5AJD A;  5C2Y A;  2ETB A;  3B7S A;  3SO8 A;  4G25 A;  4IYP A;  2OV8 A;  1NZN A;  2Y0B G;  2WXM A;  4N39 A;  5CCM A;  1OXJ A;  3TWS A;  1X81 A;  1HF8 A;  4JXT A;  2M63 A;  5AIJ A;  2DVW A;  1INZ A;  2VSO E;  3S7D A;  3PEU B;  1YYH A;  5CEA A;  3AS4 A;  3Q73 A;  3UKU G;  2Y4T A;  4GTS A;  5FQ7 A;  1H2V C;  1OUV A;  5CCL A;  2XZD G;  4C0E A;  1BPO A;  4LRZ A;  5EIB E;  4UWH A;  3D9M A;  3SFY A;  5AQA A;  2V8S E;  1E90 A;  4U0Z A;  2EIN E;  3MV3 B;  4Y6C A;  5G05 C;  2J07 A;  4DI4 A;  1UN8 A;  2IO3 C;  2L9B A;  2HO1 A;  3GZS A;  5KJM A;  3AS8 A;  2WMO A;  3Q9N C;  4TXQ A;  2VTB B;  1NI1 A;  3ZVV A;  3QJZ A;  3UIN C;  2DZN A;  3G2T A;  2P9S G;  1OWL A;  5FIO A;  5BNW A;  1HG5 A;  3RRU A;  3FUJ A;  4UUC A;  5A23 A;  4K03 A;  4U04 A;  3I3N A;  3FUE A;  4K5A B;  3C3R A;  5HS0 A;  4I6E A;  5DBK A;  5CED B;  2A4Z A;  4G24 A;  1BU9 A;  5LCW J;  2XCB A;  2KZT A;  4HNA D;  3ZNG A;  2BUG A;  1L5J A;  4ATZ D;  3ZYL A;  3FTY A;  3SFX A;  3U64 A;  3EHR A;  2VGY A;  3ML8 A;  2WB2 A;  1WY6 A;  1QNF A;  3FTW A;  3ULQ A;  1K8K G;  2VGX B;  4G11 A;  2PZI A;  3FUL A;  3LJN A;  2P9I G;  1TYQ G;  1OT8 A;  4TUM A;  4LNB A;  2DCP A;  1N4Q A;  2YHE A;  2XGO A;  4FJZ A;  3CVL A;  4YVQ C;  4MRU A;  1K3Z D;  3O4Z A;  3PZ1 A;  3MZL B;  3LCA A;  1S70 B;  2XZT G;  3MKQ B;  4WWN A;  3U3W A;  2OND A; 
#chains in the Genus database with same CATH homology
 5ARG A;  4DK5 A;  3T5V A;  4J8E A;  1GW6 A;  2WXO A;  1Y6I A;  3BEE A;  2AVP A;  3QAR A;  4L2L A;  5FWQ A;  2L0I A;  5G05 J;  4BSX A;  2WXK A;  2L6J A;  3CKC A;  4ME2 A;  3LEW A;  4ANV A;  4EBA G;  1SQM A;  3L16 A;  4CDR A;  1ELW A;  5BPP A;  3BG1 B;  5C1D A;  2X6F A;  2VGX A;  1EF1 C;  1WM5 A;  1HFA A;  4NQ0 A;  2XGM A;  3ASF A;  3U9W A;  4WNE A;  3T5X A;  4WUY A;  2IOL A;  5LX8 A;  1H0A A;  5BW8 C;  2FEZ A;  2LAI A;  3HHM A;  4M3O A;  4WWO A;  2FO7 A;  3QNK A;  5FJY A;  3VLF A;  2PQN A;  4GAA A;  4UWL A;  3LXU X;  5D0O D;  4EBA A;  1TEZ A;  3D9J A;  2XEV A;  3ZW3 A;  3URZ A;  1H19 A;  3FTZ A;  1SZ9 A;  1OWO A;  2I2O A;  3RRM B;  3FFL A;  3CQC B;  3PUJ A;  3SBT B;  4EZJ A;  3JYS A;  2CG2 A;  4JA9 A;  3RKV A;  2FBN A;  2X38 A;  1HXI A;  4HLE A;  3RJV A;  2MRI A;  4BWR A;  5CHE E;  5CMW A;  4IN3 B;  5A6C A;  2RD0 A;  2WXF A;  1B89 A;  4E85 A;  4HOT A;  2UWJ G;  5LCW C;  3HVE B;  3SI5 A;  2CFU A;  2WMN A;  3MJW A;  4G23 A;  4L23 A;  1UW4 B;  3UQ3 A;  4E6H A;  3CVX A;  4JHJ A;  5BV0 A;  2AXU A;  5FZQ A;  5JJT A;  4TV3 A;  5T4Y A;  5KJK A;  3APF A;  1U3C A;  4XIF A;  5ANR A;  2IQC A;  4N5C A;  1VDY A;  3CLJ A;  5T3R A;  3B13 A;  3PS6 A;  1FVH A;  2XRZ A;  3LY9 A;  3CSF A;  2J09 A;  2X6J A;  1XGW A;  4KZ0 A;  4GA1 A;  1X5B A;  3CVW A;  4GB9 A;  4J8D A;  4Q96 A;  1HO8 A;  3VLE A;  2KM4 A;  2UY1 B;  4MLP A;  3D9I A;  4RSY A;  3S2A A;  1MQS A;  1PAQ A;  4DPR A;  5J90 A;  2XHE A;  3FH5 A;  2WXQ A;  3ASD A;  3TXM A;  3D9P A;  1H6K A;  5JHA A;  4I1M A;  4GA0 A;  3OXL A;  5LOZ A;  3DBS A;  4CT0 A;  2OOE A;  1HE8 A;  4F7A A;  3T8M A;  3VTX A;  3TAX A;  5KJL A;  4HOR A;  4CGV A;  2LSU A;  3FTV A;  3ZPJ A;  1MHQ A;  4W9R A;  2V4L A;  5BV1 A;  2CHZ A;  1Z3Y A;  3JQ0 A;  1UG3 A;  3EIQ C;  2V0P A;  1XNF A;  3CHS A;  3QB2 A;  4JVS A;  2WVI A;  1TJC A;  2C0L A;  4CDN A;  1HZ4 A;  2WXH A;  1NP7 A;  2DBA A;  4HOQ A;  4EPZ A;  3NQP A;  3JCK C;  2CFZ A;  4H7Y A;  1UN9 A;  3QOU A;  3C98 A;  5FQ6 A;  2CHW A;  4H7X A;  4AIF A;  3MKQ A;  3TG5 A;  2KAT A;  1HS6 A;  3QDN A;  3RRN B;  1N52 A;  4EZL A;  4I6J A;  4AVX A;  5G2N A;  4APF A;  3SZ7 A;  2ZU6 B;  4Q94 A;  4XE0 A;  4FHK A;  3UPV A;  3FUI A;  2VSN A;  2A5U A;  3JQ1 A;  4GA2 A;  4P29 A;  4B8A A;  4I2Z A;  3S7B A;  2IFU A;  3BG0 B;  3SF4 A;  3AS5 A;  3IHY A;  3RIB A;  2MHK A;  3FWV A;  1QQE A;  4I17 A;  4I43 A;  4PS8 A;  3P1U A;  4N2Q A;  1KLX A;  4UI9 C;  4EZK A;  4K0R A;  3UT7 A;  1W3B A;  3RO3 A;  5FZS A;  2XPI A;  4LEU A;  4AM9 A;  3FUK A;  3LY7 A;  2LSV A;  3PRE A;  4ACL A;  2HR2 A;  3FU6 A;  3EHN A;  3CV0 A;  3TXN A;  1FCH A;  2FUL A;  2KC7 A;  3LDZ A;  5AYW D;  2I1K A;  4U0S A;  5G55 A;  2EQX A;  4O6F A;  1Z3X A;  4NRH B;  1S0P A;  4XX5 A;  4HXI A;  1JPL A;  3L17 A;  3MKR A;  2WXR A;  3ZRH A;  1DNP A;  3FUN A;  4ILI A;  3OAW A;  2WXL A;  1E7U A;  1OWP A;  2GGF A;  2J4D A;  4L2Y A;  3U4T A;  5KCM A;  1DVP A;  3LVR E;  2X6I A;  2OVB A;  3PVL A;  2R5S A;  5HQ8 A;  3R7Q A;  4A1S A;  4KMO A;  3ZHE B;  3TG4 A;  2QY7 A;  1IHG A;  4N3C A;  3SD5 A;  3LYA A;  4Y6W A;  4DI3 A;  4G2V A;  5ENN A;  3LJ3 A;  3FTS A;  4MS6 A;  2PL2 A;  4GU5 A;  3L6A A;  4IUL A;  3RO2 A;  3MV2 B;  2J08 A;  2E2E A;  4NUR A;  4CDM A;  4DJA A;  4J8F A;  1NA3 A;  4CT4 A;  4XKC A;  4U63 A;  3FUD A;  2C0M A;  3PNL B;  2YNQ A;  2MOW A;  3CK8 A;  4FUL A;  2IJG X;  1N54 A;  4FJY A;  4RG9 A;  3FU3 A;  4AY6 A;  1ELR A;  4FLH A;  5G04 C;  5J08 A;  3WXX A;  2GRM A;  3ESK A;  1E7V A;  4HOU A;  4ANW A;  2BF0 X;  2WXI A;  4JA7 A;  3TGO A;  1HX8 A;  4JW1 A;  2JLB A;  4QFV A;  1E8X A;  3KD7 A;  2VJ8 A;  2NSZ A;  3CR3 A;  2YHC A;  3B7R L;  3UMV A;  1EYH A;  3CKB A;  5JJ6 A;  4FC8 A;  3CQG B;  4J8S A;  4ANU A;  4F3V A;  3JUI A;  3L13 A;  1ZBP A;  3GZ1 A;  4EEC A;  3LS8 A;  3G2W A;  3L22 A;  2DIW A;  5ANL A;  3I4G A;  3PEV B;  3S7F A;  4B89 A;  3MYV A;  2WXG A;  4UWF A;  2J9Q A;  3KAE A;  1HU3 A;  5EKQ D;  5A7D B;  2KCL A;  4A55 A;  1JWF A;  2I1J A;  4B94 A;  4LCT A;  2C2L A;  4WNF A;  4ILH B;  4UQZ A;  2LAH A;  4WWP A;  3HDX A;  4WAF A;  4BFR A;  1TJF A;  4GZD A;  4C0M A;  2E0I A;  4GCO A;  3PUK A;  5BUZ A;  4I1O B;  3DPD A;  1H2U A;  5FZR A;  2WQ6 A;  3PNT B;  5LP0 A;  2WXN A;  4JC8 A;  3KS2 A;  2PM7 A;  3ASH A;  4OYS A;  4BY6 A;  4PS3 A;  1Z6T A;  4PDX A;  4OVU A;  1YA0 A;  4GML A;  5AEN A;  3D9K A;  3ONL A;  3AU4 A;  4ACK A;  3D9L A;  4HVB A;  5EDS A;  3LPZ A;  3G2S A;  1WAO 1;  2WXJ A;  3PE3 A;  1UJK A;  4IRU A;  4APO A;  4JPS A;  4JZY A;  4N3B A;  4FLB A;  5CMY A;  3ZHE A;  4AV7 A;  1OWM A;  4KBQ A;  3CVP A;  3ML9 A;  4B0Z A;  3D9N A;  3G2V A;  3Q49 B;  2HYZ A;  2LO6 A;  3FH7 A;  3MA5 A;  3B7U X;  3QK0 A;  3L54 A;  4LER A;  4UWK A;  4HOS A;  1NA0 A;  3EHM A;  5EX0 A;  3B7T A;  4PH4 B;  3UT8 A;  4CRW A;  3ESL A;  5JJ7 A;  3APC A;  3CST A;  3O48 A;  2QFC A;  4BT8 A;  4ATG A;  3FDH A;  3FY4 A;  4N2S A;  2HM8 A;  3ZXS A;  4AXH A;  2XPY A;  3ZIM A;  2X3M A;  4I6G A;  3EJN A;  3ZYQ A;  4BT9 A;  2LNI A;  4RVB A;  2V5F A;  3Q15 A;  4J6I A;  5E75 A;  3QWW A;  3D9O A;  5BT1 A;  2CG3 A;  4KZC A;  2AWI A;  3CVU A;  2J49 A;  3ZYM A;  3FTU A;  3LY8 A;  1EDU A;  3FTX A;  4FU3 A;  1H2T C;  3OXF A;  3TJP A;  2AXV A;  1KT0 A;  2IOS A;  4J0U A;  2WXP A;  2BTD A;  4I2W A;  4F1S A;  4ABN A;  1PY1 A;  3Q47 B;  3QKY A;  4ILG A;  3SBS A;  3CGH A;  1OWN A;  2VTB A;  2R17 C;  3CVY A;  3EDT B;  2NC9 A;  2KCV A;  3FP3 A;  3FU5 A;  4AP2 A;  1U3D A;  3ENE A;  5M72 A;  2PM6 A;  2YQ8 A;  4UWG A;  4AOF A;  3RK6 A;  4I9C A;  4CCA A;  3P2B A;  3TL5 A;  2GW1 A;  3MX3 A;  2FI7 A;  1JWG A;  4AJW A;  5AJD A;  4GZ5 A;  5C2Y A;  3OTN A;  3B7S A;  3IHV A;  3HVE A;  4G25 A;  4IYP A;  2IF4 A;  3VLD A;  4UI9 J;  2OV8 A;  2Q7F A;  5E76 A;  1NZN A;  2WXM A;  4N39 A;  2XRY A;  3CK9 A;  4BTA A;  4TRQ A;  4GZC A;  4WND A;  5CCM A;  3CHR A;  3MGB A;  2WM9 A;  3S7J A;  4FP7 A;  1UJJ A;  3N71 A;  4UQX A;  1HF8 A;  4Q69 A;  4JXT A;  2M63 A;  5AIJ A;  1INZ A;  3FUH A;  4NAC A;  2VSO E;  4CEM A;  4GZ6 A;  4KXK B;  4GPK A;  3S7D A;  2XGS A;  4A1G A;  1Y8M A;  4JHR A;  3PEU B;  4N3A A;  3MEK A;  2PQR A;  2VSY A;  5EX3 A;  5FQ4 A;  3NZU A;  2CHX A;  4XI0 A;  5KJN A;  1E96 B;  3CEQ A;  3AS4 A;  3PDN A;  3CHQ A;  4LUN U;  3CK7 A;  1HG2 A;  3CIA A;  2ION A;  3FUM A;  4I1A A;  2Y3A A;  3I5P A;  2Y4T A;  1ZU2 A;  3Q5M A;  1H2V C;  1OUV A;  5FQ7 A;  5CCL A;  4XI9 A;  5DIZ A;  3APD A;  4C0E A;  1BPO A;  4LRZ A;  4UWH A;  3RU0 A;  3D9M A;  2V8S E;  3AU5 A;  1E90 A;  1SZA A;  3CHM A;  4KVO A;  4PUC A;  4U0Z A;  1P5Q A;  3R9A B;  4GCN A;  3MV3 B;  3KEZ A;  4Y6C A;  5G05 C;  2J07 A;  3ZEF A;  4DI4 A;  3PE4 A;  2J4B A;  5G04 J;  1UN8 A;  5ARF A;  3Q4A B;  3NF1 A;  4AY5 A;  2L9B A;  3ZFW A;  2HO1 A;  3GZS A;  1IYG A;  4DLQ A;  5KJM A;  3AS8 A;  3U66 A;  2WMO A;  3IBE A;  3I4R B;  4JL0 A;  3GZ2 A;  2VTB B;  4CGW A;  4L1B A;  3SFZ A;  5AJL A;  3R7R A;  3CVN A;  3QC1 A;  4XKB A;  3ZVV A;  2XQ0 A;  3QJZ A;  4BX9 A;  4EQF A;  3GYZ A;  3CHP A;  3ZGQ A;  1HH8 A;  2I6H A;  3G2T A;  3VTY A;  1PC2 A;  4YVO A;  1FVF A;  1OWL A;  3GW4 A;  3SGH A;  2R59 A;  4R7L A;  5FQ8 A;  2AXZ A;  3FEY A;  4D10 C;  2I9C A;  3PZD A;  5JHB A;  3CVQ A;  4GYY A;  3K9I A;  1EPU A;  5BNW A;  1HG5 A;  3LVQ E;  3RRU A;  4JHK A;  3FUJ A;  4URK A;  1KT1 A;  3CHO A;  4U0U A;  2X6K A;  3QAQ A;  4TUU A;  4WNG A;  3FHE A;  1IQU A;  5A23 A;  3LKU A;  3FU0 A;  4K03 A;  2KCK A;  4RG6 A;  4U04 A;  3I3N A;  4FAD A;  5T8I A;  3FUE A;  4GYW A;  4OVV A;  3ZYK A;  4KYO B;  2JEK A;  3SHF A;  4I6E A;  4PS7 A;  5DBK A;  3FH8 A;  2Y4U A;  2A4Z A;  4G24 A;  1E8W A;  4FA6 A;  5LCW J;  2XCC A;  2XCB A;  1E8Y A;  2KZT A;  2VSX E;  4BX8 A;  2WQH A;  4F53 A;  3SNX A;  4ANX A;  3IV0 A;  2OVF A;  3ASG A;  2VQ2 A;  1A17 A;  2VYI A;  2BUG A;  3PH0 C;  1L5J A;  4XZ4 A;  3ZYL A;  4A3V A;  3L08 A;  3UUX A;  4MKT A;  4BTB A;  3FUF A;  2IU1 A;  2KZT B;  3FTY A;  4GMJ A;  4KVM A;  3HYM B;  3U64 A;  2UY1 A;  3ZN3 A;  2L0T B;  2VGY A;  3G2U A;  3ML8 A;  4KT6 B;  2WB2 A;  3NZS A;  2GRL A;  2WPV A;  4U8H A;  3EIJ A;  2XPZ A;  4UI9 K;  3QWV A;  5FT9 A;  1WY6 A;  2WQ7 A;  1IQR A;  1QNF A;  3FTW A;  5D0Q D;  3ULQ A;  2VGX B;  4G11 A;  2PZI A;  3FUL A;  4C9B B;  4AEZ C;  3HIZ A;  3IKO B;  2RG8 A;  1JUQ A;  3OXG A;  2FF4 A;  2ILR A;  1E8Z A;  2P58 C;  3ONK A;  2DCP A;  2YHE A;  2XGO A;  3E4B A;  4JEU A;  3UX4 A;  2YIN A;  1ELK A;  4GZ3 A;  4FJZ A;  3CVV A;  4V3I A;  4UQY A;  3FEX A;  4YND A;  3CVL A;  4YVQ C;  3QWP A;  4B8C B;  3MCX A;  4DLO A;  4I9E A;  4U07 A;  1QZ2 A;  4HS2 A;  4MRU A;  4L7T A;  3PRZ A;  4JEH A;  3O4Z A;  3UT4 A;  4A3T A;  4FHJ A;  3IEG A;  3MZL B;  5FTP A;  2X6H A;  3LCA A;  4G1T A;  5LFA A;  1LF8 A;  3MKQ B;  2NXP A;  4HFG A;  4GYO A;  5HI7 A;  4WWN A;  4G26 A;  2AW6 A;  3D3M A;  3U3W A;  2OND A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...