3D3MA

The crystal structure of the c-terminal region of death associated protein 5(dap5)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
168
structure length
161
Chain Sequence
LLKLEKELLKQIKLDPSPQTIYKWIKDNISPKLHVDKGFVNILMTSFLQYISSEVNPPSAPSKEQLEQEKQLLLSFKPVMQKFLHDHVDLQVSALYALQVHCYNSNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQWLTWLETA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Eukaryotic translation initiation factor 4 gamma 2
publication title The crystal structure of the C-terminal DAP5/p97 domain sheds light on the molecular basis for its processing by caspase cleavage.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
total genus 64
structure length 161
sequence length 168
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3d3mA00
1H2VC 1UW4B 2KZTB 2IONA 2KZTA 4B89A 4CEMA 1UG3A 2IU1A 2RG8A 3EIQC 2I2OA 3FEYA 1H2UA 4LUNU 3D3MA 4B8AA 1HU3A 3JUIA 4IULA 4JHJA 2GGFA 2IOSA 3FEXA 1H6KA 2VSOE 2VSXE 1H2TC 4CRWA 2FULA 1N52A 4JHKA 4GMJA 3L6AA 4B8CB 4CT4A 2ZU6B 2IOLA 3EIJA 1PAQA 4GMLA 5ANRA 1N54A 2HM8A 2NSZA 4C9BB 3RK6A
chains in the Genus database with same CATH superfamily
3FTSA 2J08A 3DEOA 4DRXE 3CVYA 3FTYA 3C3RA 1G3NB 3SFYA 4A55A 4KYOB 3VLDA 2LUHA 2AWIA 2GGFA 3DBSA 4OYSA 4O6FA 4GA1A 5G05C 4GMJA 4F1SA 2R05A 3G2SA 5C2YA 3S7FA 2LXLA 3TGOA 1N94A 3O48A 3ZHEB 4XX5A 1FVHA 2Q7FA 3ASNE 3L13A 4FHJA 4ANUA 2CHXA 3B7UX 1LD8A 4FJYA 1N54A 4OAUC 1BPOA 4D10C 2X3MA 4G24A 4ANWA 3QKYA 4JVSA 3AS8A 5FQ6A 4I6JA 3PE4A 1QBQA 4DX7D 2AXVA 2FEZA 3TXMA 4ABNA 3CSFA 4KZ0A 5CMWA 5KJMA 4K5CA 3ESKA 3UM3A 4U8HA 4EZJA 5T3RA 3ASOE 4GTOA 4NURA 3VLFA 3ENEA 4TV3A 1V54E 4MRUA 2WXQA 2Y69E 2ETBA 1TNUA 2KCVA 1HE8A 2GRNB 3FEYA 1H2UA 3PZ4A 4TRQA 5FZSA 3I5PA 4JHRA 3D9IA 3PZ2A 1BU9A 1UN8A 5ENQD 4CDRA 4MS6A 4XI0A 3HYMB 2XENA 1XNFA 4I1MA 3SI5A 5JJ7A 4C0MA 4F53A 4G2VA 3DPDA 2CHWA 3TWSA 2L6JA 3FUHA 2WB2A 3PUJA 4PS7A 2NXPA 2ILRA 5FQ7A 5KWDA 4A63B 4RVBA 1OWOA 3UT4A 5A23A 3HXBA 1O1SA 5EX3A 4EHMA 4LNGA 2P9LG 5B1BE 3G2TA 4FU3A 3D9KA 3FU3A 3NZSA 4K03A 3V30A 1OCRE 1Q2ZA 2VJ8A 4DPRA 3KAEA 2VSYA 4QFVA 2OEWA 3PS6A 1HU3A 3DSTA 3VLEA 2F8XK 4U7EB 2WXMA 1OWMA 4ZFHA 1MHQA 2Y1LE 3HXEA 5T8IA 4JEHA 2L0TB 5KNGA 1PY1A 4GYYA 3UKUG 4AY6A 1HZ4A 3FTZA 3ZN3A 2X6KA 1OCOE 3BG1B 4F1PA 4GCNA 4N2QA 4FJZA 3NOGD 3DSSA 5AQ7A 1HG5A 3KS2A 1YMPA 1KZOA 3B7SA 4XEIG 5FWQA 4LEUA 4JW1A 2VTBA 2IU1A 3DSWA 3ZW3A 3WG7E 3ZPJA 3D9LA 3TWWA 1TEZA 3L6AA 3FUNA 3ZXPA 3ONLA 4C9BB 3L17A 2YHEA 3CHPA 3Q15A 3BUAA 3CVWA 5J90A 4GZ5A 5BXOA 4FA6A 2DZNA 2HO1A 4UWHA 2YNQA 2DIWA 1JUQA 5BNWA 2VGXB 3IHYA 3GZ1A 5G55A 3W9FA 2X6JA 4LNUD 3UI2A 3EU5A 4JPSA 3TWUA 1H6OA 4HBDA 3RO2A 5D66A 4GMRA 4CT4A 3S7BA 2C2LA 5C1DA 3RAUA 3NBNB 3S7JA 2OV8A 3FDHA 5BW8C 2WXKA 1IKND 1UG3A 3EIQC 2ZIRA 1INZA 4GCOA 1YCSB 4IYPA 4GZ6A 2Y3AA 1H6PA 2QC9A 4UWGA 4WWPA 5EKQD 3GW4A 1PC2A 2WXNA 2AXUA 1EPUA 3AG1E 3FU6A 3J5QB 1S0PA 5EYPF 2QZAA 1EDUA 3CVLA 5FINA 3UT7A 3FUMA 2FBNA 2Y4UA 2QYJA 3FHEA 4K5AB 1FPPA 2XGOA 4CYMD 4U0ZA 3T9KA 4JB8P 5BV0A 3DSXA 3WXXA 1U3DA 2I1KA 4H7YA 5LCWC 5BUZA 2M63A 1LTXA 1MJ0A 2WM9A 3NOCD 3UIOC 3FEXA 3QDNA 3KSLA 3C3QA 4FADA 4GU5A 5HQ8A 3U9WA 1QQEA 3MX3A 1H0AA 3ULQA 1OY3D 1X81A 3ZEFA 2J4BA 4Y6WA 4B0ZA 1JWGA 4J8DA 3UT8A 2FO1E 3IHVA 2R02A 4DLOA 3HXDA 2RD0A 1TN6A 4HB5A 4KZCA 4UWLA 3UM0A 3FTXA 1Y8MA 1JPLA 1ELWA 2WQHA 5KJKA 3ABLE 5IY5E 2QY7A 3X2QE 1EYHA 3ULYA 1PAQA 2DWZA 2BUGA 4NRHB 3URZA 3CVQA 2XRZA 2WXIA 3EDTB 2RG8A 2E0IA 3ASHA 3BQOA 4DJAA 3N71A 2CHZA 5CBNA 3ZNGA 4JHKA 1KZPA 3SFXA 2WMNA 2XPIA 3LY7A 4WWNA 5CHEE 1O1RA 3R9MA 3IXEA 4FHKA 4YDOA 5KCMA 4JL0A 2R17C 4KVOA 3S2AA 3BU8A 2RFAA 1LF8A 3PDNA 1UN9A 3ZKJA 1N0RA 1O5MA 4UUCA 4UQXA 4CGVA 1E7UA 3FFLA 4E6HA 4E85A 4J8SA 4NACA 3BG0B 3CVXA 1UW4B 4EZLA 4MKTA 4GZ3A 4GPKA 4TXQA 4YDWA 2XGMA 2LSUA 2YINA 2H6IA 3PE3A 4LCTA 1RW2A 5G05J 4MBGA 2L9BA 4GTQA 2ZGGA 4BX9A 2WXFA 3VTXA 3MKQA 3T5VA 4BWRA 3I3NA 3PZ3A 5DBKA 3JXIA 5B1AE 3RKVA 4APOA 3LS8A 4GTTA 2RFMA 2B0OE 2KZTB 1VDYA 3ABKE 3CK7A 4ILIA 1NFIE 3AAAC 4R7LA 3RRUA 3CK9A 4GA0A 4HQDA 1MX2A 4CZ2D 4J6IA 4UI9C 3Q78A 2IY0C 3FUFA 3ZYMA 4OVVA 2IQCA 5LFAA 2OVBA 3D3MA 4CDNA 3RU0A 4IN3B 2VSXE 2ZU6B 2BKGA 3PZDA 3AG4E 3RK6A 2PM7A 2F0YA 4RG9A 4WNEA 3ZHEA 4GTMA 4GTSA 1NZNA 3ZYLA 4G8KA 4LUNU 5JA4D 3TAXA 1EF1C 1BD8A 3LY8A 5EYLA 2J07A 1TN8A 1KT1A 1TYQG 5AENA 4PUCA 2V0PA 4OAVB 4GYOA 1SA4A 4DX1A 3PUKA 3Q9UC 2J49A 5LX8A 2GRMA 3T8MA 2I1JA 5FJYA 4CEMA 1MZCA 1TJCA 4HXIA 1XGWA 2R5SA 1K1AA 1HX8A 3Q7AA 1TNZA 3CHQA 1ELRA 2NYJA 4PS3A 1IYGA 5CBOA 3PNLB 3PNTB 1P5QA 1TR4A 3EUVA 4UQYA 1H2TC 4F6RD 5CCLA 4EZKA 2PM6A 3Q7FA 3DPYA 4GAAA 3NQPA 5JJTA 3RRMB 1JCQA 3CVPA 4APFA 2CFZA 5ARFA 3FH5A 3PVLA 4JA7A 4GTRA 3G2UA 3F6QA 5B3SE 5AQ9A 4DX6D 2P9IG 3NZUA 2OVFA 3HDXA 4BEPA 4A1GA 1JCSA 5H7PA 1IQUA 3ZUVB 1TN7A 2WQ6A 1W3BA 3JXJA 3C72A 4YVQC 3AS4A 2OCCE 3MA5A 1N4SA 4YVOA 4NIKA 4P29A 2NC9A 2AJAA 3U4TA 1V55E 3CQCB 4ANVA 3JCKC 2WXHA 3Q75A 2ETAA 5CEDB 5CRUA 4U95D 3TWXA 3MV2B 1UJJA 2ZGDA 5E75A 4ACLA 2LAHA 5LOZA 3V31A 3CVUA 3U3WA 5BT1A 4GZCA 2PQNA 3MYVA 3FY4A 2PNNA 2Y0BG 3IKOB 3L9TA 1S64A 2EIKE 1MX6A 3HVEB 1DCEA 4XI9A 4AY5A 2XHEA 2I6HA 4U8YD 2F8YA 3ZU7B 3CHMA 1Z6TA 3OTNA 4EBAG 5KBAA 5FZQA 3UXGA 1E8ZA 1JCRA 3TWRA 4EPZA 5DIZA 3ISMC 3FU0A 3RRNB 2IF4A 3J5PA 4J0UA 3U66A 3QJZA 4U04A 4HRNA 3SBSA 4X8QA 3IBEA 5AQBA 3TG5A 3UX4A 2PL2A 2AW6A 3LPZA 4BTAA 2GRPB 4U63A 2ONDA 1U3CA 4YNDA 4CRWA 3TG4A 1K3ZD 5CERB 3V2XA 3O4ZA 1A17A 5AJLA 2XPZA 3APCA 1FT1A 4G23A 3DSVA 4KMOA 4HNAD 2KBXA 4PS8A 2LO6A 5D0QD 3TJPA 4OVUA 3IEGA 3OXGA 5KJNA 2LAIA 1SW6A 2IO3C 4AM9A 4GA2A 1SQMA 4LG6A 2VGXA 4ILHB 3EHNA 3SD5A 1BI8B 5CMYA 5CRVA 5JMND 2KM4A 5LCWJ 2J4DA 4FC8A 1NP7A 4HVBA 2EINE 2XEHA 3QAQA 4BETA 1NA0A 5CECB 3OAWA 3AU5A 5KNHD 5FZRA 3ESLA 1NA3A 3DEPA 3HXFA 4BSXA 4AOFA 4U0UA 3E32A 4N39A 2R59A 3ZIMA 4DX2A 1KLXA 3UM2A 2OEVA 2VQ2A 3SFZA 1BLXB 4L2LA 4B8AA 4O60A 2L0IA 3FU5A 4AJWA 3D9NA 4JA9A 4BT9A 3CIAA 2IOLA 4URKA 4IRUA 5BPPA 2P2CP 2AXZA 3G2WA 4J7WA 2UY1B 2XQ0A 4HS2A 3I4RB 4I43A 4KT6B 3DSUA 5ANLA 3ZGQA 3QWPA 3ZVVA 1IXVA 3B7BA 4GYWA 2UY1A 2YQ8A 3NAWA 3APDA 1QYMA 4ATZD 3CQGB 4WAFA 3LY9A 1N95A 4Q69A 4UWKA 1E8XA 3AJIA 5AN8A 5AIJA 2MYOA 3MGBA 3U64A 2EIME 4FLBA 4DX5D 3UPVA 5AQAA 4WWOA 3FUEA 5J08A 3CSTA 3LVRE 5M72A 3CGHA 4XIFA 3RSEG 2CG2A 3Q73A 4AIFA 2IONA 2V5FA 2P9NG 3Q9NC 2DZOA 2IJGX 1E8WA 2P9KG 4Y6CA 4G11A 1QZ2A 2F37A 2B6CA 2VGYA 2WXRA 4K5BA 2HYZA 3ML9A 3UIPC 1N0QA 1E90A 1N52A 3SO8A 4GMLA 4BT8A 2WMOA 4UI9K 2C0MA 3GZSA 1BI7B 3Q47B 2IEJA 1TJFA 4DI4A 3MKRA 3Q49B 2IOSA 4N3BA 2P58C 3ASFA 3L22A 4CT0A 2H6FA 3CK8A 2XEEA 1S70B 3FTUA 2XPYA 3QWVA 4UI9J 4I17A 4ILGA 3SHFA 4ATGA 4WUYA 2RKKA 5D2MC 5G04J 2FI7A 3LEWA 2GW1A 4N5CA 1WG0A 4CCAA 1H2VC 2DVWA 3PH0C 3OXFA 5AJDA 1LD7A 2LSVA 5ENOD 2CG3A 3HXCA 3EIJA 5EX0A 4GPMA 3HHMA 4ZHBA 2KZTA 5FQ4A 2MOWA 5AYWD 3ONKA 4I2WA 5ENTD 3FULA 5G04C 3OXLA 4RQIA 2LNIA 4RLYA 4HOUA 1N4QA 2V4HC 4L2YA 3FUIA 4TUUA 2R03A 2X6FA 1TNYA 5JJ6A 2A5EA 3DRAA 4N3CA 5BXUA 5ITZF 3EHMA 5HRYA 1NL4A 2WXPA 4G8LA 3AG2E 1U2VG 3LJ3A 4GTPA 3B13A 1Z3XA 2DYRE 1IHBA 2XCBA 2VSNA 5FT9A 3TWVA 1D8EA 2GROB 3RJVA 4EECA 4LNBA 1FVFA 4BTBA 4L7TA 4GZDA 3SGHA 4A3VA 3TL5A 4I1OB 5ARGA 3B7TA 4I6EA 5E76A 3PEVB 4KBQA 4HOSA 5D0OD 3CVVA 1Z3YA 3UUXA 1YA0A 5HS0A 4U8VD 2H6HA 5AAOA 4UQZA 3R7RA 1UOHA 5KJLA 4KVMA 3P1UA 2V5QC 3CV0A 1N4PA 3LDZA 3QC1A 3ZYQA 5FTPA 2R2LA 4F7AA 4DK5A 2IFUA 4HLEA 4GTVA 3GYZA 3PEUB 4PH4B 3EHQA 3FUJA 4HRLA 2XS8A 1B89A 2I2OA 3FH7A 4AVXA 4HORA 1MX4A 3EJNA 3KEAA 2FF4A 3CHRA 1K1BA 4G26A 4HOTA 2WXJA 3R7QA 3SBTB 3QWWA 3E4BA 4AEZC 5CCMA 4YDYA 4XKBA 2X38A 2WXOA 2J9QA 5CEAA 4ANXA 2GRRB 4M7CA 4FLHA 2FULA 4BFRA 4N5QA 1SA5A 4BX8A 3P2BA 5ANRA 3KEZA 4I1AA 4F3VA 2WQ7A 4O1OA 4B94A 5ENSD 5JHBA 3GZ2A 4RSYA 1D9SA 3QARA 5ENPD 4HOQA 2UWJG 1AWCB 3JQ0A 3B7RL 5A7DB 1KPSB 1H6KA 2KCLA 3FTVA 4I2ZA 1GW6A 3L16A 4I9EA 3SZ7A 4DLQA 3D9PA 2XGSA 3ABME 3AG3E 1YYHA 4HFGA 3IV0A 4LERA 1AP7A 3MJWA 2H6GA 3D9JA 4C48B 4JHJA 3CKCA 4LSZE 4JC8A 4O1PA 1WM5A 4JD2G 3PRZA 3AS5A 2KXPC 4HI9A 1HF8A 1L5JA 2LXMA 2VTBB 4XKCA 3D9OA 4ME2A 3SF4A 2X6HA 2FO7A 3EHRA 3SY2A 4TXPA 1NI1A 4MLPA 3HVEA 4EQFA 4J8EA 1OWNA 1DC2A 4QQIA 3ASGA 5A6CA 4ACKA 1UJKA 2A4ZA 3S7DA 3L54A 3W9GA 2PQRA 5EN5D 4U07A 3CKBA 5FQ8A 3K9IA 3I4GA 1HFAA 3KSQA 2ZXWE 1N11A 4TXRA 2XEVA 3ASDA 3CHOA 1HG2A 4A1SA 1Z5SC 1MQSA 1IQRA 2ETCA 1OWLA 3LVQE 2KCKA 2A5UA 3LKUA 3C98A 2NSZA 1H19A 4U96D 3APFA 5EILA 4HRMB 4GB9A 2VYIA 2BTDA 5AARA 2BF0X 3B95A 2EQXA 2HE0A 1E96B 1IHGA 2WXGA 2GRLA 2J8SD 3D9MA 3QOUA 1SVXA 4UWFA 3FP3A 3T8KA 3C5RA 4BERA 1O1TA 3HRAA 2GRQB 4J8YA 2KC7A 4U0SA 3QK0A 2EIJE 1N9AA 3MEKA 3TWQA 3QB2A 4XE0A 3LXUX 3Q4AB 1SZ9A 4KXKB 4IULA 1D8DA 3TWTA 4Q96A 4NQ0A 3FUDA 3HIZA 1HH8A 1N4RA 2Y4TA 2DYSE 4L23A 3UKRG 1OWPA 3ULEG 1HO8A 3HG0D 2OOEA 4N2SA 2WPVA 3DXMG 3ML8A 3UTMA 2EILE 5HKPA 4N3AA 4DUIA 3ZRHA 3JUEA 2MHKA 5G2NA 2XS1A 2BEDA 4FULA 1FCHA 4XZ4A 3JQ1A 3V79K 3UQ3A 2V8SE 1SZAA 4JEUA 2L6BA 3NF1A 3UINC 2QYUA 3ZFWA 2PZIA 3CLJA 3E30A 4AV7A 3LCAA 2DCPA 3PREA 2BKKB 2E2EA 4L9PA 3JUIA 3NB2A 4Z68A 3UMVA 3FTWA 1OXJA 3RIBA 2HR2A 1ELKA 3CVNA 3MZLB 1X5BA 2ZISA 1Y6IA 4I6GA 1ZB1A 4YDEA 4WNFA 1RZ4A 3AU4A 3SNXA 2MRIA 1ZU2A 4Q94A 1K8KG 2P9SG 3C3OA 3QNKA 4DI3A 4C0EA 2X6IA 3G2VA 2WXLA 4M3OA 2HM8A 2I9CA 4PDXA 3ZYKA 3JYSA 4HI8A 4BESA 3FUKA 4BSZB 4WNDA 2XRYA 1QNFA 3T5XA 1DNPA 3E34A 2P9UG 2AVPA 3VTYA 2IO2C 4G25A 4A3TA 4BY6A 1OCCE 2V4LA 1DVPA 3FWVA 3L08A 1MYOA 3R9AB 1A5EA 5ENRD 3RO3A 4WNGA 4FP7A 1WY6A 4AXHA 3L82A 4L1BA 2JABA 3BEEA 1TNBA 2J09A 3ZXSA 3MCXA 4HLLA 2QFCA 4W9RA 3TXNA 3CHSA 4H7XA 2KATA 3EU9A 4K0RA 2C0LA 4TUMA 4EBAA 1ZBPA 3DWLG 5EDSA 3FH8A 3UM1A 3V2OA 5BV1A 2P9PG 1E7VA 1HXIA 2DBAA 5ENNA 2CFUA 4B93B 5EIBE 1JWFA 3E37A 3LYAA 2YHCA 3MV3B 2JEKA 1WDYA 4RG6A 3SQVA 4CDMA 5FIOA 4CGWA 2JLBA 3CR3A 3DXKG 5JHAA 3Q5MA 2XCCA 4G1TA 4AP2A 3MKQB 1DCQA 5LP0A 1OUVA 3PZ1A 5EIDA 3LJNA 2VSOE 4V3IA 3D9HA 2VGEA 1KT0A 1WAO1 1OT8A 1S63A 1TNOA 4I9CA 4B89A 2XZTG 1FT2A 4JZYA 4LRZA 3CEQA 2WVIA 1OCZE 3Q79A 4JXTA 1E8YA 5T4YA 2XZDG 4B8CB 3E33A 5HI7A 4J8FA 1HS6A 3KD7A
chains in the Genus database with same CATH topology
1A17A 2RD0A 3R7QA 4KZCA 3FTSA 2J08A 4UWLA 5AJLA 3SBTB 3QWWA 2XPZA 3E4BA 3APCA 4AEZC 4G23A 3FTXA 1Y8MA 3FTYA 3CVYA 4KMOA 5CCMA 1JPLA 1ELWA 4XKBA 2WQHA 2X38A 2WXOA 4KYOB 4PS8A 4A55A 3VLDA 2J9QA 2AWIA 2LO6A 5D0QD 3TJPA 4ANXA 5KJKA 2GGFA 2QY7A 3DBSA 4OYSA 4OVUA 4O6FA 1EYHA 3IEGA 4GA1A 4FLHA 2FULA 3OXGA 5G05C 4BFRA 4GMJA 5KJNA 4F1SA 3G2SA 1PAQA 4BX8A 3P2BA 5ANRA 5C2YA 2LAIA 3KEZA 3S7FA 2BUGA 4NRHB 4I1AA 4AM9A 4GA2A 3URZA 4F3VA 2WQ7A 1SQMA 4B94A 3TGOA 3O48A 5JHBA 2VGXA 4ILHB 3CVQA 3ZHEB 4XX5A 2XRZA 2WXIA 3GZ2A 1FVHA 3EHNA 3EDTB 4RSYA 2RG8A 2E0IA 3SD5A 3QARA 3ASHA 5CMYA 2Q7FA 4HOQA 2UWJG 2KM4A 3L13A 4DJAA 4FHJA 5LCWJ 3JQ0A 3B7RL 5A7DB 3N71A 2J4DA 4ANUA 2CHZA 4FC8A 1H6KA 2KCLA 3FTVA 4I2ZA 2CHXA 3B7UX 1NP7A 4JHKA 4FJYA 4HVBA 3QAQA 1GW6A 2WMNA 3L16A 2XPIA 3LY7A 4I9EA 4WWNA 3SZ7A 4DLQA 1N54A 5CHEE 1BPOA 1NA0A 4D10C 2X3MA 3D9PA 2XGSA 4G24A 4ANWA 4FHKA 3QKYA 3OAWA 3AU5A 5KCMA 4JL0A 4JVSA 3AS8A 2R17C 4KVOA 4HFGA 3IV0A 3S2AA 4LERA 5FQ6A 1LF8A 3PDNA 1UN9A 4I6JA 3MJWA 3D9JA 3PE4A 5FZRA 3ESLA 2AXVA 2FEZA 4JHJA 4UQXA 1NA3A 3TXMA 4CGVA 3CKCA 1E7UA 3FFLA 4JC8A 4E6HA 4ABNA 4E85A 4J8SA 4NACA 4BSXA 4AOFA 1WM5A 3CSFA 4KZ0A 3PRZA 4U0UA 3AS5A 3BG0B 5CMWA 3CVXA 5KJMA 1UW4B 3ESKA 4EZLA 1HF8A 4N39A 1L5JA 4MKTA 4U8HA 4EZJA 4GZ3A 2VTBB 4GPKA 4XKCA 2R59A 3ZIMA 3D9OA 4ME2A 5T3RA 1KLXA 2VQ2A 3SF4A 3SFZA 2X6HA 2XGMA 4L2LA 2FO7A 2LSUA 4NURA 4B8AA 2YINA 2L0IA 3FU5A 4MLPA 3HVEA 3PE3A 4AJWA 3VLFA 3ENEA 3D9NA 4JA9A 4TV3A 4BT9A 4LCTA 3CIAA 2IOLA 4EQFA 4URKA 4IRUA 4MRUA 5G05J 2WXQA 5BPPA 4J8EA 2L9BA 1OWNA 2AXZA 2KCVA 3G2WA 1HE8A 4BX9A 3ASGA 3FEYA 5A6CA 1H2UA 4ACKA 2UY1B 2WXFA 3VTXA 4TRQA 5FZSA 2XQ0A 3I5PA 3MKQA 3T5VA 1UJKA 2A4ZA 3S7DA 3L54A 2PQRA 4JHRA 3D9IA 4U07A 3I3NA 4BWRA 4HS2A 5DBKA 3I4RB 3CKBA 5FQ8A 3RKVA 1UN8A 3K9IA 3LS8A 4I43A 3I4GA 4APOA 1HFAA 4KT6B 4CDRA 4MS6A 4XI0A 5ANLA 3ZGQA 3QWPA 2KZTB 3HYMB 1VDYA 2XEVA 3ZVVA 3ASDA 3CHOA 1HG2A 3CK7A 4GYWA 4A1SA 4ILIA 1XNFA 4I1MA 3SI5A 5JJ7A 4C0MA 2UY1A 2YQ8A 3APDA 3CQGB 1MQSA 4F53A 1IQRA 4R7LA 1OWLA 3DPDA 4G2VA 4WAFA 3LY9A 3RRUA 2CHWA 3CK9A 3LVQE 2A5UA 2KCKA 2L6JA 3LKUA 3C98A 3FUHA 4Q69A 4UWKA 2WB2A 3PUJA 1E8XA 4PS7A 4GA0A 2NXPA 2ILRA 5AIJA 5FQ7A 2NSZA 3MGBA 1H19A 3U64A 3APFA 4FLBA 4J6IA 4UI9C 3UPVA 4WWOA 3FUFA 3FUEA 4GB9A 3ZYMA 2VYIA 5J08A 4RVBA 2BTDA 4OVVA 1OWOA 3UT4A 2IQCA 2BF0X 5LFAA 2OVBA 5A23A 2EQXA 3D3MA 1E96B 1IHGA 2WXGA 3CGHA 3CSTA 3LVRE 2GRLA 3D9MA 5M72A 3QOUA 5EX3A 4CDNA 4UWFA 4XIFA 3FP3A 3RU0A 4IN3B 2VSXE 2CG2A 3G2TA 4FU3A 2ZU6B 3D9KA 3FU3A 4AIFA 3NZSA 4K03A 3PZDA 2KC7A 4U0SA 3RK6A 2PM7A 2VJ8A 2IONA 3QK0A 4DPRA 4RG9A 2V5FA 3KAEA 2IJGX 2VSYA 3MEKA 4WNEA 3QB2A 3ZHEA 1E8WA 4Y6CA 1NZNA 3ZYLA 4G11A 4LUNU 4XE0A 3LXUX 4QFVA 1QZ2A 3Q4AB 1SZ9A 3PS6A 1HU3A 4KXKB 2WXRA 2VGYA 1EF1C 4IULA 3TAXA 3LY8A 3VLEA 2HYZA 3ML9A 4NQ0A 2J07A 3FUDA 3HIZA 1E90A 4Q96A 2WXMA 1KT1A 1N52A 1HH8A 1OWMA 3KD7A 2Y4TA 1MHQA 4L23A 5AENA 4GMLA 4PUCA 2V0PA 4BT8A 2WMOA 1OWPA 4GYOA 1HO8A 4UI9K 2C0MA 3PUKA 3GZSA 2OOEA 4N2SA 5T8IA 4JEHA 2J49A 2WPVA 3ML8A 2GRMA 3Q47B 2L0TB 3T8MA 5LX8A 2I1JA 5FJYA 4CEMA 1PY1A 4N3AA 1TJFA 4GYYA 1TJCA 4HXIA 3ZRHA 4DI4A 4AY6A 1HZ4A 3MKRA 1XGWA 2MHKA 3FTZA 5G2NA 3Q49B 2R5SA 2IOSA 4N3BA 3ZN3A 1HX8A 2X6KA 2P58C 1FCHA 4FULA 3ASFA 3BG1B 3JQ1A 4XZ4A 3L22A 4GCNA 3UQ3A 4CT0A 4N2QA 2V8SE 1SZAA 4JEUA 3CK8A 4FJZA 3FTUA 1HG5A 2XPYA 3KS2A 3CHQA 3B7SA 1ELRA 3NF1A 3QWVA 4PS3A 3ZFWA 5FWQA 2PZIA 3CLJA 4LEUA 4JW1A 4AV7A 3LCAA 1IYGA 2VTBA 4UI9J 2IU1A 4I17A 4ILGA 3SHFA 2DCPA 3PREA 4ATGA 3PNLB 3PNTB 1P5QA 2E2EA 3JUIA 3ZW3A 4WUYA 3ZPJA 4UQYA 5G04J 3UMVA 3FTWA 2FI7A 3LEWA 1H2TC 3D9LA 1TEZA 3RIBA 2HR2A 3L6AA 1ELKA 5CCLA 4EZKA 2PM6A 3FUNA 2GW1A 3CVNA 4N5CA 3MZLB 4CCAA 3ONLA 4C9BB 1H2VC 1X5BA 3L17A 1Y6IA 4I6GA 2YHEA 4GAAA 3CHPA 4WNFA 3Q15A 3AU4A 3NQPA 3SNXA 5JJTA 3PH0C 3OXFA 5AJDA 2LSVA 3RRMB 2MRIA 3CVPA 4APFA 1ZU2A 5J90A 4GZ5A 3CVWA 2CFZA 4FA6A 2HO1A 4Q94A 5ARFA 4UWHA 3QNKA 3FH5A 2CG3A 3PVLA 4DI3A 2YNQA 4C0EA 2X6IA 3G2VA 2WXLA 4JA7A 3EIJA 2DIWA 4M3OA 5EX0A 2HM8A 2I9CA 3G2UA 4PDXA 1JUQA 5BNWA 3ZYKA 3JYSA 3HHMA 3FUKA 2VGXB 3IHYA 2KZTA 4WNDA 2XRYA 3NZUA 2OVFA 3HDXA 1QNFA 2MOWA 3GZ1A 5FQ4A 3T5XA 1DNPA 4A1GA 5G55A 5AYWD 3ONKA 2X6JA 4I2WA 2AVPA 3VTYA 4G25A 4A3TA 4BY6A 2V4LA 1DVPA 3FWVA 3FULA 1IQUA 3L08A 3OXLA 5G04C 3R9AB 4JPSA 2WQ6A 2LNIA 1W3BA 3RO2A 3RO3A 4HOUA 3AS4A 4WNGA 4YVQC 3MA5A 2C2LA 4FP7A 1WY6A 3S7BA 4AXHA 4L2YA 4CT4A 5C1DA 3S7JA 2OV8A 3FUIA 4L1BA 4TUUA 4YVOA 2X6FA 3BEEA 4P29A 2NC9A 3FDHA 5BW8C 3U4TA 5JJ6A 3CQCB 4ANVA 3JCKC 2J09A 2WXHA 4N3CA 2WXKA 1UG3A 3EIQC 3ZXSA 3EHMA 3MCXA 2WXPA 1INZA 4GCOA 2QFCA 3MV2B 1UJJA 4IYPA 4W9RA 3LJ3A 5E75A 4GZ6A 3B13A 3TXNA 2Y3AA 4ACLA 1Z3XA 2LAHA 2XCBA 4UWGA 3O4ZA 3CHSA 5LOZA 3CVUA 4WWPA 3U3WA 5BT1A 4H7XA 2KATA 2VSNA 4K0RA 5EKQD 5FT9A 2C0LA 3GW4A 4GZCA 2PQNA 1PC2A 3MYVA 3FY4A 2WXNA 2AXUA 1EPUA 3FU6A 3IKOB 3RJVA 4EECA 1S0PA 4EBAA 1FVFA 4BTBA 1ZBPA 4L7TA 1EDUA 4GZDA 3FH8A 5EDSA 3SGHA 4A3VA 3CVLA 3TL5A 3UT7A 4I1OB 5ARGA 3FUMA 2FBNA 2Y4UA 3HVEB 3B7TA 4XI9A 5BV1A 4I6EA 4AY5A 2XHEA 1E7VA 1HXIA 3FHEA 2I6HA 5E76A 2DBAA 3CHMA 5ENNA 1Z6TA 3OTNA 3PEVB 2CFUA 4EBAG 4KBQA 1JWFA 4HOSA 5D0OD 3LYAA 2XGOA 4U0ZA 3CVVA 5FZQA 1Z3YA 2YHCA 1YA0A 3UUXA 3MV3B 5BV0A 1E8ZA 2JEKA 4RG6A 4CDMA 4UQZA 3WXXA 3R7RA 1U3DA 2I1KA 4CGWA 4H7YA 2JLBA 3CR3A 5LCWC 5BUZA 5JHAA 2M63A 4EPZA 3Q5MA 2XCCA 5DIZA 4G1TA 4AP2A 2WM9A 3MKQB 3FU0A 4KVMA 5KJLA 3P1UA 5LP0A 1OUVA 3RRNB 2IF4A 3FEXA 4J0UA 3CV0A 2VSOE 4V3IA 3U66A 3LDZA 3QDNA 3QC1A 3QJZA 4U04A 3ZYQA 5FTPA 3SBSA 1KT0A 4F7AA 3IBEA 4FADA 4GU5A 4DK5A 5HQ8A 1WAO1 2IFUA 4HLEA 3U9WA 1QQEA 3GYZA 3PEUB 4PH4B 3FUJA 3MX3A 3TG5A 4I9CA 2PL2A 3UX4A 1H0AA 4B89A 2AW6A 1B89A 3ULQA 3LPZA 2I2OA 4JZYA 3FH7A 4LRZA 4AVXA 3ZEFA 3CEQA 2WVIA 4BTAA 4HORA 2J4BA 3EJNA 4U63A 2ONDA 4Y6WA 1U3CA 2FF4A 4B0ZA 4JXTA 4YNDA 1JWGA 4CRWA 1E8YA 4J8DA 5T4YA 3TG4A 3CHRA 3UT8A 4B8CB 5HI7A 3IHVA 4G26A 4DLOA 4J8FA 4HOTA 1HS6A 2WXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H2V C;  1UW4 B;  2KZT B;  2ION A;  2KZT A;  4B89 A;  4CEM A;  1UG3 A;  2IU1 A;  2RG8 A;  3EIQ C;  2I2O A;  3FEY A;  1H2U A;  4LUN U;  3D3M A;  4B8A A;  1HU3 A;  3JUI A;  4IUL A;  4JHJ A;  2GGF A;  2IOS A;  3FEX A;  1H6K A;  2VSO E;  2VSX E;  1H2T C;  4CRW A;  2FUL A;  1N52 A;  4JHK A;  4GMJ A;  3L6A A;  4B8C B;  4CT4 A;  2ZU6 B;  2IOL A;  3EIJ A;  1PAQ A;  4GML A;  5ANR A;  1N54 A;  2HM8 A;  2NSZ A;  4C9B B;  3RK6 A; 
#chains in the Genus database with same CATH topology
 3FTS A;  2J08 A;  3DEO A;  4DRX E;  3CVY A;  3FTY A;  3C3R A;  1G3N B;  3SFY A;  4A55 A;  4KYO B;  3VLD A;  2LUH A;  2AWI A;  2GGF A;  3DBS A;  4OYS A;  4O6F A;  4GA1 A;  5G05 C;  4GMJ A;  4F1S A;  2R05 A;  3G2S A;  5C2Y A;  3S7F A;  2LXL A;  3TGO A;  1N94 A;  3O48 A;  3ZHE B;  4XX5 A;  1FVH A;  2Q7F A;  3ASN E;  3L13 A;  4FHJ A;  4ANU A;  2CHX A;  3B7U X;  1LD8 A;  4FJY A;  1N54 A;  4OAU C;  1BPO A;  4D10 C;  2X3M A;  4G24 A;  4ANW A;  3QKY A;  4JVS A;  3AS8 A;  5FQ6 A;  4I6J A;  3PE4 A;  1QBQ A;  4DX7 D;  2AXV A;  2FEZ A;  3TXM A;  4ABN A;  3CSF A;  4KZ0 A;  5CMW A;  5KJM A;  4K5C A;  3ESK A;  3UM3 A;  4U8H A;  4EZJ A;  5T3R A;  3ASO E;  4GTO A;  4NUR A;  3VLF A;  3ENE A;  4TV3 A;  1V54 E;  4MRU A;  2WXQ A;  2Y69 E;  2ETB A;  1TNU A;  2KCV A;  1HE8 A;  2GRN B;  3FEY A;  1H2U A;  3PZ4 A;  4TRQ A;  5FZS A;  3I5P A;  4JHR A;  3D9I A;  3PZ2 A;  1BU9 A;  1UN8 A;  5ENQ D;  4CDR A;  4MS6 A;  4XI0 A;  3HYM B;  2XEN A;  1XNF A;  4I1M A;  3SI5 A;  5JJ7 A;  4C0M A;  4F53 A;  4G2V A;  3DPD A;  2CHW A;  3TWS A;  2L6J A;  3FUH A;  2WB2 A;  3PUJ A;  4PS7 A;  2NXP A;  2ILR A;  5FQ7 A;  5KWD A;  4A63 B;  4RVB A;  1OWO A;  3UT4 A;  5A23 A;  3HXB A;  1O1S A;  5EX3 A;  4EHM A;  4LNG A;  2P9L G;  5B1B E;  3G2T A;  4FU3 A;  3D9K A;  3FU3 A;  3NZS A;  4K03 A;  3V30 A;  1OCR E;  1Q2Z A;  2VJ8 A;  4DPR A;  3KAE A;  2VSY A;  4QFV A;  2OEW A;  3PS6 A;  1HU3 A;  3DST A;  3VLE A;  2F8X K;  4U7E B;  2WXM A;  1OWM A;  4ZFH A;  1MHQ A;  2Y1L E;  3HXE A;  5T8I A;  4JEH A;  2L0T B;  5KNG A;  1PY1 A;  4GYY A;  3UKU G;  4AY6 A;  1HZ4 A;  3FTZ A;  3ZN3 A;  2X6K A;  1OCO E;  3BG1 B;  4F1P A;  4GCN A;  4N2Q A;  4FJZ A;  3NOG D;  3DSS A;  5AQ7 A;  1HG5 A;  3KS2 A;  1YMP A;  1KZO A;  3B7S A;  4XEI G;  5FWQ A;  4LEU A;  4JW1 A;  2VTB A;  2IU1 A;  3DSW A;  3ZW3 A;  3WG7 E;  3ZPJ A;  3D9L A;  3TWW A;  1TEZ A;  3L6A A;  3FUN A;  3ZXP A;  3ONL A;  4C9B B;  3L17 A;  2YHE A;  3CHP A;  3Q15 A;  3BUA A;  3CVW A;  5J90 A;  4GZ5 A;  5BXO A;  4FA6 A;  2DZN A;  2HO1 A;  4UWH A;  2YNQ A;  2DIW A;  1JUQ A;  5BNW A;  2VGX B;  3IHY A;  3GZ1 A;  5G55 A;  3W9F A;  2X6J A;  4LNU D;  3UI2 A;  3EU5 A;  4JPS A;  3TWU A;  1H6O A;  4HBD A;  3RO2 A;  5D66 A;  4GMR A;  4CT4 A;  3S7B A;  2C2L A;  5C1D A;  3RAU A;  3NBN B;  3S7J A;  2OV8 A;  3FDH A;  5BW8 C;  2WXK A;  1IKN D;  1UG3 A;  3EIQ C;  2ZIR A;  1INZ A;  4GCO A;  1YCS B;  4IYP A;  4GZ6 A;  2Y3A A;  1H6P A;  2QC9 A;  4UWG A;  4WWP A;  5EKQ D;  3GW4 A;  1PC2 A;  2WXN A;  2AXU A;  1EPU A;  3AG1 E;  3FU6 A;  3J5Q B;  1S0P A;  5EYP F;  2QZA A;  1EDU A;  3CVL A;  5FIN A;  3UT7 A;  3FUM A;  2FBN A;  2Y4U A;  2QYJ A;  3FHE A;  4K5A B;  1FPP A;  2XGO A;  4CYM D;  4U0Z A;  3T9K A;  4JB8 P;  5BV0 A;  3DSX A;  3WXX A;  1U3D A;  2I1K A;  4H7Y A;  5LCW C;  5BUZ A;  2M63 A;  1LTX A;  1MJ0 A;  2WM9 A;  3NOC D;  3UIO C;  3FEX A;  3QDN A;  3KSL A;  3C3Q A;  4FAD A;  4GU5 A;  5HQ8 A;  3U9W A;  1QQE A;  3MX3 A;  1H0A A;  3ULQ A;  1OY3 D;  1X81 A;  3ZEF A;  2J4B A;  4Y6W A;  4B0Z A;  1JWG A;  4J8D A;  3UT8 A;  2FO1 E;  3IHV A;  2R02 A;  4DLO A;  3HXD A;  2RD0 A;  1TN6 A;  4HB5 A;  4KZC A;  4UWL A;  3UM0 A;  3FTX A;  1Y8M A;  1JPL A;  1ELW A;  2WQH A;  5KJK A;  3ABL E;  5IY5 E;  2QY7 A;  3X2Q E;  1EYH A;  3ULY A;  1PAQ A;  2DWZ A;  2BUG A;  4NRH B;  3URZ A;  3CVQ A;  2XRZ A;  2WXI A;  3EDT B;  2RG8 A;  2E0I A;  3ASH A;  3BQO A;  4DJA A;  3N71 A;  2CHZ A;  5CBN A;  3ZNG A;  4JHK A;  1KZP A;  3SFX A;  2WMN A;  2XPI A;  3LY7 A;  4WWN A;  5CHE E;  1O1R A;  3R9M A;  3IXE A;  4FHK A;  4YDO A;  5KCM A;  4JL0 A;  2R17 C;  4KVO A;  3S2A A;  3BU8 A;  2RFA A;  1LF8 A;  3PDN A;  1UN9 A;  3ZKJ A;  1N0R A;  1O5M A;  4UUC A;  4UQX A;  4CGV A;  1E7U A;  3FFL A;  4E6H A;  4E85 A;  4J8S A;  4NAC A;  3BG0 B;  3CVX A;  1UW4 B;  4EZL A;  4MKT A;  4GZ3 A;  4GPK A;  4TXQ A;  4YDW A;  2XGM A;  2LSU A;  2YIN A;  2H6I A;  3PE3 A;  4LCT A;  1RW2 A;  5G05 J;  4MBG A;  2L9B A;  4GTQ A;  2ZGG A;  4BX9 A;  2WXF A;  3VTX A;  3MKQ A;  3T5V A;  4BWR A;  3I3N A;  3PZ3 A;  5DBK A;  3JXI A;  5B1A E;  3RKV A;  4APO A;  3LS8 A;  4GTT A;  2RFM A;  2B0O E;  2KZT B;  1VDY A;  3ABK E;  3CK7 A;  4ILI A;  1NFI E;  3AAA C;  4R7L A;  3RRU A;  3CK9 A;  4GA0 A;  4HQD A;  1MX2 A;  4CZ2 D;  4J6I A;  4UI9 C;  3Q78 A;  2IY0 C;  3FUF A;  3ZYM A;  4OVV A;  2IQC A;  5LFA A;  2OVB A;  3D3M A;  4CDN A;  3RU0 A;  4IN3 B;  2VSX E;  2ZU6 B;  2BKG A;  3PZD A;  3AG4 E;  3RK6 A;  2PM7 A;  2F0Y A;  4RG9 A;  4WNE A;  3ZHE A;  4GTM A;  4GTS A;  1NZN A;  3ZYL A;  4G8K A;  4LUN U;  5JA4 D;  3TAX A;  1EF1 C;  1BD8 A;  3LY8 A;  5EYL A;  2J07 A;  1TN8 A;  1KT1 A;  1TYQ G;  5AEN A;  4PUC A;  2V0P A;  4OAV B;  4GYO A;  1SA4 A;  4DX1 A;  3PUK A;  3Q9U C;  2J49 A;  5LX8 A;  2GRM A;  3T8M A;  2I1J A;  5FJY A;  4CEM A;  1MZC A;  1TJC A;  4HXI A;  1XGW A;  2R5S A;  1K1A A;  1HX8 A;  3Q7A A;  1TNZ A;  3CHQ A;  1ELR A;  2NYJ A;  4PS3 A;  1IYG A;  5CBO A;  3PNL B;  3PNT B;  1P5Q A;  1TR4 A;  3EUV A;  4UQY A;  1H2T C;  4F6R D;  5CCL A;  4EZK A;  2PM6 A;  3Q7F A;  3DPY A;  4GAA A;  3NQP A;  5JJT A;  3RRM B;  1JCQ A;  3CVP A;  4APF A;  2CFZ A;  5ARF A;  3FH5 A;  3PVL A;  4JA7 A;  4GTR A;  3G2U A;  3F6Q A;  5B3S E;  5AQ9 A;  4DX6 D;  2P9I G;  3NZU A;  2OVF A;  3HDX A;  4BEP A;  4A1G A;  1JCS A;  5H7P A;  1IQU A;  3ZUV B;  1TN7 A;  2WQ6 A;  1W3B A;  3JXJ A;  3C72 A;  4YVQ C;  3AS4 A;  2OCC E;  3MA5 A;  1N4S A;  4YVO A;  4NIK A;  4P29 A;  2NC9 A;  2AJA A;  3U4T A;  1V55 E;  3CQC B;  4ANV A;  3JCK C;  2WXH A;  3Q75 A;  2ETA A;  5CED B;  5CRU A;  4U95 D;  3TWX A;  3MV2 B;  1UJJ A;  2ZGD A;  5E75 A;  4ACL A;  2LAH A;  5LOZ A;  3V31 A;  3CVU A;  3U3W A;  5BT1 A;  4GZC A;  2PQN A;  3MYV A;  3FY4 A;  2PNN A;  2Y0B G;  3IKO B;  3L9T A;  1S64 A;  2EIK E;  1MX6 A;  3HVE B;  1DCE A;  4XI9 A;  4AY5 A;  2XHE A;  2I6H A;  4U8Y D;  2F8Y A;  3ZU7 B;  3CHM A;  1Z6T A;  3OTN A;  4EBA G;  5KBA A;  5FZQ A;  3UXG A;  1E8Z A;  1JCR A;  3TWR A;  4EPZ A;  5DIZ A;  3ISM C;  3FU0 A;  3RRN B;  2IF4 A;  3J5P A;  4J0U A;  3U66 A;  3QJZ A;  4U04 A;  4HRN A;  3SBS A;  4X8Q A;  3IBE A;  5AQB A;  3TG5 A;  3UX4 A;  2PL2 A;  2AW6 A;  3LPZ A;  4BTA A;  2GRP B;  4U63 A;  2OND A;  1U3C A;  4YND A;  4CRW A;  3TG4 A;  1K3Z D;  5CER B;  3V2X A;  3O4Z A;  1A17 A;  5AJL A;  2XPZ A;  3APC A;  1FT1 A;  4G23 A;  3DSV A;  4KMO A;  4HNA D;  2KBX A;  4PS8 A;  2LO6 A;  5D0Q D;  3TJP A;  4OVU A;  3IEG A;  3OXG A;  5KJN A;  2LAI A;  1SW6 A;  2IO3 C;  4AM9 A;  4GA2 A;  1SQM A;  4LG6 A;  2VGX A;  4ILH B;  3EHN A;  3SD5 A;  1BI8 B;  5CMY A;  5CRV A;  5JMN D;  2KM4 A;  5LCW J;  2J4D A;  4FC8 A;  1NP7 A;  4HVB A;  2EIN E;  2XEH A;  3QAQ A;  4BET A;  1NA0 A;  5CEC B;  3OAW A;  3AU5 A;  5KNH D;  5FZR A;  3ESL A;  1NA3 A;  3DEP A;  3HXF A;  4BSX A;  4AOF A;  4U0U A;  3E32 A;  4N39 A;  2R59 A;  3ZIM A;  4DX2 A;  1KLX A;  3UM2 A;  2OEV A;  2VQ2 A;  3SFZ A;  1BLX B;  4L2L A;  4B8A A;  4O60 A;  2L0I A;  3FU5 A;  4AJW A;  3D9N A;  4JA9 A;  4BT9 A;  3CIA A;  2IOL A;  4URK A;  4IRU A;  5BPP A;  2P2C P;  2AXZ A;  3G2W A;  4J7W A;  2UY1 B;  2XQ0 A;  4HS2 A;  3I4R B;  4I43 A;  4KT6 B;  3DSU A;  5ANL A;  3ZGQ A;  3QWP A;  3ZVV A;  1IXV A;  3B7B A;  4GYW A;  2UY1 A;  2YQ8 A;  3NAW A;  3APD A;  1QYM A;  4ATZ D;  3CQG B;  4WAF A;  3LY9 A;  1N95 A;  4Q69 A;  4UWK A;  1E8X A;  3AJI A;  5AN8 A;  5AIJ A;  2MYO A;  3MGB A;  3U64 A;  2EIM E;  4FLB A;  4DX5 D;  3UPV A;  5AQA A;  4WWO A;  3FUE A;  5J08 A;  3CST A;  3LVR E;  5M72 A;  3CGH A;  4XIF A;  3RSE G;  2CG2 A;  3Q73 A;  4AIF A;  2ION A;  2V5F A;  2P9N G;  3Q9N C;  2DZO A;  2IJG X;  1E8W A;  2P9K G;  4Y6C A;  4G11 A;  1QZ2 A;  2F37 A;  2B6C A;  2VGY A;  2WXR A;  4K5B A;  2HYZ A;  3ML9 A;  3UIP C;  1N0Q A;  1E90 A;  1N52 A;  3SO8 A;  4GML A;  4BT8 A;  2WMO A;  4UI9 K;  2C0M A;  3GZS A;  1BI7 B;  3Q47 B;  2IEJ A;  1TJF A;  4DI4 A;  3MKR A;  3Q49 B;  2IOS A;  4N3B A;  2P58 C;  3ASF A;  3L22 A;  4CT0 A;  2H6F A;  3CK8 A;  2XEE A;  1S70 B;  3FTU A;  2XPY A;  3QWV A;  4UI9 J;  4I17 A;  4ILG A;  3SHF A;  4ATG A;  4WUY A;  2RKK A;  5D2M C;  5G04 J;  2FI7 A;  3LEW A;  2GW1 A;  4N5C A;  1WG0 A;  4CCA A;  1H2V C;  2DVW A;  3PH0 C;  3OXF A;  5AJD A;  1LD7 A;  2LSV A;  5ENO D;  2CG3 A;  3HXC A;  3EIJ A;  5EX0 A;  4GPM A;  3HHM A;  4ZHB A;  2KZT A;  5FQ4 A;  2MOW A;  5AYW D;  3ONK A;  4I2W A;  5ENT D;  3FUL A;  5G04 C;  3OXL A;  4RQI A;  2LNI A;  4RLY A;  4HOU A;  1N4Q A;  2V4H C;  4L2Y A;  3FUI A;  4TUU A;  2R03 A;  2X6F A;  1TNY A;  5JJ6 A;  2A5E A;  3DRA A;  4N3C A;  5BXU A;  5ITZ F;  3EHM A;  5HRY A;  1NL4 A;  2WXP A;  4G8L A;  3AG2 E;  1U2V G;  3LJ3 A;  4GTP A;  3B13 A;  1Z3X A;  2DYR E;  1IHB A;  2XCB A;  2VSN A;  5FT9 A;  3TWV A;  1D8E A;  2GRO B;  3RJV A;  4EEC A;  4LNB A;  1FVF A;  4BTB A;  4L7T A;  4GZD A;  3SGH A;  4A3V A;  3TL5 A;  4I1O B;  5ARG A;  3B7T A;  4I6E A;  5E76 A;  3PEV B;  4KBQ A;  4HOS A;  5D0O D;  3CVV A;  1Z3Y A;  3UUX A;  1YA0 A;  5HS0 A;  4U8V D;  2H6H A;  5AAO A;  4UQZ A;  3R7R A;  1UOH A;  5KJL A;  4KVM A;  3P1U A;  2V5Q C;  3CV0 A;  1N4P A;  3LDZ A;  3QC1 A;  3ZYQ A;  5FTP A;  2R2L A;  4F7A A;  4DK5 A;  2IFU A;  4HLE A;  4GTV A;  3GYZ A;  3PEU B;  4PH4 B;  3EHQ A;  3FUJ A;  4HRL A;  2XS8 A;  1B89 A;  2I2O A;  3FH7 A;  4AVX A;  4HOR A;  1MX4 A;  3EJN A;  3KEA A;  2FF4 A;  3CHR A;  1K1B A;  4G26 A;  4HOT A;  2WXJ A;  3R7Q A;  3SBT B;  3QWW A;  3E4B A;  4AEZ C;  5CCM A;  4YDY A;  4XKB A;  2X38 A;  2WXO A;  2J9Q A;  5CEA A;  4ANX A;  2GRR B;  4M7C A;  4FLH A;  2FUL A;  4BFR A;  4N5Q A;  1SA5 A;  4BX8 A;  3P2B A;  5ANR A;  3KEZ A;  4I1A A;  4F3V A;  2WQ7 A;  4O1O A;  4B94 A;  5ENS D;  5JHB A;  3GZ2 A;  4RSY A;  1D9S A;  3QAR A;  5ENP D;  4HOQ A;  2UWJ G;  1AWC B;  3JQ0 A;  3B7R L;  5A7D B;  1KPS B;  1H6K A;  2KCL A;  3FTV A;  4I2Z A;  1GW6 A;  3L16 A;  4I9E A;  3SZ7 A;  4DLQ A;  3D9P A;  2XGS A;  3ABM E;  3AG3 E;  1YYH A;  4HFG A;  3IV0 A;  4LER A;  1AP7 A;  3MJW A;  2H6G A;  3D9J A;  4C48 B;  4JHJ A;  3CKC A;  4LSZ E;  4JC8 A;  4O1P A;  1WM5 A;  4JD2 G;  3PRZ A;  3AS5 A;  2KXP C;  4HI9 A;  1HF8 A;  1L5J A;  2LXM A;  2VTB B;  4XKC A;  3D9O A;  4ME2 A;  3SF4 A;  2X6H A;  2FO7 A;  3EHR A;  3SY2 A;  4TXP A;  1NI1 A;  4MLP A;  3HVE A;  4EQF A;  4J8E A;  1OWN A;  1DC2 A;  4QQI A;  3ASG A;  5A6C A;  4ACK A;  1UJK A;  2A4Z A;  3S7D A;  3L54 A;  3W9G A;  2PQR A;  5EN5 D;  4U07 A;  3CKB A;  5FQ8 A;  3K9I A;  3I4G A;  1HFA A;  3KSQ A;  2ZXW E;  1N11 A;  4TXR A;  2XEV A;  3ASD A;  3CHO A;  1HG2 A;  4A1S A;  1Z5S C;  1MQS A;  1IQR A;  2ETC A;  1OWL A;  3LVQ E;  2KCK A;  2A5U A;  3LKU A;  3C98 A;  2NSZ A;  1H19 A;  4U96 D;  3APF A;  5EIL A;  4HRM B;  4GB9 A;  2VYI A;  2BTD A;  5AAR A;  2BF0 X;  3B95 A;  2EQX A;  2HE0 A;  1E96 B;  1IHG A;  2WXG A;  2GRL A;  2J8S D;  3D9M A;  3QOU A;  1SVX A;  4UWF A;  3FP3 A;  3T8K A;  3C5R A;  4BER A;  1O1T A;  3HRA A;  2GRQ B;  4J8Y A;  2KC7 A;  4U0S A;  3QK0 A;  2EIJ E;  1N9A A;  3MEK A;  3TWQ A;  3QB2 A;  4XE0 A;  3LXU X;  3Q4A B;  1SZ9 A;  4KXK B;  4IUL A;  1D8D A;  3TWT A;  4Q96 A;  4NQ0 A;  3FUD A;  3HIZ A;  1HH8 A;  1N4R A;  2Y4T A;  2DYS E;  4L23 A;  3UKR G;  1OWP A;  3ULE G;  1HO8 A;  3HG0 D;  2OOE A;  4N2S A;  2WPV A;  3DXM G;  3ML8 A;  3UTM A;  2EIL E;  5HKP A;  4N3A A;  4DUI A;  3ZRH A;  3JUE A;  2MHK A;  5G2N A;  2XS1 A;  2BED A;  4FUL A;  1FCH A;  4XZ4 A;  3JQ1 A;  3V79 K;  3UQ3 A;  2V8S E;  1SZA A;  4JEU A;  2L6B A;  3NF1 A;  3UIN C;  2QYU A;  3ZFW A;  2PZI A;  3CLJ A;  3E30 A;  4AV7 A;  3LCA A;  2DCP A;  3PRE A;  2BKK B;  2E2E A;  4L9P A;  3JUI A;  3NB2 A;  4Z68 A;  3UMV A;  3FTW A;  1OXJ A;  3RIB A;  2HR2 A;  1ELK A;  3CVN A;  3MZL B;  1X5B A;  2ZIS A;  1Y6I A;  4I6G A;  1ZB1 A;  4YDE A;  4WNF A;  1RZ4 A;  3AU4 A;  3SNX A;  2MRI A;  1ZU2 A;  4Q94 A;  1K8K G;  2P9S G;  3C3O A;  3QNK A;  4DI3 A;  4C0E A;  2X6I A;  3G2V A;  2WXL A;  4M3O A;  2HM8 A;  2I9C A;  4PDX A;  3ZYK A;  3JYS A;  4HI8 A;  4BES A;  3FUK A;  4BSZ B;  4WND A;  2XRY A;  1QNF A;  3T5X A;  1DNP A;  3E34 A;  2P9U G;  2AVP A;  3VTY A;  2IO2 C;  4G25 A;  4A3T A;  4BY6 A;  1OCC E;  2V4L A;  1DVP A;  3FWV A;  3L08 A;  1MYO A;  3R9A B;  1A5E A;  5ENR D;  3RO3 A;  4WNG A;  4FP7 A;  1WY6 A;  4AXH A;  3L82 A;  4L1B A;  2JAB A;  3BEE A;  1TNB A;  2J09 A;  3ZXS A;  3MCX A;  4HLL A;  2QFC A;  4W9R A;  3TXN A;  3CHS A;  4H7X A;  2KAT A;  3EU9 A;  4K0R A;  2C0L A;  4TUM A;  4EBA A;  1ZBP A;  3DWL G;  5EDS A;  3FH8 A;  3UM1 A;  3V2O A;  5BV1 A;  2P9P G;  1E7V A;  1HXI A;  2DBA A;  5ENN A;  2CFU A;  4B93 B;  5EIB E;  1JWF A;  3E37 A;  3LYA A;  2YHC A;  3MV3 B;  2JEK A;  1WDY A;  4RG6 A;  3SQV A;  4CDM A;  5FIO A;  4CGW A;  2JLB A;  3CR3 A;  3DXK G;  5JHA A;  3Q5M A;  2XCC A;  4G1T A;  4AP2 A;  3MKQ B;  1DCQ A;  5LP0 A;  1OUV A;  3PZ1 A;  5EID A;  3LJN A;  2VSO E;  4V3I A;  3D9H A;  2VGE A;  1KT0 A;  1WAO 1;  1OT8 A;  1S63 A;  1TNO A;  4I9C A;  4B89 A;  2XZT G;  1FT2 A;  4JZY A;  4LRZ A;  3CEQ A;  2WVI A;  1OCZ E;  3Q79 A;  4JXT A;  1E8Y A;  5T4Y A;  2XZD G;  4B8C B;  3E33 A;  5HI7 A;  4J8F A;  1HS6 A;  3KD7 A; 
#chains in the Genus database with same CATH homology
 1A17 A;  2RD0 A;  3R7Q A;  4KZC A;  3FTS A;  2J08 A;  4UWL A;  5AJL A;  3SBT B;  3QWW A;  2XPZ A;  3E4B A;  3APC A;  4AEZ C;  4G23 A;  3FTX A;  1Y8M A;  3FTY A;  3CVY A;  4KMO A;  5CCM A;  1JPL A;  1ELW A;  4XKB A;  2WQH A;  2X38 A;  2WXO A;  4KYO B;  4PS8 A;  4A55 A;  3VLD A;  2J9Q A;  2AWI A;  2LO6 A;  5D0Q D;  3TJP A;  4ANX A;  5KJK A;  2GGF A;  2QY7 A;  3DBS A;  4OYS A;  4OVU A;  4O6F A;  1EYH A;  3IEG A;  4GA1 A;  4FLH A;  2FUL A;  3OXG A;  5G05 C;  4BFR A;  4GMJ A;  5KJN A;  4F1S A;  3G2S A;  1PAQ A;  4BX8 A;  3P2B A;  5ANR A;  5C2Y A;  2LAI A;  3KEZ A;  3S7F A;  2BUG A;  4NRH B;  4I1A A;  4AM9 A;  4GA2 A;  3URZ A;  4F3V A;  2WQ7 A;  1SQM A;  4B94 A;  3TGO A;  3O48 A;  5JHB A;  2VGX A;  4ILH B;  3CVQ A;  3ZHE B;  4XX5 A;  2XRZ A;  2WXI A;  3GZ2 A;  1FVH A;  3EHN A;  3EDT B;  4RSY A;  2RG8 A;  2E0I A;  3SD5 A;  3QAR A;  3ASH A;  5CMY A;  2Q7F A;  4HOQ A;  2UWJ G;  2KM4 A;  3L13 A;  4DJA A;  4FHJ A;  5LCW J;  3JQ0 A;  3B7R L;  5A7D B;  3N71 A;  2J4D A;  4ANU A;  2CHZ A;  4FC8 A;  1H6K A;  2KCL A;  3FTV A;  4I2Z A;  2CHX A;  3B7U X;  1NP7 A;  4JHK A;  4FJY A;  4HVB A;  3QAQ A;  1GW6 A;  2WMN A;  3L16 A;  2XPI A;  3LY7 A;  4I9E A;  4WWN A;  3SZ7 A;  4DLQ A;  1N54 A;  5CHE E;  1BPO A;  1NA0 A;  4D10 C;  2X3M A;  3D9P A;  2XGS A;  4G24 A;  4ANW A;  4FHK A;  3QKY A;  3OAW A;  3AU5 A;  5KCM A;  4JL0 A;  4JVS A;  3AS8 A;  2R17 C;  4KVO A;  4HFG A;  3IV0 A;  3S2A A;  4LER A;  5FQ6 A;  1LF8 A;  3PDN A;  1UN9 A;  4I6J A;  3MJW A;  3D9J A;  3PE4 A;  5FZR A;  3ESL A;  2AXV A;  2FEZ A;  4JHJ A;  4UQX A;  1NA3 A;  3TXM A;  4CGV A;  3CKC A;  1E7U A;  3FFL A;  4JC8 A;  4E6H A;  4ABN A;  4E85 A;  4J8S A;  4NAC A;  4BSX A;  4AOF A;  1WM5 A;  3CSF A;  4KZ0 A;  3PRZ A;  4U0U A;  3AS5 A;  3BG0 B;  5CMW A;  3CVX A;  5KJM A;  1UW4 B;  3ESK A;  4EZL A;  1HF8 A;  4N39 A;  1L5J A;  4MKT A;  4U8H A;  4EZJ A;  4GZ3 A;  2VTB B;  4GPK A;  4XKC A;  2R59 A;  3ZIM A;  3D9O A;  4ME2 A;  5T3R A;  1KLX A;  2VQ2 A;  3SF4 A;  3SFZ A;  2X6H A;  2XGM A;  4L2L A;  2FO7 A;  2LSU A;  4NUR A;  4B8A A;  2YIN A;  2L0I A;  3FU5 A;  4MLP A;  3HVE A;  3PE3 A;  4AJW A;  3VLF A;  3ENE A;  3D9N A;  4JA9 A;  4TV3 A;  4BT9 A;  4LCT A;  3CIA A;  2IOL A;  4EQF A;  4URK A;  4IRU A;  4MRU A;  5G05 J;  2WXQ A;  5BPP A;  4J8E A;  2L9B A;  1OWN A;  2AXZ A;  2KCV A;  3G2W A;  1HE8 A;  4BX9 A;  3ASG A;  3FEY A;  5A6C A;  1H2U A;  4ACK A;  2UY1 B;  2WXF A;  3VTX A;  4TRQ A;  5FZS A;  2XQ0 A;  3I5P A;  3MKQ A;  3T5V A;  1UJK A;  2A4Z A;  3S7D A;  3L54 A;  2PQR A;  4JHR A;  3D9I A;  4U07 A;  3I3N A;  4BWR A;  4HS2 A;  5DBK A;  3I4R B;  3CKB A;  5FQ8 A;  3RKV A;  1UN8 A;  3K9I A;  3LS8 A;  4I43 A;  3I4G A;  4APO A;  1HFA A;  4KT6 B;  4CDR A;  4MS6 A;  4XI0 A;  5ANL A;  3ZGQ A;  3QWP A;  2KZT B;  3HYM B;  1VDY A;  2XEV A;  3ZVV A;  3ASD A;  3CHO A;  1HG2 A;  3CK7 A;  4GYW A;  4A1S A;  4ILI A;  1XNF A;  4I1M A;  3SI5 A;  5JJ7 A;  4C0M A;  2UY1 A;  2YQ8 A;  3APD A;  3CQG B;  1MQS A;  4F53 A;  1IQR A;  4R7L A;  1OWL A;  3DPD A;  4G2V A;  4WAF A;  3LY9 A;  3RRU A;  2CHW A;  3CK9 A;  3LVQ E;  2A5U A;  2KCK A;  2L6J A;  3LKU A;  3C98 A;  3FUH A;  4Q69 A;  4UWK A;  2WB2 A;  3PUJ A;  1E8X A;  4PS7 A;  4GA0 A;  2NXP A;  2ILR A;  5AIJ A;  5FQ7 A;  2NSZ A;  3MGB A;  1H19 A;  3U64 A;  3APF A;  4FLB A;  4J6I A;  4UI9 C;  3UPV A;  4WWO A;  3FUF A;  3FUE A;  4GB9 A;  3ZYM A;  2VYI A;  5J08 A;  4RVB A;  2BTD A;  4OVV A;  1OWO A;  3UT4 A;  2IQC A;  2BF0 X;  5LFA A;  2OVB A;  5A23 A;  2EQX A;  3D3M A;  1E96 B;  1IHG A;  2WXG A;  3CGH A;  3CST A;  3LVR E;  2GRL A;  3D9M A;  5M72 A;  3QOU A;  5EX3 A;  4CDN A;  4UWF A;  4XIF A;  3FP3 A;  3RU0 A;  4IN3 B;  2VSX E;  2CG2 A;  3G2T A;  4FU3 A;  2ZU6 B;  3D9K A;  3FU3 A;  4AIF A;  3NZS A;  4K03 A;  3PZD A;  2KC7 A;  4U0S A;  3RK6 A;  2PM7 A;  2VJ8 A;  2ION A;  3QK0 A;  4DPR A;  4RG9 A;  2V5F A;  3KAE A;  2IJG X;  2VSY A;  3MEK A;  4WNE A;  3QB2 A;  3ZHE A;  1E8W A;  4Y6C A;  1NZN A;  3ZYL A;  4G11 A;  4LUN U;  4XE0 A;  3LXU X;  4QFV A;  1QZ2 A;  3Q4A B;  1SZ9 A;  3PS6 A;  1HU3 A;  4KXK B;  2WXR A;  2VGY A;  1EF1 C;  4IUL A;  3TAX A;  3LY8 A;  3VLE A;  2HYZ A;  3ML9 A;  4NQ0 A;  2J07 A;  3FUD A;  3HIZ A;  1E90 A;  4Q96 A;  2WXM A;  1KT1 A;  1N52 A;  1HH8 A;  1OWM A;  3KD7 A;  2Y4T A;  1MHQ A;  4L23 A;  5AEN A;  4GML A;  4PUC A;  2V0P A;  4BT8 A;  2WMO A;  1OWP A;  4GYO A;  1HO8 A;  4UI9 K;  2C0M A;  3PUK A;  3GZS A;  2OOE A;  4N2S A;  5T8I A;  4JEH A;  2J49 A;  2WPV A;  3ML8 A;  2GRM A;  3Q47 B;  2L0T B;  3T8M A;  5LX8 A;  2I1J A;  5FJY A;  4CEM A;  1PY1 A;  4N3A A;  1TJF A;  4GYY A;  1TJC A;  4HXI A;  3ZRH A;  4DI4 A;  4AY6 A;  1HZ4 A;  3MKR A;  1XGW A;  2MHK A;  3FTZ A;  5G2N A;  3Q49 B;  2R5S A;  2IOS A;  4N3B A;  3ZN3 A;  1HX8 A;  2X6K A;  2P58 C;  1FCH A;  4FUL A;  3ASF A;  3BG1 B;  3JQ1 A;  4XZ4 A;  3L22 A;  4GCN A;  3UQ3 A;  4CT0 A;  4N2Q A;  2V8S E;  1SZA A;  4JEU A;  3CK8 A;  4FJZ A;  3FTU A;  1HG5 A;  2XPY A;  3KS2 A;  3CHQ A;  3B7S A;  1ELR A;  3NF1 A;  3QWV A;  4PS3 A;  3ZFW A;  5FWQ A;  2PZI A;  3CLJ A;  4LEU A;  4JW1 A;  4AV7 A;  3LCA A;  1IYG A;  2VTB A;  4UI9 J;  2IU1 A;  4I17 A;  4ILG A;  3SHF A;  2DCP A;  3PRE A;  4ATG A;  3PNL B;  3PNT B;  1P5Q A;  2E2E A;  3JUI A;  3ZW3 A;  4WUY A;  3ZPJ A;  4UQY A;  5G04 J;  3UMV A;  3FTW A;  2FI7 A;  3LEW A;  1H2T C;  3D9L A;  1TEZ A;  3RIB A;  2HR2 A;  3L6A A;  1ELK A;  5CCL A;  4EZK A;  2PM6 A;  3FUN A;  2GW1 A;  3CVN A;  4N5C A;  3MZL B;  4CCA A;  3ONL A;  4C9B B;  1H2V C;  1X5B A;  3L17 A;  1Y6I A;  4I6G A;  2YHE A;  4GAA A;  3CHP A;  4WNF A;  3Q15 A;  3AU4 A;  3NQP A;  3SNX A;  5JJT A;  3PH0 C;  3OXF A;  5AJD A;  2LSV A;  3RRM B;  2MRI A;  3CVP A;  4APF A;  1ZU2 A;  5J90 A;  4GZ5 A;  3CVW A;  2CFZ A;  4FA6 A;  2HO1 A;  4Q94 A;  5ARF A;  4UWH A;  3QNK A;  3FH5 A;  2CG3 A;  3PVL A;  4DI3 A;  2YNQ A;  4C0E A;  2X6I A;  3G2V A;  2WXL A;  4JA7 A;  3EIJ A;  2DIW A;  4M3O A;  5EX0 A;  2HM8 A;  2I9C A;  3G2U A;  4PDX A;  1JUQ A;  5BNW A;  3ZYK A;  3JYS A;  3HHM A;  3FUK A;  2VGX B;  3IHY A;  2KZT A;  4WND A;  2XRY A;  3NZU A;  2OVF A;  3HDX A;  1QNF A;  2MOW A;  3GZ1 A;  5FQ4 A;  3T5X A;  1DNP A;  4A1G A;  5G55 A;  5AYW D;  3ONK A;  2X6J A;  4I2W A;  2AVP A;  3VTY A;  4G25 A;  4A3T A;  4BY6 A;  2V4L A;  1DVP A;  3FWV A;  3FUL A;  1IQU A;  3L08 A;  3OXL A;  5G04 C;  3R9A B;  4JPS A;  2WQ6 A;  2LNI A;  1W3B A;  3RO2 A;  3RO3 A;  4HOU A;  3AS4 A;  4WNG A;  4YVQ C;  3MA5 A;  2C2L A;  4FP7 A;  1WY6 A;  3S7B A;  4AXH A;  4L2Y A;  4CT4 A;  5C1D A;  3S7J A;  2OV8 A;  3FUI A;  4L1B A;  4TUU A;  4YVO A;  2X6F A;  3BEE A;  4P29 A;  2NC9 A;  3FDH A;  5BW8 C;  3U4T A;  5JJ6 A;  3CQC B;  4ANV A;  3JCK C;  2J09 A;  2WXH A;  4N3C A;  2WXK A;  1UG3 A;  3EIQ C;  3ZXS A;  3EHM A;  3MCX A;  2WXP A;  1INZ A;  4GCO A;  2QFC A;  3MV2 B;  1UJJ A;  4IYP A;  4W9R A;  3LJ3 A;  5E75 A;  4GZ6 A;  3B13 A;  3TXN A;  2Y3A A;  4ACL A;  1Z3X A;  2LAH A;  2XCB A;  4UWG A;  3O4Z A;  3CHS A;  5LOZ A;  3CVU A;  4WWP A;  3U3W A;  5BT1 A;  4H7X A;  2KAT A;  2VSN A;  4K0R A;  5EKQ D;  5FT9 A;  2C0L A;  3GW4 A;  4GZC A;  2PQN A;  1PC2 A;  3MYV A;  3FY4 A;  2WXN A;  2AXU A;  1EPU A;  3FU6 A;  3IKO B;  3RJV A;  4EEC A;  1S0P A;  4EBA A;  1FVF A;  4BTB A;  1ZBP A;  4L7T A;  1EDU A;  4GZD A;  3FH8 A;  5EDS A;  3SGH A;  4A3V A;  3CVL A;  3TL5 A;  3UT7 A;  4I1O B;  5ARG A;  3FUM A;  2FBN A;  2Y4U A;  3HVE B;  3B7T A;  4XI9 A;  5BV1 A;  4I6E A;  4AY5 A;  2XHE A;  1E7V A;  1HXI A;  3FHE A;  2I6H A;  5E76 A;  2DBA A;  3CHM A;  5ENN A;  1Z6T A;  3OTN A;  3PEV B;  2CFU A;  4EBA G;  4KBQ A;  1JWF A;  4HOS A;  5D0O D;  3LYA A;  2XGO A;  4U0Z A;  3CVV A;  5FZQ A;  1Z3Y A;  2YHC A;  1YA0 A;  3UUX A;  3MV3 B;  5BV0 A;  1E8Z A;  2JEK A;  4RG6 A;  4CDM A;  4UQZ A;  3WXX A;  3R7R A;  1U3D A;  2I1K A;  4CGW A;  4H7Y A;  2JLB A;  3CR3 A;  5LCW C;  5BUZ A;  5JHA A;  2M63 A;  4EPZ A;  3Q5M A;  2XCC A;  5DIZ A;  4G1T A;  4AP2 A;  2WM9 A;  3MKQ B;  3FU0 A;  4KVM A;  5KJL A;  3P1U A;  5LP0 A;  1OUV A;  3RRN B;  2IF4 A;  3FEX A;  4J0U A;  3CV0 A;  2VSO E;  4V3I A;  3U66 A;  3LDZ A;  3QDN A;  3QC1 A;  3QJZ A;  4U04 A;  3ZYQ A;  5FTP A;  3SBS A;  1KT0 A;  4F7A A;  3IBE A;  4FAD A;  4GU5 A;  4DK5 A;  5HQ8 A;  1WAO 1;  2IFU A;  4HLE A;  3U9W A;  1QQE A;  3GYZ A;  3PEU B;  4PH4 B;  3FUJ A;  3MX3 A;  3TG5 A;  4I9C A;  2PL2 A;  3UX4 A;  1H0A A;  4B89 A;  2AW6 A;  1B89 A;  3ULQ A;  3LPZ A;  2I2O A;  4JZY A;  3FH7 A;  4LRZ A;  4AVX A;  3ZEF A;  3CEQ A;  2WVI A;  4BTA A;  4HOR A;  2J4B A;  3EJN A;  4U63 A;  2OND A;  4Y6W A;  1U3C A;  2FF4 A;  4B0Z A;  4JXT A;  4YND A;  1JWG A;  4CRW A;  1E8Y A;  4J8D A;  5T4Y A;  3TG4 A;  3CHR A;  3UT8 A;  4B8C B;  5HI7 A;  3IHV A;  4G26 A;  4DLO A;  4J8F A;  4HOT A;  1HS6 A;  2WXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...