3D3NA

Crystal structure of lipase/esterase (lp_2923) from lactobacillus plantarum. northeast structural genomics consortium target lpr108
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
273
structure length
245
Chain Sequence
MQVEQRTLNTAAHPFQITAYWLDQISDAVDYPIMIICPGGGFTYHSGREEAPIATRMMAAGMHTVVLNYQLIVGDQSVYPWALQQLGATIDWITTQASAHHVDCQRIILAGFSAGGHVVATYNGVATQPELRTRYHLDHYQGQHAAIILGYPVIDLTAGFPTTSAARNQITTDARLWAAQRLVTPASKPAFVWQTATDESVPPINSLKYVQAMLQHQVATAYHLFGSAIWPQLALRWLQEQGLLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative lipase/esterase
publication title Crystal structure of lipase/esterase (lp_2923) from Lactobacillus plantarum. Northeast Structural Genomics Consortium target LpR108
rcsb
source organism Lactobacillus plantarum wcfs1
molecule tags Hydrolase
total genus 74
structure length 245
sequence length 273
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3d3nA00
1RP1A 2PM8A 3SWWA 3T4UA 4P9NA 3VDXA 3ZPXA 1ZD2P 2E3JA 3R3XA 4U2EA 2BUBA 2PKYX 1QTRA 4K6GA 3MVEA 1XQVA 3ILSA 5LIPA 2CKMA 3ZLUA 2VAVA 4B9AA 3DJYA 4EY5A 1F0PA 2OG1A 1BCSA 3JW8A 4U2DA 3F97A 5T4HA 4C4YA 1VE7A 5ALUA 3GUUA 1TAHA 2HRRA 4F5ZA 5ALDA 3D2CA 5LKAA 4DGQA 1XZBA 2JF0A 5JARA 1LPBB 2PSDA 3PICA 2OLEA 3C87A 3C6XA 3SC2A 1LPOA 4QWMA 4I4CA 3G9ZA 1VZ3A 4F60A 4P93A 2RI6A 1LZLA 1UZAA 3T52A 4EY6A 3G9TA 5FLKA 4BDSA 2XUHA 5AK4A 2PSFA 2XB6A 2I3ZA 4QDZA 3E3AA 5A7GA 4Y2XA 5CH8A 2ZSIA 5CT6A 5IVHA 2XMCA 2XMDA 3R3ZA 1IZ7A 1WPRA 5LZ5A 4UBNA 5LZ2A 3IUQA 4FLMA 1XZFA 4S0XA 3H18A 3G0CA 1XFDA 3GA7A 3BXPA 4IQ4A 2C4HA 5EHXA 1HKHA 1YB6A 3WKEA 2OQIA 4DMKA 1T4MA 2WUGA 2HFJA 4AN1A 2XQJA 4DLNA 4QLOA 5E2IA 5HZGA 4AZ3A 5ALYA 2WUEA 3B3QA 5ALSA 1ISPA 2H7CA 5A2GA 5JZSA 1H2WA 3IB3A 4UBIA 1R88A 2HRQA 1HL7A 3BIXA 1G42A 1IZ8A 3W04A 2PPLA 3L1JA 1NX9A 1WM1A 1J06A 1Q83A 2JGMA 1UOPA 2B4KA 4LIPD 2O2IA 3DLTA 2OAGA 4RPCA 3LP5A 4C01A 3R3YA 3M82A 4MQMA 1KU6A 3VJMA 5JAHA 4QEKA 2OGTA 1QIKA 2JGEA 3WK6A 4J3JA 4MEAA 2RAUA 2ZSHA 2XLCA 1EDEA 1C7IA 2C5FA 1H2ZA 4K6HA 3DOHA 1E3QA 3CCBA 5AM4A 5DNWA 2QZPA 1Q0RA 1F0NA 4J0DA 3FWHA 2JGLA 5T4FA 2XMSA 2JGKA 4Q3KA 4GECA 3WIBA 1DX4A 1P0MA 3RLIA 2XE4A 3TRDA 4B83A 2VJAA 1R9NA 4L3WA 3DOIA 2ECFA 1GPNA 4DNOA 1W52X 2QXUA 4Y2PA 4Q3OA 1ETHA 1VOTA 5AKEA 2CJPA 4B84A 1I6WA 1QO7A 5CBKA 4INZA 5YASA 2JGIA 3U1TA 1CQZA 1EK1A 2CZQA 3VISA 3A2LA 2Y6VA 4EZIA 2AJLI 3OTQA 1LBSA 4N8EA 2XDWA 2HADA 3C6BA 4AQDA 5AICA 4RNCA 2XUJA 1FFBA 1L7AA 2DCMA 3F67A 1BU8A 2QM0A 3FCYA 4UHDA 4EY4A 1W4LA 3DL7A 2K2QB 3PUIA 1N1MA 1XLWA 2Q0XA 3BL8A 4EY8A 5AI6A 4GHWA 2AJCA 5I9IA 2CMFA 2YXPX 5AM0A 2RHWA 3AZPA 2OCGA 1UKBA 4G8BA 5FPPA 5I8PA 4BCDA 2I3DA 5CRIA 3M81A 1ZD5A 4KACA 3FNBA 1ZI8A 1DINA 2QS9A 3O4GA 4BB0A 1CUAA 4IHAA 2D0DA 5IVDA 3A2MA 4MQLA 1MAAA 1CQWA 4PF1A 5JAUA 1YASA 5DYYA 3AFIA 1L7QA 1TRHA 4ZV9A 2WHPB 4FOLA 4ZGBA 3WI7A 4B7ZA 4HTAA 3HC7A 4BC0A 1DX6A 3WL6A 4WY5A 2ACKA 5ALHA 3BF7A 3H19A 3WZMA 3AINA 1P0PA 4UPDA 3OPMA 1ZOIA 5EHZA 3WWDA 5BV7A 2O2GA 1QFMA 2HU7A 3BJMA 4ZXFA 2XQFA 2XUDA 4UFOA 3DDUA 5AK6A 2IITA 3WKAA 1U65A 4D9JA 2WU3A 4B9EA 3A2NA 1BEZA 5AKKA 4X6UA 5JD5A 4H0CA 1EB9A 2ZYIA 1IVYA 5AOAA 3STWA 5ALJA 1F8UA 1P0QA 1D07A 2HA0A 1U2EA 3VJLA 1EK2A 3OM8A 5FV4A 4HXEB 2VTVA 3HYSA 2WQZA 3WJ1A 3WWCA 1CUXA 1HLGA 4EA6A 1WHSA 5D6OA 3ZWQA 4TPKA 2VSQA 5C7YA 4H7DA 2Z8ZA 3LCRA 1XKLA 1IUOA 2GBGA 3G0BA 5KBYA 1WCYA 3O4HA 4N5HX 3C6ZA 1O6FA 1CUJA 4B0OA 1VKHA 2ZYHA 2GYUA 1BN6A 4BCCA 4PSCA 3WYDA 3ZI7A 3DEAA 3FCXA 2WIDA 1RYYA 5LZ9A 1XRRA 3BE8A 4TVKA 4W1PA 1CUFA 3KXPA 5K3BA 5JZBA 2PU5A 4KRXA 2JEYA 2HFKA 5DWDA 1XQWA 4UHEA 2XUKA 4GDMA 4X95A 2QXTA 5AOCA 1P0IA 5ALXA 4WDRA 1ACJA 2D5LA 1XZKA 1XROA 4BVLA 3HRHA 3O9VA 2QTBA 1WB6A 3ICWA 1MT3A 1GPKA 4CIBA 1XZJA 1LGYA 2G5PA 3EIOA 3QH4A 4BBZA 4FLEA 3C45A 1QZ3A 3TEJA 3PUHA 4Y2JA 3DYVA 3I2JA 2XQIA 4BP9A 3GROA 3RKSA 5JD4A 1AZWA 1XLUA 4DM7A 2WFLA 3EQ8A 4QDXA 4CCWA 4ZWNA 3G02A 1A8QA 4BZWA 3O4IA 5ALOA 2VEOA 1ODSA 4BC1A 1YA8A 2DFPA 4H7JA 4CG3A 2XUAA 4A5SA 4M0EA 1LPAB 4G4JA 2OAEA 5LKRA 3RM3A 3G7NA 2WKWA 3IIIA 4WY8A 4OU4A 2YASA 4PO3X 4PV7A 1EX9A 5J3JA 1XZCA 5AKJA 4OB8A 4Y7DA 1CUHA 3UUEA 1G66A 1EXWA 1AGYA 5E4TA 5CT5A 5E4JA 1RWQA 4QDTA 2XUOA 2WSLA 4Y2SA 4U2FA 1FFEA 5LLSA 2WJ3A 4DIUA 4HXFB 3HLKA 3PE6A 2GBFA 2ONCA 5SYNA 3UMJA 5AI8A 2YH2A 2AXEA 5HF8A 5CT4A 2Z5GA 5AM3A 1USWA 5SYMA 2NW6A 4TGLA 1VE6A 1E66A 2JIDA 2EDAA 4AXBA 2ROQA 1EI9A 2ZJ6A 2OCLA 1QGED 1CUBA 4X97A 1R4ZA 3I2IA 3IVMA 7YASA 1W75A 4H18A 3WK7A 4M0MA 4HZGA 4JYPA 1Y7IA 1JU3A 1OXMA 4CCYB 1A88A 2GYWA 1QOZA 1CUIA 3NGMA 4H7HA 2XUPA 1C4XA 5EI5A 1ZD3A 3SX4A 3WL7A 3IUJA 2HA3A 3FLBA 4WCVA 4BAGA 4QDOA 2PSHA 3FYUA 2VT6A 1EA5A 4RE6A 1YAJA 2GBIA 5CURA 2GZRA 2VJCA 1LPSA 1QTIA 3MGAA 1MJ5A 4ARBA 2LIPA 3IDAA 1X70A 5HF9A 5HK9A 4J0KA 1YS1X 5EIAA 3I2FA 2PU7A 1FJ2A 3D7RA 3C5VA 4BP8A 1H22A 4L0CA 1GKLA 2RGUA 3DS8A 3D5EA 3KWFA 3MUOA 2G5TA 1JMKC 3G0GA 1DWQA 4X91A 3W05A 1EH5A 3ESAA 1DT5A 3R41A 4GEGA 2XUQA 3FVTA 1UKAA 4X7BA 3BDIA 2QT9A 4DNPA 2BAGA 2QR5A 3DL4A 1XZEA 2AJBA 3H2IA 4Y2QA 3UUFA 4X6YA 2BKLA 5ALFA 4BRSA 4DMHA 3BWXA 5AOBA 2B61A 2HA7A 1LPMA 1ZD4A 1VXOA 4AX4A 1YS2X 1THTA 2ACEA 5AI5A 3WKCA 1EB8A 4AN0A 2VATA 4C6HA 4I3FA 2Y2UA 1AQLA 5AKZA 3IULA 1TIBA 3O4JA 4BE9A 4QLAA 1VZ2A 4KEAA 1LPPA 1XZHA 3HEAA 3PDCA 4C4ZA 1FSSA 5LZ8A 3HXKA 1VLQA 5AKXA 3QBJA 3FLEA 4RE5A 2XUGA 4HRXA 4Y2RA 1AMNA 1J07A 1MAHA 2GZSA 1XZGA 4BVKA 3H1AA 5CXUA 4MWTA 3WKDA 1HQDA 2DSNA 1EHYA 4Q1VA 4QDUA 1NU6A 4BVJA 4BTLA 4KRYA 5EIHA 4BTVA 4WDQA 1G5FA 5ALQA 1TKRA 3AUKA 2Y2VA 5JAOA 4BRZA 5C8XA 1UKCA 2WG1A 4EB0A 5JAPA 5ALEA 5DYWA 1QIIA 1XKTA 2PX6A 3ESCA 3C6YA 1WB4A 4J0GA 1AC5A 2HHAA 2J4CA 4YX9A 1B41A 3WKBA 1MX5A 4AO7A 2R11A 3FBWA 3NUZA 3GBSA 5AKLA 4G8CA 4EY7A 5T4EA 4U2GA 3V48A 2RHTA 2GYVA 5AO9A 1WPXA 2C0QA 1E8MA 2GBCA 3CN9A 2I78A 4C4XA 3D4LA 4U2BA 4B81A 4PSDA 2W22A 3ZLTA 4FKBA 4WJLA 5JANA 1QIJA 4J7AA 3V1LA 5IH7A 4KAFA 3KD2A 1XQYA 1X2EA 4G4GA 1LZKA 4C87A 1NU8A 2WFMA 4H7IA 5AK5A 1WB5A 4GBGA 4B80A 3FAKA 2ORYA 4BAUA 4UFNA 4LKOA 1CUYA 4MEBA 2QOEA 2QRUA 1CRLA 2WU4A 3QYJA 4OB6A 1CUZA 4DSAA 1QIGA 5ALWA 1XRPA 2IX9A 1SC9A 5A7HA 4CG1A 4AZ0A 3C5WP 1BEEA 4LHEA 4F21A 1ODTC 2PSJA 1R50A 4DNFA 4BCBA 3CXUA 4Q05A 1K4YA 1XQXA 5AKYA 4HAIA 3BIWA 2QUBA 4DMFA 5EHNA 5DJ5A 2ZJFA 1GQSA 3A70A 4ZI5A 1H2YA 1YSCA 3HABA 3M83A 5K3FA 5EHQA 1HPLA 4J03A 3K6KA 3STUA 1CFJA 3WL5A 4O08A 5ALLA 4LXIA 5AKIA 5KWJA 1SOMA 1THGA 4OYLA 5HF5A 1HBJA 3JYHA 2ES4A 3G0DA 4UBOA 1YCDA 3PF8A 2BFNA 3V1NA 3S8YA 3DKKA 1IUNA 1SFRA 4LXGA 4PSUA 4Q34A 1X2BA 3KOOA 3MUNA 2HM7A 4FFWA 2H7XA 4H35A 3BJRA 3F8SA 1KEZA 2XQGA 2Z3WA 5DNVA 3R3WA 1MX1A 3H2KA 5EIEA 5ALGA 3HACA 3QITA 3WWPA 1DWOA 2WIJA 4XX1A 4Y2VA 3Q8WA 1CVLA 3WZLA 3GELA 5ALMA 2XMBA 2WTNA 4MYSA 2QJWA 1SCIA 4J0IA 4OB7A 2O7RA 1K8QA 1PFQA 1QIFA 3STYA 2VJDA 4X94A 4CG2A 4JEIA 1XZIA 4KJXA 4X71A 4X93A 1UT6A 2I03A 2WHRA 1QIMA 4AMYA 5CH3A 5JALA 4KAJA 4PW0A 2VAXA 3HZOA 4PNZA 4AO6A 4H7KA 2WIKA 1XLVA 4NVRA 1EINA 1DU4A 4Z49A 4RGYA 2RONA 1QIHA 3HJUA 1U8EA 1VA4A 4DTCA 1QIEA 1SCKA 3W9BA 2XMQA 1JT2A 5DNUA 4IH1A 1UOOA 4ZV7A 5AIBA 2X76A 1CR6A 3FYTA 4KE6A 3AZQA 5JZ9A 4Y9SA 1S8OA 5JASA 3TJMA 3H17A 4W1QA 3LIPA 1LLFA 2X5XA 1MTZA 4FFVA 4KR0A 5FP0A 4GW3A 1W76A 3QPDA 5HK8A 5ALNA 1GPLA 1DT3A 1K5PA 3O9MA 3DD5A 5ESRA 1FFAA 4MWSA 1DTEA 3I1IA 4ROTA 4DSZA 3IA2A 2V98A 4LYDA 1B6GA 2J4FA 1JU4A 3QZUA 2C0PA 4KAAA 2UZ0A 2JGJA 2WJ4A 5DTIA 4GXNA 4FDMA 5FRDA 5FKJA 5C8VA 5BWCA 2H1IA 4YASA 1BCRA 1QFSA 4K5QA 3V1MA 2C58A 3ANTA 1XZLA 3PF9A 1UK8A 4U2CA 5ALPA 4AB1A 4V2IA 4X6XA 1LPNA 2IIVA 2X8BA 3B12A 3I2GA 4IH4A 3WL8A 5HQ3A 1UK6A 3QPCA 4HXGA 2OCIA 5CT8A 3W9UA 3WJ2A 2Z3ZA 2ZYSA 2C5GA 4BAZA 4HVTA 5K3CA 4LXHA 1CUGA 2HA6A 2FJPA 5ALZA 3N2ZB 4C89A 3CN7A 4N8DA 1C7JA 1JI3A 1YAHA 2WFLB 3O0DA 3D2AA 3QVMA 5LZ7A 1L7RA 5KREA 1TK3A 4C88A 3FSGA 3WWOA 2PUJA 4B0PA 1H2XA 3E1GA 4KE9A 1DQZA 1ZIXA 5FDFA 4FNGA 1YB7A 4FBMA 5ALVA 3N0TA 2Y1KA 4ARAA 2FJ0A 4Y2TA 2B9VA 4NZZA 4CFSA 2PUHA 1CUSA 4UBJA 4QA9A 4XIIA 1F6WA 4KE8A 2OGSA 3AIKA 5AIAA 3VVMA 2VA9A 3R3UA 1YR2A 1GGVA 3G0IA 4MYDA 4X92A 4OD0A 2DHCA 4QWWA 2DR0A 2XUFA 3KDAA 4CI9A 3WMRA 4KYVA 2XT0A 5D7BA 5AKHA 3WA7A 1TQHA 4UBLA 3VJKA 3EQ9A 3O95A 1GQRA 3G8YA 1GKKA 1YA4A 2V9ZA 1ORVA 4JUIA 2XQKA 1BS9A 2RIPA 3I2HA 3WIOA 1QLWA 1CPYA 3IBTA 1AX9A 1TCCA 1AKNA 1JJIA 1ZGCA 5I7UA 2XLBA 3E4DA 2PSEA 1T2NA 2CBGA 4E15A 4Q3LA 2HIHA 4A16A 3WLAA 5AI0A 5ALTA 5AI9A 1N5MA 2JGFA 4L9AA 4X00A 2PVSA 4GI1A 3WK8A 3DNMA 4IO0A 4H77A 3QMMA 4AO8A 3LS2A 1VA5A 4CIAA 1UK7A 5K3DA 3WWEA 4OSEA 2P8SA 1N5RA 3C8DA 3FVRA 1ORWA 3PFCA 3BF8A 4E11A 2VT7A 2OCKA 4I19A 5ALIA 3EQ7A 4X90A 3LLCA 1XRNA 3QPAA 5LZ4A 4L72A 5HKBA 1XRMA 4J0CA 4OYYA 3FYUB 4N8SA 5K3AA 4P08A 5A7FA 3I1YA 1Y7HA 3P2MA 2PBLA 3WA6A 2H9YA 1QO9A 4E46A 1AUOA 3I2KA 5DLPA 3LIIA 3DCNA 3OOSA 2WUDA 3B5EA 2JEZA 3I6MA 1W1IA 5EGNA 1XRLA 1ZGBA 1QJ4A 3C8HA 1MNAA 2W6CX 3C70A 1EDDA 4FLFA 4K2AA 5AI4A 4G9GA 4LYEA 5IVIA 2WIGA 4ZREA 3F9CA 5CW2A 3HI4A 3I28A 4W1RA 3STVA 5AP9A 1UK9A 3AJAA 1MU0A 1Z68A 1BROA 5DTJA 3D0KA 5IVKA 1XZAA 2XUIA 2XMGA 3C43A 5AM5A 3IURA 1LBTA 5JATA 3WK4A 2OQVA 4JH0A 1PJAA 1MNQA 5AH0A 2WJ6A 4HS9A 2CUTA 5AM1A 3WK9A 4BE4A 4FTWA 6YASA 2AJDA 4DMCA 1E8DA 5K3EA 1QIDA 5D3ZA 2H7YA 4WFJA 3SK0A 5HFNA 2FUKA 2HA4A 2OPHA 2WTMA 4F0JA 5JADA 2JBWA 1A8UA 3R0VA 4ETWA 4FMPA 3M3DA 2YYSA 5BWBA 3AIOA 4Q82A 2BJHA 2WHPA 4UHHA 3GFFA 2WLSA 3QMVA 5E4YA 4H7FA 5AHXA 2WG0A 3F98A 1E89A 3FSGD 2ZYRA 2O2HA 1MN6A 5C8ZA 1XZDA 1MPXA 3U0VA 1ZIYA 5AM2A 2C7BA 3S2ZA 3ZLVA 1KU0A 3KWJA 4FNMA 1GZ7A 4NS4A 3FLAA 1K63A 2WG2A 4H7EA 4UHCA 1XZMA 3PI6A 4B82A 4X3CA 2QUAA 3DKRA 4UBMA 4G9EA 4GLBA 2Z8XA 4NMWA 3AIMA 4DNQA 4OPMA 1FFCA 4M0FA 2V96A 4OU5A 1QONA 2WFZA 1CIJA 5CH5A 5FPQA 2G4LA 3ESDA 1W6RA 4QE3A 2OXEA 3CCCA 2VJBA 5JIBA 2HU8A 4QZVA 5KWIA 2XI4A 1CEXA 4AMZA 1WOMA 2R8BA 2WM2A 2XMRA 4G1FA 3DQZA 1ODCA 3PFBA 1UXOA 3ICVA 3ESBA 3HSSA 3BDVA 3OC0A 4MJ3A 1GXSA 3RK4A 4B85A 3QM1A 1ZICA 3H2GA 1FFDA 4UBKA 1M33A 2DQZA 3G9XA 1CUVA 3Q0TA 3RARA 4PQEA 3TGLA 4GWLA 4OUKX 1EVQA 1CUDA 5ALKA 1MX9A 2HA5A 3NWOA 3AZOA 1SCQA 4MXDA 1ZJ5A 1ZI9A 4BYMA 1XRQA 2Y6UA 4G8DA 5ISMA 3D2BA 4G5XA 5HCUA 1JJFA 1ZJ4A 1A8SA 4ZRDA 1IMJA 1MO2A 1J1IA 4A23A 1UFOA 3DYIA 2DHDA 4DYHA 1H23A 4UHFA 5K3FB 4W1SA 4UHBA 1A7UA 3OG9A 1R1DA 5CTAA 3VVLA 2PL5A 3IUNA 1R3DA 2HU5A 3FYUC 1CUCA 1DWPA 2B20A 1BE0A 5BOVA 2J3QA 3D59A 3VKFA 2DQYA 3I6ZA 3W2TA 1G4HA 1JJBA 5FXMA 1JFRA 2XMZA 2QMQA 4HRYA 2QVBA 3GZJA 1TCBA 1VJ5A 2FX5A 1LNSA 2EEPA 3D3NA 1R9MA 3H1BA 3IUMA 1WHTA 4ITVA 5H3HA 4X85A 5JD6A 1U4NA 3H2HA 1OILA 3H04A 2OGZA 4XWGA 3G9UA 4B6GA 4XJVA 3L1IA 2EDCA 2WILA 4XVCA 1K6EA 5AK3A 3OURA 5JYCA 2BUCA 4QNNA 5CT9A 3WK5A 3JWEA 1IUPA 5LP1A 3FOBA 5DYTA 3EF3A 3NOXA 5HFAA 5HKAA 2VQ6A 5A6VA 4W9RA 1E5TA 3K9BA 1Q0ZA 5FOQA 1N8SA 2BCEA 1JMYA 4FHZA 3ANSA 1Q84A 1CUWA 2AJ8A 1UWCA 3WYNA 2G63A 3WQHA 5IKXA 2QKYA 4FBLA 3W06A 4YPVA 3ZV7A 4EBBA 5FUMA 5D3KA 3F96A 3EBLA 2V97A 5CMLA 1Y37A 5ALRA 2O7VA 4UFPA 1GT6A 4BDTA 5F4ZA 4Y2YA 4EUSA 2HDWA 1VXRA 4J0HA 3A6ZA 4CCYA 1QE3A 5A62A 5CXXA 1AURA 1ACLA 2WIFA 3YASA 3AILA 2J3DA 4OCZA 3STTA 4P92A 1OCEA 2HA2A 4FWBA 1J2EA 3VXKA 4YK7A 1UOQA 4G4IA 5C81A 4WFIA 2WUFA 2BGRA 2BUAA 3R40A 3I6YA 3V1KA 3E0XA 2WHQA 5T4BA 1ZI6A 2QJRA 5EFZA 3V9AA 2ZVDA 5K5EA 4JNCA 1CUEA 2DHEA 3KSRA 5AKGA 3QMWA 4K6KA 2BGNA 4BATA 3R3VA 1TCAA 2ZJ7A 5A71A 1PV1A 5AJHA 3ED1A 3H2JA 2CB9A 1BN7A 2HL6A 4W63A 1CLEA 1HDEA 4J0JA 4KE7A 5LYYA 4UUQA 3X3HA 5HF6A 1DQYA 4WFKA 3H0CA 1EVEA 3STXA 4JYMA 4EHBA 2CEKA 4BZZA 1CUUA 4N5IX 1CV2A 1JKMA 4Y2UA 4IH9A 3K2IA 1O6GA 1EDBA 4E14A 5HQ3B 3L1HA 1BRTA 1E8NA 2VF2A
chains in the Genus database with same CATH superfamily
2M6KA 5FI0B 2BONA 2GM4A 2H1OA 2TYSB 2IEIA 4YMLA 3SWWA 1D2NA 2O2YA 4P9NA 5HMMA 3MOIA 1RM0A 1SUAA 2QRQA 1K92A 2Q2QA 2ZATA 2HTFA 4UQOA 4C20A 4FFBB 2QVXX 4GOLD 2ZSAA 1FS4A 1JG3A 1NRJB 4LQDA 1Y6FA 5EXPA 4GKBA 1PU2A 4XSVA 3WGZA 2P8JA 1QTRA 2ZBFA 2NU6A 2IEBA 2HI0A 3T9BA 4K6GA 1ITZA 3BERA 3QEMA 2F90A 4GNKA 4EMBA 1YJBA 2ZIEA 3UMGA 1OVGA 5JJKA 2QYOA 2R4QA 2ZM6B 3RC7A 1N2BA 1G6KA 3VR2D 2FPGB 4URUR 1QTQA 2LUOA 4ZODA 3FUTA 3DAOA 1RWVA 4F9FA 1IAVA 4EX6A 5LIPA 4DBVO 4HAVA 4DPLA 1NAIA 5J4VA 2X0IA 2P2GA 4KBYA 4K9MA 1EP2B 1CY0A 2J09A 2RBKA 2W6JA 1W1UA 4NBLA 4JC4A 4TXLA 5K0NA 3UK2A 3Q8MA 2Y1GA 2QZJA 2JZNA 1F0PA 2GAJA 2JASA 1BCSA 4I3GA 4BLTA 4CNBA 3GPBA 4RCYA 2ZJ3A 2FFQA 3J81A 1OLXB 2QB5A 2WC1A 1CJCA 1Q1QA 4BU0A 4QELA 2GD2A 2X0DA 1JV2B 4MGYR 5JAZA 3CKYA 5ALUA 3ZIDA 4HNUA 3I04A 5IZ4A 2ECPA 1G3QA 3GUUA 2NPOA 5A0TA 4NV3A 2PH1A 5IN4A 2R62A 1KI3A 2KLHA 3AJ9A 4PC3A 4I2VA 3CZPA 1LPBB 3OJCA 1U8TA 4X5OA 1I7DA 2XYRA 2A6PA 4DJEC 3RO7A 3ZGYA 3PK0A 3HP4A 1AKYA 1XTTA 4I55F 4WT7A 3TFOA 3IP9A 3UGQA 3C6XA 1FQJA 5JH7B 1ZXXA 2A1TS 1I94B 1JXQA 2ZRIA 3BE5A 4H1VA 1LPOA 3KSBC 5FI1B 1ZNQO 3I9V1 2J07A 3CRQA 2EF0A 3BRCA 4PSKA 1PGPA 3G9ZA 3X1DA 1VZ3A 3ZIUA 1WMAA 2RI6A 1WKCA 1C4KA 1GGEA 2QN2A 3LW7A 1UZAA 1E4EA 1T0BA 1SZPA 1WPGA 2F1RA 2GPTA 4KLNA 2P62A 1UJ2A 2D1SA 5DHSA 4ZQHA 2CDBA 2C2BA 1Q77A 4ZVKA 3WIEA 3A9UA 5C37A 4NMHA 2XB6A 1YRAA 4QDZA 2P9YA 1F0YA 3ZW8A 2QUIA 2GZHA 4LCEA 4F4UA 1FCJA 2FRDC 4PFJA 1LTQA 4BV8A 3TW6A 3H05A 3SYKA 2IYUA 16PKA 3GL9A 4KR9A 5AVOA 3ANXA 1Y81A 3V2IA 3L41A 1EFDN 3PDUA 1K7FB 1F8GA 1IZ7A 1WPRA 2GI4A 2VNJA 2VDRB 1NR7A 3LU1A 2WNIA 3QRWA 1GSIA 2AOUA 4AULA 3A7DA 3V9PA 4MP6A 2O2XA 3AEKB 4FOPA 4L27A 3H18A 1Y6RA 1SHJA 2CGEA 3G0CA 4GPIB 4YAEA 1PFWA 1RKQA 1RRKA 3CUKA 1XFDA 2Q5IA 3HJAA 5H4HA 1S7GA 3AUYA 3NEYA 4P84A 4YRNA 1I2DA 2WB2A 2E7ZA 3A32A 5JSZA 5GJBA 2O52A 3BXPA 1NUAA 3K6JA 4PRLA 5EHXA 4GUDA 1OAKA 2E0IA 1DQSA 3REGA 1XSEA 2G1AA 1HKHA 1RPAA 3AEUB 3QG1A 1Z6ZA 2QM8A 4RZIA 3WKEA 5CEFA 2C4MA 3CQ9A 3P9PA 2HFJA 5LDHA 5C52B 1JLLA 1U9JA 3AO0B 4ZAFA 3BWMA 2PLFA 4AG3A 4S1VA 3FB1A 1WXHA 3PX2A 3MYRA 4B6QA 4QLOA 1Z7YA 3MGBA 3P9IA 1I5RA 3B3QA 5G1NA 4F7DA 1MIHA 1U8UA 4QXAA 2NUTB 2ZIXB 1Q1EA 1EM8A 1IQPA 4ZU1X 5M5BA 1KAMA 3TH5A 2FPMA 1PGQA 3DOFA 1VI2A 2H4ZA 3VPXA 3CE9A 1QYRA 5EJ7A 1RZUA 2FFAA 2IW3A 3L4SO 4MAFA 3IEIA 3LXXA 2GEKA 3KLPX 4NDNE 3S5JA 3ZDYB 3DOJA 5IXJA 3TPCA 1VRVA 3IE1A 4DF3A 1YB2A 1BHQ1 5DVZA 2YFKA 3S2UA 1IZ8A 1JXMA 1Q7EA 3AM5A 2JJ1A 4MR7A 5BVGB 5I5EA 1GG5A 3AKYA 4ZKEA 1TC1A 4PYLA 1XAJA 3KR9A 3W3AD 4PVDA 3KE9A 1P62B 1IH8A 3ANMA 3FRIA 5BSHA 4GAEA 4KZKA 2J0EA 1SOUA 1VL0A 1Z18A 2OTCA 3PENA 4LIPD 2EJCA 3LX6A 5BXQC 3X2FA 2AXQA 3KUCA 2O2IA 3GLFB 1TMGE 4FHEA 3X1WA 4RPCA 1WSWA 3QOWA 1TEVA 1QCCA 5J2UB 5COBA 5DPMA 3K5WA 5KTYA 4MQMA 4N01A 4O4IB 3K8OE 3VJMA 4R16A 3JX9A 1U6KA 5BNZA 2MDTA 4P5EA 5HMLA 3PCXA 2JGEA 3V5NA 3K0KA 5DYGA 2ZB2A 4PS1A 1KDTA 4F4HA 5AVQA 3MM4A 2B8NA 3TLKA 4BKMA 2B1QA 3LCUA 5FWAA 1B8NA 4F3TA 2X8JA 4K8RB 4WBNA 3H1TA 1C7IA 2O54A 2Z58A 4ZV4A 1RJ9B 5LOVA 5LSAA 2UV8A 1V4BA 1X7YA 1VHDA 3GGGA 1C41A 4L50A 3BXGA 4DIFA 1Q0RA 1T1IA 2WVJA 2IP2A 1U7DA 3S28A 1IWBB 3L0BA 2IHZA 2IBTA 5DGHA 4Q3KA 3FF1A 4POAA 3W1WA 2RGYA 1CDEA 5EE0A 2J67A 1E9VA 2JIBA 4RJLA 4LF4B 1MOPA 4YXFA 2VJAA 1R9NA 4X0EA 3NVMB 2VBIA 1H4QA 3KG2A 3TINA 1RTTA 3NJ8A 3U44B 1N9GA 3D9QX 4YRLA 1GPNA 4UMEA 4DNOA 4KXXA 4FB4A 4PAGA 2JIPA 5BN3A 3ZU2A 1MJGA 1W52X 2XBLA 3NHJA 4PYNA 5BSEA 2E87A 4ED9A 4V0ME 1PG5A 1QPZA 3TUJC 5H59A 1GITA 1OKKD 1GR0A 1I6WA 2JI4A 1GPH1 2GARA 3ZKWA 3D4IA 3ZE2B 2JGIA 5DLQC 1CQZA 2J33A 4ZJPA 5DP2A 4MUIA 2TECE 3L0DA 3W8RA 3V3TA 2QU7A 4HK4A 3T9FA 4CMJA 1V9CA 3QELB 5FL7A 4KGXA 1QHSA 3N70A 1DKUA 8OHMA 2NO1A 3V2HA 2Y6VA 1P77A 1DTWB 2EBUA 5HCNA 4H17A 4QM7A 2A35A 4Z0PA 1VECA 2A8YA 2Z8YA 4PQGA 2P4UA 3OE7D 3HYTA 4H16A 5L6LB 3OIGA 4YVFA 5ELXA 2JJ2D 1PV2A 4R7ZA 2VWGA 4YCAA 1P81A 2P4HX 2PGAA 4YEDA 4AQDA 2VHXA 4F45A 5CFNA 3JWGA 2Q9CA 3BXEA 1ZX1A 3KPJA 5GY7A 3VZRA 4BNDA 4D3FA 4KGDA 1EPUA 1J0DA 4M9ZA 3EGDA 3HP7A 2BBWA 5KTKA 3VU0A 3OCYA 4FD2A 2GKSA 3I9MA 4JMLA 4C4RA 3HBMA 1JFFB 1GGHA 1Y5LA 4N5MA 3PUIA 1N1MA 2VHCA 3DO5A 4ZIRB 3P20A 3ZTYA 3HKBB 2QLLA 4MOWA 1UINA 5I9IA 4WK2B 2E49A 4ATNA 1U3TA 3EXHC 4JLNA 2PV7A 2X3UA 5CAEA 1UKBA 2POCA 1OX4A 5L8VA 3DJFA 3PKZA 3L7YA 4ZOLF 3BTVA 1AU9A 3AEYA 2P9FA 1N0UA 3B1WA 4L9WA 5KTMA 2BSQA 3L6DA 1A2BA 1QRSA 3OIWA 4DC9A 3RU2A 2R8OA 4KNYA 2COEA 4UOEA 5FPHA 1RRGA 1KMHA 3PC2A 3U62A 1QP4A 5B6IA 4IDEA 1I7QB 1UT5A 1ORHA 5DNEA 4KACA 4MLPA 1UC9A 3HBFA 4W8OA 2XXAB 4NS1A 3FNBA 4NY1A 1HT1E 4J3FA 3QK7A 2C88A 2QTAA 3RNLA 4K0RA 3O4GA 2E5WA 2FSIA 1CUAA 2E82A 4IHAA 3UYLA 4ZOQI 5KEIA 2FDCA 3PL5A 4AF7A 2QAGC 4J2OA 4JYCA 1RAAA 1IM5A 3GYGA 3V7FA 4CU2A 4HMPA 3PEEA 1U0BB 2YCBA 1Q1BA 4IZHA 3E84A 4C0WA 3RG8A 3SLGA 3GRPA 2CE2X 2DUWA 1TM5E 4UC0A 4ARCA 3JCZA 3OVMA 4ZEXA 1L7QA 2NAPA 5HKOA 5AFSA 2K4MA 2Q3BA 1UWVA 4ZV9A 2QE7A 2WHPB 3U48A 4ZZ0A 2SKEA 2DPHA 3QIVA 4BNNA 2BL4A 5GM1A 2H31A 3IRVA 4MDFA 4HTAA 3QVXA 1HNZB 2G9QA 2OZPA 4DR3B 4LMRA 4P3KA 3WJ7A 1DX6A 2H51A 2CLCX 4N9WA 4WK4B 2KYRA 5ALHA 3ELWA 3OJEA 1EJ0A 4LJAA 5FADA 5KS2A 2RHBA 3DCIA 2FB9A 2DLDA 3OPMA 2P91A 3T35A 1RJFA 1Y6ZA 5DMXA 3BQ9A 3RC1A 2I3AA 4OQQA 3VPGA 1YGPA 5L6MB 2R4UA 3HWWA 4RY8A 3ICEA 3Q6NA 3A3OA 1IFXA 4AJ2A 4QFMA 1U2GC 1QSGA 1KYXA 5HYVA 3AI7A 4B3IA 1PN3A 9ATCA 4EABA 2HU7A 5ECWA 3LQFA 2FFJA 3BJMA 5AW7A 1SBTA 1W85A 3O84A 2V5UA 2PL1A 1QE0A 4JI5B 4U7PB 3ECAA 1OXSC 1Z29A 2OUIA 2MMCA 1NYLA 2QPTA 2CXUA 3DHVA 1OYYA 3GLTA 4RVNA 3WKAA 3AP3A 1L5MA 3SHVA 4D9JA 2QUJA 4C6TB 3KLBA 4B75A 4GVLA 2ZB8A 4X6UA 1GFIA 3AVTA 1FJHA 4IJMA 2YOGA 4H0CA 1D9XA 3FDZA 2AYZA 1T2CA 3IUSA 4TMTA 1T1SA 4GGOA 5IF3A 2XPCA 2NSHA 4WFQA 2YMPA 3E53A 5CA0B 3U4MA 3E3MA 4MKFA 1QC5B 1VC2A 4YAKA 3USES 1CHNA 3KVYA 4ZEWA 1Z22A 3ZWVA 1EK2A 3VR0A 4BTEA 3HJNA 2A7QA 2FQYA 5CM9C 3COWA 3OM8A 4I46A 4QUKA 2BDUA 5F35A 4IXMA 4LXXA 1M8FA 4Q16A 4DILA 2WQZA 3UK0A 1SBIA 5JMOA 3A9VA 1G2QA 1VHQA 2ZJ2A 5JEEA 1AA6A 1TZBA 4EA6A 1SIUA 3ZK8A 1MOSA 1T4CB 3HHPA 4R1MA 4OSPA 1JR4A 3EZ2A 3GI1A 1UBCA 4LZPA 4WUVA 2IEGA 2JLRA 2L18A 3MELA 3R74A 1GZUA 2OE2A 1YDWA 1NVXQ 4GLLA 1XRSB 4WKNA 3V33A 3PDHA 2O7NA 3CUWA 3SP1A 2ATEA 1JBEA 1HLFA 4W82A 1ID8A 2HO4A 4UEKA 1TO2E 2Z98A 3TG2A 3C3DA 1NT2A 3AUSA 3BHNA 4YRQA 3UCXA 3LL4A 3O4HA 4GQAA 4BQNA 3QSGA 1C1HA 4CLXA 1V96A 4K6FA 2M9MA 4PPNA 3CLUD 5E7IA 4CIXA 4HLQB 1EFHA 4ON9A 1NMEA 3QTBA 5CLLA 3VKGA 2FN4A 3FTCA 1XQ9A 3RTEA 2ZYHA 3PUJA 2CDRA 2VJMB 1Z25A 3VC1A 4F6RB 2Q9UA 3IODA 4LG1A 3H8VA 3I30X 3K30A 3OF5A 2P9ZA 5CBPB 5JDIC 3DHYA 2D3WA 5AW1A 3W5IA 1GXSB 3K9QO 3FCXA 4G97A 4ZYZA 4PQYA 2B0CA 4A1FA 2V7UA 3W5BA 3ISJA 1XRRA 3M1IA 1YJ5A 3BWEA 4Q03A 3RDPA 4NDZA 1CUFA 3TRKA 3HNPA 4ZAYA 3L2OB 4AG5A 4AT1A 2OVBA 3BWVA 2V6GA 3OTHA 5JZBA 5LQRA 4KRXA 3MS4A 1Q1GA 3BVPA 2GJ4A 2HT1A 3GOQA 1FW8A 5JTTA 4RDHA 1Z26A 3K0AA 4UHEA 1QZUA 3BMNA 1ZM2A 3PEVA 2DY1A 2XIJA 1NXVA 2WYHA 5A3VA 2O57A 2IZZA 3FNQA 1U4OA 1P9LA 2PANA 1WW3A 2YV3A 3FPGA 4II3A 1Y4SA 1X92A 4M0KA 2ZIAA 1SCUA 4HH1A 1KZ9A 1VLMA 3BJEA 4MW6A 4YJ3B 5KHAA 3ZWYA 1ODLA 4AUEA 2Q7XA 3EH1A 3X1JA 2QD1A 1ACJA 1WXEA 2CF5A 3LBNA 1TLFA 3TLXA 2BYTA 5BYAA 1RZRA 3PUZA 4BVLA 3HRHA 2P6NA 4N5LA 3E9YA 1FS5A 1MT3A 2V7VA 3KB8A 2AFIB 3VSAA 1LLQA 4HLCA 4R9VA 3RVNA 3G2JA 4XW2A 4G81A 3LUKA 4OA8A 1NUUA 3D6VA 2XVYA 4MARA 2FSGA 2G5PA 4IWYA 5KTSA 2ERXA 3UFXB 5TQ0A 1M74A 3UWOA 2Q9AA 2WF7A 3BFPA 4FLEA 3T3EA 3TLMA 1OOEA 1QZ3A 1DOHA 4WSOA 4GQBA 3RIGA 3RAJA 3ZE8A 5A5GA 1RM5A 1SO8A 2QX8A 3RTGA 1YQUA 4Y2JA 1U8ZA 2H8KA 1UXKA 3L9XA 3E5HA 2QL5A 3FNHA 2RHJA 3LM8A 2H57A 3I2JA 5I9SA 1SOWA 1VG9B 3RKSA 2P7IA 2P11A 1N25A 3A7EA 4JBWA 3HV2A 3BIFA 2RCYA 1PWZA 3M4JA 4UD6A 1TEZA 3RVDA 4DM7A 1SURA 4HGNA 1M9NA 4R1UA 4NF2A 5A04A 1TC2A 2AKEA 1WS6A 1P1CA 3EQ8A 4QDXA 1JUDA 3AT1A 3MLAA 4JP1A 4OSOA 4ZWNA 4CQLB 5DASA 4ZCMA 3K9GA 2B21A 3BC1A 3QLJA 1A8QA 4PX3A 4X1KA 4EGJA 4BZWA 3OEHA 4JKYA 2GK7A 5CNMA 4D98A 5MFZA 1E3MA 1T26A 2ZSDA 3U56A 3TEFA 3SQLA 4PLTA 1O6BA 4BC1A 1YA8A 1FDRA 3O38A 3N2GB 3O90A 3ME5A 4H7JA 3OPYI 5GV7A 4X8LA 3RTDA 3D8SA 1BGWA 4JL5A 4MLCA 1CR4A 1XEWY 4EHNA 5B64A 3G2QA 1NQ5A 1PHRA 3I8XA 3CX7A 3KUKA 3NM6B 3QVOA 4G4JA 4A8JA 3LVFO 2MSLA 4G0UA 3BB1A 3PHLA 2VTDA 1KSJA 5LKRA 1W4AA 3GJRA 1NUQA 3FMGA 3ZY2A 2WZQA 1WHTB 3G7NA 1WO8A 5BW6B 2F3TA 2GF9A 1BVYF 3GA5A 4MCJA 4Q7MB 1EQAA 2XTAA 4WY8A 3KZOA 4C4PA 4CFYA 2P9HA 1MPTA 4XVRA 1PNQA 1Y8CA 1EX9A 3AV0B 1JIJA 3V4RA 2C99A 3FW1A 3QWHA 2EARA 2ZROA 4EY3A 3LVBA 4EL5A 2BTQB 1JG1A 1PS8A 1EXWA 4GICA 7MDHA 2HY7A 4Z86A 3PNPA 1ND6A 5ERXA 4QG7A 1MV8A 3ASUA 2EZ9A 3GLGE 1BWRA 1Y5RA 1Y6JA 1YULA 2D5IA 2YIDA 4Y18A 4Y2SA 3N3AC 3JY6A 3MCWA 3AH8A 1D4AA 2DTDA 4P34A 5KYVA 1YRHA 3PNVA 3AUTA 5FTMA 2IVFA 1NBOA 3ZWWA 1MABA 4PO1A 4BEBA 3MBIA 4R7GA 3M9XA 3L1UA 4ZO4A 3LVRE 2C7PA 1H6AA 3U17A 1H2HA 1PBTA 2JEOA 2OK7A 3OFJA 1PZXA 2WYIA 4DRZA 3L5OA 4XJSA 4F3YA 2QRVA 1UP6A 2P41A 4ABYA 4MUKA 5CXSA 5A06A 2BCJQ 1YB4A 3PXGA 5T3UA 5DN9A 3OCWA 1PFKA 4GKJB 3HWX1 3VQTA 2R86A 2V8OA 3PXBA 1LEHA 3Q5EA 2EKLA 1MO6A 1MRZA 1ZH6A 5DBFA 1G3MA 3UXYA 4AY5A 4O8CA 3C4JA 5J59A 2Z5GA 4YTEA 1ZVMA 4X24A 3ZN2A 5AM3A 2X42A 5IT9A 3ZK9A 2GCIA 4HDCA 3SIRA 4BNZA 1O96A 1J8FA 5KX5A 4N49A 1MZVA 4TV9A 4F9GA 1OB5A 3RYFA 1A4UA 4KPEC 3V4PB 1E9EA 1TVKA 2NVUA 3BSYA 2ZJ0A 4HAOA 1E66A 2WWVD 1QZZA 3L93A 3O0TA 1EGVB 1I36A 1XDDA 2JIDA 1A5BB 2YVQA 2OD7A 1JIIA 2ZJ6A 3LDFA 2OCLA 4B43A 2QRMA 5MFPA 2GB4A 1J39A 1ESCA 5JZVA 2I65A 2XZLA 2Q8NA 4KXWA 4Q1DA 3SI7A 4Y1FA 5IF9A 2AVNA 1NP3A 1QX4A 3F6PA 1W75A 3L8YA 4BO5A 5D2CA 4CCSA 4D02A 5DBGA 4EB8A 3EUFA 4JENA 5FQNA 4D8WA 1DRWA 4UZFA 4KQ9A 5PNTA 1Y7IA 4UM7A 4BPRA 2JD2A 1JU3A 3C74A 3W7VA 3AF6A 1CRWG 3CRZA 3U13A 2A9QA 2R751 1QOZA 3HU2A 1CUIA 4M2LA 3NGMA 4PYQA 3WFJA 1QHHA 1NI4B 4QUHA 4U5XA 2C54A 2LBPA 3Q2OA 4PPGA 4QTUB 5U4QA 1BKYA 1O77A 2JJQA 3KQSA 1ZD3A 3WL7A 3KQTA 3EC7A 3NP9A 4WCVA 5SYAA 1OYVA 2YMLA 3IIKA 3UXMA 1MXHA 1SK8A 2BKUA 4KQGA 4PXSA 4WEOA 4D9GA 1EZ4A 2HJVA 2ZFUA 5K0GA 1KMCA 3H1GA 4MR9A 1XJQA 3GMSA 4JIGA 4XIGS 2VT6A 2F67A 1C0LA 1OC4A 3B1KA 3IDFA 1YAJA 1RZVA 2W6IA 3KXDA 4NEHB 3COZA 5KDOA 4TZ6A 2VDMB 4BJ1A 5HJ5A 2R6R1 5JC8A 3HA3A 1NXPA 2GZRA 4V0NA 3KVRA 4D3DA 3R9XA 1B00A 2VJCA 1H5UA 3BMOA 4FMCF 4BU1A 4OF4A 3IXLA 3MGAA 4YRCA 2IV2X 4NOMA 1AUXA 5TT0A 1NPDA 1I24A 2QGZA 1L5WA 1EFCA 3LSYA 4ALJA 2B1RA 2KQUA 2QZ9A 3W9SA 5LPNA 1KGDA 1WVMA 4EF5A 5HF9A 4FGWA 4PFQA 1YS1X 5LXTB 2HREA 3AGQA 2IPOA 2PU7A 4X20B 1EFRA 4PLYA 1UP4A 2X58A 2ODEA 2FMKA 3R4VA 4BP8A 1H22A 3KJQA 3E9DA 5HW0A 1APBA 3IP8A 3FVQA 1V45E 3WB9A 2Q3JA 2XD9A 5T3YA 2XTJA 3OP4A 3M5DA 1OZ0A 3KWFA 4P33A 4QULA 3MPUA 5EZYF 2JA2A 1TIKA 3MUOA 4LDPA 4Z1MD 2P9BA 5K4HA 4MA0A 2QG6A 4CZ2A 3KQUA 4MV1A 3WRXA 4BXOB 2Z2JA 2L2QA 1XLTA 2RKBA 1E6LA 1XXHA 2DPGA 2QN9A 3KFXA 4S1PA 4TT8A 1JDUA 4G63A 2P35A 4LWOA 1N2XA 2DWPA 2WU1A 4E7PA 2NUPB 3B7GA 1XF1A 3RNOA 1MKYA 2FSVC 3ABRB 3P0IA 1FP1D 4FGZA 3C39A 1E2JA 4HUTA 1ZQ1A 2ZJOA 3H0KA 1RWOA 4WZBE 2QTMA 1K3TA 2P79A 1JHVA 3UAVA 5FPYA 4O2LA 2PT5A 1TEHA 4GPZA 3GCGA 4JT2A 3A11A 3C3CA 4I3HA 4DNPA 3RAFC 4HXYA 2JAPA 1YUMA 1E9BA 3AF1A 1EGHA 3WLQA 4L6IA 5JCXA 1RMQA 3S2YA 8ATCA 4LJ7A 2ZBEA 4Z3DA 5E1MA 5KNDD 3HCRA 4NYMQ 4MSUA 1AKRA 1NR5A 1TO1E 3KJZA 4G67A 4NPCA 2J30A 2V8BA 1DC3A 3BYZA 3JALA 4RENA 3UOGA 2B1GA 4E5SA 5TLSA 4TOIA 1QF6A 2A0XA 2NSYA 5LN1A 3CE6A 4M54A 2B8WA 3BKWA 3E9QA 1G20A 3N28A 4K6OA 3HL4A 4TTRA 4MVJG 4V0KA 2E89A 5K8CA 1JPVA 2ZR0A 1J20A 3G9QA 5LUBA 1N6PA 1EUDA 2EBWA 3DZHA 1CQIA 2J7PD 4IVNA 4OV6B 4FNOA 5IU6A 2GZDA 1XPRA 1DV1A 2NU6B 3GEGA 2J3EA 1FFSA 3QEMB 2Q6VA 1YS2X 2A2ZA 4AMVA 3H4MA 1DG1G 1JIUA 5CIQA 3VPSA 2ACEA 5DTRA 2YICA 5CDYA 1KH1A 3H3XA 3EHEA 2Z2YA 3JQFA 2OBNA 1EB8A 1R6VA 4OM7A 1UKVY 4YQEA 5IN5A 3WKCA 1ADJA 3IAM6 1VPEA 3CVUA 1ADCA 1N1GA 1PQPA 4D41A 3WDLA 2O8DB 1F3OA 4B8ZA 4I3FA 2Y2UA 4H4DA 4LCJA 1NAHA 3GARA 5B36A 3BKXA 1ODIA 1KL7A 1IHYA 1YJAA 1BCSB 1YS6A 4RTLA 4C2UA 1L8OA 3JQ8A 3IULA 1P2GA 3BIJA 3P9SA 4MIOA 1TIBA 1P2SA 4KR7A 2QLBA 3HZZA 2VJOA 1GV0A 1IM8A 5EP3A 5LWQA 5F77A 1Y1RA 1Q50A 3JQBC 4MLZA 3IEKA 2C29D 3UNXA 4TTQA 2OXFA 2PFKA 3R0IA 3VKHA 3Q3CA 4S1NA 3PNQA 1P0FA 1YK1A 1FF9A 1D7AA 4OGWA 4FYJA 1UZMA 1DV2A 1X86B 2BJWA 3NHSA 1UKEA 5LQAA 1JS1X 2I71A 4HFNA 2WSBA 4ZD6A 1NY6A 2PLNA 3R7SA 3LBAA 5LZ8A 2DQSA 3B2NA 4EFLA 2GAAA 3GPIA 1KC3A 1TLTA 2HQ1A 3JD2A 2WIAA 3OJOA 3M5CA 4HWTA 2EW1A 2FW6A 4JFAA 4NI5A 2ZREA 4RK0A 4Q47A 3ZD8A 3KYIB 1G3RA 1I8TA 2NX2A 2Q0QA 3E70C 4P83A 3KOZA 4RE5A 4ZQFA 3UKJA 1AMNA 2YNMA 3N2EA 4FUQA 4K88A 4KMSA 1ZHHA 4CV0A 1ZUNA 2ANCA 3T7CA 5J63A 3SF0A 4MUHA 3OQIA 4XUCA 5IMBA 4F84A 4XM2A 2VJQA 4DQUA 3GEMA 3H1AA 4MWTA 2R48A 2WSIA 3VTZA 3WKDA 5CXUA 3EVAA 2B99A 2C2ZA 4IMRA 2DSNA 4Z4HA 4OGKA 2ECKA 2VR1A 3PX7A 2FK8A 5FO1A 1NQXA 5A5VA 3A1DA 3IPRA 3AP1A 4ZQCB 1VG8A 4BTVA 4XRGA 3P5BA 2XYPA 3VR5A 5MN6A 2O19A 3GF4A 1BTOA 3SSAA 2YWCA 3H9UA 3NBMA 3WLOA 3SQDA 3I9NA 2AOUB 4NR0A 3I58A 5DM1A 2ZUCA 4CT4B 5FFNA 3IO3A 4JZYA 2OOKA 4YMWA 4IRUB 4HFJA 3VR5H 5BUSA 5JDCC 1DIBA 3SR4A 3COVA 2P3OA 4YONB 4V1CB 4RHTA 3CF6R 4KCGA 1TJNA 1A27A 1JE0A 4GH5A 3AB3A 5J5CA 1VSVA 4JBNA 5CFOA 2Q3EA 4OHUA 1QIIA 4W9NA 1Z82A 4LUCA 3ESCA 3IDSA 1CEEA 4YAUA 3OLVA 3LTEA 3C6YA 5AESA 3RUHA 1IBCA 2CZCA 2VSYA 3EB9A 3KSAC 4N41A 4J0GA 1JLLB 1WKVA 2QMZA 4G5HA 1IL0A 1G4AE 1R5BA 3JD0A 3OICA 1PEAA 5F76A 5JFOA 4FCTA 2OWDA 3DBRA 1X38A 3HB7A 5EKSA 4HDOB 5DGXA 3W34A 4YX9A 4AO7A 3QFTA 2I2WA 3GB9A 1LF5A 1SD5A 4QUIA 4WVFA 1EM8B 2R11A 3GAZA 4OGGA 3NUZA 2QW0X 4TWIA 5AKLA 1JN0A 1NBME 2A9JA 3F3KA 3HJRA 3BAFA 4RZSA 1WRBA 1MZPA 3HUFA 1HT0A 2J6IA 3V48A 1NUTA 2BELA 4DIDA 2J9XB 4F12A 4JJ4A 4O3MA 2GYVA 5TXGA 5IJZA 4Z9FA 1FTYA 2JFUA 3I01M 1GZ6A 1WNFA 2CVZA 3F0TA 1QG0A 3G8CA 4IL5A 4MR7B 1E92A 4DLTA 1GPYA 4FGUA 4KO4S 2WJPA 3VAZA 1BU5A 2F8MA 1C3JA 1PIWA 4NBKA 1Z0JA 3IIEA 5DT2A 1RLMA 4Z2YA 4L0DA 3V7WA 4UNRA 1M1YA 3HYCA 2FETA 2D3TA 3CX6A 3E1SA 1QRRA 2W22A 3PLNA 1H6BA 1KZHA 4A10A 1QG4A 3CPSA 2HMYB 3LYUA 4ACAA 1PDOA 2FOLA 1ZIOA 1QIJA 2FR1A 1Z6PA 4RTKA 5IH7A 1DRUA 1R37A 1X2EA 1O2DA 3NDPA 3LG2A 3KQQA 2D06A 1GTVA 2KBEA 4Q9AA 4YT2A 1EDOA 4QC2A 1NU8A 2WFMA 5JS6A 4AJ9A 3WGMA 1GZDA 3I6QA 3S6JA 4K05A 1C3EA 4WNYA 1WB5A 1EGMB 2JG3A 1EP1B 1GTZA 1OTYA 1G8YA 2DUUA 2P9JA 1EP9A 3OCUA 3OUTA 3PWKA 4UFNA 3ZZNA 4BAUA 2D13A 2OCDA 1N0WA 3HFSA 4NH0A 3I76A 1CUYA 1WUHS 1GQYA 2IHBA 3QLUC 4GSLA 2FZEA 4HQFA 5A4MS 2QOEA 1M2JA 1SVLA 2DUMA 2X8JB 4EPYA 5BSFA 4UCQA 3D3JA 4WBNB 2WU4A 1AM4D 1DHRA 2OGWA 2PX8A 2HKIA 1PT8A 4QBTA 4TXHA 1W1WA 1CUZA 1Y1KE 2RI0A 2VT3A 3M0EA 3QF4A 1X7YB 3ZV6A 4WY2A 4J6EA 5ALWA 3RPEA 4JJ6A 5D01A 4MPJA 4KP7A 3EJWA 2Z4TA 3MGGA 2H2HA 5G40A 3IJRA 2ZRBA 4JGIA 1VJ1A 1Z38A 3FROA 3GDWA 4I5FA 2P65A 4AJOA 5JJ5A 1XNRB 1BEEA 4K46A 3ZYZA 4NK5A 3H6GA 4HQ0A 3TOCA 4S2UA 1PBNA 4ZRNA 4KPFC 3WQRA 3RS0A 1N9GB 3CXUA 2UYGA 2O1SA 3LZ6A 4P54A 1KFBB 1ZGZA 4Q05A 4J4TA 1MD9A 3B13B 1FLNA 4FT2A 3TZCA 5BN3B 2WWYA 1SOAA 4G5GA 1PR4A 1RXEA 4JEMA 4GKAA 1YU6A 3FCAA 5DXAA 1GL7A 1ZLXA 3C6KA 3EEOA 1QX3A 2JHGA 3ZCTA 1XMPA 1USIA 1Z5ZA 1G7RA 2ZJFA 3HBNA 3MWLA 3ZKWB 1TCUA 4HNAB 1GQSA 2DM6A 2HHJA 1H2YA 2L19A 5L4LA 1CCWA 4HLDA 3VBCA 4HVLA 2PUAA 3H5LA 3U7QA 5ES3A 3QWAA 1Z8HA 4NZOA 2IS2A 2AF3C 4RLSA 3ZR4B 3MRVA 3K6KA 4LV6A 1CFJA 1HH4A 5CK5A 3RKRA 3QLEA 1VYUA 2DPXA 3F3YA 2QBYA 3IT3A 2PUGA 2NPIA 1OAOC 2Q6OA 1Z16A 2HRCA 3ZY5A 1H0RA 3B1YA 5AKIA 3RREA 2EZ4A 1RLOA 1QQ7A 1VYTA 3CMCO 3K2BA 1I7LA 1QF7A 3BD7A 3ZWNA 3MAGA 2W71A 2A0FA 3S1AA 3L8GA 4OYLA 4FGSA 4OXYA 1T29A 1UDBA 4P86A 5FOTA 4CR7A 3MS2A 5IJXA 1N36B 1SHZA 2I4RA 4KIGA 3K31A 5HF5A 1TD1A 2P2YA 4NKRA 1Z83A 2Q4TA 4KMMA 4NCKA 3KCQA 1HO3A 4R83A 1T0JB 4BNDB 4HTFA 4LWQA 3JYHA 3G0DA 1HZZC 4JVMA 5FR2A 3EGDB 4UBOA 1YZ3A 2YW9A 3I39X 2I99A 1FLVA 2ZK7A 3PF8A 4P7FA 5EMMA 4WEQA 2RBGA 5K6AC 1EBFA 3GRCA 3A10A 3LUHA 3A0RB 1N0IA 2G07A 2W2LD 4KDEA 1QHGA 1RCUA 4KR2A 3GN2A 3HN7A 1SFRA 3TZBA 2QD4A 2ZJ8A 2ARKA 1YIDA 1GD1O 4D3YA 4JUAA 1K7YA 2G70A 1S3FA 1OHHD 1X2BA 4JU8A 2Q7DA 2CJFA 5CAEB 4EUFA 1OX4B 4BB9A 2H7XA 4LMAA 1C1XB 3A6FA 4H35A 2PJRA 5HZMA 4YGXB 3I45A 1P39A 2JIMA 2V5AA 1TM1E 1OX6A 4JOBA 4IFEA 1W94A 1X74A 4AMGA 1DAGA 1KMHB 2YWEA 3LLUA 3M6AA 4M87A 5JI2E 4TYMA 1JHDA 1QGDA 3WOVA 1W93A 2ID4A 5EMJA 1DAMA 1ZMOA 2BFAA 1LFDB 3DCJA 4XDHA 5ALGA 5BN5A 3WWPA 1DWOA 3PHIA 2XGGA 2WIJA 5FX2A 2VBFA 4UM9B 1Z7GA 2OB1A 3OH8A 4YRDA 3OJXA 2CF6A 4TXMA 4PZCA 1NBAA 4EPVA 1KXZA 3ISVA 4KXUA 3DG9A 4EUKA 1YF3A 2FQQA 4G9BA 4Y2VA 1FUUA 1NXQA 5FA6A 1X9HA 5LB4A 2NU7A 3D6NB 5KINB 3OF2A 3F71A 2B8TA 1VKNA 1PNTA 4JJKA 5GGYA 3TNLA 3ZV3A 2AN5A 3T9AA 4N48A 3ZS8A 1T1EA 3TDKA 4GP7A 4BFCA 1ZYUA 2WTNA 1HORA 2YBEA 3JWIA 5FORA 1JR3A 2QJWA 1MJNA 5BYBA 1PR2A 2NXJA 2QM7A 2R66A 3ETNA 4HGPA 3RIHA 1MTOA 4BFXA 4DIEA 4BO9A 1KAHA 4QXOA 4YPFA 2DBYA 2EKPA 3WRYA 1R0KA 2QDKA 3RASA 4F38A 1PFQA 1QIFA 2I2AA 4RFSA 3Q7PA 5CB4F 1ULBA 3L77A 5K8TA 4W5HA 3GLIA 4ODIA 2VJDA 4X94A 5CGZA 5M29A 2JHPA 4CG2A 1SUWA 3NPMA 2BGLA 1XZIA 3PQ5A 4XGIA 4X93A 5CB0A 2C5EA 2AD5A 3IP1A 4FONA 1RNLA 3CLVA 1ZR2A 4UHJA 1PFUA 1O6ZA 2XNCA 3GX1A 1ORRA 4KAJA 2R9VA 2WYWA 2FDXA 4J7CA 3EMVA 3RHSA 3KYJB 3HP1A 3LOUA 5GQSA 1B42A 1ONPA 2SKCA 2RKWA 1JP7A 1WEKA 4H7KA 5IKPA 3O75A 4NVRA 2P5YA 4ZQIA 1DU4A 1NMYA 2ATIA 4LPKA 1V4VA 4MP8A 4Q1CA 1W85B 4XDGA 3O26A 5SZIA 5TS3A 4FDUA 3GEDA 5GVRA 3NW9A 4II2A 4DEYA 1VA4A 4EA9A 1QH9A 1MJFA 4M8NE 3ROQA 1GG9A 4D9EA 1IY0A 1CZHA 3BMCA 3BWCA 3EJ6A 4HGOA 3VZBA 1SELA 1QGAA 1VLHA 2C4UA 4IH1A 1DQNA 3D6UA 4LRSB 5TVKA 4DCNA 3IQGX 3MFYA 3EUAA 2DFNA 4KQKA 5AIBA 5L3SA 2NQ8A 4TSFA 1UDRA 3FDZB 3LFUA 4KE6A 1J0CA 3TLEA 3U09A 2C7QA 1SXGA 1SB8A 1IQUA 4RHYA 5CPFA 3QPVA 4GKVA 1E5LA 1LTKA 5BSTA 2Y9MB 3JQAD 4K8OA 3TJMA 1Z4NA 5JASA 3H17A 1IC6A 3HQ4O 2AF4C 2IEYA 2ONYA 2VHJA 2Z3VA 3IPLA 4HGQA 1V0JA 1PVVA 2FPIB 4RL4A 4W1QA 4ILKA 3V55A 3WYEA 3DEZA 4TMWA 1MTZA 4ZT2A 2DP4E 5DZSA 1K66A 4MUEA 4PC6A 4X8OA 3P97A 4HN9A 1HFWA 2NO4A 3ND9A 1N5JA 1SBHA 4KR0A 4EW3A 5FP0A 1GAWA 4GW3A 2Z9CA 4IIGA 4L95C 5HK8A 4G89A 4RMNA 3AWDA 1Q17A 4IIVA 5EIOA 1GEEA 2YINC 1JU9A 3M7IA 4B3XA 2XECA 3GAMA 4KXVA 2Q49A 4PC7A 2JCSA 4R8MA 2D5BA 4MV0A 4QPDA 5KO2A 3O9MA 3QSYA 1RDFA 4GM4A 4D8YA 3TQCA 2QU8A 4B6OA 1P91A 2FZCA 5F33A 2OV6A 2ZYWX 1COWD 4TMFA 4QRIA 1S7CA 2B6NA 1O9HA 2Q21A 3K2QA 4LC1A 4A4DA 5CDSA 3IXMA 3PFKA 1F6BA 2MR6A 4J75A 4LYDA 1KNXA 4NV1A 1F12A 2PLWA 4YLEA 2XVMA 2I7VA 1R5JA 4TZ0A 2EYUA 3K4HA 2DFDA 1FQKA 3F5DA 1ZOLA 1DHTA 3BILA 4PRKA 4DCSA 5AVXA 1JDPA 2IXBA 2C0PA 2XNKA 4U1RA 2IHJA 3LZDA 1ZOPA 1KK2A 3CUYA 4GXNA 4IGAA 2J5RA 1H0KA 2VWPA 1QAOA 2FF5A 2JJYA 1C50A 1DIGA 1IBKB 3ZX4A 5B3JA 3N0RA 4EF4A 3CY6A 5IULC 3L49A 3TIIA 5BV2P 3UEOA 5BWCA 4YASA 3GBVA 4DKJA 1Y3FE 3T7JA 1OFGA 5KKCA 1CKEA 4JQSA 1O54A 4ZU6X 1OPRA 3K0AB 1I80A 3T38A 4POOA 2ZUEA 3LHSA 1OFUA 1DIHA 1M5UA 2NIPA 5DM60 1P1KA 3F7NA 1PKEA 4M22A 4F6CA 1RRMA 3OZEA 4FILA 5ALPA 4IGKA 1SCUB 4I4TA 4S05A 1OR8A 2Y0PA 5DHQA 4DR7B 1LRKA 4X45A 1P6QA 4RJKA 3VPDA 4V1CI 3PJDA 4X7PA 1TVCA 1TI7A 1A96A 2E5FA 4HEHA 1T2FA 1YZUA 3JWJA 1ZRMA 1BOFA 3I2GA 3O74A 1KWGA 3VNQA 1CEYA 3IYLW 4PAQA 4DWOA 1XEWX 2CDCA 4ONEA 1GZ3A 2ZE6A 3KRTA 3W2FA 1UEJA 2H5EA 3KBBA 4L1KA 4GMXA 4BWGA 2H1VA 2R7AA 1VMDA 2GA8A 1J90A 3ES9A 2VUIB 2G67A 1WVGA 5TQ0B 2Z3ZA 4TYYA 2P7HA 4D4IA 3G8BA 5F5LA 5A1JA 1SY7A 2Q2WA 3CLRD 2O5EA 4FJ2A 4L76A 5L7TA 3DW3X 2C5GA 1E0KA 2BMAA 1SVSA 3NZEA 4DQ0A 4HVTA 5K3CA 3VYRB 4ZOLA 4Q4AA 2QE6A 1V2GA 4LXHA 1CUGA 3KU4A 1YZLA 4N76A 5CX1A 2IZ0A 2QAJA 3KD3A 2FJPA 3OAAA 4HB4A 3TAUA 5IX8A 1HX7A 4XWYA 2IYSA 4IYRA 3FHTA 2HBRA 4MAAA 2H6EA 1N2OA 4EKGA 2VJPA 3C6QA 3CN7A 1EZ1A 2JGRA 3DWGA 4MUNA 3O0DA 4N8DA 4ZA2A 4B40A 3P9CA 2WT8A 1P72A 1T2EA 3DBVO 3DLPX 5KREA 1P2BA 1KQOA 1CNFA 3C5HA 2B5WA 3L6BA 4X1KB 1NXSA 2C82A 2PUJA 5K1ZA 3LNTA 3NC4A 1YB1A 2P9TA 4BZPA 5HS6A 4KMOA 4JUDX 1C0EA 1H2XA 3FMFA 1P2VA 4IEIA 2VH5R 1XJ5A 1OI3A 3E1GA 4KE9A 1LW6E 4NCHA 1T6YA 4UVDA 4BVEA 3WGIA 5ILOA 2W2PA 4FNGA 4DLBA 3JD4A 3GJ3A 5FJIA 3N0TA 3EMBA 3K7EA 4MICA 3CYFA 5BRJA 4Y2TA 4JUBA 1WUKS 4YV7A 2HQOA 1YR9A 4QAJA 1NE7A 3MGCA 1BXGA 2VNAA 1IHUA 4JJEA 4OOFA 3A3PA 1S6YA 3EA4A 3NEJA 4AUKA 1F6WA 1C1DA 2AR0A 2XXJA 4N40A 3ZV4A 4MQ6A 3NIDB 4A8JB 2CNWD 3DLBA 3TVYA 1KZ6A 1DTSA 1I3MA 3JTEA 4E2ZA 1C9NA 6ADHA 4EFKA 3IPXA 1N2GA 2G17A 1R4NA 3V2UA 1ZCFA 3HDVA 2R6GA 1E9RA 4MYDA 2Z1MA 2ZRMA 2D1FA 1Q7BA 2QPLA 1TU4A 1PWHA 2O4CA 2GETA 3L1KA 1WX1A 5D85A 5BR8B 3KKZA 1C81A 2LKCA 3MG9A 1T8TA 2Q46A 4KYVA 3UAGA 2ZRAA 4MYHA 2UZ4A 1OUMA 5D7BA 1KKLA 1W6UA 2ZRJA 1RJGA 2J4DA 2DWOA 3IOYA 4HB2A 1U8YA 3CJTA 4R8LA 3ETCA 3R6DA 5AKHA 3WA7A 4UBLA 5IT4A 5FO0A 2QVZX 3Q9NA 2AA3A 1Q57A 3T3IA 3VJKA 1NOJA 3EX7C 3SS9X 1EJ2A 4YLGA 3JRXA 3NQ41 2LR0A 1CRQA 1L5NA 1GQRA 3G8YA 4R9SA 1W49A 1OQAA 2OV2A 1KMQA 1XWIA 3JZDA 5TVGA 1UPAA 3TTSA 3RBVA 2V9ZA 1F2TA 1IOLA 1ORVA 1QQ6A 2XQKA 3G5UA 3Q9SA 5FA5A 4C6RA 3NBYC 1BS9A 2RIPA 2V7TA 4RK4A 4NWIA 2G5GX 1M66A 2GFIA 4LWZA 3R5HA 4DMLA 1ZS9A 3WIOA 1KSGA 2QRVB 4EG3A 4KRGA 3IBTA 4FJ1A 1AX9A 3IE2A 5BMVB 1Z6AA 1AKNA 2V4UA 3UJ3X 3VR4D 1ZCAA 3C1UA 3WRVA 2O6HA 4F97A 4A1OA 4FEAA 5B1EA 1L4UA 3MTGA 4FFNA 1CU1A 1SVUA 4HD8A 1HLDA 2BGWA 2C9DA 2FZGA 1Y89A 1JNXX 2LW7A 4DA9A 1UZUA 2WLTA 4E15A 4E5KA 1O96B 3GDOA 3QWFA 4BKRA 1WJGA 1Z17A 3CKMA 5HUHA 4P38A 4TV9B 3TIXB 4O4HF 2DPMA 1NE2A 4CGZA 3J80A 3BSWA 4G36A 1W8IA 2WMDA 1TVKB 4XH9B 2NVUB 5LB2A 5CCXA 1YKFA 3OPVA 5HKKA 2GUWA 5DK4A 1T1JA 4U39A 1OXVA 3WL3A 3ZWBA 4LECA 4EIWA 3E5RA 3N8HA 3OX2A 1L1EA 3Q0IA 4BLOA 3W5UA 3DNMA 1RJDA 2C95A 2OXTA 4AW9A 4GU5A 3MINA 3EEQA 4IO0A 4XCXA 1HURA 5EQJB 1SG9A 2QX6A 2Y77A 2C92A 4JQZA 2W6QA 4LXQA 5TGDA 3ZOKA 2VP2A 5JNWA 3M3PA 1M6YA 2Y1CA 3R6TA 1HDRA 3NOQA 2CHUA 2DFLA 2MSEB 1WP9A 3O7MA 4LVUA 5LBUA 3SZUA 2EATA 3VOSA 3WLFA 1CRPA 3WWEA 2O8CB 4EAQA 5LJIA 2A1TR 3A1SA 1KSHA 1JQLB 1ZCZA 3C8DA 3LPDA 4RS4A 3P0EA 4EHLA 3PFCA 4YQYA 1SPBS 1L3CA 3LUFA 3DE2X 3HLYA 3ASZA 1OXTA 2D59A 2OBMA 4WKPA 4Z99A 2VT7A 4P5PA 1VPTA 4MKHA 4L3VA 3F49S 3U4CA 5ALIA 3EQ7A 1A7AA 5DV9A 1GFSA 3GJQA 1Y63A 2C2HA 4EMTA 3VNUA 1FDUA 2R47A 5KNBD 2XW6A 4B35A 3HKEA 1HLPA 2Q07A 5KOJA 2HXYA 2R8ZA 1JTEA 4LYFA 4QYTA 5DLDA 4UTRA 4MR9B 2AOVA 3DZFA 3HO1A 1P5ZB 1TK9A 1FNBA 1CR0A 1SBZA 1IN4A 1UPFA 4KIFA 4O2BF 3R9XB 4L0QA 3UJBA 4CKXA 2VDQB 3B89A 3BMOB 3I2KA 3FIJA 3ILYA 3V1TC 5DLPA 1Z2PX 4DDUA 1R6AA 3DCNA 3KSZO 3OOSA 1KZYC 1TNDA 1LX7A 2JIZD 1M7GA 3BZWA 3E9MA 3PLAE 2GNPA 4F4FA 1AMUA 3KZVA 1KRXA 3PC8A 3I6MA 4LE1A 1NSYA 3KXLA 1TQDA 2V7QA 4KXNA 5EGNA 3JQDA 1A69A 1K3UB 3OQOA 3MTQA 1KEKA 2C1XA 1U0TA 3C4QA 1Y8ZA 3GR6A 1PG2A 3VFDA 1MNAA 1G59A 1E9FA 3USCS 2ECQA 3OZDA 3THYA 2PX4A 3A4VA 3INTA 2OAQ1 3OPNA 1NW5A 4MYRA 4RLHA 4YNBA 1WUYA 5JVDB 4NQRA 5FTWA 1Y6GA 4V39A 1HNXB 3BRSA 2X1HA 3FOEC 1LDGA 2VA8A 1VJCA 2BFCA 3DTVD 1QH0A 4YJHA 4LYEA 4C78A 4YRZA 4Q6WA 4DDVA 3EZ6A 3A2KA 2O7QA 3LX5A 3F9CA 1XXHB 3W4JA 3EASA 3WAGA 3B5JA 1NJ8A 4A82A 1IJBA 5DB4A 9GPBA 3RSHA 2P0AA 1Q92A 3K9LA 2AQHA 4ESHA 3STVA 5AP9A 4KBFA 4UXHA 4GL2A 3DMPA 3U3OA 3H11A 1I3KA 1NJFA 5I9NA 5DTJA 4OLJA 4QTTB 1C3VA 3DNFA 4ZT7A 4BLSA 2NXNA 3ND8A 5IVKA 3CUUA 3ZQUA 3T5PA 5H3LA 2HU2A 2V55B 1BWPA 1SXJA 3G8DA 3BGDA 1QVZA 2GEJA 3NONA 4H4EA 2GLTA 4IX1A 4DG8A 1KZ1A 5DISB 1LBTA 3AVYA 2UYOA 1Y3DE 2HC9A 2V0CA 5JATA 4YUVA 4I1PA 4UASA 3JALB 5KYNA 2OAP1 3WK4A 3TO5A 4E33A 2OQVA 2HYIC 2CFIA 3R7FA 3S68A 2EFGA 1HEYA 4JLSA 2BR4A 2CBZA 4C6SA 1G20B 2QX7A 3QEBZ 2BN4A 3DE7X 3H7IA 4DMUB 4C5BA 4Z7NB 3OZTA 3ZBQA 5JCPA 3FGNA 3UF0A 2RG7A 1IK6A 4XGNA 3ZXUB 5EP1A 1EUDB 1NFQA 5AH0A 4ZHQF 1CQIB 2WJ6A 4R5HA 5DGDA 4C0SA 2JRLA 4OL0A 1E1CA 2IZ1A 2CUTA 2JVKA 4L3OA 3WICA 4BFWA 4XUDA 5DEOA 3FHOA 3WK9A 6YASA 4BE4A 3AI2A 4LCBA 3DDZX 1RAIA 3T54A 1NRIA 2CK3A 1E8DA 2ZIZA 5K3EA 1QIDA 1U4SA 3ZDQA 1EK0A 1LUAA 1HNNA 1T0UA 5I9BA 1J22A 2W42A 2H92A 1G5PA 2GN1A 1FFGA 5F21A 4BO2A 1PL8A 4HSGA 4WFJA 4ENQA 4OBEA 1EWKA 1GL3A 4BZQA 1RQGA 5IKOA 4ZICA 4ZCLA 2FUKA 3JQ8B 2BISA 3RVRA 5CEEA 2Y4OA 2QD2A 2QW1A 4QYWA 1SQFA 2YVKA 2IH4A 1SPXA 3GT7A 1J23A 1OFHA 1PSWA 3V8PA 3LY7A 3Q7IA 1JKFA 1NMSA 2QGNA 2RAPA 2QN1A 2A5FA 2Z1NA 3D8HA 1FNCA 3EHDA 3OM1A 1H85A 4IWNA 4QOEA 4URZR 3M3DA 3M4YA 1ENZA 1KO8A 4FHGA 4N7RA 2CJWA 1RTKA 3BH6A 2CJXA 3NRCA 4LZNA 1Y3AA 4QXPA 1WSBA 2HPAA 2GO7A 3G2LA 3UHAA 4U00A 3T1HB 2UUAB 2BJHA 4Q3BA 3U9TA 5BQPA 5B4TA 3QFRA 2I4TA 3U4HA 2FSPA 3GFFA 1UJ6A 3OU6A 4IJKA 4MK4A 4Y9DA 3SGLA 4A8PA 3A25A 3MHPA 3HE3A 1SXPA 3CW9A 1QR2A 1Y5NA 2YJ5A 4O1MA 3CF4A 3FSGD 2ZYRA 4DV2B 5ICEA 3O1HB 1ZUNB 5LL6P 1YR7A 2B7LA 3RFXA 3OQIB 3NDBB 1YZTA 2QP9X 3P9YA 3GUCA 1T8YA 1SGWA 3C41J 4DLUA 1PR1A 3BTUA 4HEA6 3BE6A 3HY6A 5BSGA 2BMFA 5IM4F 3ORYA 2FG7C 3S2ZA 4HG2A 1NY5A 5KQRA 1AN0A 4OHPA 4QECA 1O08A 1GPBA 1RI1A 5GONF 5IZCA 2AVDA 3A9WA 3DTTA 4HFRA 3L3BA 1G6OA 5JSYA 1RYZA 2CDNA 4FNMA 4NS4A 2G25A 2O5RA 4IV8A 3RU9A 3T95A 4CR8A 1GQQA 1OE0A 5F2OA 1RYBA 5HSGA 5F3RA 2YQZA 5LA6A 1T5BA 4UHCA 1DJLA 3LFHA 1FDVA 3ZWMA 4BVHA 5AW2A 2C7OA 2YJGA 2QN8A 2JCXA 2Z4SA 1DQRA 2GPBA 4G9EA 4C2BA 1K8YB 3PFFA 1Z7EA 5AW6A 4NMWA 3CTMA 4BB6A 4CMGA 4G0QA 2ZT5A 3GJTA 3I5AA 1MX3A 2V96A 2X4IA 4NCJA 1G8PA 4WERA 3PPVA 4A8JC 4R40A 4IMJB 1JW9B 1XELA 5FLXA 4TYWA 3WMWA 1CIJA 3EPHA 3NORA 4ZDKA 1ZW6A 3OC6A 3DBRB 1NZJA 2CB0A 3SYMA 1C29B 2WSSA 5CH5A 2XIQA 3HB5X 3WS7A 3PUVA 4WZAA 1B8OA 1R8SA 2G4LA 3UV6A 4Q1EA 1W6RA 1DKOA 4CGYA 1A9QA 2O5CA 5K0JA 2HGSA 2IKSA 3KM0A 4YJKA 2VJBA 1KYZA 3OQVA 3O31A 1BAPA 2JCBA 4NE2A 2RHDA 4IWXA 4Q7EA 3W78A 4QZVA 2AOXA 3ROKA 5KWIA 4BLVA 2A84A 1ZJJA 8ABPA 4I1VA 5EQTA 1MMFB 4KQIA 4J2HA 4RTOA 2ZUFA 1W7AA 4G5QA 3H13A 1SBCA 2G9NA 3U1BA 4Q12A 5JXHA 3EIEA 3CVVA 3Q11A 1M1YB 2R8BA 4Y0VA 2V5VA 1O4WA 4LNUA 4G1FA 4I6GA 3PR2B 1EFTA 4M1EA 3O8DA 4YS6A 3MPOA 1E2IA 4D0NA 5FFMA 5BP7A 4FFPA 3PGKA 4P0QB 1U3GA 4KU4A 2VPXA 3TQQA 1YMQA 3NP7A 3Q7EA 3TDNA 4GP6A 4YUWA 4A92A 3LWNA 2XJ9A 3HSSA 3OLZA 4MP3A 2A9PA 2NSDA 2ET6A 4RIEA 1RVDA 3EOAI 4OBXA 1JSXA 3VPFA 4RGBA 1NASA 2ZBDA 3C8UA 4B85A 4CU5A 5K01A 2OCYC 4QT4A 1ZSYA 2R68A 3I3OA 3KEGA 4UUNA 3AU8A 4HRAA 1M33A 2Q6TA 1QBGA 2H59A 4OK6A 4QARA 1CUVA 5IBRA 4PBTA 2WJZB 3NYIA 2QL9A 1VMKA 3ETEA 1F7VA 4Q1FA 1JAZA 2GT1A 1CX9B 2BGKA 2XDYA 4G0YA 1C30A 1KK1A 4HWOA 3RFTA 2IQIA 4PNHA 4AJ1A 4CXMA 2X5NA 3QF4B 2J9FA 4NEGA 5KZMB 4JL8A 3GJZA 3TZLA 4EHDA 3OPQA 2RH8A 3ZWCA 2VRNA 5K0TA 2ZI6A 2PGOA 4A5OA 4F8JA 3AVUA 4I4NA 1FTSA 3AZOA 4EHHA 3FMIA 3CNNA 1ZI9A 2CV2A 2JDID 1XRQA 4OP3A 2JFYA 1I1HA 2Y93A 3AEXA 3AHJA 3OECA 5AYVA 1RABA 3P2JA 4AJKA 4RABA 3UMRA 5ISMA 1YZGA 4KIJA 1SCDA 2FLVA 2F00A 3EEFA 2EFEB 1CY6A 4G5XA 4MWBA 4R0VA 5DT9A 5HCUA 4B74A 2ZM5A 1YFJA 2GHQA 3JQGA 3EDCA 2OWEA 3RC3A 4ETIA 4FZJA 3UA4A 2RK6A 3TG8A 1HC7A 4ZRDA 3REFA 3GP3A 4OLBA 3VGJA 4FDLA 4KBGA 2GVNA 1E2HA 2XKKA 3KEFA 2CEAA 2Z09A 4WCFA 5E38A 3DYIA 3I1FA 4E30A 2DHDA 2O20A 721PA 2W2QA 4H1TA 1B3RA 2FW9A 2YJTD 3ZHRA 1YZNA 4UHFA 2PT6A 4QSHA 1DC6A 1G8AA 1GKIA 3P32A 4P32A 3U7QB 3EWNA 1A7UA 5GM2A 1R1DA 2QBYB 3DTNA 1I01A 4O4LF 1FVXA 3Q3VA 4UVIA 1VL6A 2IYZA 2CNKA 3PQDA 4HAWA 3G88A 1I2ZA 4NFSA 5IJAA 1TB4A 2CHEA 3O3OB 2HU5A 3VZCA 1E1KA 1LDYA 2EZ8A 2BGJA 2IPXA 4LBWA 3S1AB 1KMMA 4CETA 1D2RA 3LPNA 3R09A 1DEXA 3LF1A 2JKYA 4D56A 3VNAA 1W34A 3GJ8A 4BLUA 1JDJA 4FSHA 1Q74A 4RA9A 4EB6A 1BMQA 3OFND 4HTFB 1AS2A 4KNVA 5A03A 3OHMA 3JAWA 1U0JA 1ULUA 2F3SA 1H2AS 2VDKB 3ZGXA 1QKKA 2YHIA 3LBIA 4PRZA 1JJBA 1RFLA 2VF4X 4OK3A 1TGVA 2DLNA 1AMOA 5I48A 3INGA 2BEUA 3I5MA 4HRYA 1E2NA 1JX6A 1ZL0A 4NIMA 1Z0KA 4QGBA 5K8JB 1YFLA 3HCEA 3RYTC 4FIZA 3T7EA 4M1SA 1AB6A 4MVXA 2DULA 4RZUA 2K6GA 4KK4A 1B0ZA 2GJSA 4P98A 4JVNA 1DBWA 4LGVA 3TAHA 2EEPA 3KPVA 4QHYA 3LQQA 8MHTA 4CN8A 4MO9A 4F04A 4D8UA 4GBMA 5CIYA 2QMOA 5LM3A 5KDLA 3WRXC 3C2QA 3ZJVA 1UZLA 1NM5A 1UPUA 2AMFA 1I13A 5LQCA 5E3HA 1XLTC 3E22A 4MB6A 3ZHVA 1MHTA 2FHSA 1OLUA 1FK8A 2OFOA 2XAUA 4KQ6A 4KUEA 1LCIA 1NN5A 3L1IA 4MIYA 5BN5B 2IU0A 2J0SA 3MS7A 2WJGA 3O91A 4OHKA 3WFZA 3GLQA 1XDBA 1FX0B 1OPXA 3GVPA 3OFSA 3WNBA 1FDOA 2BUCA 4I14A 4EBFA 5TIIA 3ABZA 3LDUA 1DAKA 4EVQA 4Q02A 3NEPX 1ADFA 3WK5A 1FNDA 1NHWA 4DDMA 1L4FA 2NZ8A 2NU7B 4DKXA 1TUGA 1IUPA 5CVCA 3FOBA 1VKOA 1T13A 3P4XA 2VHQA 1AO3A 3EFOA 5JQWA 3P0FA 1ZBDA 1RWWA 2YVLA 1MHPA 2PGDA 4YRAA 2PD4A 3UHPA 2R6CA 1E77A 5HKAA 4CLRB 2YZMA 4X9XA 3WGHA 1NX6A 1WMEA 2HSGA 2M32A 3D7KA 4CM4A 1XMIA 4A15A 1GV1A 5C51B 2IEAA 4URWR 1E5TA 1Q0ZA 2AQKA 1Y8RA 1DBSA 1DP4A 2ADFA 2PCLA 2QVLA 3BGVA 3GHHA 4PBRA 3MWFA 1M73E 3CMMA 3MCTA 4RFSB 2VHEA 5FOQA 1EVJA 4M49A 4XQ0A 2XZPA 3GLIB 1T6XA 3ANSA 2O3RA 1UT8A 1JEOA 4QUJA 3B6JA 1CUWA 3LBFA 4CEJA 3I3SR 2X3YA 4ID9A 5IC6A 4F56A 3QHPA 3WYNA 2D0IA 3MN1A 2Q45A 1P9NA 2FEKA 3CHYA 4Z3KA 3TDMA 4AQ7A 1QLHA 1F4VA 2G63A 2NYRA 3BMXA 3GFSA 4M46A 3FR8A 1IQ0A 1W88A 3N0XA 2QKYA 4F93B 3SBXA 4AYWA 2XD4A 3DQPA 4ALIA 2NU9A 1Z62A 4LY9A 4Y0AA 4K1LA 5FYQA 1QO0A 1ZM4A 3F96A 3CH6A 3KELA 2P69A 4LC0A 3JQFC 1U11A 3AB8A 3EBLA 2D74A 4TL7A 2EZTA 3UICA 1U0RA 5GTDA 3B51X 1E7SA 1GZ5A 2MTBA 2V97A 3LWDA 4M0LA 1IPEA 4P4SA 5ADHA 1V25A 2RHGB 2OZKA 3GP5A 1VFNA 3NTQA 3BE4A 1EXDA 4GZMA 4U8HA 1DAPA 5ALRA 5E9AA 3GFPA 2JGAA 4L5YA 5G0UA 3OZFA 3BMCB 4N3NA 4R2LA 4BDTA 3TECE 3GAFA 5F4ZA 2WJYA 1M0EA 1R8YA 1T0IA 2R7KA 2WRZA 3NRBA 1VXRA 4YDSA 5L3SB 1IDOA 1PGJA 1MQAA 2HPVA 3KZMA 5CX4A 2Y3IA 2I4MA 2QJOA 3W9YA 3WLPA 3QKIA 1JG7A 1EE2A 4Z0NA 4J7XA 1INLA 5B7NA 1CXZA 1OJLA 4B4OA 4S35A 1CR2A 2WIFA 3N2YA 3YASA 2J3IA 3NDRA 4BNGA 4EJMA 1DRKA 1UPCA 3AILA 4BPBA 2J41A 4GVPA 3T7TA 3EYWA 2AEMA 1FU7A 1ZG3A 2OZEA 3HNRA 2HA2A 4GWKA 5HRAA 3HA5A 4BVBA 5ED4A 1VHTA 2RE8A 1FNMA 2NP6A 1XT6A 1ZEMA 3QU5A 1L5OA 2O8BA 5J4YA 2M98A 4M9RA 4IQ8A 4MA5A 4FBGA 2ZJ1A 3SF8A 2VHWA 1ISJA 2JFOA 2PZBA 1UZNA 5AJVB 3UWMA 2YNMC 1PDWA 2WUFA 4L9RA 4NESA 3UAXA 1QP7A 4L8FA 5UKDA 4F1KA 5JY1A 1MEEA 1P4JA 1SAYA 3R40A 3W6OA 3V1KA 5GADl 3KQMA 1GRCA 1KJ8A 4Q1BA 2LWIA 5T4BA 1ZI6A 3Q1KA 4K9OA 2AFHE 3UY4A 1SUPA 5K5EA 2GZ2A 5E8JA 5HJ7A 4FM9A 4FMBB 1JAXA 3QUTA 4BMPB 4EYKA 1BKDR 5B7GA 4HJXA 2ZDHA 2W8ZA 4KN9S 4IIJF 1ENYA 1CFZA 3IT0A 1AUVA 4DV7B 3HXTA 4B3RB