3D3NA

Crystal structure of lipase/esterase (lp_2923) from lactobacillus plantarum. northeast structural genomics consortium target lpr108
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
273
structure length
245
Chain Sequence
MQVEQRTLNTAAHPFQITAYWLDQISDAVDYPIMIICPGGGFTYHSGREEAPIATRMMAAGMHTVVLNYQLIVGDQSVYPWALQQLGATIDWITTQASAHHVDCQRIILAGFSAGGHVVATYNGVATQPELRTRYHLDHYQGQHAAIILGYPVIDLTAGFPTTSAARNQITTDARLWAAQRLVTPASKPAFVWQTATDESVPPINSLKYVQAMLQHQVATAYHLFGSAIWPQLALRWLQEQGLLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative lipase/esterase
publication title Crystal structure of lipase/esterase (lp_2923) from Lactobacillus plantarum. Northeast Structural Genomics Consortium target LpR108
rcsb
source organism Lactobacillus plantarum wcfs1
molecule tags Hydrolase
total genus 74
structure length 245
sequence length 273
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3d3nA00
4BP9A 1TCAA 2JEZA 5EGNA 1DU4A 4EY5A 5K3DA 1XKTA 4H77A 2VT7A 2QXTA 2CBGA 2QKYA 1QFMA 3FLAA 4NVRA 1ODTC 3I1IA 5LLSA 2XUFA 1J07A 4FWBA 4OU5A 4QA9A 2D5LA 2GZSA 5BWCA 2B4KA 3QH4A 1R1DA 5AM1A 3AZOA 5JALA 3T52A 1DINA 3R3UA 1UT6A 1CUSA 3PUIA 1XROA 2XMRA 5JAOA 4J0JA 1AMNA 4MYSA 5AI0A 4DNQA 1EB8A 1T2NA 1MX5A 3WKEA 5K3EA 5AKKA 5FP0A 2RHTA 5AKLA 3FLEA 1MO2A 3O95A 2AXEA 3SWWA 2ZYHA 2CB9A 1EDBA 4Y2VA 4W1RA 4W1QA 3KXPA 1SCQA 3KWJA 2WSLA 1H2WA 3BIXA 4BCCA 4IO0A 1FFCA 3JW8A 3VJMA 4LYEA 2OXEA 2OPHA 1RP1A 3DDUA 3DKRA 5T4HA 3UUFA 3R3XA 3WJ2A 4DM7A 2BGNA 3I2IA 5ALPA 1JJFA 2AJBA 5EHQA 1XZJA 3ESDA 1JFRA 2PPLA 2FJ0A 2DHEA 4LXIA 2IIVA 4QDTA 3F67A 3A2MA 3AIMA 1X2BA 2WJ4A 3HEAA 1XKLA 3AINA 1K8QA 2PSDA 5HZGA 5ALEA 1GT6A 1LPMA 3FWHA 2WG0A 2JGEA 3SK0A 4A16A 4B80A 4G5XA 4N8SA 5A62A 1UFOA 4J03A 5K3CA 1EDDA 2FUKA 2XUDA 2HA4A 4C89A 2ONCA 3QYJA 3F9CA 3OOSA 1OXMA 4U2DA 2H7YA 1F0NA 1XRQA 2C7BA 2XT0A 1K63A 3G0DA 3IURA 4G4GA 4ETWA 4WCVA 4H0CA 4BTLA 2BUBA 3IUQA 1HLGA 3WWCA 1LGYA 2H1IA 4ZREA 3V9AA 1DX6A 3R3ZA 4Q1VA 1WB4A 2OCGA 5LZ8A 3V1MA 3G0IA 3R0VA 5AI9A 4EA6A 4WY8A 4CCWA 2CUTA 2V96A 3HLKA 4BYMA 1L7RA 3O4GA 1QGED 2CMFA 3WMRA 5AJHA 1XZAA 5HF9A 4N5HX 3FSGD 4WY5A 3NOXA 1SCKA 2VJAA 3IULA 5JASA 2O7VA 3DL7A 4UUQA 3B5EA 1CUAA 2HIHA 4L72A 2V9ZA 1MAHA 2DHCA 1UXOA 4LHEA 5LIPA 4LXGA 1MNAA 1LZLA 4J0DA 5HF8A 2B61A 1FJ2A 2VJBA 3HYSA 3C87A 2ACKA 5D3KA 4UBIA 4YPVA 1XZCA 4M0FA 3AZPA 4I3FA 3TJMA 3IUJA 3GZJA 4BDSA 4MYDA 1A8UA 2WUFA 5A6VA 2ZYSA 1VA4A 2WIDA 1QTIA 5T4EA 2QUAA 4Y2JA 1K6EA 3IIIA 1HL7A 2VJDA 3M83A 5HKBA 2HFKA 5CBKA 4X90A 3CN7A 4MQLA 1CUCA 4Y2XA 3VVMA 4KE6A 1MAAA 2OQIA 3T4UA 4XVCA 2XUGA 3FLBA 1R9NA 4AB1A 1UOQA 5AKEA 1BCRA 5FDFA 4OD0A 5I7UA 4PSDA 5ISMA 2X5XA 1BEEA 3BDIA 3A2NA 2C5FA 3LIIA 2XMGA 5C8VA 3STYA 5FRDA 2GYVA 3B3QA 3F8SA 3WK8A 5ALZA 5LYYA 1ZI8A 1JT2A 3FVTA 3U1TA 3STWA 5CT6A 1N5MA 4L0CA 2XLBA 4OUKX 5AI8A 2WFLB 5AHXA 2I3ZA 3AFIA 1QIFA 2HA2A 5EHZA 5CT8A 3I2KA 3LIPA 3HZOA 1CUZA 1H23A 5AI5A 2GBIA 3WYNA 4B85A 2RI6A 1ZD4A 1GKKA 4U2GA 2V97A 1EINA 1YR2A 5FLKA 4Y2PA 1F6WA 3D5EA 2HADA 1CUUA 1DQZA 5JAPA 2WIJA 1X70A 2OLEA 4U2FA 4F60A 3BF8A 4G1FA 3OG9A 1WHTA 1XZFA 4BAUA 2OCLA 3ZLUA 3EQ9A 1YB6A 5AOBA 4OU4A 3WK9A 1SCIA 1D07A 3C6YA 1C7JA 4QWWA 5CRIA 5ALRA 1CVLA 4F5ZA 4ROTA 3AILA 1ODSA 4ZI5A 5EIEA 2JGFA 5DTIA 3ZPXA 1XLUA 5JAUA 1E89A 3G9XA 3JWEA 3IUMA 3W2TA 4JYMA 1VE6A 1ZD2P 3E1GA 4BVKA 1JMYA 3D2CA 3QVMA 2O7RA 1EK1A 1ORWA 1QZ3A 3H2GA 4KE8A 3G0CA 4Y2QA 3C8DA 2OGZA 1BRTA 3DJYA 2LIPA 5AK4A 1OILA 2QUBA 5FXMA 4AN0A 1NU8A 3M3DA 1QIHA 3BDVA 4KJXA 3G0GA 1UK8A 1E3QA 1IUPA 2VEOA 2X76A 1O6FA 3O4IA 4DNFA 3FYUB 2GBFA 5AI4A 4FLEA 5CMLA 3AZQA 1XRPA 2Y6VA 2PU5A 3WKAA 3K2IA 5ALKA 3KD2A 3MUOA 2I78A 5SYNA 1JKMA 2GYWA 4BBZA 2HA0A 3GA7A 5DYYA 4KRXA 3R40A 2CKMA 4GDMA 1VXOA 2XUJA 2QJWA 1BU8A 1EHYA 2WQZA 2PUHA 5JZBA 1QOZA 4BDTA 4TPKA 4J0CA 2RHWA 2H7XA 4CIAA 1CLEA 4QE3A 2Y1KA 1B41A 2HHAA 1GGVA 1TCCA 4G8DA 1QIDA 3OM8A 2VQ6A 1Q84A 1IZ7A 2WIGA 3O9MA 3K6KA 3ESAA 4KE9A 1LLFA 2XQIA 5KREA 4UHCA 2QTBA 3GUUA 1YSCA 4K6KA 4NZZA 5ALVA 1TAHA 4Y2RA 1E8MA 2WJ6A 5D7BA 5AM2A 5LZ7A 3FCXA 5LP1A 2Z3WA 3BIWA 2C0QA 4DMKA 4OCZA 5DYWA 2R11A 2VT6A 4KE7A 4KAAA 3VDXA 2BAGA 2QS9A 4AZ3A 4J0HA 5HFNA 1IUOA 3WL7A 1H2YA 2OQVA 1Y7IA 3M81A 3QMWA 4Y9SA 1FFBA 3I1YA 3KOOA 5CTAA 2OG1A 1THTA 3M82A 1H2XA 4Y2UA 3V1LA 4A5SA 2WFZA 4E11A 4PSUA 1W75A 5D6OA 1TQHA 2PSFA 5JAHA 3I2JA 2AJLI 2DQZA 2WFLA 1YAHA 3ICVA 2WTMA 2O2GA 5AM4A 1XQXA 2VAVA 1VJ5A 3YASA 1XRLA 1QIKA 3KSRA 3MGAA 2FJPA 1IZ8A 1GQRA 3ILSA 4MEAA 4QLOA 4B81A 3G7NA 4KR0A 4C4ZA 1M33A 5ALIA 1CQWA 3O4HA 3STUA 3SX4A 5DWDA 1ACJA 3FCYA 5JZ9A 2WUEA 1W1IA 2ZSIA 1QO7A 2XUKA 2ZYRA 3NUZA 4N8EA 5ALXA 3GFFA 2J4CA 1F8UA 3RLIA 1ACLA 4DNOA 4AZ0A 1P0QA 1P0IA 1ZD5A 1TIBA 2ECFA 2XQGA 3NWOA 2WM2A 3QM1A 3WKCA 1LPNA 1MTZA 4B0PA 1AC5A 1A88A 4BCBA 1C4XA 4JH0A 2I03A 4I19A 5ALWA 3AJAA 2XQKA 2B9VA 4IH9A 4RE5A 4WFIA 5IVKA 1LZKA 3DD5A 4Q34A 1O6GA 4X85A 2NW6A 3G0BA 5HK9A 1MJ5A 3HRHA 4QDZA 2QZPA 2OCKA 5AKYA 2CZQA 4GXNA 3R41A 1DT3A 5IVDA 3QPDA 1EH5A 3VJKA 4J7AA 1XZIA 4PNZA 5ALHA 1G66A 1QIMA 1QLWA 1VE7A 1AKNA 2G5PA 4S0XA 3N2ZB 2J3DA 1VLQA 4W9RA 5DLPA 3WWPA 4PW0A 1ZGCA 2ZVDA 3FYUC 4OYYA 3I6ZA 2PX6A 3FYUA 3QBJA 5DTJA 1AZWA 2QT9A 3G9ZA 5AKZA 2BJHA 4D9JA 4FOLA 3JYHA 3ZV7A 3CCBA 4HVTA 3QPAA 3C6BA 5AO9A 3WLAA 2XMCA 2HU5A 3G9TA 5AICA 3WI7A 5T4BA 2VAXA 4EZIA 4BC1A 4WFKA 2GBCA 4BE4A 2QVBA 1B6GA 2WLSA 4AN1A 4PF1A 2Y6UA 4RNCA 1AQLA 4HRXA 3IBTA 4QDUA 4BB0A 4BCDA 2JEYA 4YX9A 4FTWA 4H7KA 4G9EA 3WK7A 3PI6A 3DYIA 3Q0TA 2QRUA 3WKDA 2AJDA 2ZJ6A 2Y2VA 1NX9A 1XZEA 2C4HA 2W22A 4GWLA 5K3FB 4G8BA 4LXHA 4B84A 2BUCA 5EIHA 1TK3A 5T4FA 2K2QB 4UHDA 1P0PA 3O4JA 2FX5A 1YB7A 3R3YA 3FVRA 2WJ3A 3ZWQA 4LKOA 4G8CA 5IVIA 4IQ4A 2PBLA 2P8SA 1LPOA 1CUHA 4X97A 2O2HA 2WILA 5ALJA 3IVMA 5ALQA 1QFSA 4KAJA 5AIBA 4X6UA 1S8OA 4W1PA 1XRRA 3L1JA 4DTCA 4IH4A 3DYVA 4XJVA 1BS9A 3WZMA 1U2EA 5BOVA 5DJ5A 5LZ5A 1EX9A 5AKHA 5EHNA 4X93A 2JGLA 2IX9A 4C01A 5HK8A 3DCNA 4UHFA 1N5RA 5CT4A 2PSEA 3N0TA 2HA3A 5CH5A 4K5QA 3PF9A 2JGKA 4TVKA 4MJ3A 4XIIA 1H2ZA 3ED1A 4Y7DA 1MU0A 2PSHA 1DT5A 5E4JA 2JIDA 3EQ8A 2YXPX 3WA6A 2BGRA 1WPXA 4B7ZA 4BTVA 4B9EA 3OPMA 1CUIA 4UBNA 1VZ2A 5A7FA 4C6HA 5CH3A 1KU6A 1E8NA 4GBGA 3D4LA 4KAFA 3PF8A 4JUIA 1RWQA 1JI3A 4N5IX 2XUQA 3AIOA 1LPAB 1CUGA 1BE0A 5CURA 2HA7A 3D2BA 1XZKA 1QIJA 3RARA 4AMZA 2AJ8A 1XQVA 3WWEA 1AUOA 1CUEA 1U65A 3WA7A 3RM3A 4ZWNA 5EI5A 5LZ2A 4DIUA 2PL5A 3HSSA 4MWSA 1WHSA 4H7DA 2QXUA 3H19A 3C5WP 3C6XA 3H2HA 4BE9A 1QJ4A 5KBYA 4B82A 1WB5A 1CUDA 3HJUA 5AOAA 3HACA 3HXKA 2QOEA 5AM5A 3AIKA 4X95A 1CUWA 2HRQA 2YH2A 5DNWA 2YASA 5SYMA 1UKCA 2EDCA 3ESBA 1ZICA 4CCYB 1IMJA 4EY4A 4Q3LA 2C0PA 5D3ZA 1QIGA 4UFPA 4U2EA 2WG1A 5HF5A 2XE4A 1SFRA 4FNGA 3VVLA 1UOOA 5CT5A 4FBMA 4HAIA 1ZIYA 1WPRA 2OCIA 1HPLA 2ES4A 4GEGA 4H7IA 1XQWA 3QPCA 1XZMA 3W05A 2BUAA 1W4LA 4DSAA 2JBWA 1MN6A 2PUJA 5E4YA 4DGQA 3WIBA 1QIEA 2WIFA 4K2AA 4EY7A 4ITVA 1DWQA 2DCMA 3FNBA 5DNVA 3G9UA 4QDXA 4UBKA 1A8SA 1UK9A 5K3FA 1XQYA 4FLFA 1QIIA 1UZAA 1L7AA 3R3VA 4BVLA 3LLCA 3OTQA 2J4FA 2WHRA 3WL8A 2JGIA 4Y2YA 4BZWA 3E0XA 4OPMA 4PO3X 5DYTA 1ZJ4A 5FV4A 3I2FA 1I6WA 3MUNA 5CT9A 1ZGBA 1LBTA 4GLBA 6YASA 3KDAA 5LZ9A 4DNPA 5AP9A 4MEBA 3H17A 1IVYA 3VISA 5JD5A 1W6RA 2ZJ7A 3TGLA 1CRLA 2HA6A 5ALFA 2DR0A 4FHZA 4L3WA 4DMFA 1XZBA 2XUHA 2XUAA 4ZRDA 5CXXA 3A70A 2VTVA 2C58A 1GKLA 2HA5A 3I6MA 5FPPA 4XX1A 2GBGA 4TGLA 3QITA 1YCDA 1N1MA 2G4LA 4EY6A 1AGYA 1CUXA 1CUBA 1R50A 3KWFA 1PJAA 4E14A 1HQDA 5JADA 1EK2A 1KU0A 2XLCA 4EBBA 3LCRA 3LP5A 3LS2A 2WFMA 5FOQA 1JU4A 2JF0A 4ZV9A 1UKBA 1T4MA 2XQJA 2O2IA 2X8BA 4Q82A 4C87A 5ALTA 3VJLA 4FFVA 3EBLA 1ZI9A 1L7QA 1J1IA 4P9NA 3D2AA 2VATA 3DEAA 5ALGA 3C43A 3I2HA 1UWCA 3H1BA 2W6CX 3DQZA 5KWJA 2QR5A 5ALMA 3C45A 1QO9A 2Z3ZA 3WJ1A 5AOCA 2YYSA 5HKAA 2EDAA 3IUNA 5K5EA 4Z49A 4BP8A 2RGUA 3V1KA 1P0MA 4RE6A 2B20A 2CEKA 2HM7A 3WIOA 4UFOA 1XZHA 2QMQA 2OGSA 3WK4A 1XFDA 5C8XA 1SC9A 5C8ZA 3WL5A 4G4IA 2RAUA 5H3HA 4BATA 2XUOA 3VKFA 4X6XA 2C5GA 3DLTA 1XRMA 4IHAA 3D3NA 4CIBA 1YS2X 3GROA 4Y2SA 3F97A 5LKAA 3RK4A 1ETHA 2ZYIA 4EY8A 4DMCA 4E15A 3TRDA 1DTEA 3I6YA 4DSZA 3U0VA 4CCYA 4CFSA 4DYHA 2V98A 4M0MA 3F96A 4UHEA 4P93A 4MXDA 3C5VA 2QM0A 4OB7A 1VZ3A 4X92A 3PFCA 5AI6A 4X6YA 2G63A 1VOTA 3RKSA 1DQYA 1HDEA 4OB8A 2WU3A 4W63A 4AXBA 4WJLA 4V2IA 4WDRA 1ZIXA 2DSNA 4CG1A 5DNUA 3IB3A 2XB6A 2VSQA 3FYTA 1CIJA 3V1NA 2OAEA 3STXA 3IDAA 4IH1A 4X7BA 1EVQA 1SOMA 3CN9A 3DKKA 3S2ZA 2WTNA 3STTA 4U2BA 5ALUA 1ZJ5A 3X3HA 1XLWA 3QZUA 1N8SA 1BROA 1E66A 4B6GA 1YS1X 4H7EA 1Q0ZA 4RGYA 3D0KA 1EB9A 4PV7A 3QMMA 3TEJA 4QLAA 5E4TA 3A2LA 4OB6A 4J0GA 1JU3A 3OURA 4FKBA 3WK6A 2Z8ZA 1CQZA 3GELA 3H2JA 1GPLA 5AK5A 7YASA 3WL6A 4MWTA 2XUPA 3CXUA 3W9BA 3C6ZA 1LNSA 5JZSA 4ZGBA 3BE8A 1YASA 3IA2A 4FMPA 4X3CA 4GHWA 5IKXA 4Y2TA 2HU8A 1CUVA 5AKXA 4C4YA 3H2IA 2WKWA 3H0CA 5A7GA 1CR6A 5EHXA 5AKIA 1WCYA 3C70A 3PDCA 5ALOA 4HXEB 4UHHA 4FLMA 1ISPA 1EDEA 4F0JA 5JARA 5A7HA 2OGTA 4GW3A 4UPDA 3QMVA 1EXWA 2H9YA 3WWOA 5HF6A 3W06A 4AMYA 5I8PA 4BZZA 1LPPA 4X00A 1TRHA 5IVHA 4B83A 3GBSA 2XMBA 3I2GA 4AO6A 3BWXA 2WHQA 2HU7A 3BJMA 4B0OA 3G8YA 1YAJA 2JGJA 1GXSA 3DS8A 4P08A 4HRYA 3PUHA 5AK3A 5HQ3B 1CUJA 1ZI6A 1IUNA 3OC0A 1WOMA 4A23A 2PM8A 3BL8A 4ZV7A 1UK7A 3H04A 1E5TA 4O08A 2GYUA 2DQYA 3SC2A 3HI4A 2XMQA 4Q3KA 1J2EA 1E8DA 3PICA 4AO8A 4UHBA 1XZDA 3D7RA 4OYLA 3P2MA 1DWOA 4J0IA 1TCBA 1ORVA 4AQDA 1FFEA 4C88A 2JGMA 2VF2A 4H7JA 4WDQA 1NU6A 4NS4A 4K6GA 1RYYA 3STVA 2G5TA 1GPNA 1UK6A 5ALYA 2Q0XA 5KWIA 2IITA 5AKGA 3BF7A 3E4DA 1FSSA 3BJRA 3MVEA 1HKHA 4L9AA 5JD6A 5JD4A 2ZSHA 2WUDA 5LZ4A 3K9BA 3ANSA 4Q3OA 5FUMA 3BXPA 2UZ0A 5F4ZA 3A6ZA 4I4CA 2WHPB 4H35A 3W9UA 4AX4A 1Q83A 5AM3A 2ROQA 2EEPA 1R3DA 3L1IA 1UOPA 4CG2A 4FBLA 4KYVA 4UBMA 1CUFA 1UKAA 5BV7A 2WIKA 1MPXA 3I28A 1XRNA 1FFAA 1USWA 4HZGA 2XQFA 3G02A 3CCCA 4FDMA 1VKHA 1MX9A 3PFBA 4EUSA 2H7CA 3EIOA 2PVSA 3VXKA 4OSEA 3ZLTA 1R88A 1Y37A 4YASA 3S8YA 3WQHA 3WZLA 2ORYA 5CXUA 1AURA 4C4XA 3L1HA 4ZXFA 1LBSA 2XMZA 2XUIA 4G4JA 4B9AA 1Z68A 1R9MA 4BRZA 5HCUA 4Q05A 4UBOA 1LPBB 1OCEA 1WM1A 4GI1A 3PE6A 2VJCA 3V48A 1A7UA 1U4NA 4CI9A 4HS9A 4KRYA 2RIPA 5AH0A 4X94A 3UUEA 4PSCA 1CV2A 4LIPD 4QNNA 1EI9A 1XZGA 1EA5A 1PFQA 2DHDA 2WUGA 2ZJFA 3H1AA 4DMHA 2BKLA 3WK5A 5ALNA 5K3AA 5A71A 1ODCA 5AK6A 1CUYA 1BEZA 2Z5GA 4WFJA 4DLNA 5I9IA 4X91A 1KEZA 4YK7A 2XMDA 5C7YA 1JJIA 2AJCA 5YASA 5ALLA 3ZI7A 2WU4A 1VA5A 1MT3A 3FBWA 3DNMA 2BCEA 1ZOIA 2E3JA 5LKRA 1GZ7A 2PSJA 1HBJA 3FAKA 5AKJA 4ARBA 1Q0RA 1QONA 4W1SA 2R8BA 1W52X 4FNMA 5HFAA 5ESRA 4QWMA 5EFZA 4X71A 3DOIA 2QJRA 4P92A 2BFNA 4H7HA 1C7IA 4INZA 3ANTA 4UFNA 3H2KA 2RONA 1YA8A 1QE3A 5JANA 3EF3A 1ZD3A 1DX4A 4K6HA 3ESCA 1FFDA 4LYDA 4MQMA 4ARAA 1DWPA 4PQEA 1K5PA 2J3QA 4UBLA 3R3WA 1CPYA 3EQ7A 1CEXA 1EVEA 3DOHA 4JYPA 5HQ3A 4G9GA 4KEAA 4AO7A 4EB0A 1BCSA 3ZLVA 1MX1A 3F98A 4E46A 2CJPA 4BVJA 5ALDA 1QTRA 2HFJA 1J06A 3D59A 5E2IA 1X2EA 2OAGA 5C81A 1PV1A 4U2CA 1THGA 1MNQA 1XLVA 3O9VA 1H22A 2XMSA 4BC0A 5AM0A 1BN7A 4HTAA 4HXFB 4JNCA 3ICWA 3NGMA 1U8EA 5FPQA 2XDWA 4EHBA 4QZVA 1WB6A 1GPKA 2HDWA 1F0PA 3E3AA 5AIAA 5IH7A 1K4YA 2GZRA 1Y7HA 3FOBA 3Q8WA 3B12A 1JMKC 2PKYX 5J3JA 4QDOA 2HRRA 4JEIA 2Y2UA 2I3DA 2WHPA 3C8HA 2WG2A 5JATA 4H18A 4NMWA 5ALSA 4M0EA 2ACEA 3UMJA 1GQSA 1TKRA 4N8DA 1R4ZA 4BAZA 3DL4A 1G5FA 4H7FA 5JIBA 4XWGA 3HABA 2PU7A 2D0DA 4QEKA 3W04A 4KACA 3H18A 1VXRA 5A2GA 3WKBA 5EIAA 3O0DA 4J3JA 4BAGA 1XZLA 4FFWA 5CH8A 4J0KA 5JYCA 1W76A 2DFPA 1LPSA 2XI4A 3FSGA 4F21A 4HXGA 1AX9A 5FKJA 1BN6A 4CG3A 2Z8XA 2VA9A 5K3BA 1G42A 5CW2A 3WYDA 3AUKA 3WWDA 3HC7A 1YA4A 4BRSA 1G4HA 1CFJA 1JJBA 5BWBA 4RPCA 4UBJA 2HL6A 1A8QA 4GECA
chains in the Genus database with same CATH superfamily
1JL3A 2B1RA 3PV0A 3ZOZA 2B37A 1J70A 1BCRB 4IIHA 3RTEA 3WRYC 1INLA 1XKTA 4XFKA 3W8DA 3HFRA 5CM9C 2CBGA 4RWEA 3KUCA 2Y1CA 5AVWA 1K97A 2PMCA 2GH1A 3GYBA 1Y8RB 2WNHA 2ZSDA 2IHZA 2WSMA 3R09A 3I1IA 3Q3EA 4FMDB 3KDSE 2WV7A 2XSZA 1YFLA 2JKYA 4CQLB 5AUOB 3RAJA 3HCCA 4YS6A 4ZVRA 1PEYA 2IIPA 3B1FA 4RGQA 4FWBA 5IZ4A 4J94A 4NFYA 1LNQA 1VBFA 2D5LA 4JBHA 4ECEA 2OESA 5BP7A 5HM8A 3I23A 4ENQA 3GT3A 2F43B 3AYZB 2Z8YA 2GZSA 3SI7A 1GDDA 2B4KA 3KT6A 1R1DA 2P9BA 5LPNA 4KU4A 1F8GA 2Y9PB 5JALA 5T8KA 3D8TA 1DINA 3FW1A 3R3UA 1ZO8A 5DDIP 3PUIA 1NNUA 5F2EA 2GCIA 3FKQA 2K6GA 2AN5A 2CVHA 4LRTB 2XB2A 3FKJA 1RYBA 2H7VA 2J7KA 3PJGA 4A82A 4DV6B 1A3CA 2P2CA 4KPUA 3IKMB 1GZ4A 4AJNA 3JS5A 2X8AA 2Y8EA 5JAOA 4DTIA 2QLFA 3DW1X 1ISGA 5F4BA 1OXBB 2O19A 2IW3A 2VK4A 1IEQA 4D5EA 3UCXA 4XM0A 1QPGA 3WKEA 1Q2XA 5JY1A 1E1MA 2CDCA 1D0SA 1V1MA 2PKRA 2XGSA 5AKLA 1MO2A 3O95A 4OFXA 2OZLB 1HC7A 3G59A 3JQCA 1GQYA 5H8WA 1GFWA 1PQWA 2DWQA 1X8XA 2CB9A 4FMCB 4J16A 5FOVA 3WLOA 3G7SA 1KJQA 1RIIA 1KSGA 1PJSA 2DTEA 3H2YA 1FTGA 4TMKA 3UJCA 1W1UA 1CVRA 1UEIA 1TYBE 2B5VA 3CRMA 2HRBA 2WSLA 5CITA 5JAZA 3FFXA 2H29A 4L75A 4GYKA 4OH1A 2YC2C 3TQCA 4QTTB 3FUWA 1S2LA 5BT9A 3OJWA 3HXPA 1T8UA 4HH0A 4BU1A 2Z6VA 1DC6A 1CQJA 4BWYA 3TOZA 4JJ4A 1YONA 3C3XA 4MPRA 2GSWA 2H00A 1GNLA 3G85A 4P83A 1HGXA 1E7QA 3DKRA 1WUIS 5EKSA 4C0HA 1Q1GA 1IHXA 4BYGA 3ENWA 4EL0A 5KNCH 1SVLA 2BHNA 5T4HA 3T0IA 4C4AA 1K0UA 3IIMA 1DEHA 1BNCA 3WJ2A 5FWDA 2BM9A 3GH1A 2P9EA 2BGNA 1WHTB 2GFHA 3R0JA 4JL8A 3BVPA 1XB2A 4B6EA 5JECA 2J3JA 1JJFA 4C29A 1HE3A 2V5UA 4ZN6A 3EZXA 3I39X 3ESDA 3LCJA 5AJTA 5AXCA 1KYVA 3SZ3A 4B7CA 2Q6LA 4U1RA 3VR4H 4BWFB 4F92B 2OK8A 1EWRA 3CV3A 2OO5C 3Q10A 3U6KA 1FP7A 1YR3A 4RMHA 4DF3A 4R0MA 3FE2A 5ECDA 4A0FA 3GVIA 5CG2A 3KKEA 1AY0A 1KZYC 2WJ4A 1YIOA 5LQAA 3AINA 1K8QA 3VAYA 5IMSA 5ALEA 2JLXA 1YZ3A 1FW8A 2WM3A 1TK9A 2FVXA 1R6UA 1O6BA 5FNVB 2BDEA 4ZICA 4TT3A 3RSZA 1L4BA 1P5HA 1Q1ZA 1VDZA 1T6XA 4B80A 4F4CA 1GG5A 1CERA 2C92A 4JLBA 3K9WA 2FN4A 4R2MA 7REQB 1C3VA 3PQ6A 4GR5A 3F46A 3PGJA 1JSXA 3LBNA 4M46A 2UYHA 1RZRA 2QN7A 1W0KA 2Y77A 2XUDA 4OXIA 3TQIA 1FMJA 1AK9A 4MVWA 4KP7A 1QTQA 4C89A 3RT1A 2ONCA 4GVXA 1CX9B 4ZYVA 4K9RA 3B7PA 3FXAA 4Q03A 1QLHA 4CLXA 5GP1A 5HE8A 1JQ3A 5KJ6A 3P52A 3RIEA 1F0NA 3W1WA 3PEEA 4D3SA 1S01A 3TUIC 3COSA 4WNIA 1VC2A 2AZDA 1FVFA 1K63A 4N4AA 3D6UA 2ZFUA 3CVJA 3CLRC 1J2YA 3G0DA 3K4QA 4PNHA 4AP9A 3H0EA 4FEYA 4E12A 5DXJA 3VPCA 4BTLA 2BUBA 1E9EA 1WVMA 2DBVO 3HJAA 4UNPA 4U7DA 4AVYA 5D5PA 3GEMA 3QVKA 5KNDA 3MD0A 3ZZMA 1UC8A 2XXAB 3P9KA 3FR7A 2H1IA 4ZREA 4LDQA 2QTNA 3PHCA 4QRDA 3V9AA 3E9YA 4H3VA 1QF9A 4N0MA 5A9SA 1VSBA 1WB4A 2AWNA 2OCGA 2R8EA 3GT4A 3ZN2A 1UBHS 2B4AA 1I8TA 4NFHA 4RZ3A 1SA0B 5FJJA 1L7NA 4XPIA 2AMYA 4EUKA 3I37X 2WJWA 3EJWA 4L8WB 4QD3A 3UH1A 4D2IA 5KUTA 4ZAZA 4IIFA 3B2EA 3E58A 2CUTA 3DE4X 1Z6QA 5DCWA 2C61A 4PM4A 1A82A 4B2LA 4BYMA 3NKVA 2YOGA 3SS8A 1Z4NA 5BQFA 2D3TA 3JVIA 3VPFA 2X5NA 1SXJE 1A50B 3D8SA 1YRYE 4HWTA 5D86A 4ED9A 5AW9A 3LVQE 1N7IA 3WGMA 3FY4A 2PD6A 5CA1A 4OGGA 5HF9A 4EFDA 1BSVA 1M9NA 2E85A 2F48A 4YRTA 1WZUA 3FSGD 3NQ41 3L9XA 4MROA 5B2ZA 5ELXA 3BWMA 3IAM6 4PS0A 4CQJA 3IULA 3P96A 4MJXA 1G55A 3DL7A 4UUQA 3IRUA 3DZCA 1CUAA 4E21A 4LK3A 1MAHA 2ZQYA 2I6TA 1L7VC 3R8CA 2CXHA 2YV2A 1LZLA 2VNHA 1EVJA 3L06A 1H9AA 1MABA 3ENKA 2CNNA 3KL2A 3HJNA 1P61B 4R3WA 1LLDA 5HBGA 3JATB 3HKEA 4PQGA 2FG5A 2Q2QA 3UAYA 3FYDA 4NATA 4K03A 3OFND 3R5HA 1FVHA 3LSTA 3MCWA 4OQYA 4ZZ3A 5KZMB 2VJBA 3HYSA 4P4GA 3ZE6A 5K0ZA 2ACKA 1P0CA 2W2VA 4RY0A 4UBIA 1KDZA 3TPCA 4XWWA 3EGXB 4KREA 3AZPA 1E7YA 1TQ4A 1ISHA 1HT1E 2BEJA 2CXXA 2HWWA 2W48A 1UDBA 3MMZA 1GG8A 5DGIA 5DGCA 1TQ6A 4BDSA 1Q91A 1A8UA 4DMLA 4D9BA 1OBOA 3A9SA 1PU2A 2DX7A 3KQVA 1O4WA 3DDCA 3VRHA 4LG1A 3JVVA 3AVVA 4G5QA 3I62A 2FPUA 4LCJA 1DELA 3LUJA 4MVJD 4QUHA 3PVCA 5ENZA 3CUWA 1B00A 2ZAOA 5T4EA 2ZZNA 4Y2JA 1PS0A 4RKFA 2VYFA 3BMOB 2VPXA 1ZNQO 2QM8A 1VFNA 3BHJA 3FPAA 3GC6A 3IIIA 2P9GA 3IJEB 3NHFA 3R3JA 5F35A 4R71A 3KSBC 2VQFB 1QMGA 3SYTA 1YQWA 4AUKA 5HKBA 4CUJA 3VKGA 4LKRA 4Q15A 1W5FA 5HJEA 2HMUA 4BIIA 2WOJA 5FV7A 4TOIA 3I9NA 1KKUA 2PEYA 5DT9A 3PSHA 2WM8A 2BGIA 2P90A 4TKVB 5FI0B 1DARA 2A9OA 1OPRA 3W6PA 5KOHB 1HETA 1JBKA 1GTJ1 3LPMA 3DE6X 3IJ5A 1SVWA 4JL5A 5LU8A 1AF7A 2FN8A 4PCUA 2VIIA 4Y6RA 4ID9A 1IK4A 3CM0A 1OU0A 3DV0B 4EY3A 3GNSA 2JHFA 3ZHQA 4MUYA 2QWXA 2WQ6A 3LUBA 1NBMA 3GJRA 1SXGA 3KQWA 2IQ5A 1X9GA 1SIBE 4O02B 1UOQA 1ZH8A 5DYNA 5AVVA 3DVQX 2NQTA 4AZ3B 1O2DA 4GOKA 2I6UA 2G1KA 2Q41A 4DR5B 1W73A 1IM8A 3L0SA 4OUDA 4PANA 3HNOA 2PKQO 4JFAA 5FUWA 2C7GA 1M2JA 5I7UA 3SYMA 2VAMA 1UF9A 4PSDA 2RBGA 3BX1A 3DZ8A 5ISMA 1H0SA 2X5XA 1DZ3A 2P9CA 3BDIA 2JAQA 3IEXA 3WL3A 1XEFA 4Q1EA 1V26A 3LIIA 4RIGA 4U5XA 2GYVA 3RREA 3K0BA 4TMZA 2DPMA 3HU2A 1KDYA 1X3LA 4PONA 4BB6A 3U1TA 1JT2A 2X2FA 4QU5A 1C2TA 4A0HA 1Y3AA 2E89A 3STWA 3GWZA 5CX1A 3ZBTA 3W5CA 2PGIA 4L0CA 4OUKX 2XLBA 5DKFA 3VU9B 5LNK1 1R27A 5CHYA 1JECA 1T13A 3O2SB 4XWYA 4D3FA 4F5WA 3MNFA 1PBNA 2BKUA 1ZC3A 3IMCA 1QK5A 2HA2A 2IYRA 2P1ZA 4UZSA 5EHZA 2GEKA 2I33A 3AO0B 5T64A 1JAXA 3WB1A 1JYEA 5CVJA 2XXJA 5DHAA 3EVNA 2VYCA 1RAFA 1Z75A 1YRQA 4JJ7A 3PG5A 3UV7A 3KZNA 4UU0A 1Z56C 1XOIA 1G3QA 5F3RA 2EYQA 2FW9A 2EEZA 3P9SA 2QN3A 3UJ3X 1AKTA 4KX5A 2ZM6B 1E4EA 4X1IA 1CT9A 1LQUA 2MSNA 1LK0A 4RL4A 1J5PA 1XU7A 1G7SA 2RI6A 3CF4A 2AC7A 4ISBA 5LUAA 4WOJA 1GKKA 3K09C 2O52A 1QB8A 2Y1XA 1ST3A 1JRLA 3M4NA 2RG1A 5EFOA 3AGPA 5HDQA 3U4QA 1KNXA 2H63A 3NYWA 4ASUA 2GJSA 2I4LA 1CNFA 1MEJA 2Q5QA 3BWCA 4YXWA 1E9BA 1YR2A 4BMNA 2PUCA 1KI3A 4Z8XA 4U4AA 2PG3A 1ES9A 1HTWA 4MMYB 1F6WA 2VYND 4HDKA 3QU2A 1CUUA 2BEUB 2YN4A 1PL6A 1KVQA 1NUTA 4B44A 3JAWA 1FP4A 4NAHA 1SKUA 2RGEA 3QKSA 4MDYA 4DFDA 2QLBA 1U8TA 3MSXA 3OT1B 3P9QA 4O2BA 1UC5B 2WIJA 2HY7A 1Y1KE 1G8PA 2OLEA 1L4YA 4I4IA 3CEPB 4U2FA 1ZD1A 3P9YA 4QX6A 4YJGA 5LJIA 1KAEA 4MYRA 4DXDA 1KQFA 2ZPUA 4RXTA 4P1ZA 4PLWA 2CLMB 3UV6A 4CMHA 4OQFA 5BV1A 1OHHA 1XZFA 4RJJA 3I5XA 3ZLUA 3I34X 4BX2A 1SBNE 4F9EA 1F17A 2ONJA 2G71A 2QE6A 2WD7A 1BMTA 3LK6A 4QKQA 3PLAE 3LD9A 1T91A 2O2JA 2QX7A 5AOBA 4EMBA 1E9RA 2COEA 4OU4A 4RGVA 3WK9A 1O0BA 3AM1A 2RKOA 2PEZA 3C6YA 1VDMA 1Z9BA 4IIUA 121PA 1AN0A 1OW3B 2JH8A 3RQIA 4CPDA 5CEEA 1BJTA 4UVDA 3HVHA 2R2AA 4HAZA 3TNDA 4F4JA 4NOKA 1R8JA 3Q1LA 3PGVA 3AILA 4L76A 3V6LA 4CV0A 4DSUA 3EDMA 5I45A 3EX7C 2FDCA 3OT4A 4JZKA 2CLHB 4FB4A 2HXYA 3PI7A 2XB8A 3O3NB 2P1DA 3FGNA 1IHYA 1ODSA 3N0RA 3N7TA 4PPQA 2I9PA 5HJ5A 3T8YA 1WUKS 4CR8A 2QD1A 4MUAA 5JV5A 4V02A 1OBFO 5EIEA 2JGFA 1YB4A 1D03A 1G8GA 3CH7A 5DTIA 4PHTA 2PJZA 4CN9A 5KYWB 4XW2A 3R5JA 2XA2A 3ZPXA 1XLUA 3QXSA 1U8ZA 2I4IA 4Y6GB 5EEHA 1MENA 1PR2A 3CVYA 3ZGYA 4PTZA 4KQKA 2KPOA 4XXHA 1G8KA 3G9XA 3F9IA 4Q7QA 3IAEA 3T3PB 1SKBA 4NBUA 2ORVA 3W2TA 4CU5A 2LXNA 3H8JA 1P9RA 2NO6A 1QDUA 4A26A 2H17A 5C35A 4ZGWA 1RPZA 1V1JA 3ELUA 4NE7A 3T4EA 1EK1A 3RODA 1QZ3A 2QG9A 1BMQA 3CPSA 3IT2A 5KHOC 3AOGA 4GWGA 4Y2QA 4P34A 1JSCA 2Q7XA 5BV2P 5IULC 1ECPA 4WK4B 1MO3A 3C8DA 4F6RB 4MS3B 2X3UA 1CW2B 2BTEA 1OUMA 1BRTA 1MORA 5KYKA 1SWVA 1YBHA 2CJFA 1LDNA 4YUAA 2OLKA 5AK4A 1HO3A 1OILA 1U7ZA 1NVUQ 1QS0A 2ZRDA 3QNWA 2QUBA 2QBYA 4FONA 2H1LA 4RC9A 3S27A 4AWBA 5DPMA 4AYTA 3VNUA 1D6NA 2QM7A 5KWEA 2BSQA 1IFXA 1H4TA 1E3QA 1UK8A 2ZRAA 2VEOA 2X76A 5EJGA 4GP7A 4ZJPA 1QWSA 2SBTA 3SQXA 2IHBA 2QR3A 2ZBRA 3IR7A 3PCTA 1MO6A 2A1IA 4G4SO 3G2HA 5SZHB 1ND6A 2ZATA 4HNGA 4BWGA 2IS6A 1II0A 2UXCB 3R20A 4PX9A 3P2JA 4YXFA 3ZVLA 3LHSA 4P5EA 5EXSA 3AIIA 4HQLA 1U2ZA 1E96A 3IQDB 4TV8A 1FDIA 1PHRA 1VI5A 1Z0AA 3AFGA 3QXXA 3DKPA 4O8ZA 5BWOA 1XMVA 1SU7A 2ERYA 2IS4A 3JQEA 5EXDA 3C6QA 4KXMA 2Z0MA 3UB2A 4DCTA 2M98A 4P5DA 2WUVA 2OKCA 4MTLA 2A8YA 1G59A 1G4UR 2I9KA 3K2IA 3NLLA 3ILXA 1H0RA 4HWKA 1TO6A 5ALKA 1TQDA 1G2OA 3GRKA 5KYVA 5U4XA 2EIHA 3UQZA 1XBTA 3S5UA 2GYWA 1VJRA 4OXNA 1VPVA 2P2ZA 3GA7A 1L4EA 2OHFA 3NHPA 3HZZA 2X40A 3UH0A 3UVEA 1LSOA 3AW8A 4KNYA 3JWIA 4KRXA 3OZEA 3R40A 3ID6C 4C78A 4E6PA 2I4RA 1FFWA 3MWKA 1W85B 4GDMA 1EJBA 2YNMC 3ROQA 2XUJA 3AEQB 5J4YA 4DR7B 2WQZA 1EHYA 1SVOA 1S5PA 1QOZA 2I99A 3LUKA 4MRMA 5BR4A 5GJBA 1GEEA 1L5ZA 1HFKA 2D06A 3RJTA 1VMDA 3MYRA 1BXGB 1J33A 4J0CA 5IABA 1JV2B 4CIAA 4C6TA 1SUWA 3S55A 4YDHB 2XT6A 3DF9A 1SCNE 1JQBA 1X77A 4GOJA 4DADA 4E5PA 1QPBA 1LSSA 2CLCX 1QIDA 3OM8A 3W8RA 2V7EA 521PA 4A5OA 3PC8C 1NW8A 2QAJA 2FSGA 3K9GA 1YRBA 1IZ7A 2GUWA 3N2NA 2BI4A 3ESAA 1H5QA 2COKA 2GCOB 4AUEA 4BO5A 2FGKA 4DWOA 3EGDB 1Y63A 2B5OA 4Z5XA 2A1UA 2GPAA 5BXYA 3DT8A 4KN8A 4EYGA 3S2FA 1UJNA 4EI2A 2FMIA 3KKLA 1LEHA 1RWMA 5FBQB 3JQ6A 1JX6A 3PFKA 4CM8B 1YSCA 1U1GA 2OHGA 3HO6A 3FPKA 1OYVA 4NZZA 3GJXC 4FYXA 5AM2A 4L4XA 1LTQA 2JFFA 5LZ7A 2X9LA 3AB3A 2XR1A 2Q7DA 2MJLA 2QTZA 2Q99A 2Z3WA 3NH9A 4BNNA 4DM3A 2QZSA 3CNBA 2QMZA 4FBGA 3KYCB 3NTOA 4GQIA 2AKAB 4HFRA 3OC6A 4KBFA 5DYWA 4B3BA 1DKRA 4YRIA 1W36C 3GU3A 2QVLA 1QF7A 4UMDA 3COVA 3OTIA 4LFBB 4MI1A 4D9FA 1MT0A 5BN3B 1VMKA 2YL2A 4KE7A 4L50A 1PKXA 5M3BA 4JUBA 2GESA 2QN9A 1IHDA 3VDXA 2C3UA 1PBTA 5SY4A 3K16A 1WDTA 3C7TA 3C7KA 1PLLA 2DH5A 4YLEA 3QWAA 2HCFA 5ICEA 3FPEA 5A2QA 2XYQA 2OQVA 3FCUB 1WMDA 4PVCA 2PX3A 2FW6A 5IMBA 1OIVA 1OI3A 4LVUA 2P6NA 1BS1A 3BA1A 3I1YA 5KPDA 5DGXA 3KOOA 3TXXA 4E2FA 4DCUA 3VZCA 2B4YA 2OKGA 4NCIA 1GA4A 2GJ4A 1QF6A 1NJSA 1Y80A 2WVAA 2XRFA 3A11A 3CW8X 2AX4A 3F7MA 3PKZA 4M0CA 3IOCA 2DUMA 5TB5A 3RYFA 3CKMA 1GTMA 1HE4A 1E1RD 3BZWA 4LGYA 2IV7A 4Z7QB 4URVR 2POCA 2Z98A 2BSAA 4LC0A 2FPXA 3BERA 1FVXA 4NY1A 4XLLA 1UL1X 2WW8A 2FP4A 4WN9A 2QRVB 3BJIC 4E11A 2XGJA 3I32A 3KV3O 1SK9A 2P4HX 2V4ZA 2I1VB 3CB4A 2AHOA 2VSNA 3DAPA 3B9PA 1TQHA 1A04A 2CHEA 3CSSA 3L8HA 4AKGA 1S7GA 5JNTA 3Q2OA 2DC1A 4V3CA 4RD3A 3FSEA 1UBNA 2XD4A 2NV2B 1K88A 3KJIA 3P45A 3PYLA 4NJMB 4OFBA 3N3BC 4UULA 3TKLA 3TW4A 3K72B 4LYHA 3T7DA 2O2GA 2ONKA 4RZHA 2XNCA 2JIOA 5AM4A 3VC2A 3DW3X 1QRUA 3UGTA 3TKYA 1CDDA 5E9JA 3ZNQA 4CLRA 3QK7A 1FFGA 4HGOA 3N07A 1CR2A 4UQOA 1Z4LA 4YRQA 1QIKA 2ZYVX 3DHVA 3F3YA 2FN3A 3RWMB 1G5IA 1YZQA 2P79A 5DM4A 2QNBA 4KITB 3K6SB 5HDBB 1ZG3A 1Z7EA 2UXDB 1RKBA 1XAIA 2H1VA 3OESA 1TEVA 2FXIA 5G4KA 4QHTA 1OE0A 1T9HA 2GS9A 4X63A 1NE2A 2F1RA 3W90A 3FOZA 3A9CA 1YR8A 1NVEA 2I6SA 1ACJA 3OFNA 3QE4A 4NONA 3ADOA 1UFRA 5EE0A 1R0LA 1NZJA 2KWIA 5MGNA 2ZS9A 3A32A 1CB7A 4C0XA 1RTKA 3RVLA 1W1IA 3M5PA 2ZSIA 5GJVC 5DYIA 5BSUA 2QX6A 5JXJA 5EJFA 3KOYA 3NUZA 4N8EA 3D6VA 3VGJA 1OX4A 4TLEA 3U19A 3STHA 2YVQA 4DDVA 7AT1A 3H97A 2Z1MA 4MVJA 1UDWA 4GLFA 1UH5A 3ZD7A 4OEHA 1ACLA 4OMCA 1WZNA 2Y4NA 3EVAA 1YVEI 1L7XA 3EH2A 4HJRA 5ITWA 5J2UA 4FOOA 1P0QA 1RLTA 3OQ6A 2SECE 1SVIA 4RCZA 1P33A 1DADA 1GQQA 3M6LA 4V0MA 4WZAB 1SC1A 2YX1A 5C5EA 1RJ9A 1UBUS 4MI6A 1TIBA 5BSMA 5SICE 3FVQA 1AQIA 1JLKA 5IEBA 4LE1A 2HLNA 4LNAA 1GNTA 3WKCA 5KTKA 3AR3A 3JD2A 4MLZA 3WLKX 1OV4A 1YZHA 1E32A 4B0PA 2OV3A 5LR6A 3U4DA 2VYVA 1AKUA 3QVJA 2X0IA 3SHTA 4EAAA 3NRCA 4LV6A 1YDEA 2I2DA 5L3QB 5KPJA 1Z37A 1ZITA 4EB6B 2C77A 4E2WA 4LUCA 4I50B 2HT1A 2FSPA 5F33A 2Q8NA 2DUNA 2WYOA 4P7FA 3P19A 4O33A 2DULA 1JLMA 2BRUC 4PGAA 4KL8S 2XQKA 3GLGB 2QVYX 4IH9A 4HHEA 4J9UE 4EHLA 3I45A 3KKNA 2YHAA 3BD7A 3TWOA 1AQJA 4WFIA 3J81A 4IF4A 3ROMA 2G04A 2I3AA 3UJDA 3R5TA 1GAWA 2P9YA 4Y6PA 3OJLA 3DD5A 3DMGA 3K0AA 3QNMA 3G8CA 5J58A 4BUCA 5I9MA 4D26A 4OI1A 3MJTA 1ZH4A 4MVJF 5THXA 2BZ1A 4X85A 2LE0A 1ONBA 3DD1A 4C7XA 1N6NA 2NW6A 2GN4A 3G0BA 1GUYA 2VHQA 4AY3A 4Y0AA 5J2UF 2GFIA 4GXNA 1ITZA 1L5HB 5JEDA 1US8B 3NAGA 3HXTA 5AJYA 3LUFA 3Q9LA 3R5SA 4J7AA 5L3SB 1SHZA 1JHYA 2A5YB 4FKMA 1P1RA 1U5CA 1U2QA 4DJDC 2DMRA 2CHFA 1H6DA 1QLWA 1RYZA 1H8ED 1YCGA 2DVMA 3GFRA 4YRGA 5KNBD 3LF2A 4KLNA 3N2ZB 4BNHA 4MUIA 1Q7BA 3ORHA 1N9GA 3AC0A 2JLBA 2ZUBA 2CLLB 2NG1A 1VLQA 4W9RA 5EVCA 3RUCA 5ADUS 4FSHA 5FORA 1JHDA 2WV9A 3WWPA 2I8LA 1GKIA 3OJXA 5EUMA 4CM4A 1URPA 5K99A 4X65B 1VHDA 2ZKLA 1G8SA 3I6ZA 2MINB 2PX6A 2PPVA 3K30A 3VSBA 3FYUA 1OZGA 3P9PA 4IDFA 4S35A 1J2TA 4KR6A 2WY2D 2AXQA 3DEKA 5KSZA 1AZWA 1XEAA 2DZDA 2JI9A 2D1YA 4UTZA 4WACA 1XQ9A 2DFKB 4DRYA 1WMAA 2FEMA 3W2EA 3DDHA 4WSOA 5DEIA 1G9XA 3ZLJA 1I5RA 4RHUA 4DQ0A 4N6OA 3A05A 2CXUA 3B3GA 1MCZA 2H2IA 3QX8A 4M6WB 4MAMA 4OXRA 1EFHA 1HLPA 2AUTA 3GLQA 4FI3F 3CCBA 3H5AA 3MHPA 5ICCA 1QYCA 2QUIA 1CEYA 1P6UA 2FSHA 3QPAA 3ODGA 1QFXA 3HKBA 2AE2A 2WWVD 2X0FA 5IDYA 2NYAA 4C9BA 5F7XA 1QHHA 2JANA 2ZROA 2DTDA 3PRHA 4OHPA 1NJ1A 3G9TA 1NBEA 4IJMA 2V0NA 4N0EA 5IC6A 3WI7A 4R1LA 1RI3A 3HRIA 2QMUA 4IJWA 4ZAYA 3KUKA 1ULUA 3LUAA 5T4BA 4DR1B 1D2NA 3JQQA 2D54A 2IPMA 1Z08A 3AJDA 3RV3A 3GVHA 3UBMA 3O91A 5FOUA 3VH2A 4FILA 3TLEA 3OZ7A 2IXAA 5E9WA 3RVNA 4YCNA 4G5OA 1C0IA 5JO9A 3Q7QA 1IXSB 4AN1A 2Z8YM 3NT4A 4PS1A 4NWIA 2ODBA 1ZGZA 4B6QA 1YE3A 3QX3A 3GMTA 4R2JA 4TTTS 3IBTA 4CF4A 2WSSD 1ZCFA 1U3FA 2VP3A 3FI9A 3PNVA 4QDUA 3RNLA 3RVPA 3IKLA 4PZCA 5KYYA 4C3ZA 4UW9A 1NXPA 2VVTA 3M4JA 1XMQB 1NW5A 4CMAA 1F4PA 3AR8A 1K98A 4HDRB 1D0IA 3I42A 2D5AA 2Y68A 3QU9A 4F3YA 5EXXA 2AJDA 2C82A 1Z0UA 2NOAA 2Y2VA 2ZE5A 3R3HA 2I1LA 3RRZA 1XZEA 3ZLBA 2QUKA 2WJYA 1GFIA 4BKOA 1PR0A 3FHJA 2H54A 3ZX5A 4CMEA 3OTOB 4RTQA 2PYDA 1KH1A 4N82A 3IVRA 4NYJR 3NNNA 3F3SA 1E2PA 3LSYA 4LXHA 2XNDD 2VT3A 3D31A 2X8WA 3T3NA 1MC1A 1TK3A 3ROPA 3W7BA 2IYVA 2V55B 3IVAA 1NVDA 5T4FA 4UAGA 2K2QB 2VJMA 4BN4A 2XOKD 3A1SA 2CUZA 4UHDA 1IE3A 4K46A 4FCCA 1VIDA 3A9WA 1JSRA 5GMOA 1IAVA 3TDMA 3MJEA 4KSCA 1ABBA 3ETNA 4KXNA 3DMTA 1TT5A 4OHVA 3UMRA 3B36A 2P2GA 3ASYA 3BK2A 1N4DA 1YZTA 4TYNA 5GQSA 4HPJB 5E7JA 4LXTA 3F6EX 3D6TB 5ED4A 4DANA 4F5EA 4RESA 4KPGA 2BKEA 1NZFA 1ORHA 3IQFA 4LKOA 1YKGA 1FLNA 3VR6H 3KTAA 2CGEA 4IQ4A 2PBLA 4Z0PA 1BH2A 1HTTA 2R5NA 4X97A 1MGPA 1OQAA 1BCSB 2LGJA 2O2HA 3H2ZA 2QTWB 5EN4A 1CY7A 2XEDA 2JLRA 1B2LA 5LOVB 3UNXA 1NE7A 2OXRA 2NO4A 5BMOA 1XCJA 2PUTA 4IH4A 4DTCA 3DYVA 2JFBA 3MS4A 5J23A 1X7XB 4XJVA 4HVCA 3WZMA 1U2EA 3Q1KA 5BOVA 2YHIB 4XVHA 4JLUA 3UAWA 1EX9A 1DIBA 1G8FA 1L9KA 1PFKA 3FZQA 4EG5A 4JJ8A 2EW2A 1AKYA 1G7RA 2EQAA 3NEAA 4IXWA 2FRVA 4XUCA 1FFSA 5HK8A 1FZTA 1XTPA 2PJRA 4KQWA 3KQQA 4PINA 3JQ7A 1DC3A 3R9XA 4L9SA 1JXMA 1PR6A 3EE6A 4F4DA 1NY6A 1XNHA 3SXUA 3RANA 3M5DA 1T0IA 3PF9A 3PPYA 3LFTA 3DVAB 3TVTA 3D3KA 3JYNA 4R9NA 1W9HA 1USVA 1VJCA 3HDQA 4PZYA 2O2SA 4GPEA 4XIIA 3D1VA 4A8JC 3EXG1 1KS9A 3IMEA 1ZM4A 2RI1A 3HGTA 4NXMB 2IELA 1JHAA 2AW3A 4Y7DA 3MC1A 2NYVA 4L7QA 1MU0A 1KGDA 3DOEA 3WLSA 5D85A 1PJQA 4ZVVA 3EVEA 5KS2A 5TIIA 2VJYA 3HLYA 1N2JA 3K0KA 3E03A 3EQ8A 4YQFA 3IV9A 2P5SA 3CF0A 3LRPA 3LBYA 1T6YA 1LW6E 2BGRA 1DC8A 1N5OX 1WPXA 2VUUA 3BH6A 3CZ5A 4D46A 2FMUA 2V7VA 4IJKA 3BH0A 2Y71A 1R5OA 2Q3HA 5EJEA 1GFZA 3QQPA 2WWYA 4LBYA 4AWAA 2PT6A 2PL9A 2G1AA 3IV7A 5FOWA 1BA3A 1LSUA 3N2YA 5EVJA 4XGQA 3VH3A 2BM0A 3HVIA 3QXHA 4KDRA 4BO1A 2VK2A 1G6OA 3EXIB 2QE7A 3OU6A 2DBYA 3GRVA 3I30X 4Z9XA 4N7RA 4UAVA 3FCOA 4ZK2A 1E8NA 1E2FA 3WHLA 4GBGA 1MJNA 2AZXA 1QZZA 2FR8C 2WTXA 4OA8A 2YHUA 3L79A 4DM4A 4DV0B 1QG0A 1TM2A 3AERA 1WCWA 1XTVA 1DC4A 3PGXA 4DY6A 3RBZA 4ZC8A 4U0KA 5E9AA 1WXGA 1KJYA 4DIOA 3GWGA 4EFMA 2RG7A 3QLUC 1B15A 1RWOA 4KQEA 1LPAB 4XI9A 5E2BA 3R7AA 4DBVO 2BGWA 4AMBA 3IILA 1TECE 4QAJA 2HPVA 2HA7A 1N6HA 2HJHA 5E6SA 5JO0A 2Q1TA 1SXHA 3D2BA 2YWHA 4J8PA 5ADVA 1TMYA 1VSUA 5EE3A 2EFHB 2Y0DA 3UOGA 5BR8B 1GV0A 2OCAA 4F3CA 5BURA 3IXMA 3I2YX 3K92A 4RTLA 1IOZA 1MVLA 3WIUA 1N2EA 4YLYA 1AUOA 4RQBA 1SIOA 3TXAA 2ISQA 3NP9A 4MKHA 5EGSA 1U8UA 3SBOA 2ZT6A 3ZJYA 3FMIA 3B5JA 3I5UA 4N47A 1ANKA 2BF7A 3TVYA 3RJMA 1IOLA 1X7ZA 4EG7A 5K0GA 2C2OA 1XHLA 4AS3A 1T1IA 3IVXA 1EM6A 2PL5A 4GC5A 1R0XA 3O8LA 1IPFA 2IPOA 1YZVA 5TQ2B 1E1CA 1DBVO 2HU2A 2R1VA 1NRJB 4A1FA 3NP7A 3AEKA 3EG9A 3UENA 1QGUA 2ZTHA 2HSEA 4G24A 1YKSA 4ND5A 2J1LA 3VOAA 5F9FA 1MEOA 1Z38A 2JH9A 1RLUA 1IRXA 3FD8A 3QA9A 2I0FA 3DWFA 1KOGA 1OU4A 4PY2A 1KEEB 1M8PA 5LA6B 3OJEA 3JQAD 1X0VA 3MF4A 4ZHSA 1UANA 3R44A 4U0JA 1L4LA 4J2OA 3SQWA 4MIKA 2RGBA 3C6XA 1ZJ6A 2WKSA 2BJVA 2RH8A 2W2NA 1ZWKA 4QXPA 5F5LA 2CXOA 3HB4X 4JYAB 3ZGLA 1I3OA 5CJ2A 3REGA 3DZIA 5FULA 2B2CA 1U9CA 3CLUD 3RVOA 3VPDA 5KBYA 1UXKA 2HJWA 3M5CA 1CUDA 1OLUA 3AR9A 3A3YA 1MO4A 3OQBA 1MZVA 4LJYA 4RA9B 1LJLA 3TF5A 2PGJA 4OXKA 2A92A 3BZBA 1E1RA 1UMDA 4EVIA 1RXWA 2QOEA 1WQ1R 3A6PC 2AZ4A 2VWQA 3ORRA 4YJ3A 2YH2A 3ZNOA 4JDPA 5FYQA 4WBNA 1G19A 2PRYA 1H6BA 4G0ZA 1EZZA 1K0FA 3O5AA 4EW6A 1E1YA 4WEOA 2VF8A 4ZVPA 4ER3A 3UKOA 3C1UA 2I4OA 1DCTA 1T5HX 1U7XA 2RI0A 3Q4GA 4DXHA 1LRKA 5CLHA 2P0YA 2VQDA 4L2IB 2EP5A 4HYTA 1V5IA 1T10A 1TM3E 1E6CA 4WTOA 3O31A 5JS2A 3OHMA 3NBZC 3OY7A 4BJ5A 4YIHA 3IXLA 2C0PA 1Z34A 4CYMA 5B58C 1ULTA 5K0CA 1ZKMA 2XMPA 3PX3A 5D3ZA 2MMCA 1C0LA 1QHSA 4WLVA 2J09A 3W79A 1C7RA 1WD7A 1RC8A 3MWGA 2Q9BA 3OE5A 1AKVA 4U2EA 2WG1A 3WFZA 1B26A 2WVHA 1YQEA 1SFRA 4URFA 2P68A 5LQRA 3S1SA 5EP4A 5CT5A 4C4SA 2YZGA 1EYZA 1A76A 1E69A 2CUKA 3IPLA 2PMEA 1XL1A 4HAIA 3WNDA 3ECAA 2QA5A 5C1IA 3CLSD 3DBRB 2B1IA 4YJ2B 2XBLA 3CLTC 4XQEA 1Y6GA 2OCIA 4X20A 3KTDA 4Q48A 2C9MA 3VDNB 1QUEA 2ES4A 2GEVA 3P26A 5FA6A 1B74A 3UIEA 4YJ3F 4P6VF 4G0UA 4WBNF 5NULA 3JWJA 4OSPA 4C5AA 1XZMA 3W05A 2XY4A 3TFWA 5GINE 3PD7A 3BXZA 4DSAA 4W6QA 2JGNA 2CMDA 2C59A 1E64A 1U0OC 2CVQA 3H9GA 3PXUA 3CNEA 1MN6A 1CQIB 1L7DA 2P91A 1UMBB 4KYIB 2Q27A 3WIBA 3AG6A 2WIFA 5EIBC 2V7UA 4JC5A 3ZBQA 2QV0A 2PX4A 5J1SB 4N65A 4P80A 2XCOA 3BORA 5JI2E 3MWLA 3OCVA 2DCMA 2XDQA 5DNVA 3G9UA 3IAAA 1DJNA 5I5EA 4BO2A 4LOAA 1V4VA 4YVFA 4K8OA 3TUZC 3OX4A 1PW7A 2I1WA 1M8KA 2PJUA 1ZBDA 3GUVA 1Q74A 3OIYA 4HLDA 4KQ9A 1J97A 1EXNA 3CBGA 4QSMA 5KYNA 4QDXA 5M2QA 4YMWA 1XDWA 2C2BA 2Q5IA 1A8SA 4LZLA 2XYGA 4J0FA 4ZQFA 5K3FA 2XX3A 1E1DA 1XQYA 3R7BA 1G3IA 1UZAA 1L7AA 2QN1A 1JFSA 2LW7A 4J1NA 4LNUB 3B2QA 5A3RA 3CGGA 3Q3HA 4D98A 5KQPA 1CDZA 1NFFA 2K4MA 3CEAA 3LLCA 2M6SA 4I9UA 4XFJA 5FADA 3WGOA 2FZ5A 3X2SA 4B3TB 1L6IA 3A14A 4HB0A 4C0QC 3P2YA 1PL8A 2W70A 3WL8A 5C52B 4BZWA 1IXYA 2V59A 4A36A 3QW2A 5JH7B 1ZJ4A 2W7TA 5G0UA 1IB0A 1OI2A 1GZDA 1KFKB 4F1KA 2YWXA 2VT2A 3DVRX 1A9OA 1KSJA 2JCSA 2PS3A 4W5JA 4YP6A 1LBTA 3D3JA 4GLBA 5K4HA 2HF2A 4QBHA 3MERA 4FN5A 3LC2O 5LZ9A 3QI2A 2GNOA 1JFVA 3C8UA 4N7JA 4I6GA 1ACMA 3MGKA 3VNSA 3H17A 3EOZA 3KHUA 2HWUA 4MPJA 4AZVA 1KKLA 1ODKA 4TL6A 4PG8A 1I5OA 5DEOA 3D54D 4Y8VA 1CRLA 3ZDFA 4EKEA 4G0NA 1H2BA 2HHJA 2HA6A 1JAHA 2BFPA 4B7XA 4ENPA 4LDNA 1SMKA 2EHJA 4FHZA 2BFBB 4B3HA 3RS8A 1KETA 4TV9B 1H8EA 2NTVA 5KNBA 5T7BA 4RZQA 4L3WA 3U40A 3A7DA 3L43A 2ERCA 2PVCA 4KGXA 3S2EA 3TBKA 2H31A 4LK2A 1XZBA 2XUHA 3RR2A 3WGZA 3MIIA 4J90A 3V1UA 4DRXB 3AKZA 1FSPA 3SJCA 3TE6A 1WPGA 3BK1A 3K0CA 2OG2A 3ZHVA 5F76A 1GAEO 2UZIR 5EYPB 2OB1A 1JWAB 5BMVB 4R40A 1U28C 3DZDA 4ATNA 2L42A 1V0JA 4KMOA 1XMPA 4C14A 1N8TA 3UJ7A 1JDTA 3USES 2ZBDA 4IUDS 3I12A 3NDRA 3QVUA 3QIAA 3DHYA 4U7TB 5CJJA 4BO4A 1EZ1A 2EP8A 3NWJA 4K0RA 1S3FA 4PG6A 3UT0A 3SYNA 1QAQA 2HA5A 3IPYA 2JLZA 4XX1A 4O4JA 4HWSA 3B7GA 1FX1A 2NP6A 3JALA 3K73O 2P9HA 3QITA 4JP2A 3SR3A 1L1QA 1N25A 1RC0A 4BFSA 5JXHA 3DPIA 5E3HA 1K8XB 4JKOA 1AIPA 4HB4A 3RRYA 2ZK7A 1BWQA 1PTJA 1XLTC 2OMKA 4FX5A 1Q5PA 4EF6A 3PITA 1OH5A 4IWYA 1YGPA 5JOQA 1AE1A 1F60A 1M2OB 4IBOA 1AGYA 1UBTS 1Y3DE 1RZVA 1U2PA 2CNKA 4Q93A 2EWWA 2PT9A 3A9TA 4FJ0A 3THRA 5E6RA 3QTLA 3L5OA 1PJAA 1OC2A 4JSTA 3SQNA 4FU0A 1UFKA 5KDLA 2VI5A 3P0JA 1UWLA 3JQBC 3O26A 1JFFB 1NSFA 2QR2A 2YWRA 3DAOA 1FMCA 4DIEA 4EBBA 5CM2Z 1QCCA 1A69A 2IZ1A 2O2XA 2Z4TA 3RS3A 2WSSA 2X1HA 2H85A 4JHXA 2WOOA 4M60A 2JF0A 4ZV9A 1UT5A 3G5AA 2YYYA 4CMIA 1N32B 3FTNA 1B0UA 4D0NA 2NUPA 4Q82A 3UWPA 5JS8A 4E5NA 1C50A 3LT1A 2JVJA 1W6UA 3L1VA 1DKPA 2YXBA 2Z56A 5EIWA 2NUTB 4LHWA 1COZA 1QCZA 4US1R 3H4MA 4JXKA 5TPZA 1HQYE 3VJLA 1W94A 4MI9A 3IUYA 4KK3A 2C8KA 4YAOA 3KPJA 5G0SA 3UGQA 3EN0A 1U9JA 1E6WA 2UZ1A 3NHZA 4GH5A 4R1PA 1NVVQ 3GUZA 4UU7A 5JCOC 1Q3KA 3R0ZA 4O4JF 4XR9A 5A6SB 2X1VA 3DEAA 5ALGA 1A2OA 1FQOA 1T5IA 3G17A 4D8YA 2UZ4A 2LRHA 2HJGA 3I2HA 4REQB 3S70A 3AJRA 3W5IA 2JARA 2GWRA 2XOKA 3RJZA 5JWRA 3S2YA 5KWJA 2QR5A 4K3UA 4E5DA 1I3CA 2IXGA 3V6MA 2J0EA 2E87A 2Z3ZA 3NAZA 2R00A 2VSOA 5E1MA 3MTIA 2IRWA 5T3YA 2UZ3A 1ZEMA 1QYIA 2RCNA 4PLPA 5HKAA 1EMDA 4O2AB 2HWYA 4Q4HB 2EKLA 5DHTA 5FL7D 1DKUA 4H6XA 4HBGA 3K96A 1Q20A 4KXVA 2D1SA 3CF2A 1M1YA 4IW3B 2GEBA 4BP8A 1C80A 3A6KA 3OLXA 4Z53A 4MQFA 1P0MA 2RHOA 3C5EA 3G2NA 4RE6A 1X7HA 2B20A 1SU4A 1ABEA 1ZNZA 1R6VA 3QTBA 4OXXA 1OAAA 2NU7B 1RU3A 2OGSA 3RUHA 3IUPA 3GZTB 1PWZA 1GZ6A 2ODTX 5DNAA 2H1FA 4AW9A 1SC9A 2ZQZA 1EUQA 4KO3S 5FI5A 1QQAA 1PV2A 2RAUA 1OT5A 3A9RA 3JARB 2XUOA 2HLHA 5G0TA 1JEOA 5KTPA 1WSWA 2VKTA 5I4KA 3D8HA 1HURA 4CFYA 2XAUA 3HYNA 4CM7A 1DAOA 3JSAA 4X6XA 3DLTA 5E1OA 5IJ0A 1UFQA 3IQIX 1X7WA 2D74A 2GTPA 1X1TA 2Q6IA 3L4SO 5LB4A 1RW4A 5A4DA 3B20A 1Z26A 1ZAKA 1OT3A 3OF5A 1WXQA 2QTHA 2HCJB 3SC3A 4JXZA 4KH0A 3BKWA 3R7FA 1NLYA 2WSIA 4KSYA 3WP0A 1XNQB 1Q0LA 3LJKA 3V7NA 1GDHA 3LQQA 4KV9A 4WH0A 5JISA 5LKAA 1QOQB 4EI7A 1N1GA 4I1UA 1NC1A 4UAUA 2B3DA 1UODA 2CFOA 2G08A 9GPBA 5JU6A 1KFEB 2GNPA 3KZKA 2YHSA 4U3JB 3TRDA 4QTUB 1WDKA 4L07A 3QE9Y 4J4TA 4HN4B 5K0EA 4UUAA 1N4AA 3U0VA 2VRCD 4INPA 5AFSA 1WBBA 3QLTA 5LVAA 4DYHA 1R66A 4O6VA 3SP1A 4M0MA 3F96A 2IIQA 4UHEA 1J8VA 3BTOA 3HVJA 3NJ4A 4U63A 4OB7A 5IJZA 1Z5PA 4WCFB 2C04A 3SF8B 1UXIA 4COKA 2D2XA 5TR9A 2J45A 3EPJA 5FF9A 2YTZA 4IQ8A 3VHXA 4RTOA 2J9FB 2QAGB 2QXYA 3VM6A 3TOVA 3WRYA 1SVUA 3RYCA 1KXZA 1U98A 3L0OA 5F9HA 4I9FA 3UUWA 2GERA 4B33A 2WU3A 4W63A 1D0VA 3HI6A 3ZH9B 1AD2A 3HG7A 1BQEA 2RK6A 3E4CA 4V2IA 1CKEA 5FAXA 1J56A 4L57A 1WRBA 1JDJA 2DSNA 4CG1A 4UMFA 3VPAA 1KFCB 2VRBA 3ICOA 2XB6A 3GLVA 1OYOA 2NVBA 1VYTA 4A8HA 4J07A 2V6IA 4DQDA 2I66A 2FHPA 3VHRA 1KHHA 1B8VA 3DBIA 4C43A 3QKUA 1IZ0A 1JEQA 2IYQA 3WMWA 2AL7A 1UDCA 4YBRA 1D09A 3FB4A 3KAJA 1MQ9A 4GZLA 2WQ7A 2F4VB 2EARA 1JNXX 1WEKA 1SOMA 3AW9A 3DKKA 5DLQC 1G8JA 3FZEA 2GM5A 2RGNC 4Q66C 4TVOA 1P2FA 1MAWA 1P29A 2R1ZA 2Y0BA 1UM8A 4JA2A 4W4TA 5ALUA 1QV9A 2KLBA 3D4BA 5ER6A 3UKDA 3DKIA 3EB9A 1YRAA 3LQYA 4XDHA 5EE1A 2PGAA 4IF6A 5BN5B 4RENA 3HYRA 3OIGA 1PV4A 1N8SA 1I7LA 1P60A 1AKWA 2PY6A 3MWDA 3R9IA 3ZW8A 3M6FA 3HN6A 1OFIA 3PKJA 3FSRA 4JBLA 4RQUA 6LDHA 2PANA 3E18A 1E0AA 2OSBA 2O1SA 1QRTA 3D0KA 4PX2A 2PYIA 3EDCA 4YQZA 5FBKA 1RRVA 3R6WA 4PV7A 3TLGA 4CLEA 2WZBA 3CR7A 3HWRA 1EVLA 2ZLBA 3UK1A 3FPGA 3UY4A 1PNRA 1CZUA 4GMDA 1LA2A 3TSAA 4HCJA 3U4GA 3I9JA 1W8DA 1NY5A 3K8ZA 1I4DD 3FCSB 2NZ2A 5KJCA 2A1TS 3GPLA 2CYCA 2WKQA 2ZI3A 3V4VB 3H4IA 2CJWA 4OH7A 1NXXA 1SHUX 4QNMA 2F6RA 4LSMA 2AQHA 5D3MA 2IPAB 2VJOA 2WSYB 3IV6A 5LMUB 4J0GA 2YMPA 3LDUA 3LYAA 4BLOA 2ZJBA 3HJFA 4C7VA 2AFVA 3WK6A 2IV3A 2I4NA 3LHKA 3UUGA 2NV0A 1CQZA 2PX2A 2II6A 3REQA 3DEZA 1VECA 3DB2A 1GPLA 1PLJA 3E5MA 5JBNA 2O8BA 1C3OB 2GHIA 4MVJM 1IVSA 4HLNA 2NO7A 2INGX 3TMAA 2DCUA 2YQ5A 1CZKA 1TU0A 2JGDA 2IE8A 5D00A 1D2EA 2IU0A 5DK4A 5BSTA 4PN3A 3SBXA 4M21A 3NKFA 1VL1A 2R4TA 2J6IA 2ORED 3VSDA 1HYEA 5TV2A 4ZI3A 2XUPA 3QMPA 1OTXA 3C6ZA 4ZGBA 2V5AA 3TIIA 1FNMA 3AESA 1DB3A 1I0LA 1GIAA 4Z1MD 5FPHA 4WOKA 3OLWA 1DTSA 4ZPXA 4DLRA 3U4IA 3TBFA 1EIZA 2Y1DA 3MLBA 1CUVA 1W25A 3FRHA 3CA8A 4DMUB 5TY0A 4U7GA 4MV8A 3ZQ6A 3FPFA 4IIJA 2ATCA 4HK4A 3NYRA 1VTKA 1CR6A 4WY2A 5A7GA 4MHSA 4FCTA 2G36A 2V3WA 2P8JA 1JDBB 1JR3D 3THXB 4MVJP 2W98A 4YRJA 2IDZA 1QC5B 2BDTA 1HT2E 1ND5A 1TAGA 1Z0IA 2EW1A 1ZW1A 1XZPA 3C70A 2B7BA 3LC0A 3WLJA 3ZWPA 3JD3A 1NXWA 1YQQA 2CE2X 2XCLA 2RD2A 3MM4A 4M36A 2W42A 4UHHA 4PO8A 4JI5B 2I34A 5JARA 2A0UA 4P4SB 2ZIVB 4WGFA 5H68A 4RXMA 3MTGA 4GW3A 4UPDA 3CZCA 1Q7TA 2GN2A 4L8VA 1AF4A 1BX0A 1ECLA 4OQNA 4X8HA 3W3ZB 2G88A 1V45E 1KR5A 2FV8A 3IGFA 3OWXA 5EQDA 5HOQA 3AJ8A 3IELA 1T1GA 4X00A 3KPUA 4IDCA 3KPYA 4N41A 1P4HA 4B83A 1X86B 2XMBA 1FIUA 4ER0A 4P4TA 4MR9A 1IHUA 3CZQA 4NCJA 2EFCB 1FDOA 1ORRA 1XC7A 2VHYA 2CMKA 2B8WA 1KPHA 1GILA 2FCRA 2WHQA 2ZI5A 4DUZB 1L5VA 1NM5C 1K89A 3TJRA 1YD7A 1ZISA 1Q1AA 1Z3CA 4MVYA 4DLPA 2JGJA 2ZUCA 5CLGA 1GXSA 2NV6A 3V4PB 1ZBQA 4GLLA 1XVVA 2C2ZA 2WAOA 1FDSA 1YHYA 2EKDA 2JCVA 1XVTA 3TR5A 1Z8DA 3LECA 4IIJF 1FXSA 2B4QA 3RRNA 4ARZB 5AK3A 5GZ1A 3PTZA 2Q50A 3S1LA 4Z54A 3LGXA 3FNRA 4OK5A 5EJ9A 4IZHA 2NXCA 3KJFA 4A23A 1MAUA 3DMHA 3EMBA 4MKZA 1QP0A 4NAUA 4N18A 1GCUA 1XEXA 2J6BA 3BL8A 4MRSA 4ETIA 3ZI4A 3A1EA 2CLIB 2I6QA 3TZ6A 2VXYA 1E5TA 2YXLA 3TI9A 3BIOA 4CEJA 5KYGA 4DDTA 2GNAA 3NYIA 1LS6A 2XMQA 5REQA 2UUOA 5LP6B 1L8OA 3UMSA 4QQNA 3A06A 1N75A 5JXIA 1J2EA 5IANA 4RVOA 4AY2A 1HDCA 1E8DA 2Z1NA 4IO1A 5TNXA 5JZVA 2JFWA 3KKOA 2JIQA 5JJLA 5KOYA 2Q5CA 4JR1A 2R2GA 4MARA 2JLUA 2C7OA 4AO8A 4IXDA 2B6NA 3RO7A 1CRQA 1U8XX 4FCVA 4P2BA 1CE8A 4XM1A 4DCPA 4HDSB 4M89A 1N6KA 5A03A 3P2MA 3MW8A 4L4RA 4U8HA 5BSEA 1DWOA 1XVIA 1T3TA 1E1NA 1SD5A 4R2XA 3UOAB 4Z4EA 1OLSB 2BKXA 1Z73A 4J0IA 4KFUA 3K9QO 4UHKA 2CL7X 3JTEA 4G01B 3ITEA 1E2UA 3FOCA 1MB4A 2FFRA 5FHQA 4MW5A 4ZVQA 2JGMA 3ORFA 9LDBA 2VF2A 4LRWA 4NESA 3OZDA 3ETHA 3L0ZA 3SS9X 4RLSA 5DLEA 5TGTA 5EPOA 3O0TA 3A1UA 4DRZA 2VQEB 5K3OA 3MJVA 4HFNA 3VI3B 2FRDA 3KJZA 4F6LA 2OP1A 2TS1A 2EL7A 2JIPA 2VTKA 3STVA 2G5TA 4UNNA 3OLYA 1K7FB 1UPXA 5KWIA 3SZUA 4OQEA 2FWMX 4R2HA 3GJ6A 3BF7A 3MINA 2QRGA 4HNUA 1FSSA 2CC2A 5IK2D 4L9AA 3AT1A 3HP4A 1N5DA 3HK2A 3UCEA 3UO8B 3ZY2A 6NULA 1GKUB 2OECA 3JCZA 2R87A 4RKEA 2P4QA 3W2GA 2W6JD 3ANSA 3LO5A 4Q3OA 4XR4A 3RNOA 4K2HA 3BXPA 4CTNA 2ZSEA 1JA1A 2I7VA 2G1UA 4XDZA 4BLUA 4I4CA 4Y18A 2Z5FA 4W9NC 4E5SA 4E33A 1T5TA 4ZRMA 3FH0A 5AM3A 2ROQA 1W4BA 2IYOA 2EEPA 3FBGA 2AFHA 2CF6A 1UOPA 2HBYA 4EHDA 1RJEA 5LBUA 2EG9A 4F85A 2HNAA 3HY3A 4UBMA 1CUFA 1J99A 4DOMA 3KOXA 1NQ5A 1Q0UA 2WIKA 1TQ2A 3I28A 4M7RA 5G4LA 1XRNA 1EUCB 4WCFC 1USWA 2H4YA 3U3DA 1G7TA 3WQRA 4QYIA 1RHKA 4AJIA 3FUXA 1G0OA 2WMYA 4XCVA 1MX9A 1RVDA 3TFOA 1Y4ZA 1DAHA 2IHTA 1GRNA 2WJIA 4GYJA 4RKYA 4EM6A 1DO2A 5B4TA 1B6TA 3EIOA 3I83A 4N3CA 4LOLA 4MMXB 2QW8A 5FTKA 2FEWB 4B6FA 4MDEA 1A9ZA 1GNRA 3L4JA 3A3NA 5A5EA 3QKRA 3WZLA 2V6MA 1RI4A 1XELA 2ORYA 2E18A 1DKOA 3T9BA 3KQLA 1OOEA 1F2TA 1PYDA 3WYFA 2FOXA 2F8MA 4OATA 3SFZA 1M0WA 4ND3A 4Q4JB 2QIPA 1UAYA 4LCEA 1DBPA 2XMZA 3I73A 2XF2A 2Q3CA 4B9AA 4DDMA 4BNIA 4DCJA 3W9SA 2WAAA 1DXYA 1UBJS 1PK8A 1R8SA 3T41A 3ZCXA 3KOZA 3MCAA 2XIJA 5IKOA 4P8RA 5HRCA 1WM1A 5CXQA 1R10A 1U02A 4GI1A 2PZAA 3LL7A 3QY9A 3TZEA 3HP7A 3C1TA 1DAKA 1GADO 2XXBA 1L1RA 2TMDA 4DSNA 1W0JD 3GB9A 4XGNA 3NTQA 2OFFA 3WB0A 4B7AA 1GWNA 1RVV1 4QM7A 3I8SA 2QY6A 3A1TA 2CLSA 1E2BA 2HNKA 4F38A 2RIPA 5KOJB 1R0ZA 4KUGA 3DCJA 4NABA 4GRAA 4PSCA 4WNAB 3FMPB 3AR4A 3LYLA 1PDWA 1YDWA 2F59A 3KQMA 4M8SA 1TVCA 4P31A 4CKBB 2QI9C 1RYDA 2CUNA 2SKEA 1ZUIA 5BV8A 3EDYA 2QZ9A 1MH9A 1R74A 5K0FA 2PBFA 3DZKA 2PSSA 4DLZA 1OLOA 1MA3A 1Y4AE 3PUZA 4FMDF 5SV2A 2YY7A 4J3NA 4E22A 3GEDA 1MG0A 2JLQA 2XPCA 3GFBA 1POWA 3I9MA 4FUQA 3TM4A 3WK5A 4Q4CA 1K6XA 1QORA 3ZU5A 5ALNA 4R0NA 1SOWA 4OQMA 1GPH1 1Y5MA 3BMNA 4ZVUA 2G5CA 3UJAA 3WQSB 4LVCA 3H86A 5DNCA 1E5XA 5J4HA 5AK6A 4F2WA 3BSYA 4D42A 1A4RA 1RCTE 3LP8A 3KZXA 2O8EB 3AG5A 4NX2A 1IATA 4BX0A 5I9IA 3Q7EA 1YVPA 1Z28A 4L27A 1YB5A 3H5WA 1KEZA 2VNAA 1GAJA 2XMDA 2NVUA 3OAAD 1JWLA 1O89A 1JQAA 1I2DA 1HORA 2BMWA 3B6MA 3PQEA 2EGUA 4NU6A 3WAJA 1ZRNA 1RKUA 2EL9A 2Q6VA 3QX7A 4L5AA 1VBKA 4PAMA 5B6IA 2GCNA 4QUGA 1DJPA 4G81A 4LXYA 3ZI7A 1II8A 4HJXA 2UV8A 2BN4A 2DPYA 1X7GA 1P4GA 2CYBA 4TLBA 4TS3A 4BU0A 4DV4B 1QGDA 1JA9A 2I87A 5B58T 4B4DA 5FBRB 2BFAA 4FMCF 4Q18A 1VA5A 2VRCA 4KPUB 3WICA 4YMUA 4NPHA 1MT3A 2DQ4A 3D7SA 4C22A 2GZDA 2BCEA 4NDNE 4LAFA 1NF2A 1F0KA 2IYLD 2RHRA 4MQ6A 5LKRA 1ISFA 1GZ7A 3AY0A 1SG6A 1JDBC 2PUDA 1B6SA 2J9YB 3GVXA 3NHAA 5H3LA 4TTQA 2VF7A 3OQHA 4W1SA 2CL6X 2CL5A 1I94B 2X23A 4OF4A 4YJFA 1TCUA 4MV1A 5EIOA 3REOA 4FNMA 3UQYS 1V1MB 5ESRA 4TRMA 5A4AA 2ATIA 1TZJA 2X9GA 4BP3A 2EV9A 3DOIA 4R81A 5IFKA 2QJRA 4GOLD 1NBHA 3PGA1 3EGIA 2ZSKA 2QAIA 4EB8A 4YBZA 4H7HA 13PKA 3ANTA 4UFNA 5IW8A 3T4PA 1DTWA 2XB4A 3COYA 3R6TA 4Q9NA 3F74A 3ADDA 2GZAA 2XGMA 4R3NA 3ZYCA 2P3SA 3NOOA 4A15A 2H4HA 4ZOLA 2B34A 3FTQA 2H2HA 1G5TA 3B6IA 2WK1A 3QF7A 1G9SA 2YJ3A 2YS7A 4EJ6A 3ETDA 3VI4B 2C9CA 3HB1A 1DX4A 1CQJB 4HQKA 4FEGA 4M87A 1D3AA 4TSFD 1P1FA 4IQ0A 2GXSA 4RXUA 3FOFC 3EUAA 3KE8A 1FFDA 2IDMA 2H5LA 2IOYA 3OZVA 2FUEA 2ZXUA 2CLKB 2AG5A 3SC6A 3N7AA 1EP9A 2CBXA 3SNKA 1Y7LA 4ARAA 1TB4A 2QY9A 3AUYA 1FYDA 3EDQA 1DWPA 3PGKA 4PQEA 3W5VA 1K5PA 5FEMA 4HV4A 4Q9AA 4UBLA 3R3WA 3E35A 2C7PA 2WJPA 4UAJA 5AHRA 1EVEA 2Y92A 1SVSA 4X0EA 4WZBE 5EKDA 4JYPA 4QG7A 5IXJA 3CWCA 2NXNA 4HBZA 4AO7A 3V4FA 4EB0A 3GCDA 3ZLVA 1RCFA 1MX1A 2W6OA 1SWWA 4A92A 1XPRA 5AWFC 1I2BA 2ZJ4A 1L1FA 3R5XA 2HFJA 2W2XA 4BO3A 1J06A 3SHQA 4D6YA 5LP6C 4JI0B 1EVKA 1SHKA 1Z12A 3CF6R 3L84A 5B12A 5K45A 2GPTA 3PJFA 2D3WA 4RV9A 2FPIA 1AQUA 2XWPA 1M1NA 2GKSA 1L5LA 4PIPA 2O4CA 5C81A 3T1VA 5B57C 3TG2A 1PGNA 3IX7A 4YB8A 4YP9A 2Z9DA 1E3LA 5JDCA 3S2UA 3IAS6 3LZ6A 4ZOLF 5LQSA 2O0JA 3D6JA 3HXMA 4I8DA 2H59A 2R6ZA 4BUJA 2XRZA 3LDHA 1KP9A 3OIUA 4AJOA 1A9XA 1FPQA 4AI6A 3O9VA 3CINA 2ODPA 2XMSA 4BC0A 3F4KA 4NV0A 4DG5A 2Y93A 1QE0A 1BN7A 3LMKA 3WAKA 4HTAA 1DRUA 2B99A 5AUNB 4YAWA 4DLBA 5KTMA 5LN1A 2EVWX 2FSVA 2NACA 2WYHA 5A4KA 2O2ZA 4KZPA 3VYTB 1XIVA 4NICA 2HXGA 1GPKA 4XTCS 2HDWA 1LK5A 2YXDA 3TG8A 4DWVA 4G41A 5HIJA 3COWA 5AIAA 4EFLA 4EKDA 4MPDA 4KPYA 1I1HA 3AI3A 2GZ1A 4ALMA 2GM4A 4RORA 1TDJA 1NQTA 3SLGA 2JCXA 3KSAC 1WMEA 3PC8A 4R2KA 1GYRA 4Y6LA 3AP3A 5E9QA 4MV5A 5A9SB 4EYKA 4QHSA 1YMQA 3KM0A 2EXXA 4S04A 1YJ5A 1O97D 4XPIB 1CEEA 1B3BA 2PX0A 1O96A 3FYSA 1ZVKA 4P7JA 4V1CI 5IF9A 2Q4RA 1SBIA 3E53A 3LQKA 1OTYA 2G7ZA 1TA9A 4QDOA 4K05A 1ZJZA 3Q0IA 4TWBA 1JR3A 1F6DA 2OUKA 1CR1A 1JVSA 3G2JA 5TEWA 2IWHA 3TZKA 1N78A 3MSCA 2C3MA 3GFQA 5DTMA 4I08A 2I3DA 1W1WA 2I80A 3A1FA 1DKQA 1J9GA 4LXQA 4PG7A 4S1VA 2MOKA 1LFAA 3B7WA 3LFUA 2QLNA 3EBOA 4ND6A 2IDKA 4U7PB 1SRQA 5DRYA 3OTWA 2GZ3A 1ZN8A 2OC4A 1N6PA 4XVQA 3R7DA 3WLMA 2EQBA 1TKRA 2KQUA 4S3MA 3NHSA 1P8AA 4AN4A 1R4ZA 1YE5A 2GAFA 2C3PA 2PUAA 1OXUA 3NFYA 2X0RA 5LB2A 1SBTA 4A0SA 2EBHX 2EU8A 1Y9EA 3TLYA 5B64A 3QXJA 2IF2A 1JDSA 3T5DA 2YXNA 3G82C 1VL8A 2AYZA 5FTMA 3KEQA 4RIHA 2G9ZA 2PT5A 3HABA 4LJKA 3HKEB 1DS6A 5KTYA 4PLZA 2CE7A 1AVTA 1H2RS 1ECCA 1P7PA 2VRNA 1S1CA 1Z2NX 1W5TA 3EQ2A 1KWKA 2X6TA 3NHYA 4M1OA 3DUFA 3OU2A 3W04A 4KACA 4B74A 3A3KA 2XVXA 5KYUA 4PLVA 1VXRA 5HTKA 2W6PA 3MGGA 4J3JA 5EIAA 5E6UA 5GVRA 3UG7A 2RB5A 2CVZA