3D3NA

Crystal structure of lipase/esterase (lp_2923) from lactobacillus plantarum. northeast structural genomics consortium target lpr108
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
273
structure length
245
Chain Sequence
b'MQVEQRTLNTAAHPFQITAYWLDQISDAVDYPIMIICPGGGFTYHSGREEAPIATRMMAAGMHTVVLNYQLIVGDQSVYPWALQQLGATIDWITTQASAHHVDCQRIILAGFSAGGHVVATYNGVATQPELRTRYHLDHYQGQHAAIILGYPVIDLTAGFPTTSAARNQITTDARLWAAQRLVTPASKPAFVWQTATDESVPPINSLKYVQAMLQHQVATAYHLFGSAIWPQLALRWLQEQGLLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative lipase/esterase
publication title Crystal structure of lipase/esterase (lp_2923) from Lactobacillus plantarum. Northeast Structural Genomics Consortium target LpR108
rcsb
source organism Lactobacillus plantarum wcfs1
molecule tags Hydrolase
total genus 74
structure length 245
sequence length 273
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3d3nA00
2V9ZA 1T2NA 1ORVA 2PBLA 2HA4A 2VT6A 4G9GA 3WYNA 3G7NA 3NGMA 3UUEA 4W1SA 2JGIA 2XMGA 4KE9A 4AMYA 3PF8A 4C89A 3GELA 5FUMA 1IMJA 2H7YA 1QOZA 1MU0A 4IQ4A 5DNWA 1TQHA 2CKMA 1CLEA 1L7RA 2VAXA 2EDCA 3LS2A 3VJMA 4GDMA 3FCXA 5AK3A 4GECA 2PSJA 5LKRA 5A62A 4B0PA 3L1HA 2HA3A 4HXEB 3O95A 2PM8A 3V1KA 5D7BA 1UOOA 2WUEA 3O4GA 4Q1VA 2B20A 1PFQA 3PFBA 3OTQA 5HZGA 1XQWA 1QE3A 3V1LA 5K3BA 1XZDA 4BYMA 3WKDA 2Z3WA 4HVTA 4F0JA 1YB6A 4X97A 4EBBA 5CTAA 5JAUA 4XX1A 3VXKA 3QYJA 4ZREA 5ALSA 1UK9A 3H2IA 5I8PA 4X94A 5KWJA 2XI4A 3LIIA 4X6XA 1JU4A 2DHCA 3W05A 5FPQA 2QT9A 4FFVA 3SX4A 2RONA 2XLCA 3HEAA 3V1NA 4Y2XA 3D2AA 3RKSA 2XUAA 5AOCA 1P0QA 4UBIA 4WCVA 5DWDA 1XRMA 1R3DA 4DSAA 5HCUA 3D5EA 4AZ0A 4CFSA 1WB4A 5D3ZA 5DJ5A 5IVDA 2JIDA 3DS8A 1C7IA 4UHFA 4ZV7A 4NZZA 1U65A 2O2HA 4AQDA 2QUAA 3RLIA 2XMQA 1WPRA 1GPKA 2I3ZA 3E0XA 3F8SA 2VSQA 1THGA 3HC7A 3WWEA 3K9BA 5AJHA 3AZQA 1QONA 4LXIA 1ZGBA 4FBLA 1XZJA 4X91A 3H2JA 4KE6A 2XQIA 2WJ4A 1KU0A 4L0CA 5ALUA 2PU7A 4C4YA 2YXPX 4BRZA 4KEAA 4G8BA 3G9XA 5EHXA 1MTZA 4Y2PA 1Y37A 2QS9A 1PV1A 2ACEA 4PSDA 4Y2JA 3I6YA 1QO9A 5ALHA 2I3DA 4CCYB 4X3CA 5AKHA 3IA2A 4JYMA 1RP1A 5IVKA 2YASA 5AM1A 1JJBA 3WWOA 4EA6A 2HU5A 3ZLUA 1A7UA 5ALOA 5BOVA 3CN9A 4BATA 4LYEA 2I78A 4A5SA 4EHBA 1DX6A 2QVBA 3ESAA 3C8HA 5DLPA 2IX9A 1F6WA 5DNUA 5K3CA 2OPHA 4P08A 4PQEA 4G4GA 4FKBA 1M33A 1GQSA 3GFFA 3WK9A 3NWOA 5KWIA 2BGRA 1Q0RA 1GZ7A 3O4JA 1HKHA 1XLWA 4XIIA 2H7XA 5CH8A 1QIJA 5ALPA 1XZIA 2DHDA 3DD5A 1UFOA 1CUHA 1U8EA 5LYYA 2BUCA 1BCSA 5CT5A 4PV7A 5C8XA 3STTA 3I2JA 5K3EA 4CG2A 1EB8A 2VATA 1HPLA 1A8UA 2I03A 4EY6A 2FUKA 1EINA 3DL4A 4OD0A 1USWA 1EXWA 4FOLA 5LKAA 2Y2VA 2XT0A 3M82A 1EA5A 3WIBA 4KE7A 3BXPA 4H0CA 1AGYA 5JD4A 4CCYA 1YCDA 3D2BA 2XUHA 1QIMA 4HRXA 3I2GA 3N0TA 1XFDA 1U4NA 2PSFA 4QDTA 3SK0A 5E4TA 3HZOA 1TCBA 1JT2A 3STXA 1IZ7A 3I1YA 1A8SA 2IITA 2WSLA 4HAIA 5LZ9A 4QWMA 3FLEA 1UK8A 1RYYA 1B6GA 4KAJA 4Y2TA 1CUCA 2EEPA 1JFRA 1BCRA 1DINA 6YASA 2ZJFA 2Y2UA 4HTAA 2H7CA 1N1MA 2CEKA 4BE4A 1DT5A 3FOBA 4X00A 4BDTA 3MGAA 1F0NA 2OGZA 4W1PA 3H04A 1EDEA 5AKXA 2BFNA 2HRQA 1G66A 4BB0A 1CUJA 3WK6A 5AK5A 3WWDA 4G4JA 3G9ZA 4IHAA 3GZJA 1XKLA 2DQYA 4B6GA 1XRRA 2QTBA 4QDXA 3QMMA 5CH3A 1O6GA 1EHYA 4GWLA 4RPCA 5D6OA 5AKEA 1CUIA 2P8SA 2XUQA 1BN6A 5CURA 4U2FA 4CG3A 5HF6A 2GYWA 1H2XA 3IB3A 3FBWA 4DSZA 4J7AA 3HRHA 3E3AA 4CIBA 1DWQA 4PF1A 4A16A 4LXGA 4K2AA 1EVQA 5FXMA 3D4LA 3EQ7A 5FOQA 1G42A 5HQ3B 4UBKA 3B12A 1QIFA 1CUVA 3DLTA 1LBSA 1ZIYA 1XZFA 1YS1X 1P0IA 2XQGA 5K3DA 4B83A 1TCAA 2ZSHA 1VJ5A 5ALLA 4AMZA 1TCCA 3BIXA 3ZV7A 3D0KA 3PUIA 2BAGA 1NX9A 4GBGA 2JEZA 4QDZA 3VVMA 5EI5A 1BEEA 2HFJA 3ZPXA 5ALVA 2B4KA 2OGTA 4AZ3A 2GZSA 2O2IA 3HJUA 4KRYA 3KWJA 1W76A 4OYLA 3H1BA 3R3YA 1LPBB 2PSDA 4ZWNA 1QIGA 1JMKC 5A7GA 1GQRA 3I2IA 3ED1A 2HADA 5LP1A 1BROA 1VXRA 4KJXA 3WK5A 3OM8A 3Q8WA 2W6CX 3H17A 2XUPA 4U2DA 2LIPA 3HI4A 4FMPA 1FFAA 2GBGA 3WWCA 4BVKA 1K6EA 4QLOA 1LZKA 3DOIA 4QWWA 4BVJA 2ECFA 5HF8A 4ITVA 5HQ3A 3O4HA 1X2BA 3FWHA 4CG1A 5JARA 2GZRA 3PUHA 1F8UA 2HL6A 5FP0A 1J06A 3BL8A 2O7VA 4QLAA 5ALEA 5AKGA 2IIVA 3E1GA 5JAHA 1AURA 1X2EA 5AKKA 3D2CA 3QBJA 5EGNA 1YAJA 5AI4A 2Z5GA 3WI7A 3I2HA 2ZJ6A 5K3FB 4AX4A 4BC1A 2FX5A 4KE8A 4OUKX 2HA0A 4Q3LA 5BWBA 1MX5A 4J3JA 4UBJA 2XMRA 3F96A 1EDBA 2V98A 2XQKA 3DQZA 1P0MA 1QLWA 2JBWA 4UHBA 3WL7A 1FJ2A 3G9TA 3O0DA 4OB6A 4Q82A 1CFJA 4FFWA 3FVTA 2VA9A 5JASA 2HRRA 2FJPA 1JU3A 5E4YA 3D59A 2AXEA 2XQJA 2JGKA 1MNAA 1AC5A 3SWWA 4H7FA 5ALMA 1UKBA 4L72A 5AKZA 2OQVA 3C6BA 2WIKA 4ROTA 1BRTA 4AXBA 4GEGA 2WLSA 5EIEA 1QTIA 2PX6A 4NVRA 4IH9A 2DQZA 4XJVA 1UWCA 4DIUA 1ZOIA 1VZ3A 2Z3ZA 4P92A 5AM5A 4F21A 1GPLA 3I1IA 5K3FA 2Q0XA 2CB9A 4U2EA 2WIGA 4RNCA 3PFCA 2QXUA 4WDRA 4G9EA 2DFPA 5AK4A 3AFIA 4L9AA 2VQ6A 4PO3X 4BCBA 4M0FA 3FVRA 1UK7A 5DNVA 4BTLA 3AINA 2JEYA 5ALJA 1CUSA 1FSSA 3M3DA 4B0OA 3HLKA 3TJMA 1TRHA 4UBMA 1TAHA 2XUKA 3K2IA 4F5ZA 1XRLA 3UMJA 3G02A 1D07A 1W1IA 3G9UA 5ALQA 1ZGCA 1VE7A 1QJ4A 2XQFA 1EH5A 5AI0A 1SC9A 3VKFA 4CI9A 1WM1A 2CJPA 4HZGA 4YPVA 1THTA 1QIEA 3FSGD 2C58A 2CZQA 4P9NA 5CBKA 4BAZA 3IUQA 3B5EA 4ARAA 5ALNA 1ZI8A 1H22A 4DNFA 4V2IA 1KU6A 5AM0A 2XMDA 2ZSIA 2PKYX 1EB9A 5AM4A 4PSUA 3S2ZA 2XUDA 3W9BA 4G5XA 2ACKA 4MJ3A 1CUEA 1UKAA 3AILA 3HABA 4BTVA 5HF5A 2Z8XA 1E66A 1ZI6A 5K3AA 4DLNA 2BCEA 1T4MA 2EDAA 1Q83A 3NUZA 3G0IA 5AKIA 2RGUA 3A2MA 1JJFA 2C4HA 2BKLA 2JGEA 2C7BA 4UFPA 3AJAA 5AICA 4AO8A 3ESDA 2PSHA 1H23A 4QE3A 5AIAA 4AO7A 4BRSA 3HSSA 3E4DA 4G8CA 4BZWA 3DL7A 1IUNA 1E8NA 4BP9A 1EX9A 1JMYA 4LXHA 2V97A 3QH4A 1IUOA 2PPLA 3PF9A 2WJ6A 2WUDA 2O2GA 1E8DA 4KRXA 3LIPA 1XZEA 1VKHA 1FFDA 2WQZA 4C4XA 5ISMA 1TK3A 3BJRA 5EIHA 1BEZA 4Y2SA 3DOHA 5CW2A 2ZYRA 5E2IA 4EZIA 4HRYA 3ZLVA 4B84A 1QZ3A 1W6RA 4LIPD 5AK6A 3WL5A 1OXMA 5BV7A 1L7AA 4HXGA 4MQMA 1YS2X 1UOPA 3D7RA 1EVEA 5EHZA 1N8SA 2HM7A 4FDMA 2OCIA 5A6VA 3MUNA 1CUWA 1LPOA 5CXXA 1R1DA 1LPSA 5DTJA 3ZLTA 2GYVA 4X85A 1ORWA 3V9AA 2PL5A 4QNNA 1ACJA 3ICVA 4CIAA 3DEAA 4KAFA 1VLQA 1HBJA 2B61A 4YASA 2VJCA 2ZJ7A 3WMRA 3VISA 5HF9A 5ALXA 2WFLB 4PW0A 1CUFA 1XZGA 2BUAA 2Y1KA 1C7JA 1R9MA 4F60A 1AQLA 1ODSA 3CCCA 5IKXA 3H1AA 4FLMA 4B80A 4LHEA 4I19A 1CR6A 1O6FA 3WIOA 4DM7A 4ZV9A 4AN1A 4WDQA 1DTEA 2JGJA 1CUZA 3AZPA 5AI9A 3C6XA 3W9UA 1XRPA 3PE6A 1OCEA 2JGFA 1VXOA 2G5TA 3EF3A 3HYSA 5ALYA 3EQ8A 5C81A 2BJHA 2OCGA 3QPAA 5ALGA 4BVLA 1MN6A 5CMLA 5JAOA 2XUJA 2B9VA 3WKAA 1MO2A 4QZVA 3R3VA 5A71A 2WUFA 3KSRA 2AJ8A 3C43A 3QVMA 2X8BA 3C5VA 2FJ0A 3FCYA 5HFAA 3WK7A 2GYUA 3FAKA 2ONCA 5LLSA 4BCDA 4IH4A 3P2MA 1CUAA 5AIBA 1FFBA 3EQ9A 1XRNA 3I2KA 1DQZA 1XZAA 2GBCA 5AI6A 4YK7A 1ISPA 2WFLA 3G8YA 4K6HA 4BAUA 1UT6A 1CUXA 4C87A 1EI9A 4AO6A 4ARBA 4X92A 3KWFA 5LIPA 3C87A 4G8DA 4UHHA 3JWEA 5AM3A 5KREA 3F98A 1EK2A 2XMBA 3X3HA 1IZ8A 4INZA 3R3ZA 1SCQA 2VT7A 3I6ZA 1S8OA 2AJBA 3VDXA 4UBOA 5FDFA 1MT3A 2RAUA 1YASA 2QJRA 5T4FA 2Y6UA 4X93A 3V48A 2ZYHA 4X6YA 1CPYA 3BWXA 3D3NA 4C01A 4MWTA 4C6HA 1QIIA 5EFZA 2E3JA 3QPCA 5ALIA 4HXFB 4GXNA 1ZJ4A 2CBGA 4Y2RA 3TRDA 3W04A 4MYSA 2ZYIA 2HU8A 3WZMA 4Y2VA 2K2QB 4LKOA 1WOMA 1DQYA 5C8VA 5SYMA 4WY8A 3G0DA 1PJAA 3UUFA 3OURA 2JGLA 4EY8A 3GA7A 3GBSA 3IURA 1R50A 1AZWA 3AIMA 1MNQA 4QDUA 2WHQA 1CQWA 2WUGA 1VA4A 1Y7HA 3TEJA 3IVMA 4QEKA 3ZWQA 5AOBA 3HACA 2QXTA 2QM0A 5LZ2A 1QIDA 2CMFA 7YASA 5LZ7A 3R3WA 5JADA 1QO7A 1IUPA 4UFOA 4NS4A 5DYYA 5AH0A 3IIIA 3AUKA 2HFKA 3LCRA 3DJYA 2ES4A 1Q84A 5JIBA 2WU3A 2ORYA 1FFEA 3R0VA 5JAPA 5JYCA 4Y2QA 4P93A 2XMSA 1HQDA 2DHEA 3IUJA 3BIWA 1LPPA 4J0JA 4OSEA 2QZPA 2YYSA 4FLFA 3WWPA 4OYYA 3QM1A 4UHCA 5CXUA 4G1FA 2ROQA 4YX9A 1J1IA 1G4HA 3I28A 5A7HA 3H2HA 4RGYA 5HFNA 1K5PA 4DGQA 1X70A 1HL7A 4WJLA 1GKLA 4K5QA 3F67A 1QFMA 4H35A 3WKEA 5AI8A 4OU4A 4H7KA 1XKTA 5CT9A 2PU5A 2J3DA 1DX4A 4MEBA 2H9YA 4MWSA 1SCIA 1IVYA 4FNGA 1K8QA 2C0QA 3C70A 3K6KA 4K6GA 5CT8A 4J0CA 1CUGA 3DKKA 2QR5A 3B3QA 3EIOA 5ESRA 4W63A 3BJMA 3GROA 4DMCA 3BE8A 3U0VA 1N5RA 3RK4A 1VZ2A 4WFJA 1H2WA 5JZSA 3TGLA 1UXOA 4DNQA 2UZ0A 4KACA 5HKAA 2Z8ZA 5K5EA 1H2ZA 4M0MA 1L7QA 3FSGA 1XQXA 1XRQA 2RI6A 3WZLA 5ALZA 3OPMA 4HS9A 2QUBA 4MEAA 1UK6A 3IUMA 4I3FA 2WM2A 3W2TA 1HLGA 4UFNA 2VJAA 4BC0A 5F4ZA 4QA9A 4Q3OA 2QKYA 3Q0TA 3WL8A 1E3QA 3C8DA 1EK1A 4L3WA 3H18A 4MQLA 3ANTA 5AI5A 2OXEA 4GLBA 2WU4A 4XWGA 1WHTA 3JYHA 3R3XA 3OOSA 3BF7A 2BUBA 4AN0A 1HDEA 5FKJA 3QZUA 3WK4A 5E4JA 4DTCA 4ZI5A 3WKBA 5JD5A 4ZRDA 3A2NA 3U1TA 2GBIA 3KOOA 5FV4A 2XMZA 1LLFA 3L1JA 3ANSA 5HK9A 1TKRA 1P0PA 2RHWA 3C6ZA 1GT6A 3M81A 4B82A 4TGLA 3F9CA 4E14A 5HKBA 2PVSA 2X5XA 1LPNA 5DYWA 3R40A 4B7ZA 4H7IA 1K63A 4BE9A 1A88A 2OQIA 5T4HA 4N5HX 1W75A 1ZIXA 1YSCA 3NOXA 1ZJ5A 2PUHA 3CXUA 3LP5A 4Z49A 5AP9A 4Q05A 2XDWA 1H2YA 3DNMA 5JZBA 4N8DA 4E11A 1MJ5A 5ALKA 1N5MA 2JF0A 3VJLA 4FTWA 4NMWA 5EHQA 2XUOA 4C88A 3WJ1A 5ALRA 1VA5A 5IH7A 3FYTA 3WLAA 4ETWA 4JH0A 4S0XA 4OU5A 4X90A 4EUSA 3VJKA 1ODCA 4E15A 3T4UA 3S8YA 2CUTA 4H77A 1ZD5A 1SOMA 1ETHA 1MX1A 3AIOA 3W06A 2QOEA 2DR0A 4UHEA 4MXDA 2J3QA 2WG1A 3FNBA 4Y7DA 1OILA 5CH5A 4U2CA 5AKLA 3T52A 5CRIA 3KXPA 2OLEA 4Y2YA 1SCKA 2AJLI 2VJDA 2QRUA 4K6KA 3WL6A 1RWQA 4RE5A 5T4BA 5FRDA 3DDUA 5JD6A 3A2LA 2WG0A 1ZI9A 2AJCA 3I2FA 3A70A 2XMCA 4IH1A 1B41A 4OPMA 3DYVA 2O7RA 4KR0A 1CQZA 1A8QA 4JYPA 3OC0A 2QJWA 5C7YA 1Z68A 3L1IA 3PDCA 1YR2A 1TIBA 3AIKA 2R11A 1Y7IA 3FYUB 4DNPA 4N8EA 1YA4A 5JALA 2HIHA 1QFSA 4X7BA 2HA7A 4J0IA 1QTRA 3QMWA 1NU8A 4MYDA 5JATA 1XZMA 3HXKA 3BDIA 1KEZA 4N8SA 1WB5A 4JNCA 3ESBA 4WFKA 2XUFA 1UZAA 4JEIA 3RARA 1WB6A 1CUBA 1LNSA 4IO0A 4AB1A 4B81A 1JKMA 4FLEA 4DMKA 2V96A 1U2EA 3BDVA 1ODTC 4H7HA 4BCCA 1ZD4A 4TPKA 3WKCA 2D0DA 1EDDA 1GPNA 3R41A 4GI1A 3MVEA 5J3JA 4CCWA 4KYVA 2R8BA 1E89A 3ZI7A 1YA8A 4JUIA 1XQYA 1E8MA 5EIAA 5I7UA 3EBLA 2HA2A 1NU6A 3GUUA 2OGSA 1CUUA 1DWOA 5ALDA 2WFMA 1LPAB 3JW8A 3WYDA 2OG1A 5C8ZA 1XZCA 2WHPB 4UHDA 1GXSA 2W22A 1AX9A 1CRLA 1QIHA 3STWA 4UBLA 2WTNA 2QMQA 1XZHA 3FYUA 1R4ZA 1LPMA 3CN7A 2OAGA 2RHTA 4D9JA 3KDAA 3DCNA 1QIKA 2X76A 4TVKA 3F97A 2WG2A 4J0HA 1ZD2P 5T4EA 2BGNA 3H2KA 1CVLA 3ESCA 5SYNA 4G4IA 3WA7A 4DNOA 1BE0A 4BBZA 4BDSA 1AKNA 1UOQA 1VOTA 4U2BA 2YH2A 3AZOA 4H7DA 3M83A 2WHRA 4EB0A 3WK8A 2HA6A 4B85A 2DSNA 1I6WA 3STVA 5ALWA 1XQVA 4UBNA 5A2GA 4QDOA 1UKCA 4GHWA 4GW3A 4OCZA 1LZLA 1XZBA 3WQHA 2HA5A 3WA6A 1VE6A 2XUIA 2J4FA 2OCKA 1G5FA 1ZICA 4Y9SA 4EY4A 3ILSA 4W9RA 3G0BA 4BZZA 2JGMA 5CT6A 4BAGA 2C0PA 1AUOA 4H7JA 3FLAA 4H18A 3I6MA 4Q34A 2C5FA 2WHPA 2H1IA 5JANA 3QITA 5FLKA 1LGYA 3A6ZA 4OB8A 2HHAA 4PSCA 1W4LA 4EY5A 4ZGBA 1DT3A 3N2ZB 1LBTA 5KBYA 3PI6A 1BS9A 4C4ZA 1CUYA 5CT4A 1F0PA 4H7EA 2WJ3A 3OG9A 5AO9A 1ZD3A 2Y6VA 2WIFA 1JJIA 4E46A 4X71A 1R9NA 3C5WP 3RM3A 1FFCA 5D3KA 2OCLA 1MAAA 2HU7A 4X95A 1J07A 1ACLA 2AJDA 4A23A 1GGVA 2WILA 2ZVDA 2XB6A 4WFIA 5H3HA 5LZ4A 5YASA 2G5PA 2D5LA 1XZLA 1WPXA 1JI3A 4N5IX 3V1MA 2HDWA 1MPXA 5AOAA 1CV2A 4M0EA 4UPDA 4W1RA 3H19A 1AMNA 3WJ2A 3IDAA 3DKRA 5ALTA 1CUDA 3C45A 4J0KA 4O08A 3FLBA 5BWCA 3PICA 3STUA 4U2GA 1SFRA 1YB7A 2GBFA 4FNMA 1CIJA 2WIJA 4RE6A 4ZXFA 5A7FA 2RIPA 2WFZA 3C6YA 3CCBA 1K4YA 2ZYSA 3IULA 2DCMA 2OAEA 1MAHA 4J0DA 4DMHA 4I4CA 1QGED 3VVLA 4KAAA 4XVCA 3FYUC 1XROA 4DYHA 5AKJA 3LLCA 2VJBA 5IVIA 4W1QA 1MX9A 1XLUA 3O4IA 1DU4A 5ALFA 2WKWA 3IBTA 4B9AA 2VAVA 4UUQA 1GKKA 2PUJA 2VTVA 3MUOA 1E5TA 4Y2UA 4DMFA 1XZKA 1YAHA 2PSEA 4Q3KA 3G0CA 3ICWA 5AHXA 3STYA 3QPDA 3H0CA 4OB7A 3R3UA 1BU8A 5FPPA 1C4XA 2VEOA 5DTIA 2J4CA 5IVHA 4B9EA 2WTMA 3YASA 5JZ9A 3KD2A 1Q0ZA 5I9IA 4FBMA 1XLVA 3BF8A 3DYIA 5LZ8A 3SC2A 1R88A 2G4LA 1J2EA 4X6UA 2XE4A 4J03A 4LYDA 5AM2A 1WHSA 3H2GA 2G63A 5HK8A 2NW6A 2WIDA 4FHZA 1BN7A 3G0GA 5DYTA 5EHNA 1WCYA 5LZ5A 2XUGA 3QMVA 3IUNA 2C5GA 2XLBA 2VF2A 3O9MA 4FWBA 1CEXA 4J0GA 1W52X 5AKYA 3O9VA 4BP8A 1DWPA 4PNZA 4EY7A 4WY5A
chains in the Genus database with same CATH superfamily
4GQIA 3VPFA 1T2NA 2P90A 3HYCA 4B2LA 1BKDR 1CYDA 5HQTA 1ZBDA 3QJYA 1PN3A 4S12A 3G82C 3GDOA 5CDGA 1LWNA 2OV2A 3PD7A 2IYXA 4PXAA 4UQOA 2Z0MA 4AMVA 4FYWA 4HNHA 3AWDA 4R69A 2YNMD 1A4RA 3AJ8A 2IXDA 3NR2A 3OU2A 5G02A 3MLBA 1KYWA 2H2GA 1EXMA 1C14A 2CY0A 1E18A 3KK0A 1QYRA 1IMOA 4DCGA 5KQPA 3NGMA 3E0QA 3F2IA 1BOOA 1MKYA 3JYNA 4EUNA 2PKQO 3A28A 3ASYA 3HCBA 2WPDD 3LOQA 3AI2A 2XCTB 4S2UA 4FNOA 2G9ZA 4L4ZA 4W5JA 5GJBA 4LF5B 1UBUS 4KQKA 1DEXA 3P0FA 4WE3A 2B8NA 3E7DA 1EBBA 4JMLA 2OC9A 4Y0NA 1R0BA 3GGGA 2ZYDA 4O4HB 1AB6A 1U7UA 3CS3A 4OI0A 5FI5A 2AEEA 2BMVA 5KYYA 2P0AA 2XF2A 3UHAA 4AMYA 1RI1A 4EL0A 4IVNA 1QORA 1C8KA 3VYWA 1GZ5A 1BS2A 1QYCA 1RMQA 1Q77A 3W5HA 2G1UA 2JKVA 4ZI2A 4TZ0A 1IMJA 5FPYA 3DXYA 4C14A 2NADA 3IKJA 4H1WA 4KO3S 4Q3DA 1QNFA 1RM4A 5HFJA 3R5FA 3ZBUA 3MA0A 1GT91 4M54A 2XJ4A 1MU0A 5LP6A 3LLUA 4UCQA 1X7XA 1T8RA 2IHUA 2Z9BA 3AVWA 5IAOA 2NU9A 1A72A 2IODA 4AZ0B 3UWOA 1T5LA 5FBVB 4MKGA 2HXSA 3IMKA 2ZWOA 4YEDA 1WW8A 1FNSA 4IIDA 5TR9A 4GDMA 5KDLA 3MWGA 3BFPA 3GUVA 4GECA 3OEYA 1VMDA 4ZMSA 4KN8A 2WMOB 2JCGA 4DIOA 1VG0B 3A6GA 3KQOA 3OTIA 5E7QA 1TGYA 3A8TA 4CL3A 5IXJA 3DLAA 2G72A 2BEVB 5TQ2A 3SYLA 4FEEA 4JI3B 1OLUA 3JYQA 2IUSA 4BB5A 1V4BA 1I7SB 4O63O 3GHHA 3KE9A 4AT1A 2ZI7A 4ZT4A 4D2IA 4RQAA 2CVOA 3OLVA 2ERXA 3Q7TA 4Q1VA 2WZDA 3PB3A 3PFBA 2XD4A 3TJRA 4R8LA 2P68A 5HZGA 3O8NA 1YULA 1LDNA 5F1KA 1XQWA 2HJ9A 3Q41A 3UJHA 4QM7A 2CNDA 2PZGA 4J0FA 3TRHA 1C3OA 1ZMBA 2FAXA 3DCYA 1XZDA 4BYMA 2DBYA 2X0NA 3MYYA 3T4PA 1XZPA 4ETNA 1E6MA 1KEVA 3RRZA 4EDHA 5ICEA 3U09A 3KLBA 2O2XA 3FWPA 5F5XA 3VBEA 3DULA 1XAHA 4WBXC 4XX1A 2VWQA 1B76A 3WHPA 1NQVA 1TXGA 8ATCA 3AVVA 1LBIA 1ISRA 4ZREA 2D13A 2J1LA 4IV0A 4YQEA 4EFLA 2I6QA 2E1PA 1N2BA 1UK9A 2YBDA 3JYLA 4LJKA 4PR3A 2QLFA 2FZ5A 1F5NA 3Q7IA 4JJKA 4XIYA 5D1HA 5D7NA 2E4YA 4D97A 1Q7CA 4D44A 2R6HA 2C7PA 3GDWA 4X6XA 2HIGA 3IILA 1V95A 3F6YA 3P4XA 4HYQA 4I3HA 3KPYA 7REQB 1ETUA 1JIVA 3W05A 4CEIB 2IXAA 3VZPA 4FFVA 4ZYVA 4YQYA 3LLMA 1D7AA 4QU8A 2JIMA 1XDGA 4EEXA 2J08A 2RONA 2XLCA 1IOVA 4O4HA 3RVRA 3GLHE 5CP8A 3RKSA 2XUAA 4C0WA 4ZOBA 1GZUA 1WTCA 4HV4A 4ECAA 3SKYA 2G0TA 4QPZA 5B2ZA 2RGCA 2Q2NA 2JI9A 3I12A 1D3AA 1QDLB 4P8RA 5DIZA 3STHA 4AQYB 5EMKA 2VZEA 2GCNA 3I23A 3B9RA 1DJLA 4FKMA 3RRXA 1KKMA 3AOEA 1OBHA 3FI9A 3HV0A 2XNCA 1G5PA 1KRHA 3DNPA 2X0EA 2EW1A 2FSVC 3F73A 4M3NA 5L7YA 4AZ0A 5TJHA 4OQMA 3KSAC 1FA9A 3WS7A 1NHWA 1QVRA 4NWIA 4BNTA 1VIMA 5JG7A 3TPFA 2JIDA 2BISA 2FZVA 3V8RA 4UHFA 1W36C 1Q14A 1UJ4A 4R6WA 2OECA 2O7SA 4GLJA 4YJDA 4DCNA 3U4HA 1N8NA 3QE9Y 3L0DA 4ZCRA 4ZJUA 8ADHA 4NZZA 1A95A 2P40A 4ZOLB 2OBMA 1EXNA 4FN4A 5IUJC 3LBYA 2ZAOA 4A7PA 2HN9A 3AQIA 3B9QA 3JQAD 4CQMD 1I24A 5BNTA 2BEVA 4TYPA 1Y5NA 3FKSD 2OA0A 2XMQA 3GLFE 3SFTA 1WKVA 4NL4H 4XRRA 5JZVA 2D1FA 3EY4A 1GPKA 5JECA 1Z2PX 2VDQB 2Q99A 1O94D 2I3ZA 4QU9A 4WAUA 4BNJA 3F8SA 1AOXA 4RDCA 6AT1A 2ZWPA 5L3RA 5HSGA 3QU5A 4C6TB 3IS3A 1AHIA 2AT1A 4UD6A 3MB5A 2QW8A 4X62B 2W2TA 4R5MA 3TPCA 1DLIA 2R44A 4YT8A 4MGHA 4GWKA 4YCAA 3AZQA 2Z2YA 1Z3IX 3RTDA 1QONA 3NWEA 1VSUA 3C74A 1DG1G 4IXNA 5F7XA 1XZJA 1UPCA 1JAYA 3U7EB 4JS0A 2ZP1A 2IGBA 1ZNWA 1XC7A 2Q4OA 1MENA 2WJ4A 3COVA 4WXPA 4JN6B 3HZRA 3T38A 3NEYA 3PC4A 3OJEA 2IHBA 1GZSA 4HPWA 1TTTA 1NASA 4LBVA 1OXSC 3P20A 3RVPA 4FYJA 1E77A 4OGWA 1DP4A 1MD9A 1RWKA 4JJ6A 3H05A 4O4LB 2V7TA 1XO1A 4G8BA 2P6PA 1MTZA 3K16A 2H16A 7REQA 4CEIA 4R31A 4CIYA 1QCZA 2PCJA 1GFSA 1E58A 1BE1A 3ZTTA 1JVSA 3D4PA 3W78A 2QS9A 3BFXA 5J2UF 4TYWA 3BHIA 3BN3A 2Q3FA 2ZJ1A 4HL6A 1B4DA 3QPBA 5MHTA 3IEKA 4Z9XA 4ZT3A 4AIIA 3EQZA 2IH2A 3FX2A 3KHTA 3EFOB 2I3DA 4OQXA 3MXTA 3B1YA 4RHXA 2WAMA 3D54D 3K4PA 2FDXA 2WDPA 3NAGA 1Y42X 2W2XA 3QXJA 1V4NA 3KDPA 2CDAA 4AFNA 5IVKA 2I7TA 4OQFA 5IFKA 5BWMA 4KGVA 5HM8A 1K6MA 1YQQA 4YIHA 2GESA 2BFAA 3SBEA 1EQ2A 4P4UA 2OC4A 2QRZA 4ZHSA 4INAA 2HH9A 4UOQA 4BATA 3UATA 4Q4AB 3WMWA 4LYEA 4EO9A 2I78A 4P22A 1YRWA 5FNVF 4TT8A 1BFDA 1C0IA 1MHTA 1DX6A 3ET4A 2FEWB 2RK4A 1PBTA 2WSIA 3KZCA 2PH1A 4DCOA 3FNEA 3QX7A 1LFAA 2W8ZA 5DVZA 1KAQA 5AW0A 1NW5A 4ZOLA 4B35A 3V1UA 3I8SA 4OL0A 2ERCA 1JFTA 2QI9F 2OPHA 1IHOA 3FVQA 1KY5A 2BBWA 3N86A 1CZRA 3LO5A 3PIRA 3MQ2A 3WBJA 4DYVA 1G98A 5EZ5A 1E6UA 1M33A 1GQSA 3M89A 2RC5A 1VJ0A 5BN4B 4JI7B 1HMYA 4R3WA 3HGTA 2WJWA 2Y0DA 1IVSA 2BGRA 4QO8A 1GZ7A 3PPIA 1DBSA 4KB5A 1XLWA 1E3MA 2UUOA 1AK9A 1EDZA 4C6TA 1QU2A 4KLZA 3DYBA 1QIJA 4BP1A 4QBKA 2ZIUB 4EKGA 2BY4A 3ELBA 2DY0A 1UFOA 2EQBA 3G3EA 1KK0A 1OIVA 3L46A 3LL4A 4MW5A 5T6BA 4BO5A 5BWLA 3OQOA 1IXSB 2ZRAA 1FJGB 2QVLA 1WXEA 2ZT8A 4BKRA 1UBMS 4U5XA 4PPNA 1U8EA 4K9OA 2I6TA 2WSSA 3OPNA 4G63A 4X8HA 5DEOA 4WLVA 3SM3A 4KLCA 3V80A 3Q3JB 1CS4C 3ZDQA 2DU8A 4YO8A 2EJWA 2YN4A 4PV7A 4I46A 1L3CA 5BQ5A 1JHYA 5EE0A 4DA0A 5FTMA 1WIWA 4CG2A 2PFSA 4R05A 4DG9A 2CNNA 4L95C 2EEZA 3DUFB 4GL4A 3OJ0A 4EGAA 4O4LA 2PUGA 2OMEA 2F3PA 2NVWA 1L7PA 1PTJC 3HDTA 5GPBA 5ARBA 1EJ6A 2BI4A 1YQXA 2NYVA 1USWA 1EXWA 2QI9C 4OI1A 3TZLA 2HJGA 1LLQA 2H8KA 1SCUB 1VSVA 2K4MA 3KZ1E 3VOSA 1EA5A 3H5AA 3WIBA 2RE8A 3BXPA 1G2OA 4UMDA 1FYEA 3EFOA 3FHOA 3MLAA 4PTLA 1YCDA 1FC0A 3D2BA 4R2LA 3MZ0A 1PJCA 3U9TA 2PZJA 3GH3A 1V6SA 1L5LA 3AVPA 1Y4UA 3N0TA 5GV8A 3RU3A 3FXAA 5K20A 1U94A 2E18A 1R6BX 1CFZA 1T0UA 2Z98A 4HDCA 5E1OA 5KTOA 1GGNA 2JCBA 4X63A 1RPAA 3TW0A 4P3KA 3M2PA 1TCBA 2OG2A 3K1ZA 1NBIA 5GM1A 1WEKA 3LC0A 3LSYA 2YQ4A 3QX9A 4Q4AA 5HUHA 3EGXB 4KQMA 4RVCA 3GFSA 3B1FA 3M9XA 3C6KA 2WSLA 3MLEA 4HAIA 3GPIA 4NI5A 3FLEA 4J1TA 3NS7A 4XTRA 1QVVA 1U90A 2D2VA 5JPCA 5DGIA 3U61B 4KAJA 4EB8A 2IYPA 2I3GA 3NAMA 2UXCB 3ILHA 3VU8A 1JIKA 2BL4A 2D2IA 1RWBA 2RH9B 4MZDA 3FDXA 3QQ5A 2ZR7A 3EXEB 2XEXA 2GZDA 2ZJFA 2Y2UA 2ZIGA 4JU9A 4Q12A 3DMNA 5BN4A 1XMQB 1AKVA 2RJNA 1I7QB 4NIMA 3U60B 4D9MA 1KMNA 2LWIA 4EFDA 3FPBA 4MLPA 1ADFA 2BI8A 3I0NA 4TMYA 4GE3A 4BE4A 5IASA 4X00A 3SSMA 2A84A 5A03A 4BDTA 2YVLA 4TQ9A 1SUBA 1Y89A 3ZH9B 5BUCA 3BXFA 2FW6A 2CWWA 4WW0A 2H4XA 3G2NA 3Q11A 2PNFA 1J23A 2TYSB 3LC7O 3T34A 3LDGA 4WOJA 1DAIA 2ARKA 3V42A 3WK6A 1D2EA 1E1YA 4LTMA 1DC7A 5COQA 3QA9A 4HFNA 2YJNA 2QEQA 1KVRA 4MUGA 2P4EA 4U5QA 1WB9A 2B92A 1OWPA 1PDOA 1R6DA 1L5SA 3DUFA 3EZFA 3F9RA 2VHJA 3GVHA 1H1DA 2XYQA 3Q8KA 1YRAA 1CVIA 1PR4A 1X74A 4DW8A 1T9GS 4OQQA 1XPUA 2BGWA 2KQUA 3QLVA 1XRRA 5LJIA 2NZVG 4O4JB 2F48A 3CSDA 1SCUA 3EGOA 2C78A 3ZZ0A 1JHZA 4M7PA 4RJ2A 5BPFA 1WQ3A 3DE3X 5EMNA 2NZUG 4BVFA 4EWLA 1MQSA 2XCLA 1OQAA 1JDJA 4G25A 5C35A 1A2OA 4HGNA 1J70A 3FUVA 5DHPA 3TOVA 1D6JA 3ER9A 5G3YA 5CVEA 1G19A 2BFEB 2W6ID 4D9IA 4MV7A 1OH5A 4WXYB 3GFQA 3FNHA 4PM4A 1L4LA 3IIEA 3L3BA 4FKZA 2G0AA 1LQTA 4UAUA 5KNBA 1RRGA 2RJOA 2Q28A 3L0ZA 1WV1A 3O74A 4J2TA 5TLSA 2WD7B 4QTZA 3GRZA 3EGXA 1CUIA 5LQUA 1N5JA 3PDIB 2W71A 1Z13A 1XDBA 1YFKA 1WLYA 3IVRA 4DSTA 1BN6A 3X1ZA 5CURA 1B6SA 1ODIA 5AW2A 2EATA 3TI7A 2ZJOA 1RAHA 3KRTA 1Z8HA 1E96A 2ASEA 4RV5A 3B2QA 1DKUA 2R7AA 2RGNC 2GYWA 3OQJA 4NBWA 4AURA 1XBTA 3W5CA 1C50A 3D6VA 3PBKA 4HF7A 4L28A 3VR6H 2GH1A 1S3FA 3EXEA 4CIBA 4K2AA 2JHAA 1XQ1A 2QVXX 3D4LA 3I1FA 3EQ7A 3U49A 1OXVA 5FOQA 2BSAA 1G42A 1OTHA 3RRMA 2FPSA 3E15A 4HGQA 2OORA 4RSRA 1HT3A 3IAM6 3WGZA 2GB4A 2WJGA 4KDRA 4C03A 4Q9KA 4G24A 4CM4B 2AFIE 4UBKA 4BFLA 5IH3A 3VHQA 1MRSA 4IFIA 1GTZA 2ZRCA 4OHBA 1CYEA 1F6BA 5JBIA 4B2YA 1LBSA 4LVNA 5L53A 3NRBA 1PLKA 2E37A 3IT0A 2PMEA 3R74A 2AC4A 2E89A 3W5UA 2R62A 5K3DA 2XW6A 1RBMA 5J3JA 1OWLA 4B83A 3AFHA 4PLFA 3GRYA 2IYYA 2P0EA 1IOWA 1SGWA 1ZXLA 2A9RA 1VJ5A 2O1XA 5ALLA 5B6PA 3BVPA 3DEZA 4AMZA 3ZE8A 4EF4A 3ADOA 1JXMA 1KJQA 3G2HA 5ETJA 1TCCA 3IH5A 3ZNNA 2WF7A 4IDHA 5DXFA 2RK3A 4GOND 4B8ZA 2F9LA 5CVUA 4MS3B 3K4QA 4NV0A 3H3XA 4POAA 1KO1A 1EFTA 3T8YA 1VMKA 1QYWA 1YFZA 2BHLA 4M0PA 4QC2A 5K4GA 4JXZA 4GKKB 4BRWA 2VPXA 2OKGA 1VJDA 3RTAA 2JEZA 4RABA 2ZRHA 2ZRIA 3GJXC 4UD2A 1HMPA 3AYXB 3GXBA 4O4JA 4D3DA 1WUHS 4XZ3A 4L6AA 3ZCPA 4AJ9A 2HFJA 2VSXA 3A9SA 3KWMA 1KWGA 4UVDA 1XNRB 3I8OA 2XADA 3VYTB 1T10A 1NV8A 1PLLA 2B4KA 1SKMA 1B74A 4JT2A 2OGTA 2YUTA 1Y9DA 3SEFA 2RSLA 2VOEA 3LKZA 5G53C 2IYEA 3W5JA 2ST1A 1VCIA 2GK4A 3H13A 4V39A 5K8VA 2B4TO 3T3DA 2BFEA 2QRLA 4JK3A 4WL0A 2FFJA 1RHKA 4C21A 3FFWA 3IXQA 1Z2AA 2P6MA 2PSDA 3CJTA 1UKEA 2GCGA 2Q8PA 1U3FA 2V5UA 2RIRA 3ER6A 3QE4A 4LBYA 1OGJA 1P5HA 1VKNA 3VX4A 4D3YA 2I9KA 4BNLA 4KR7A 3L05A 4MGKR 2EX1A 5KCZA 1MEJA 2WD7A 1GAWA 1PK9A 3I2IA 4G1CA 3UJ7A 1HQCA 2FQYA 3PDIA 4KWIA 2E21A 1GPUA 4OLJA 2PKXA 4OHPA 5JCJD 2IZ6A 4DCJA 3C4JA 3S1AB 2BGGA 3R9IA 1RIIA 1HV8A 1R0SA 4A10A 3Q8WA 2EJTA 5CDUA 1SUIA 1FP7A 1RWNA 4C1NA 2B3TA 1ULBA 2XUPA 5E0KB 3WGOA 2LIPA 5IT0A 3ESYA 1IC6A 1Q3TA 2BEWB 2HSZA 2FY8A 4OUDB 3IP1A 4U2KA 1FFAA 2ZUVA 3HEBA 3I1JA 4PGMA 3MJFA 4YO7A 1K6EA 2IY7A 2XIQA 4DCPA 4L75A 1GPAA 3GEGA 5I7RA 4D82A 3EPPA 4BVJA 1ORDA 2YFQA 2GVDC 4N5NA 4ITVA 1MAWA 1IU9A 2HK9A 3O4HA 4LX8A 3KR0A 4CM4A 2P3QA 2C5LA 1ZN2A 4UPVA 3W8DA 4YRNA 1FNCA 3UWPA 4FONA 4CG1A 3PUHA 2IZ1A 1WP4A 2HL6A 3EW9A 2BOVA 4OXRA 2OXTA 4KVFA 2PFGA 5C8YB 2OB1A 1KEWA 4HH3C 2R25B 3BL8A 3OT4A 4DTIA 3WISA 3GRFA 3EF0A 4M1QA 1DBWA 1LC0A 3OIYA 2WKRA 5IXSA 3W2EA 1P31A 4R83A 5AKGA 3MS2A 1WE2A 3O1LA 3W5VA 3LBFA 3T9EA 3ZGNA 4F5DA 3O93A 3UV3A 1P4HA 2NUPB 4DM3A 1KH2A 2IEAA 3DO8A 3LKDA 5AKKA 4EUEA 5K6AA 3HK2A 3J81k 2D3TA 1YAJA 4MS3A 2FNAA 2JZNA 1LJUA 3GAZA 3T9AA 4DYDA 2Z5GA 2Q5QA 1XTUA 1NBAA 2PTGA 2VK1A 3AJDA 4MR8B 2X15A 1KO8A 1YUBA 1XMSA 5K3FB 4R98A 5F3RA 5A1JA 1E1LA 2NU7B 1PL7A 4BC1A 2O48X 4C2UA 4OUKX 4MW4A 1T15A 2X2OA 4PANA 4Q3LA 3TOSA 4BPBA 3HXQA 1JTEA 4FK8A 3RR2A 5JE8A 2CNKA 3GWZA 4QYIB 4GUDA 3UCEA 1P8JA 1KFBB 3Q40A 4HB3A 3WHLA 1FOEB 3L6DA 1YHNA 3UMSA 1SIBE 2GEDA 5JJ5A 5I9MA 4ZYZA 1L5FA 4ASUA 4ZTZB 3OOYA 1K8YB 4KLNA 4LNHA 3VNRA 3ZGVA 2BZ0A 1FU8A 1VSBA 1P0MA 4NAVA 3KQWA 1US8B 4BTEA 2VP2A 4Z4QA 5A6SB 2A58A 4DG5A 3GFPA 3IQDB 4G0ZA 3S1AA 5AQEA 1M6VB 1G5TA 1CFJA 1KGDA 4ZOAA 1WZIA 2GPNA 3OFVA 5EPEA 3Q3CA 3VFDA 4CT5A 5JASA 1UOEA 1FFWA 2IL1A 4RLQA 2O8NA 2QY9A 4MULA 3BSYA 2GJ9A 1KIMA 4RK1A 4L50A 2FJPA 1HNZB 2BEWA 5JAZA 3D59A 4I1RA 4OUDA 4XLZA 3PPYA 1I51A 1NNLA 2QB5A 4AUKA 4CKWB 1LSJA 1WDWB 3ACBA 4FR2A 4FOSA 5DTQA 4JR1A 4DEXA 5AUNB 3UBTA 3H5TA 4TM8A 4A9AA 5CPFA 4CR6A 2EFEB 4H7FA 2MOKA 3C6MA 3SS8A 4LDAA 1UKBA 1U28C 2FUG1 2E2WA 1MJGA 1THMA 4GNKA 4V1CB 2PWYA 2PZKA 1MCZA 2Q2VA 2QUJA 4AC9A 3B60A 4OBXA 4X5OA 2IOFA 1U5AA 1W9HA 2WZQA 3PJGA 5C8YA 3RVKA 1WMBA 1AUVA 4X54A 1BDMA 1COWA 3B7GA 1MR3F 5GMOA 2FG7C 4RMJA 4DR5B 4LF6B 4EHLA 2Y1OA 2NUPA 3BX1A 2ZUTA 2PRYA 3RTEA 1ELOA 5B7NA 4IH9A 4DMUB 4MIOA 4DIUA 1P80A 2QTGA 3V32A 3HM9A 2P2GA 1EJBA 3REGA 4DEYA 3NUGA 3ZDRA 1ZOIA 3EQ2A 3Q2KA 1J97A 5BW6B 2G40A 5GJVC 4Q3CA 1YRHA 4OAQA 5AM5A 3D8UA 1K0UA 4XGIA 3K6JA 3JQBA 2OVBA 4MR8A 5A0TA 1GPLA 3BFJA 3GLQA 1FSPA 1M72A 2ZB8A 5K3FA 4LG1A 1UZMA 1XXHA 2NU7A 3CZ9A 1C4KA 2DULA 4JLWA 1MJNA 3BH0A 4PYQA 4D5EA 4F7WA 3ZU4A 2LIVA 1E9AA 1YONA 2NX2A 1WMFA 3B13B 3WAJA 2CJWB 3OHPA 4HVCA 1ZX1A 2E4AA 1E2LA 4KWEA 4ZU3A 2EGGA 4UU8A 5AK4A 4L9AA 2B7BA 4QYIA 4Z9FA 4D46A 1S02A 4NKRA 3OKPA 1PSWA 2PYZA 1Y6JA 2D2XA 3EZNA 1D5CA 3NASA 1TZJA 3KPJA 1QE5A 3S28A 1UK7A 2AOTB 3TFOA 1J0CA 2GPSA 2J5RA 3AINA 1CWUA 1ZNYA 2C2HA 1SOWA 4ND8B 3VPGA 4NFHA 3TAHA 4BFXA 3H9JA 1US8A 2AH5A 3LQ4A 4RL4A 1W36D 1G8SA 3KZOA 3WGJA 5A6SA 3FNFA 1TRHA 4JWKA 1R00A 4J7CA 5CDHA 2FZKA 3NIGB 3ZK7A 2XUKA 1M6VA 4V0OA 4DSUA 4F5ZA 1GFIA 2R79A 4Q1EA 4XB2A 4ZCIA 1JDPA 1NMSA 4BZPA 2IS1A 3G02A 3ICCA 1B1CA 2AA3A 4IDAA 3NKFA 2AQKA 4AMBA 1RQNA 3O8LA 5K0BA 4CKWA 1ZGCA 1VE7A 2AG8A 4X3OA 3WGNA 5EJ4A 1W5AA 2I7DA 2XQFA 3QU9A 4FDLA 4JOSA 4B6FA 1A7JA 1RZUA 1TYCA 4Q1AA 4FE7A 4RJIA 1FTGA 1YQEA 2QRQA 3VKFA 1AK2A 5CB8A 4FX2A 4W5WA 1H2HA 1VL1A 4CI9A 5EP2A 1XEFA 2RHLA 3PJRA 3M6UA 4YPVA 1KI4A 4V1CA 1V5EA 2PGNA 3I73A 1HEUA 1XDSA 4ED9A 2XWSA 4NG4A 3FNGA 2NP6A 4YONB 4FU0A 4D9CA 5CBKA 3BSFA 4DIKA 4ZVVA 2PLRA 3WLIA 2ODWA 1Y6QA 4ARAA 3K0HA 3LY7A 1NQTA 1LNZA 1NWCA 2GAOA 3KZNA 1UAYA 1ZI8A 4OHUA 1NQAO 5ALNA 2C2KA 4AD8A 1KF0A 4EARA 4JV5B 1J99A 1FPQA 1FW8A 4XXHA 3KEFA 4YGXB 2XMDA 3B7WA 4HMPA 3ZGYA 3BHMA 3C5HA 4JBYA 4TZ6A 5EEGA 4FFOA 2ZJZA 3L82B 1YDGA 1FSGA 4PSUA 1E2IA 3BXZA 3E70C 3OCUA 2G9VA 2XUDA 3S2ZA 4L9SA 5FX2A 2PRJA 1I4TD 4G5XA 3WYFA 1OZAA 3OQ1A 2CJFA 2ZEJA 5EVJA 5E1MA 2Q1UA 1ATIA 5T41A 4MJ3A 4G4SP 5CNIA 4ESOA 1CUEA 2BGLA 1QFXA 2GHIA 1BX3A 4LJ7A 4FFPA 2M9MA 1G5QA 1W44A 2B78A 5I7SA 2WEKA 3AILA 4I81A 5K03A 2AN3A 1K3TA 2CBXA 2Z2JA 5DW0A 4MCHA 4E09A 2CJWA 3UY4A 2BDEA 2I80A 2WY2D 3CZAA 4RMHA 4CVNA 1P75A 2D2EA 2ENWA 5KDDA 1QR6A 3PT9A 2VZ0A 4JQSA 1J9EA 1AGXA 2CXHA 1PV2A 2PRKA 3LPMA 3N0WA 5EMHA 4ICIA 1XAJA 4WLOA 2AOTA 2RG1A 3GAFA 4CMGA 5H16A 4M4SA 2JIOA 2RGUA 3W5DA 5MN5A 4ND8A 4YXWA 1ZC3A 2GJAA 4ERXA 2BKLA 3THXB 4RK6A 2X41A 2Z5VA 1T5TA 3PSAA 2XZTA 1GV1A 2DHRA 2Q1WA 3BERA 4V0RA 2H0RA 1C5KA 3K7EA 3NRCA 4K40A 1OBFO 4M9CA 4NFYA 3ESDA 3PA8A 4FYMA 4IEFB 4KH1A 5AICA 3MT9A 1U1FA 3KL2A 1H23A 4FR0A 3H5NA 4JA2A 5AIAA 5CXSA 1M2EA 2IV2X 3UB4A 4AF8A 3DT8A 2JCSA 4G41A 5I3ZA 4PYMA 3H9CA 4EGFA 1TQ2A 1DJPA 3HWRA 1SXGA 2ZR9A 3EODA 3QFRA 4BGEA 5GIPE 1XN4A 4R0VA 2QTFA 1R16A 1DFGA 3AK4A 3OJLA 1BRMA 4L0MA 2A3NA 5F12A 3JTEA 3UJ8A 3ZDDA 3O3MB 4PPGA 3CZRA 4C5AA 1T8SA 2YBEA 2XMPA 2HMVA 1EX9A 1QHEA 1YQUA 2DH6A 3H65A 4HAXA 4QBFA 3WV5A 4L9RA 1LA2A 4PFKA 4NNJA 4UVEA 5JPDA 5KOIA 2DUNA 1NMXA 4EPRA 1PRYA 2V4MA 1P9RA 4IY1A 2C42A 4GNRA 3FD8A 3X1YA 2W2LA 1C0LA 4F6RB 5J47A 4QUJA 4L5BA 2R84A 4OP2A 4V24A 4Z4EA 2NOAA 3QF4B 3QVKA 4YWHA 2A5LA 3PGVA 3TMAA 1G0OA 3OIFA 1BWQA 2O1EA 2DPHA 3S3TA 3D4BA 5IHPA 4LXTA 3LIPA 5AOVA 1VKHA 4J4TA 1FFDA 1RHMA 2WQZA 4C4XA 2PWBA 3V8QA 5ISMA 1E6KA 1NIJA 1NZDA 1YZKA 1VHTA 3AY7A 3H0KA 4HMOA 4C3OB 3BJRA 3QE2A 1N4AA 2Q9CA 5EIHA 1J8VA 4ZANA 5JAMA 3ZY3A 1C3VA 3LC2O 4MNTA 1DIOB 1NXWA 4MHSA 5CW2A 2REXB 1DKOA 5E2IA 5IEJA 1I3OA 3JVVA 3SSOA 4BMVA 5A3JA 1Z5GA 2WT9A 3IBGA 3U3DA 2WDZA 5ESWA 4CNQA 1GD1O 5EE3A 1QGYA 3GGDA 1UMKA 5WRFA 1MEEA 3SP1A 3T1VA 2IH5A 1YS2X 1W0KD 1UOPA 1I8TA 2Z9DA 2YVUA 4V0SA 1N8SA 5EIXA 4YRFA 4RZQA 3MJVA 4LY6A 4L0DA 1DKQA 1T8WA 2FX2A 4KL8S 1TC1A 1SHUX 3MUNA 3J7TA 3LPLA 1JDBB 1NATA 4WPGA 4ODIA 1MDBA 1Z7GA 2FSGA 3E7XA 4IZ6A 3SHQA 3T0GA 4EVIA 3KQUA 1JAIA 3KSUA 3EGVA 4U0JA 1LPSA 1SVLA 2WOOA 3AR7A 1JXAA 3E5RA 4PG7A 4Q5IA 5DTJA 3U17A 3ZLTA 5CD1A 4HPJB 1KK3A 2GYVA 1KE2A 3THXA 2DPLA 2I1WA 1PJQA 4QFBA 1SD2A 4TWRA 1HRDA 1OYVA 1XP8A 1ORWA 4QTTB 4X85A 3RTBA 3TRKA 3WLEA 4MPDA 2WWTA 1PKXA 3CYFA 4JU8A 3TH5A 2ORVA 4QNNA 3VUFA 2X58A 4E5KA 2X2FA 2RH8A 4WEOA 4CIAA 1IZ0A 3WRWA 3VR6D 2Q49A 2AFHE 3LT5A 3HY4A 3O82A 3AONB 1HBJA 3QOXA 4FCCA 1S4MA 2XRFA 2YWHA 2VJCA 1N2XA 2ZJ7A 1KL7A 3Q12A 3ZK8A 3UV6A 5ALXA 2XSZA 5BSWA 4ZAXA 3L8FA 4PW0A 1TOAA 5EJIA 1WW3A 5KVCA 1C7JA 1YFJA 1R9MA 2RHHA 4WXHA 4G01B 1JPJA 1AQLA 2OV4A 1ODSA 2OHVA 4MI3A 1KKLA 3H1AA 1EM8B 3LM8A 1N36B 4HRVA 2H0AA 3PQDA 4EL5A 2H92A 5HKKD 2FFAA 4I19A 4F6RA 4ER7A 1O6FA 2WNIA 3GO4A 1RWXA 3PDHA 3BQ9A 4GLLA 4NOLA 2IP2A 3Q98A 3TLBA 4DLLA 4RTMA 3QF4A 1NVVR 1CEEA 4FQ7A 4RQTA 3OMLA 3NWJA 1N9KA 3FCSB 3RBXA 3LQFA 5B3KA 1JEOA 3EVNA 1SIOA 1L5YA 3AJEA 3R6LA 5AI9A 3I3SR 1C30B 2ZSEA 2B34A 3RS8A 1J2UA 4NCHA 5CFQA 4HLCA 4LXUA 4ZVPA 3OQBA 4TWAA 3IKLA 1MABB 2RBEA 4LZWA 1B14A 3HXMA 4D74A 1BDBA 1YC5A 2GN0A 5IAEA 2IF2A 1V8FA 2IZ5A 2YXLA 2Q1YA 1S0UA 4G3XA 4MVCA 4Q15A 5DT2A 3E2MA 1II8B 2O3UA 2YJ3A 2PLFA 5CAEB 4AAYA 5H68A 3T4EA 4PRZA 5AVSA 4D9GA 1R0YA 1M54A 4IWYA 3K4HA 4BHTA 4M98A 2OCGA 4QGAA 1G2PA 1M6HA 3ELYA 3AEZA 3QPAA 3BEOA 3ZD7A 3JZDA 3EFHA 1EWQA 4ZQBA 1Z4LA 4WI1A 1KK1A 3OBBA 2R4QA 4LSGA 4BVLA 1Z7YA 5TEVA 1HEYA 4ZZ3A 3P1JA 2NT4A 2BEUB 1A9TA 1N3LA 2BV3A 1E6WA 1JJAA 1HFJA 2WSYB 16PKA 1OJ7A 1ZQ9A 2R86A 3IVAA 4QZVA 3T15A 5JTTA 1S9HA 5A71A 1XCBA 2WUFA 3U31A 2YN2A 1V9CA 2Q5FA 3C43A 1L4KA 5ITZB 5DHFA 5AVQA 3L07A 1GILA 3UOAB 4MPPA 3II6X 5HFAA 1QOQB 4J90A 4YH1A 5KTKA 2W4IA 4GOOD 3RVMA 2DJIA 2COEA 1ZCZA 2H07A 4KTTE 3WSTA 3WDSA 3MQ4A 1OGYA 3HI6A 2OYCA 1DEOA 1PNOA 1CUAA 3CRW1 5AIBA 3CRQA 4Y98A 4B3IA 5ANRB 1FFBA 1NG1A 1TO2E 2Q7DA 2BR5A 5KYNA 4EHFA 3I2KA 2X1VA 5HTKA 1ONOA 3RUFA 4BNZA 1BE8A 3EK2A 5K6TA 1ISPA 3T7RA 5I7OA 2EP5A 2L17A 3G8YA 3GNSA 2VYVA 4L5CA 3AFOA 4QUDA 3KTOA 3QPUA 2JIPA 2H48A 3TEMA 5BUSA 4FD3A 3GW8A 2Q6KA 5B36A 1TLTA 2L19A 1E3EA 1EM8A 2VKTA 1WMDA 4DLKA 2PV7A 2EWVA 4OX9Y 2A67A 1DIRA 4FW9A 2QL6A 4UNPA 1XMPA 5HDQA 4D6XA 2CL7X 5C53B 4YRRA 5AM3A 4BBAA 2PUAA 1HG0A 5IC6A 1EMDA 1H5UA 1JB9A 1A2QA 3DPIA 4KOAA 3KQNA 1JJ7A 2OL4A 2NTEA 3ND6A 1MT0A 4UEOA 1S8OA 4ON9A 1PZMA 3KQSA 1U02A 2ZB7A 1QBKC 1V5GA 2DP4E 1C30A 1QXSA 5FL7D 4AY2A 4URXR 2B4QA 3FROA 5EXTA 1W88B 1QGUB 1Z22A 4IGFA 5ECDA 1MABA 3CTPA 4JI2B 1YASA 4NCBA 621PA 4EI8A 5DH9A 4ZAVA 3OECA 3C3WA 1YS7A 3V48A 1II8A 2BM1A 2LCIA 3JV7A 3JQ7B 4LJAA 2ZYHA 1FFSA 1FMLA 1FDVA 2FCAA 3UNXA 3UQZA 3FBGA 4X6YA 5IAKA 4C4TA 3E81A 3ETHA 2C7GA 4GGPA 4PZEA 1J20A 1RYDA 2MINB 1P17A 2EYUA 3V34A 7MDHA 5FPKA 2JD1A 1N78A 1PU2A 4EAAA 3V5NA 2ANCA 5FUVA 3EEIA 4C6HA 4RDHA 2AUNA 1G3QA 2JFQA 3QWAA 3M8KA 4IW3B 5H3CA 1GGMA 1MPTA 3CFYA 4JLUA 4M1MA 1V1JA 1EWKA 4YJKA 4GP9A 3LXRA 3D5TA 3QPCA 3ZDBA 3EVCA 1Z12A 4FYHA 2BEUA 1UADA 2HMYB 2CBGA 3TOZA 4JP3A 2ZYIA 3P5BA 5CJ2A 5CITA 1LTHR 3QOYA 2TMYA 4HLQB 4JVNA 4FGZA 3HNPA 4QUGA 4WUVA 1E9DA 4WY8A 1REQB 4MA0A 3V7WA 3GK3A 5ITZA 4KGXA 2HD4A 5TJ9A 3RNLA 1XF9A 3FE2A 1J0AA 1QK3A 1V2HE 2EBFX 3BGSA 3IRUA 4TL8A 5AHOA 2GFIA 4CMKA 3OUZA 4DR3B 3HMKA 2EBUA 2CLLB 5EJ8A 2CMKA 4ZQFA 4HI0E 1FSFA 2QM7A 2BZ1A 2LE0A 1ZS9A 4Z53A 3KJZA 3O4RA 1MTOA 4CUJA 4DAEA 5C37A 1ZD1A 4RKYA 1NW6A 3GCDA 4IOLA 1R50A 3ZJYA 4O6VA 4E5PA 1U2GC 1T1GA 4QT4A 1AZWA 3L18A 2PD4A 4WGFA 1UCFA 2ZWAA 3QXCA 2MSWA 5CJPA 3AYZB 4CZ2A 2GPJA 2V45A 4QULA 2AL7A 2WHQA 1ZAKA 4OMDA 4A0RA 2C5BA 4LHZA 4C04A 3WSWA 3D5QA 2IOHA 1IL0A 3P0HA 1JP7A 3TZEA 3IVMA 1Q7EA 4QEKA 3A2KA 3KB8A 5LFAA 2OHHA 4QSHA 2HR1A 2PLWA 4AP5A 5DYNA 1J42A 1QPBA 2B6HA 3O2JA 1FCJA 4RK5A 4FFRA 1PQUA 4ZVRA 4B47A 1LY1A 5JXHA 1GPMA 1UPBA 3BWVA 2Q5LA 1XV5A 3MMNA 1W59A 4JX9A 4DZTA 3T3GA 1MFPA 2CMFA 2GVNA 1E79D 3I45A 1N6RA 1RAFA 5JADA 2IGTA 2P9EA 1AMUA 2QLJA 1XD8A 4PZLA 4LWQA 1W88A 5DYYA 4K9MA 4P5DA 1QGUA 1FVHA 2B4RO 2VFAA 1SWWA 2HGSA 3I37X 1ESZA 4OL9A 4AYXA 1N33B 1EP9A 5DP2A 3EAFA 1E0KA 3IV7A 1RE0A 1ZSVA 3LCRA 4R9NA 2Z2KA 4IMIB 4XDYA 2EZ4A 1ADBA 2RHBA 5JH7B 3IEMA 1U1CA 3JQ7A 2X22A 4D0RA 2A4KA 1SG6A 1J5EB 5C32A 1Q84A 1E4VA 2Y1DA 1QU3A 4G0OA 4RHFA 5JAPA 3W3AH 3WNQA 2MINA 4HUQB 2A5FA 3GMTA 1QG4A 5F1PA 5B1SA 4YDQA 5M34A 3IAM1 4BYGA 5K0ZA 4QOEA 1ODLA 3BE4A 5JI3E 4B8WA 1D0IA 3FOZA 2J3HA 4ZCSA 3NEJA 4CV3A 3PT5A 4MH0R 1DO0A 4JYBA 1QLHA 4X7MA 4YDSA 4B6PA 1QHIA 2QZZA 2QZPA 2RK6A 3KEQA 1G8KA 1ZN9A 3PWZA 4G0MA 4FLFA 3VV2A 1IXRC 5AT1A 2C3PA 3R0JA 2UUAB 3ISJA 1U8FO 2I2DA 4BEVA 1IJBA 1TZMA 3R6TA 4G1FA 1Z73A 5DSTA 4DBLE 4EYSA 5BN3B 1REQA 3KKPA 3V4RA 1M5UA 2PA3A 3GFVA 1FYVA 3RAGA 4BXOB 3LAWA 1L5RA 4DLWA 1WXQA 4D6PA 1W6UA 5CFMA 3OLXA 5AK0A 2PDAA 4IUBS 3I28A 2GQ0A 1G3IA 3H2HA 3K2EA 4RGYA 1K5PA 1X70A 2OWEA 4FBGA 3RHFA 1HL7A 1MAVA 2V74B 3NTRA 4WJLA 1SHJA 1CIPA 3RUIA 1LH0A 1SC6A 1P19A 2HXYA 4MQ6A 3S2FA 4YVFA 3R8CA 4HGRA 4U3JB 2IP4A 5FEUA 1M1YE 4H35A 1HZJA 1NN0A 3WKEA 5K8CA 4EW2A 4EI9A 4B34A 2RGWA 4CBVA 2QRGA 2WOJA 5AI8A 3SZUA 3GJ5A 5FO1A 3WC4A 1ZCBA 1E3IA 1C9JA 2P6NA 4D92A 2RGEA 5EIBC 1YFLA 4YJ3F 1J7JA 1RFLA 5HJ2A 1DNPA 2V7WA 2ZSAA 2PU5A 5DTMA 2J3DA 1DX4A 1JKJB 3DZCA 4JB2A 3KLNA 4CQMB 3JQAB 5CK4A 4MEBA 2H9YA 3E3LA 5FBQB 2NNWB 4IJ5A 1H0SA 4RK0A 4BO9A 3TBKA 1KDOA 1SCIA 4CDNA 4Z6KA 2QRVB 3FPFA 3FY4A 4FNGA 4G9BA 2QMEA 4W9NA 1XLTA 3Q87B 1POWA 4BE7B 2HF9A 2P78A 3B53X 3COZA 5K99A 2WMYA 5IAAA 4JUCA 1LLDA 1K88A 3QP9A 3RTGA 3H7IA 1R8QA 2IWHA 1UC8A 4KAXA 4A2WA 3QEAZ 4EVRA 2EZUA 2XD9A 1ECJA 2ISCA 4MYRA 3RUPA 1XT6A 3BDAA 1BMDA 3ZW7A 2Q3EA 5DX1A 4W63A 2AFRA 3UAWA 1N5IA 2HV8A 2OZEA 3M1LA 5JH7A 4MQ4A 4PFSA 5JBNA 2AR9A 1ZLXA 4R8MA 5IG2A 3RK0A 4OK5A 1B8NA 2V0GA 5GP1A 1OI7A 3RK4A 1X77A 1VZ2A 2V7VA 2GN1A 4WFJA 1DJMA 3KKEA 1S96A 3TOXA 3K5PA 4HUQA 4QBIA 4R1TA 5JZSA 3KT0A 2CLIB 3NC0C 3ADBA 4WJZA 4FQ8A 1G3RA 4R1UA 1Q11A 3IJRA 4E1BA 3N8NA 1OE0A 5K7SA 1T6ZA 2OK7A 1JLRA 1FZQA 2HJVA 2Z8ZA 4TXJA 2KX7A 2W6PA 5K5EA 4LKRA 4D4HA 1HI9A 5IYZB 2NXWA 2W5UA 1DEHA 4FMCF 2I1QA 5JHHB 4ZVMA 1HH4A 2NZJA 1NLUA 2C04A 2OHIA 1A5ZA 1C2YA 4FP9A 1RPTA 4KO8A 4RKRA 3DBRB 5L7TA 5BN3A 3U3XA 3MG9A 2IU0A 2GDZA 1IZ9A 3LZCA 3WRYC 4BXOA 3CR3C 1XDZA 2VZLA 4PHCA 1H4SA 5BSVA 5T57A 3DVRX 4AJLA 2VOJA 4RPGA 2GNPA 1SOUA 1F7VA 4Q7JB 1V39A 2ILVA 2WM2A 1HLGA 5AXBA 1E7YA 2JHPA 1NN5A 5TS3A 2J48A 2ZTUA 2PNJA 2AD5A 3B1KA 3HY6A 2G77B 3PITA 3PC3A 4NYIQ 3NC4A 2P91A 4BC0A 4NHOA 3RYCB 2DERA 1PHRA 3DAHA 4U3JA 2IS2A 1FDWA 5DE3A 1KC3A 2FR8C 2IKQA 3Q85A 3SFZA 3Q0TA 2IC5A 4PXYA 4E5SA 1MC5A 2VJLA 4B3RB 9MHTA 3WL8A 4FDAA 3RU9A 1ID8A 2EW8A 4P4GA 1E3QA 2V9CA 3C8DA 3CUYA 2DM6A 4O0MA 4L3WA 3ZCRA 4V1CI 2DEUA 1HSZA 3IEVA 2HF8A 4EPXA 2AUMA 2QIOA 4LF4B 1NXQA 3ANTA 3F6EX 2AJTA 4NU8X 1JKJA 2IEIA 4B4KA 1Y8CA 3GBVA 3HO6A 2J7PD 4CQMA 3JQAA 2ZFUA 3W7BA 1C8LA 3IFSA 3NTXA 4YCBA 2AZTA 2HSEA 5DXAA 4J49A 2QRVA 2XZOA 4BMSA 4IYRA 2V5AA 1Q1NA 4H1TA 1CRQA 1EA7A 2NSHA 2VYNA 3O5AA 3FWNA 4N6NA 4ZDIA 1BHQ1 7AT1A 2YHSA 4YRPA 2CKDA 2XA1A 3AY6A 3P2YA 1CRZA 4PVDA 3GRVA 3WLRA 4H4EA 4XD2A 4FT2A 3KYJB 2BHRA 3CPHA 3GP5A 3LOUA 4YPFA 3S5JA 4ZI5A 4DTCA 1Y48E 5DISB 1HOXA 1DAPA 3UK0A 4FOTA 3SQNA 4B4OA 2GBIA 2NG1A 4E5VA 3KJQA 5BURA 1T2DA 5BQXA 4ENQA 5FV4A 2XMZA 1JR6A 2R8OA 3PX2A 4M8KA 1N5KA 3LGAA 5E0OA 2IHJA 2IOQA 3FPCA 3ANSA 4UULA 3NYRA 5F33A 4QKQA 1G2QA 3CRVA 4OK3A 3EA4A 1GSIA 4LI3X 3V6MA 3ZHZA 3ED5A 5KNDH 3RI3A 2NSYA 5GOZA 3S7ZA 2VF4X 4E1VA 2NO4A 3JZIA 5CYFA 4G81A 3M5PA 1YGPA 1OOEA 5DGXA 1FUYB 1LF0A 2CUNA 4HVLA 3C2QA 3EG5A 3DV9A 4K9PA 1DAKA 2L2QA 1DRJA 4KSYA 3LRPA 1KQ3A 1H6CA 4RHYA 3E8MA 4YDRA 3CSUA 3KHKA 4F9GA 2FWMX 2MSKA 1VJCA 2VXYA 4G6ZA 3FTNA 4I5DA 5LQAA 3O38A 4N47A 2C96A 4LE2A 1K63A 4P7FA 1A88A 1U4SA 2OQIA 2PGJA 4OM8A 1U3VA 1UKZA 2EQ5A 3DBRA 2OFFA 4UM5A 2GZ2A 1GYQA 3C0KA 4LTDA 4YAKA 1ZJ5A 3D0OA 3D31A 1LWOA 4JBLA 2XIJA 4DV4B 4Z49A 1U1IA 2CDBA 1OIWA 1KH1A 5KX5F 3S2IA 2BTEA 2WHXA 5HZMA 4KFRA 1V48A 3NIBA 1GNLA 3T7TA 2ZZMA 1MVNA 3DNMA 1QVWA 5JDCC 3RYCA 4J1NA 4I1YA 4GI3A 2PA0A 1MJ5A 2P5SA 1F8YA 3QTTA 5ALKA 3L06A 3VJLA 2IRWA 2NXNA 3N28A 1IDN1 4M9RA 3S99A 4XFKA 3ZQUA 1TFRA 2XUOA 3ZZNA 5J1SB 4TUYF 5ALRA 3ZVRA 1M6YA 2W6MA 4MP8A 2J59A 1ARZA 2YVKA 1XK7A 1NI5A 4GPEA 4J9UE 2CZGA 5E4FA 3ROXA 2GTPA 3WLAA 5A2QA 3RS7A 4LJLA 1D2CA 4XRGA 5JWOA 2CJXA 3S0JA 4HG2A 1V7ZA 4N1AA 4LGCA 5GZ6A 1Q15A 5JY6A 1U80A 2XBMA 1EIZA 3N5CA 1ODCA 1GQOA 5EKXA 5JYEA 1C1HA 3L0IB 5JBQA 1TA4A 1IATA 1CE8B 4AP9A 3WIVA 5CFNA 1OBVA 5COBA 1ADJA 3AQ4A 3ROKA 1YBHA 3GMDA 2R751 1H69A 1TMYA 4H27A 4MINA 8OHMA 4GMHA 3S8YA 3C3AA 2JH9A 3RIGA 2H3EA 1V9LA 2JIRA 4GX0A 2EVWX 2BIFA 2VUTA 4OIMA 1W4AA 4BEJA 1VSQA 3URKA 2YW9A 4HMQA 4JLNA 2WTUA 4HYYA 1ETHA 1MX1A 4D9HA 4TYYA 2XTZA 3TX6A 3S8EA 2QOEA 4I55F 1HE8B 1HDZA 5LJLA 2ECOA 2YY6A 3HQ4O 3IQZA 3QBVA 2J6BA 4MDFA 1T2UA 2GRJA 4PPFA 4DWOA 3F8WA 2HCRA 4OGGA 5C3MA 3PC6A 1N2SA 2ZU6A 4KN9S 4S24A 1ZH2A 1A69A 1XTTA 4JDPA 3CVOA 1VMAA 4M8NE 3OU7A 4AJJA 4F9FA 1YZUA 2VSNA 5TIIA 4ZQCB 1ENOA 4DHWA 2IW3A 4LPKA 3K71B 2OBFA 1OLXB 3JAWB 4OXQA 4Y2YA 1CZUA 1SVNA 1SU8A 4TXHA 2X4GA 4DIBA 3VKGA 1HETA 1UINA 1YQ9A 3D3KA 3QWHA 2V6GA 3N0XA 3PFIA 1RWQA 2WPNA 4MVJM 4MV4A 3TCNA 3ROMA 1QQ7A 2LKCA 1CRPA 5KNCA 4QPPA 3DUWA 3HUFA 3DDUA 4F9TA 1KO4A 3BTVA 3DHWC 3I6BA 4IIEA 9GPBA 2WU8A 4MVJP 4ZAGA 1ZI9A 5THXA 1SUFA 1EUQA 1WA5A 3FH0A 3MMXA 1LV7A 3CCFA 4QOSA 6REQB 1ST3A 4BVBA 2F17A 2X3FA 3E3OA 2QLTA 1JS1X 2F3QA 5A06A 3T7DA 2NAPA 4EIWA 3CO5A 1LEHA 3DMHA 2FLWA 3ASVA 2NO7A 1PS0A 1S8NA 2XYGA 4LJ6A 4RQUA 1SHKA 5KHAA 5IT4A 1L7OA 2A5JA 2HI0A 2ONJA 4C43A 3K70D 4P38A 1DIHA 3G2OA 3SHOA 1T4CA 3KB2A 3UHJA 3WMFA 3V3TA 1QYVA 1NN3A 2DCUA 4C7BA 2ZT7A 1OGIA 3PQ2A 1PIWA 3PXGA 3GB9A 3L4KA 4ZQEA 2QYHA 1EVLA 4BLTA 1Z2DA 2OE2A 1Z68A 3L1IA 2MYPA 4FJ1A 2QYOA 3LZ6A 1YR2A 1N75A 1MQ9A 1CNFA 1FP2A 2Q8NA 2XZDA 3FYUB 3GJYA 4ZARA 5FT9A 4P34A 1CE8A 3ZBTA 4DNPA 2ZUEA 1YA4A 5JALA 4Q19A 4YCSA 4URWR 5B1HA 4MRPA 3A14A 4XCQA 1PEDA 4B45A 3KKLA 4WN3A 4ZQGA 5JAQA 1Y9EA 1LTKA 2DAPA 4DLBA 4X7BA 2DFKB 2I6XA 3PEVA 5A04A 2B8TA 5EKUA 1RDFA 5G1NA 4JOBA 4FMBB 3AB8A 1W0JA 5TGZA 2IBSA 4QU0A 4EPTA 1QTRA 1TVEA 1NU8A 1QG2A 3QMWA 4MYDA 1WXWA 2QP4A 3COYA 4RLSA 1P1CA 2D4HA 3PFGA 3UH0A 4DMLA 5JATA 1XZMA 3IP9A 3HXKA 3BDIA 4YN3A 1KEZA 4MV5A 1RPZA 4KUEA 3IDSA 1BW9B 4XUCA 5B58C 1H2EA 4MWDA 2I2CA 4Y6GB 5FR2A 1VHDA 1L5NA 2O4CA 5B3LA 1OYYA 5C7IO 3BMNB 4YP6A 2IU6A 1IONA 3OX2A 1CZLA 1V37A 1WB6A 1CUBA 1OY1A 2J3JA 2QD1A 3L84A 4MKFA 3O8DA 4QXQA 3PUZA 2JLCA 2WTAA 5DBGA 4AB1A 4OEHA 1AUXA 4IV5A 2P67A 4LQDA 4EG6A 1A1VA 2HJSA 1JLLB 2W42A 3CNLA 4KBGA 1ZD4A 5JRDS 3JAWA 1OLXA 3OQNA 3R0ZA 2RG7A 2D0DA 3LC1O 1QG6A 3TOCA 1W2WB 3W4KA 4X7RA 1GPNA 2OV8A 1UODA 2ZGVA 3UH1A 1K92A 3MW8A 4FM9A 3X1KA 2D00A 2P62A 1QHXA 3FPGA 1J24A 4JL6A 4B7UA 2QN2A 2QTTA 2O2DA 2ORIA 3NTVA 2IXFA 1TD1A 1W48A 4R9RA 4O2BF 4I0WB 2YFYA 4ER3A 1A50B 2W93A 1H05A 2LDXA 4Q4JB 1E89A 2X2EA 2ATEA 2W98A 1XQ9A 3IEPA 3ZI7A 3D8NA 1FW6A 3D1JA 2FMXA 3HXTA 1U2SA 1RLMA 3VYVA 5EIAA 5ABPA 3EVTA 4CKXA 2D1QA 6REQA 1GQYA 3CVVA 2W6IA 5J4KA 2VQFB 3N0VA 2JAPA 3CPSA 4F97A 4HBZA 2ZYWX 3GUUA 2ZWMA 2F1IA 4RGVA 2O50A 5I9TA 1ZL2A 1QOPB 4G0WA 1X6VA 2DFNA 5J9FA 9ATCA 1CUUA 3NT2A 1VDZA 1J21A 2ZATA 3OE4A 3EIUA 2WB2A 3JW8A 1AHHA 2C8JA 1E7RA 2QTAA 2QF7A 2WHPB 1UKYA 2Q3MA 3LVFO 2QN8A 4HD8A 4OBBA 1RWWA 1S2MA 3JQ8B 1RTKA 2GX6A 4FB5A 1B23P 2VPIA 4E4YA 5CA1B 5IZCC 1S8AA 2B1QA 3STWA 1SPBS 4KQCA 3ZQ4A 3P52A 3U6BA 4Y1FA 2I33A 2QMQA 3MWKA 5EHIA 2CNWA 1XZHA 1JQBA 3KPUA 4WBNF 4Q00A 1T25A 2R47A 3D81A 4LS3A 2AXPA 1ZU5A 5HBGA 1A97A 4RTSA 4YBRA 3FYUA 2J33A 2R8ZA 1LPMA 2PUCA 3TL3A 1AQ6A 2IW1A 4NYMR 2OAGA 2WV9A 1DQRA 1GNVA 3VZQA 4F3RA 3QW4B 2I1LA 1R0ZA 1KERA 1KQFA 4GI7A 4Z1MD 3DCNA 2WJPA 2X76A 2ZQ5A 2G9QA 3DAPA 1A0OA 4NJMB 3TMKA 4TZKA 1XRJA 1T9BA 4E6PA 2HK6A 2H2AA 4EHHA 1U2PA 4R1SA 3HJNA 3LMKA 1Q17A 1NRWA 4A0GA 1WXGA 2BGNA 2J45A 3ESCA 1RAAA 3ZZMA 2HX1A 1PX0A 3BGVA 2QQ5A 1F2DA 3CTMA 3GJZA 1H9BA 3PI7A 3QVWA 4I4IA 5ECYA 5B7GA 3A7DA 1BW9A 5FTJA 4DNOA 1AXEA 1X14A 2OCAA 5EY5B 1BE0A 5IW8A 1Z26A 3OZEA 5HUJA 2Z8YM 1AKNA 3MC1A 3LX8A 3BMNA 4P54A 5DWVA 3RSLA 2YH2A 3W3AD 3AZOA 4H7DA 4QOIA 1FL9A 2GJSA 1OSNA 1ZH0A 5DHRA 3QGMA 3WK8A 2HA6A 4EB0A 5DASA 4D4KA 3FYCA 4N40A 4BQIA 4XI9A 1F14A 2CVZA 3BQNB 1RAGA 1P4SA 5CLGA 5ALWA 3STVA 4GW3A 4E5YA 2OP1A 5FNZA 3VSAA 4DQKA 2PGAA 1OI2A 1YE8A 2DKFA 3QVSA 1LZLA 1HX7A 1XZBA 1Y5MA 4C22A 3H83A 5FIUA 3L8ZA 1H5NA 3WA6A 1Z45A 2ZT6A 2Z4RA 4AIRA 1Q95A 4CLXA 4Q4JA 2AB0A 2QRKA 3HDYA 2WWVD 1T5SA 3RRFA 1M1XB 5JVDF 1V8PA 2J4FA 3BD7A 3EUFA 1G5FA 4HDQB 4YLYA 3W6UA 5KTMA 3S81A 2FSUA 3WNBA 1EX1A 1GUZA 1M3SA 2CVFA 4W9RA 1ZAYA 3QLEA 5FTWA 2JGMA 4YFYA 5BWNA 2PUFA 3LX6A 3CM0A 2AF4C 2EZ9A 2ZCJA 2C0PA 3A0RB 2VTKA 5KTYA 4IJUA 5AJWA 4Z1OA 3T3OA 5LUBA 2MCFA 4JLJA 3FLAA 3SEZA 3NH6A 1FDIA 1P4RA 1WR8A 4UUAA 1B8PA 1EQUA 4EHNA 1P3Y1 5FA8A 1U2DA 4Q34A 1N6OA 1WABA 1QWOA 2C1EA 2WHPA 3O90A 1Y5LA 4W8HA 3NAZA 2P8JA 3I5UA 3JQ8A 3QITA 4TWIA 1NW7A 5H82A 3BJEA 2GAAA 3HJBA 4M9XA 4DA7A 4EKIA 2OV1A 5CA1A 1CW2B 4JC5A 4LZPA 3FNQA 5AHRA 4H3SA 2C1ZA 1W73A 2C8VA 2VYQA 3HXLA 1E4OA 1BE6A 1Z75A 4PSCA 4D9EA 3GA5A 1RC1A 1HK7A 1G6Q1 2JB9A 3PGXA 3AGQA 1DPFA 3FAZA 3ZE9A 5KBYA 3GFGA 1NUUA 2AOXA 4O2AB 3G23A 1A9OA 2Z30A 5EXEA 5LXTF 2FQQA 4IOKA 3ST7A 1YDMA 3B1VA 4H7EA 3VOTA 2GCEA 3L7AA 1G6OA 1N1GA 1UH5A 3MSXA 1XCOA 2NO0A 1Q0QA 3GDGA 3PCRB 4NJMA 5IKOA 1EAMA 1ZD3A 4O1HA 1R9NA 3RM3A 3K9QO 4DV3B 1VLZA 1H3FA 4Q01A 1YR3A 2YOGA 1J07A 1SUEA 2Y0CA 4X95A 1XMXA 4A23A 2N1BA 1U2QA 2NIPA 3W8EA 4JOCA 3F4BA 4MIKA 3UF0A 3JRXA 6LDHA 5KJCA 3OJOA 4UCXA 1R12A 4DREA 1IQPA 3IR7A 2I76A 2PX2A 2ZVDA 5G41A 3SBDA 4NE7A 3AU8A 3H0EA 3NHAA 3UEOA 1L1QA 5LZ4A 2AN4A 1QP4A 2BKXA 4QG7A 5KI6A 5KU1A 2A1IA 1WY5A 2W8BB 2DPXA 2R4TA 4IKOA 3A7EA 4PTYA 2Z04A 4L5AA 1XZLA 5DX0A 4DL9A 1PWHA 4FDVA 2PAFA 4DZRA 2E82A 2I5PO 3ZOKA 2O5VA 4DRXB 1KPGA 2V1XA 3EVDA 2ZWVA 4YV1A 1C29B 2HDWA 1YU9A 5CEFA 1EFAA 3NVKI 4LECA 1VRCA 3HDJA 4C06A 4EGJA 4HQFA 2C3YA 4Q7LA 3R3SA 3ZCXA 3D43A 1A76A 1PW7A 3HKEB 3L8EA 2PAAA 2V6FA 4M0EA 4UPDA 4WERA 1AMNA 2VTDA 4MQFB 4RXUA 1JPUA 1W5EA 4O8CA 1KP3A 3DKRA 4H4CA 1KXJA 3WB0A 3C1OA 5ALTA 3C45A 1SBCA 4GLOA 3BB4A 4O08A 2DGDA 2R00C 4M9SA 4CV0A 3TLJA 1W7AA 2H57A 2ERYA 4Y0AA 4TM7A 2DYKA 4AUEA 4KPUB 1YJ8A 5DHQA 4DSOA 1UZNA 5F9HA 1FYWA 1PEYA 1U3GA 4GM4A 1V3TA 3TF5A 2G08A 2WFAA 3B1XA 3DHVA 3OJXA 2WB4A 4FNMA 3CJRA 5DIFA 2XV1A 4AL4A 2C7RA 3DDZX 3G5TA 3PFFA 2CV2A 5EIBD 2YS6A 3SC2B 1Q2XA 1QNLA 2RIPA 2WFZA 2NVOA 3C6YA 4MUBA 5F1YA 5BSRA 5KWEA 2XRMA 3IULA 2DCMA 2OAEA 4DA8A 1KI1A 3DV0B 1MAHA 1QCDA 4IO1A 2GYYA 2A30A 4LWOA 3RS2A 4KNYA 1NRIA 1WHSB 4EFMA 1HM5A 4HDRB 2YTZA 3INTA 4GPIB 3LOPA 1ECGA 5EJ9A 1EFHA 3QXGA 1SQSA 1IIRA 2QR3A 4O2AA 1YRBA 2OBBA 3OZAA 4O2LA 2XWBF 4R1LA 4JC0A 1GN9A 4HJXA 4DV7B 2O8FB 5GONF 3R7DA 5U4XA 4G07A 1Z4NA 5L6LB 1U0EA 4ZVNA 2QD3A 3WL4A 4MVJF 2QP9X 1NBHA 1ENZA 3ZEAA 1A9ZA 1YTUA 3RYHB 1IDOA 1M2GA 1NM5C 3JWPA 5FOTA 4O8ZA 3IAHA 3L93A 3VU9B 4P3YA 1M74A 1PJ4A 4R2IA 4BKUA 5LU8A 1Z2OX 1M76A 1UBSB 1XGKA 2H17A 1MX9A 1OR8A 4M7RA 1C1YA 1XLUA 3O4IA 3EXHB 3LNCA 2UYOA 4TXMA 4RV9A 4XLLA 1NQWA 1O58A 3A4LA 1P1HA 1PFWA 3K73O 1FY2A 4FX5A 3INYA 4RVGA 3NV7A 1N2ZA 1YOBA 5ERXA 2FGKA 1JR3D 5F9MA 1NYRA 2GTIA 2X0FA 2XQVA 1LSOA 2W8BA 3R77A 4UCWA 5JLAA 3A1VA 4B31A 3OX4A 2C4MA 2GSDA 1L4GA 1P2BA 2O2SA 4F04A 3HBAA 4ZO6A 1BGWA 4QELA 1WVGA 3NNSA 4DRXA 1RM3A 4DMFA 2ZVJA 4IOJA 4E5MA 3VOBA 1XZKA 2QSYA 1S3GA 5LUAA 2GHTA 2ZJ4A 4OY3A 2PSEA 4XYMA 3MT8A 4Q66C 5TV2A 4B48A 3WO1A 3UJNA 2NACA 3BMOB 3HKEA 3H0CA 4N7JA 2HPHA 3G85A 3V4ZA 1TRKA 3DMTA 1PQYA 4P86A 3S55A 1IULA 3PPWA 4MQFA 4MQBA 3TLGB 4KR3A 1NUSA 4IQ0A 3ZY2A 4DB2A 4DCSA 4ZVKA 1TIKA 4PC6A 2JS7A 4I4TB 2J4CA 4IRXA 4CL8A 4NPHA 2B3DA 1QG0A 1KVUA 3QKWA 1WDMA 4O5OA 4BLOA 4KPUA 3FHLA 2OCDA 3GJQA 3W5BA 3KD2A 2XF8A 3L9WA 2QE7D 5EG5A 1VKZA 3L6EA 4NZPA 2QPAA 1SBZA 5REQB 5L40A 4G97A