3D3OA

Crystal structure of the effector domain of the putative transcriptional regulator iclr from acinetobacter sp. adp1
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
176
structure length
176
Chain Sequence
b'SNALFSSRDILEVLQDIHMETGETVAIATKNDIYLQYIQIIESVHALRFHVDENAIRPLTMSSNGWMLMSTMNDKAIDNTVRRANTITQKDGIRFEVDDMMARIRQVREQGYASAEHIPFVGGGTICVLLPMTIQGQPVTMGLGGALDRIKQNYDRYLELLLNGVQQLKKSDSFHQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative transcriptional regulator, IcIR family
publication title Crystal Structure of the Effector Domain of the Putative Transcriptional Regulator IclR from Acinetobacter sp. ADP1.
rcsb
source organism Acinetobacter sp.
molecule tags Transcription regulator
total genus 53
structure length 176
sequence length 176
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3d3oA00
4Q0JA 2M7UA 2VKSA 2GX5A 2IA2A 3VV4A 4G3WA 4EU0A 1VHMA 3OBFA 2Y79A 3DBAA 3S7QA 3CITA 3IBJA 4LRZE 4YNRA 2LB9A 1YSPA 2XROA 3D3OA 2O9CA 2ZMFA 3IBRA 4MMNA 3S7OA 4IJGA 2O9AA 4G3KA 5C5KA 4FOFA 3OOVA 3NOUC 3CI6A 2XSSA 2W3EA 2VZWA 2B18A 3MF0A 3NOTC 3E0YA 4MCWA 2OOLA 2LB5A 4O8GA 2W3DA 4YOFA 2W3HA 4DMZA 3KSFA 4IUKA 4MN7A 1MC0A 3EEAA 1YSQA 3K2NA 3R4KA 4Y2FA 4Q0IA 3ZQ5A 2W1TA 3KSHA 2Y8HA 4O0PA 5HPFA 4E04A 2QYBA 2W1RA 5AJGA 3O5YA 4R70A 3KSIA 3KSGA 4RQ9A 4Y3IA 2KOIA 5HL6A 2VJWA 2HGVA 4LRYC 2K31A 5DFYA 2KLIA 4MDZA 5HPIA 2G7UA 3TRCA 3KO6A 2XRNA 3E98A 4ZRRA 3NOPC 3G6OA 3LFVA 2VEAA 4ETZA 3W2ZA 4O01A 2O99A 1F5MA 2O9BA 3MQ0A 2O0YA 4IUHA 3S7PA 5HSQA 4GW9A 5K5BA 3HCYA 4GLQA 5L8MA 5LBRA 1YKDA 1MKMA 4Y5FA 5I5LA 1STZA 1TF1A 4QPRA 5DFXA 4LRXC 1TD5A 4ETXA 4EUVA 5TJJA 2W1TB 4CQHA 1ZTUA 3NHQA 2W3FA 4ME4A 4Z1WA 2M7VA 3S7NA 2K2NA 2W3GA 4PAUA 3BJNA 3C2WA 4G3VA 3RFBA 4BWIA 4DN0A 4R6LA 3MMHA 4Q0HA
chains in the Genus database with same CATH superfamily
1N9OA 1XJ6A 5CXWA 4UAAA 4OP5A 5A93A 3N7WA 3LGOA 1S1ZA 3LI8A 3D4FA 5FQKA 3OPRA 3NOUC 3CI6A 3IS2A 1EI5A 5L2FA 2X71A 3IHAA 2XFTA 2W3EA 4GJ4A 2Y59A 2VGKA 4GN2A 5FI2A 1KVLA 3DAVA 5D3OA 4WZ4A 1A0KA 1KVMA 2WKHA 2XK1A 2XGNA 4NKPA 3MZEA 3Q7ZA 4OPZA 5FASA 2ZD8A 5GLAA 5TBMA 1TDLA 4Q0IA 3ZQ5A 4GZBA 4GS9A 3ICYA 3VSLA 3F1PB 1K57A 4WLAA 3ZVTA 4DDSA 3L9KA 4JLFA 1M40A 1LHYA 4BENA 4KUOA 1ZC2A 2V1ZA 3G34A 4ID4A 5TFQA 1L0DA 4WMCA 3VSKA 3FKVA 4HOIA 5HWTA 4B4ZA 2VEAA 4OKPA 1U60A 3EWKA 1K56A 4JXWA 3GR2A 2HDUA 3LICA 4PKYA 1Q2PA 3UN7A 1OTAA 1MKMA 2IWDA 5I5LA 1IFQA 5CERA 1BLSA 3ZNYA 1PZOA 5DF9A 3BM6A 3AGFA 1N9LA 1QMFA 3GDIA 5GHZA 2W3FA 3TW8A 3LEQA 2Q9MA 2R9XA 4S2OA 3WS1A 2ZM8A 3H82A 3F1NB 4P6ZM 2W0NA 1VB6A 3LR3A 1T18A 3M2KA 5J7EA 3MXQA 2EFXA 3H9WA 4QY5A 3A3FA 4QWOA 5F83A 2D02A 2VV8A 2Y2QA 3G31A 3PBSA 4DKIA 2W3HA 3C7VA 5AQAA 2WAEA 4OLGA 4DMZA 2V0WA 3OPHA 2A49A 4UHUA 2H10A 2H5SA 2XLNA 3E4QA 2EX8A 5G4YA 4PPRA 1EROA 3SW1A 4CJNA 4H8RA 3KSIA 3KSGA 4JBFA 3ZNTA 5J4EA 2JKFA 3UMEA 4I3AA 3MJQA 3ZG9B 3BW6A 2HDQA 2ZM2A 1OT6A 3LUQA 1L0FA 4M3KA 4LCMA 1RP5A 1H8YA 3PTEA 2KDKA 3IX4A 4KZ8A 5K5BA 4ZDXA 4EV4A 1JWZA 2YKHA 1HZOA 4YWZA 3V5MA 2Z6DA 3N6IA 5E43A 5HAIA 5IT5A 1J9MA 2HZ5A 2Y2GA 1V9YA 2ZOIA 4B4XA 1FILA 5KZHA 5FEFA 3G2ZA 1ODVA 2VLGA 4G3VA 1MZUA 4OVDA 3IH8A 4Q0JA 2VKSA 2WGIA 4KZ4A 4EBLA 4G3WA 3OBFA 1NYMA 1FSWA 3NIAA 3WRTA 4K0WA 3VFFA 4U3TA 1TS0A 5EM0A 2QJ5A 5HW3A 1XA1A 2V20A 1C3BA 3ITAA 4FOFA 1UGUA 2AVXA 2J9OA 1K4EA 2IWCA 4D2OA 4DE0A 3FYZA 3CZDA 4S2MA 1OTBA 2PR5A 5AQ7A 4NETA 3KSFA 1YAXA 2WGVA 1KGGA 1G68A 1MC0A 1DRMA 4YINA 3MSHA 4WEJA 2OV5A 1D7EA 4B9OA 4RQ9A 4EWFA 1VETB 4CLCD 5CHMA 1K0KA 2XRNA 1LL9A 1IOUA 1JTDA 1SKOB 4GOGA 3I7JA 2HPBA 1IEMA 4WN5A 3C4OA 3BFGA 1VEUB 2P7JA 4GDBA 3LR0A 2B95A 2QWSA 2ZJ9A 5CEDA 3EGDC 4LRXC 3A0RA 4FD8A 1S67L 5DKLA 1BUEA 3ZFZA 3LCEA 1GSVA 3S7NA 4JGOA 3IT9A 2K2NA 2ZLYA 2W3GA 4PAUA 2EWWA 4FUWA 2ZBBA 3DTKA 5CEBA 4HP4A 3BY9A 2DNSA 4EETB 3CITA 3F1PA 2WYXA 3CUEA 5C5KA 1DJCA 5FQJA 2OWHA 1OTIA 1W63Q 3MF0A 2XD5A 4JXSA 2RCXA 1P97A 1EW0A 5HL1A 5BOHA 1E25A 4IEDA 5JYOA 1XJ4A 4NG2A 3SS3A 1MPLA 4E3LA 3OCLA 5HZHA 3Q81A 4Y2FA 5FAQA 3MKFA 4IBRA 3W8KA 3M6BA 2PD7A 3BLMA 3G2YA 3O5YA 4KZ6A 2BLSA 1OT9A 1DJAA 5HL6A 1HVBA 1MWTA 1PIOA 3O87A 3QP5A 3F1NA 3EEHA 3BY8A 2P04A 2VA0A 4ETZA 1IELA 3W2ZA 3W4QA 4LV3A 4C6YA 4CLCC 4GLQA 4ZJ3A 3AGEA 4OQHA 1K54A 2W1TB 3MQOA 3LIAA 2ZC7A 3VP4A 5FSRA 1SKFA 4HHDA 2BTFP 3Q07A 3UDXA 4AFIA 2Z2LB 3MXSA 1BT5A 4OH0A 3BLSA 1QMEA 2GX5A 2Y2NA 2H0TA 1PRQA 3UB9A 2LB9A 3IBRA 5EOEA 5FDSA 4G3KA 4WMCD 2HDRA 3V3SA 1S4SA 2EX6A 1MXOA 3UDIA 4Q8IA 5CECA 2JKRM 4BLMA 3DWKA 3KX0X 4ZJ2A 3HLCA 4LCLA 1K56D 4MCWA 1Z6FA 4EBPA 2OLVA 4LV0A 4BL3A 1JTGA 3ZG7B 4X53A 4YOFA 2MJ6A 2XD1A 3ITBA 2GNXA 3PAEA 3VP3A 2ZQ7A 2Y2PA 4FSFA 2J3TC 3N4IA 1LSXA 4I39A 1DP9A 4L9EA 2ZC3B 2HP5A 3ISGA 1N9NA 1XJ2A 5DTTA 2JKRI 2GZAA 4JGPA 1BLHA 3KO6A 1UWPX 3SZTA 3T1XA 3NDEA 3GQZA 2WK0A 4QHCA 1F5MA 2BG1A 4Y0UA 3MQ0A 3UE1A 3AGDA 5EVIC 1YKDA 2I72A 4D60A 1XX2A 4KZ5A 2V1AA 1YLWA 5TJJA 1MY8A 3FWLA 1ZTUA 3JPUA 3LIDA 4JGQA 3W4OA 2V0UA 5AQBA 4DE1A 1XKZA 4X1LA 4MN6A 4WF0A 3C5AA 2PAVP 1BTLA 5DTSA 4I3IA 1KDSA 2IA2A 4WYYA 1Y4OA 1YQSA 5IHVA 3UB8A 2WUQA 4UQIS 3H7WB 5E2FA 3TOIA 2QHKA 1VETA 2E8JA 1NY0A 1GSXA 5KIZA 3OC2A 1ES5A 4N9LA 2B5RA 4Y13A 4HJ4A 1SKOA 3QP2A 2IWBA 3OPLA 3ZG0A 5EECA 3NDGA 1VEUA 3BQ8A 1BLCA 2PHYA 2VGLS 3JVUA 3FPVA 2XA7S 2L1MA 4DDYA 3F1OB 1HLUP 2JKTM 4K08A 2QKPA 2DCFA 1G6AA 3VE3A 4E6WA 3ZDJA 3Q7VB 1DY6A 5F1FA 2V9AA 5GLDA 3SH7A 4S2NA 1SDNA 3HUOA 1RCJA 3UB5P 3NECA 2HF6A 1YMSA 2ZOHA 4QY6A 2WKPA 4L0LA 4L9FA 2A2LA 2NUPC 1K55A 5HWVA 1J3WA 1CJFA 1BSGA 1PZPA 4IVIA 3UPPA 5CGXA 4HNBA 3RTYA 2L0WA 3G6OA 1S0WA 1PI5A 4JXVA 3N8LA 2CC1A 4IUHA 4GW9A 5EFWA 3LIFA 1FCOA 3LYXA 1MKIA 1TF1A 3QP1A 4QPRA 3LR5A 2JKTI 3U4LP 3MR0A 5U47A 4JPMA 4DE2A 1S4RA 2I9VA 1ESUA 4P87A 1NZOA 3VFHA 4BBUA 1X0OA 1IYOA 4GHIB 3IQAA 3NULA 2PDRA 4KZ7A 4R0QA 1W8YA 5DVAA 2ZC4B 3V50A 3QP4A 3HREA 3DTEA 4IHQA 1F9IA 1XP4A 1V9ZA 3K3DA 3C38A 2HJ9C 1CQAA 1ESIA 2HJEA 3GV9A 4UEYA 1H8MA 3UY6A 5F68A 1H0MA 1KOUA 3MXRA 1NLZA 3MZFA 1YSQA 5CHUA 2W1TA 5L09A 5HX9A 3VP2A 5G18A 4E3IA 1LI0A 5HDDA 2Y2LA 3C30A 3VOLA 3N8RA 2X02A 4MNRA 1KE4A 4E3KA 2HGVA 5HDCA 3PBTA 3JYIA 4HH2A 5HPIA 1M6KA 5F1GA 3CG5A 1BYWA 2WGWB 4FH2A 4EBNA 3WS0A 2O9BA 2XDMA 2PBDP 1K6SA 4X6TA 5F5YA 2EXAA 4BMWA 3UDFA 2XF3A 3B33A 3O88A 2YKFA 3RXXA 4IVKA 2QJ7A 2WKQA 4S2KA 5DJTA 2JKGA 1IYQA 5HD5A 3T1SA 5HARA 3BFEA 4JKTA 4C75A 4I5SA 1S66L 4ZBEA 3S4XA 4OQ0A 1KGFA 1FCMA 3RFBA 4DN0A 4PM9A 4NXEA 1T1AA 3CHWP 1KDWA 5MC7A 4HBTA 2PYPA 4LV1A 4LRZE 3R7WB 1LL5A 2XROA 4WZ5A 2XFSA 4CLCB 1Y28A 2XSSA 5KSHA 3PXPA 4HESA 3C8CA 4HJ3A 3EQVA 4OOLA 4IBXA 2UWXA 3ZCZA 5JYPA 4I38A 1YM1A 2X01A 4PM5A 5EVEA 4R1GA 4KQQA 3T50A 4NK3A 4IUKA 4O7DA 3IF6C 3WRZA 3IXGA 3SH8A 1DP6A 2Y8HA 4E3NA 3PHYA 4X25A 2ACGA 3TJZC 1ERMA 1Q2QA 2Y55A 3T4OA 2DRWA 4LENA 3UPOA 4KQOA 2HP9A 3FV7A 3NOPC 2Y2IA 3LIEA 1NXYA 2NUTC 3BFCA 2P9VB 1MWRA 3GRJA 3H7WA 1MBLA 4A5RA 1GA0A 3P7NA 1YLZA 1ERQA 4B88A 3OPPA 4EUVA 4OPQA 3ZHHA 1YLTA 4XUXA 1ONHA 1NRJA 4Y0TA 4WM9A 3S22A 3B42A 4KG6A 3F1OA 2WKRA 1P0ZA 3VE4A 4ZJ1A 1FIKA 3Q7VA 3IBJA 1KE0A 4BBTA 3OZHA 2ZMFA 1NJ4A 4ESPA 4P85A 4ARZB 4N1HA 2V2FF 5EVIB 2VZWA 5HAPA 3IWIA 3UMDA 2EX2A 2VV7A 4LGWA 3P09A 4UQIM 2OOLA 1IKIA 4X55A 3PBNA 5FDHA 3EGXC 4O8GA 2C6WB 3W4PA 4KZBA 4MEZA 2Y4AA 1ZG6A 3KYEA 4S2PA 3ULFA 4E04A 5EM1A 4OONA 2J8YA 2XA7M 4QD4A 5DFYA 4S2IA 5FQMA 1XFNA 1P9WA 5GHYA 4KENB 4B93A 3QP8A 2XEPA 1PNEA 4GHIA 1ES4A 2KX6A 3G32A 2O0YA 4JGRA 3S7PA 3EOIA 1FOFA 3UE6A 4Y5FA 4GD8A 2VK3A 3WS4A 4QU3A 5EUAA 3PYPA 3GMWA 1I2SA 1SZVA 1LSWA 3DTIA 4R4RA 1LSVA 2JN7A 3C4PA 2Y2KA 5HFOA 1K4FA 4BWIA 1W79A 3T1QB 4PM7A 4EU0A 1VHMA 2H28A 4HH3A 5DF8A 3A3IA 4E6XA 1LI9A 3DBAA 5FL3A 3GECA 3S7QA 3TG9A 1VQQA 1WYCA 1YSPA 2O9CA 4PM6A 1XFQA 3V67A 1K38A 4HIAA 4OPYA 1LLBA 2PBYA 5EOOA 1N9BA 3HVFA 1XGJA 5FQIA 2WGWA 1XA7A 4FTXA 3C7UA 4F94A 4Y17A 4KZ3A 5CRFA 5EV0A 5M18A 2RL3A 4K91A 3IX8A 3HLFA 1XPBA 4PHTA 4LRYC 2L4RA 3CMZA 5DJUA 3JVVA 3SH9A 5A8BA 3E98A 1ES2A 4RYEA 4ZRRA 5F69A 2OSUA 1PFLA 1YMXA 2PU2A 3R7WA 2O99A 2EXBA 4EQIA 5FAOA 5FI7A 2DMWA 1P9RA 4H6JB 1L3LA 4RX2A 5DFXA 3VMAA 4MN5A 1VM1A 3HL9A 5G4ZA 2A24B 2M7VA 4HI4A 4KUKA 1SCWA 3M6HA 3E2LA 3BJNA 3HUNA 2QMIA 3LY4A 3HLDA 1PW8A 3A3JA 2M7UA 5FQQA 1H3QA 4WBGA 3SOIA 2ZQCA 3SS4A 4YNRA 2J9PA 1TS8A 3LEZA 1G28A 1E3UA 1TEMA 1BULA 3T4QA 2M1CA 3PBOA 4DJ3A 2ZM0A 3E0YA 5DKKA 5CTNA 2OWJA 3CAXA 5KMWA 1Z09A 4JF4A 3A0SA 3A3DA 3D9YA 2Y2JA 2P9VA 2W3DA 1K55C 2Y2MA 1AWIA 1G5UA 4RA7A 2G2WA 3NY4A 3T4SA 4WEKA 2WKEA 1KGEA 2JC7A 1TS6A 3P01A 3U2AA 4LLOB 1K57C 5HPFA 2Q9NA 2FFYA 5GL9A 2QYBA 3IWOA 3CJMA 2K31A 4XUZA 2KLIA 2W27A 1IYSA 4MDZA 3UNWA 3T12B 3CWFA 1WYBA 3NJAA 3MFDA 3HLGA 3UE0A 4CPKA 1S1YA 5HDSA 3BRMA 5A91A 4ARZA 1ES3A 2A3UA 1TS7A 2VGJA 4DF6A 4HQAA 4S2JA 5EVIA 1NWZA 4ETXA 1L0GA 1JVJA 3IF6B 4NXFA 4I3JA 4R4SA 3ZGAB 4R23A 3VOYA 3VP1A 4F3LB 1OTEA 5EVLA 4LV2A 3LO7A 1MWSA 4Q0HA 3WS5A 2G2UA 3PBQA 4XT2B 5EE8A 5EPHA 1AXBA 4KQDA 2HV1A 3PAGA 3D3OA 4IJGA 4GNUA 4HJ6A 3HJKA 2O9AA 4GB7A 3FZCA 1CEFA 2JCHA 1GSWA 4U0TA 3NI9A 5AVEA 3O3VA 1O07A 4OP8A 5GHXA 4E3MA 3V3RA 4K0XA 1K25A 4QJGA 2K7SA 2XQZA 4PMAA 3MS6A 5CX7A 4DE3A 1OJGA 2V8FA 3RXWA 4WL9A 3EEAA 3K2NA 3R4KA 3K3CA 1GHMA 2GJ3A 4DRTA 4E3OA 3DWZA 3S1YA 2PD8A 1I5QA 1S6RA 3HLBA 1SHVA 4Y3IA 1WA9A 1FQGA 2VJWA 1GHIA 1T1BA 2J80A 4ZAMA 1O7EA 5L07A 5E2GA 1PWGA 2ZQ9A 5AQ9A 1EWZA 4II7A 4X68A 3HCYA 2OAQ1 2OLUA 5M1AA 1DJBA 1N4OA 4GDNA 1K6RA 4U0XA 5HD3A 4JF5A 4WZ5C 4CQHA 4BD0A 3UO9A 3LI9A 3UPNA 4FH4A 4RX3A 3A0VA 4HBUA 5IU1A 2EFUA 2OAP1 3N8SA 2R9WA 1I2WA 2E8IA 1BLPA 4HY8A 5HWWA 4GCZA 1XXMA 3Q1FA 2Z2MB 3GSGA 5FATA 2ZMAA 1BZAA 3HBRA 1FR1A 5A90A 3HLWA 3NOTC 3ZYTA 1L0EA 3FKWA 2QZ6A 2JHEA 3T1RA 4DXBA 4P0MA 5J8XA 1NLYA 4E3JA 2Y2HA 2Y91A 4MLLA 4KQRA 3T4LA 1W5DA 4H6JA 3WWXA 3B3XA 3QHYA 2Q0OA 2JBFA 4KG2A 3M2JA 3TE8A 1T1CA 1UWNX 3IF5A 3HJIA 4MBHA 4O0PA 2A24A 1OPXA 1CEGA 3E4OA 3Q82A 2WAFA 1W8QA 1LT0A 3V39A 3QNCA 5TR7A 2QPNA 1DP8A 4GD6A 3E4PA 3UB7A 4C3QA 5L10A 2EX9A 3IXHA 3GVBA 2V1BA 4O01A 4EERA 5E2EA 4M4XA 4MBFA 1TDGA 1E4DA 2ZC5B 3HLEA 3E2KA 5KSCA 3FC7A 4KZ9A 1PI4A 1NRFA 5DF7A 3RH8B 3IH9A 1GA9A 1JWVA 3P98A 4ME4A 3A3EA 2EWVA 2WADA 3NBLA 4PM8A 2ZL1B 3LR4A 2CMNA 3LIBA 3QNBA 5CTMA 3VV4A 1RGZA 2Y79A 1NZUA 1IYPA 3NCKA 1YPRA 3CUEC 3T4TA 2WZXA 3FPWA 4OOMA 1ALQA 4EEUA 1ACFA 1HD8A 5FEGA 5CHJA 5HAQA 2P08A 5A92A 3CPTB 4FCFA 4DJ2A 1F2KA 2PT7A 2R78A 3G35A 1W63M 2ZMVA 4N92A 2VX8A 2LB5A 1KE3A 2PU4A 2Y2OA 4NXBA 5FAPA 4EQ1A 5IS1A 4MN7A 1PWCA 1SDEA 3OLOA 4R3JA 5GLCA 4HEFA 5TGFA 3IF6A 4MBKA 1T19A 4HP9A 2GDNA 1YLJA 1CI8A 2VV6A 4F3LA 5J3WA 4R70A 4OQIA 5FQ9A 1WE4A 3IS2B 1PWDA 1CF0A 1NYYA 3L7HA 3MFXA 4XT2A 1HTZA 4EW7A 1CI9A 1E3UD 2INWA 3WS2A 1IKGA 4KG5A 2WZZA 5FI6A 1Y54A 4OLDA 5AVFA 3DW0A 3UB6A 2VGLM 3D72A 1STZA 1K54C 1H8ZA 5TBMB 2C5WB 2PR6A 4RVAA 4GS9B 4P6ZS 2B02A 2PRFA 3SS5A 3NHQA 4X69A 4CLCE 2J7VA 1CK3A 2ZQDA 4Z1WA 4Z9QA 3FG8A 3ZVWA 2V8CA 4N9KA 3IXBA 3MBZA 4R6LA 4ZTKA 2J3TD 1F98A 4UA9A 4P6BA 4JF6A 4LFUA 1L2SA 3BQAA 3KYZA 3IX3A 4WUJA 4MMNA 3S7OA 3QP6A 3OOVA 2FH5A 1RGYA 5GLBA 1FCNA 1OMEA 2HP6A 4EXOA 4GKUA 3UE3A 3BFFA 4NEED 5EVID 4OPRA 2J3WA 1GCEA 1JNUA 2BASA 4BQMA 3H82B 2EA9A 4Y15A 4X56A 3BYDA 4JXGA 3KSHA 2ZQAA 2W1RA 4R3BA 5F6AA 5M19A 1FR6A 1XJ3A 5FA7A 3TRCA 4R3AA 5DTKA 3KYQA 2WKIA 4X1MA 4L9GA 4OQGA 4EUZA 1MWUA 3BEBA 3BWLA 3IHBA 1OTDA 5E2HA 2UV0E 4UA7A 4R38A 1W7FA 5L8MA 5LBRA 1PYYA 2JE5A 1TD5A 2XH9A 4NXGA 2ZQ8A 3G4PA 4BL2A 1FSYA 1ZKJA 3VOZA 2H0YA 3LY3A 4DXCA 3EQUA 5F82A 4KZAA 1G6OA 5CGSA 1JWPA 4EESA 2D01A 4CLCA 3MQQA 3G30A 3OCNA 3IXDA 3DTMA 2ZC6B 4Y7PA 4N1XA 3BFDA 5I94A 3T4KA 1GHPA 2B18A 3MZDA 3ZG8B 4OOYA 1PW1A 4LPZA 2Z6CA 4BBVA 1YT4A 4WELA 1ZG4A 1XGIA 3IWQA 4QB8A 1YLPA 2XR0A 3TSGA 4S2LA 4S2NC 2P74A 5AJGA 1ONGA 2KOIA 3HUMA 2ZL1A 3PBRA 3CLOA 2FFFB 2HDSA 2G7UA 1ZHHB 4YFMA 1H5XA 1LL8A 3LFVA 1OJ5A 1D1JA 4EEPA 1YLYA 3NC8A 5HSQA 2PYRA 3PR6A 4PKYG 4BJPA 3GTCA 3MKEA 3O86A 3RJUA 3VP0A 3CPTA 3ZG5A 3B47A 4XXRA 5CGWA 1TVFA 1D06A 4UA6A 4BD1A 2FZ0A 3C2WA 3BECA 3T4JA 3MMHA 4Y0OA
chains in the Genus database with same CATH topology
3F1OA 1N9OA 2WKRA 1P0ZA 2GX5A 4HY8A 3VE4A 5HWWA 4GCZA 1XJ6A 3UB9A 3IBJA 4BBTA 2LB9A 1S1ZA 3LI8A 2ZMFA 3IBRA 4G3KA 4ARZB 3NOUC 3CI6A 3IS2A 1S4SA 2JKRM 2VZWA 2W3EA 4GJ4A 3KX0X 3UMDA 2VV7A 3NOTC 3ZYTA 4MCWA 4UQIM 2OOLA 2JHEA 3PBNA 1NLYA 3EGXC 4O8GA 4YOFA 2MJ6A 3T4LA 4H6JA 4NKPA 2GNXA 3TE8A 1T1CA 4FSFA 1UWNX 5TBMA 4Q0IA 3ZQ5A 3HJIA 2J3TC 4GS9A 1LSXA 3ICYA 4O0PA 3F1PB 4I39A 1DP9A 3ULFA 4WLAA 4E04A 2A24A 4L9EA 1N9NA 1OPXA 1XJ2A 3E4OA 2XA7M 4KUOA 5DFYA 2JKRI 2GZAA 1LT0A 4JGPA 3KO6A 1DP8A 1XFNA 1P9WA 1UWPX 4HOIA 3E4PA 5HWTA 3UB7A 4B93A 2VEAA 4O01A 2V1BA 4EERA 4GHIA 1F5MA 4M4XA 3EWKA 3MQ0A 2KX6A 2O0YA 4JGRA 3S7PA 3LICA 4PKYA 3EOIA 1OTAA 1YKDA 1MKMA 3FC7A 3UE6A 4Y5FA 5I5LA 1IFQA 2V1AA 3PYPA 5DF9A 5TJJA 3RH8B 1N9LA 3GDIA 1ZTUA 1LSWA 3LIDA 2W3FA 4JGQA 4ME4A 3TW8A 2V0UA 1LSVA 2JN7A 2EWVA 3LR4A 4MN6A 4WF0A 4BWIA 2CMNA 4I3IA 3H82A 3F1NB 3LIBA 2W0NA 4P6ZM 2IA2A 3VV4A 4EU0A 1VHMA 2H28A 4HH3A 1VB6A 2Y79A 3DBAA 3GECA 5FL3A 3S7QA 3UB8A 3LR3A 1T18A 3CUEC 1YSPA 3T4TA 2O9CA 4UQIS 3H7WB 3FPWA 4OOMA 5J7EA 3MXQA 2QHKA 4EEUA 1GSXA 1XFQA 3H9WA 3V67A 5KIZA 3OC2A 4HIAA 2P08A 2D02A 2VV8A 4HJ4A 4DJ2A 2PT7A 2R78A 3PBSA 1W63M 2ZMVA 2VX8A 2LB5A 2W3HA 4NXBA 3BQ8A 4DMZA 4EQ1A 2PHYA 2VGLS 3JVUA 3FPVA 2XA7S 2L1MA 2V0WA 5IS1A 3F1OB 4MN7A 3OLOA 2JKTM 4K08A 2QKPA 3VE3A 1T19A 3E4QA 4HP9A 2V9AA 5G4YA 2VV6A 4F3LA 3SW1A 5J3WA 4R70A 3KSIA 3KSGA 4PHTA 2HF6A 4LRYC 3IS2B 2L4RA 5DJUA 5J4EA 3JVVA 2ZOHA 2WKPA 4L0LA 4L9FA 2A2LA 3UMEA 3MFXA 4I3AA 2NUPC 3MJQA 4XT2A 5A8BA 3E98A 5HWVA 3BW6A 4ZRRA 5F69A 4EW7A 2INWA 1OT6A 3LUQA 4HNBA 3RTYA 2L0WA 3G6OA 3R7WA 2KDKA 2O99A 4IUHA 5K5BA 2DMWA 4GW9A 1P9RA 5AVFA 4H6JB 5EFWA 3UB6A 3LIFA 2VGLM 2YKHA 3D72A 3LYXA 4YWZA 1STZA 1TF1A 2Z6DA 4QPRA 3LR5A 5DFXA 5TBMB 2JKTI 4MN5A 2PR6A 3MR0A 5IT5A 4GS9B 4P6ZS 2B02A 5G4ZA 3NHQA 4CLCE 2A24B 4Z1WA 4HI4A 2M7VA 1V9YA 3FG8A 4KUKA 2ZOIA 1S4RA 3BJNA 2I9VA 1ODVA 2VLGA 4G3VA 1MZUA 4R6LA 2J3TD 1F98A 4Q0JA 2M7UA 2VKSA 1H3QA 4G3WA 4BBUA 3OBFA 1X0OA 3BQAA 3KYZA 4YNRA 1TS8A 4GHIB 1G28A 1TS0A 2QJ5A 4MMNA 4WUJA 3S7OA 2PDRA 4FOFA 3OOVA 1UGUA 3T4QA 2FH5A 2M1CA 3PBOA 4IHQA 1F9IA 4DJ3A 3E0YA 5DKKA 1V9ZA 3K3DA 3C38A 1OTBA 2HJ9C 2PR5A 4EXOA 2OWJA 3CAXA 3UE3A 3A0SA 4NEED 2HJEA 2W3DA 2J3WA 1JNUA 4UEYA 1H8MA 2BASA 3KSFA 1YAXA 3T4SA 4WEKA 5F68A 3H82B 1KOUA 1NLZA 2EA9A 1MC0A 1YSQA 1TS6A 3P01A 3U2AA 1DRMA 4LLOB 2W1TA 3KSHA 5HPFA 5HDDA 3C30A 4WEJA 3VOLA 2QYBA 2W1RA 1D7EA 4B9OA 4RQ9A 5F6AA 2HGVA 4CLCD 2K31A 5HDCA 2KLIA 2W27A 3PBTA 4MDZA 1XJ3A 4HH2A 5HPIA 3TRCA 4R3AA 2XRNA 3KYQA 3CWFA 1IOUA 3NJAA 4L9GA 1BYWA 1S1YA 3BWLA 2O9BA 1OTDA 5HDSA 4WN5A 4R38A 4ARZA 1TS7A 2P7JA 5F5YA 5L8MA 4HQAA 5LBRA 4BMWA 3LR0A 3B33A 2QWSA 2YKFA 1NWZA 2QJ7A 3EGDC 2WKQA 4LRXC 1TD5A 3A0RA 4ETXA 4NXGA 1S67L 4NXFA 5DKLA 4I3JA 5DJTA 5HD5A 4F3LB 4I5SA 1GSVA 3S7NA 1S66L 4JGOA 2K2NA 1OTEA 2W3GA 3EQUA 4PAUA 2EWWA 3RFBA 1G6OA 4DN0A 4NXEA 4EESA 4Q0HA 1T1AA 3PBQA 4XT2B 5MC7A 2D01A 2ZBBA 4CLCA 3MQQA 4HP4A 3BY9A 4KQDA 4EETB 2PYPA 3CITA 4LRZE 2HV1A 3R7WB 3F1PA 3OCNA 2XROA 3D3OA 3CUEA 4IJGA 4HJ6A 3HJKA 2O9AA 5C5KA 4CLCB 2OWHA 1OTIA 1W63Q 1Y28A 3T4KA 2XSSA 2B18A 3MF0A 5KSHA 3PXPA 1GSWA 3C8CA 4HJ3A 3EQVA 5AVEA 4OOLA 1P97A 1EW0A 4LPZA 4I38A 2Z6CA 2K7SA 4BBVA 3T50A 4WELA 5CX7A 1XJ4A 4IUKA 1OJGA 3OCLA 4WL9A 3EEAA 5HZHA 3K2NA 3R4KA 3K3CA 4Y2FA 2GJ3A 1DP6A 2Y8HA 2PD7A 2PD8A 5AJGA 3PHYA 3O5YA 4Y3IA 1OT9A 2KOIA 1WA9A 5HL6A 2VJWA 3TJZC 3PBRA 3T4OA 3CLOA 1T1BA 2G7UA 1ZHHB 3F1NA 2J80A 3EEHA 4KQOA 3NOPC 1LL8A 3LFVA 1OJ5A 3BY8A 2P04A 2VA0A 4ETZA 3W2ZA 4EEPA 3LIEA 2NUTC 3H7WA 4II7A 5HSQA 4CLCC 3HCYA 2OAQ1 3P7NA 4GLQA 2PYRA 3PR6A 4PKYG 4BJPA 5HD3A 4EUVA 2W1TB 4CQHA 3MQOA 3LI9A 3LIAA 3B47A 1D06A 1NRJA 3A0VA 4HHDA 2FZ0A 3C2WA 5IU1A 3B42A 2OAP1 4AFIA 3T4JA 3MMHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q0J A;  2M7U A;  2VKS A;  2GX5 A;  2IA2 A;  3VV4 A;  4G3W A;  4EU0 A;  1VHM A;  3OBF A;  2Y79 A;  3DBA A;  3S7Q A;  3CIT A;  3IBJ A;  4LRZ E;  4YNR A;  2LB9 A;  1YSP A;  2XRO A;  3D3O A;  2O9C A;  2ZMF A;  3IBR A;  4MMN A;  3S7O A;  4IJG A;  2O9A A;  4G3K A;  5C5K A;  4FOF A;  3OOV A;  3NOU C;  3CI6 A;  2XSS A;  2W3E A;  2VZW A;  2B18 A;  3MF0 A;  3NOT C;  3E0Y A;  4MCW A;  2OOL A;  2LB5 A;  4O8G A;  2W3D A;  4YOF A;  2W3H A;  4DMZ A;  3KSF A;  4IUK A;  4MN7 A;  1MC0 A;  3EEA A;  1YSQ A;  3K2N A;  3R4K A;  4Y2F A;  4Q0I A;  3ZQ5 A;  2W1T A;  3KSH A;  2Y8H A;  4O0P A;  5HPF A;  4E04 A;  2QYB A;  2W1R A;  5AJG A;  3O5Y A;  4R70 A;  3KSI A;  3KSG A;  4RQ9 A;  4Y3I A;  2KOI A;  5HL6 A;  2VJW A;  2HGV A;  4LRY C;  2K31 A;  5DFY A;  2KLI A;  4MDZ A;  5HPI A;  2G7U A;  3TRC A;  3KO6 A;  2XRN A;  3E98 A;  4ZRR A;  3NOP C;  3G6O A;  3LFV A;  2VEA A;  4ETZ A;  3W2Z A;  4O01 A;  2O99 A;  1F5M A;  2O9B A;  3MQ0 A;  2O0Y A;  4IUH A;  3S7P A;  5HSQ A;  4GW9 A;  5K5B A;  3HCY A;  4GLQ A;  5L8M A;  5LBR A;  1YKD A;  1MKM A;  4Y5F A;  5I5L A;  1STZ A;  1TF1 A;  4QPR A;  5DFX A;  4LRX C;  1TD5 A;  4ETX A;  4EUV A;  5TJJ A;  2W1T B;  4CQH A;  1ZTU A;  3NHQ A;  2W3F A;  4ME4 A;  4Z1W A;  2M7V A;  3S7N A;  2K2N A;  2W3G A;  4PAU A;  3BJN A;  3C2W A;  4G3V A;  3RFB A;  4BWI A;  4DN0 A;  4R6L A;  3MMH A;  4Q0H A; 
#chains in the Genus database with same CATH topology
 1N9O A;  1XJ6 A;  5CXW A;  4UAA A;  4OP5 A;  5A93 A;  3N7W A;  3LGO A;  1S1Z A;  3LI8 A;  3D4F A;  5FQK A;  3OPR A;  3NOU C;  3CI6 A;  3IS2 A;  1EI5 A;  5L2F A;  2X71 A;  3IHA A;  2XFT A;  2W3E A;  4GJ4 A;  2Y59 A;  2VGK A;  4GN2 A;  5FI2 A;  1KVL A;  3DAV A;  5D3O A;  4WZ4 A;  1A0K A;  1KVM A;  2WKH A;  2XK1 A;  2XGN A;  4NKP A;  3MZE A;  3Q7Z A;  4OPZ A;  5FAS A;  2ZD8 A;  5GLA A;  5TBM A;  1TDL A;  4Q0I A;  3ZQ5 A;  4GZB A;  4GS9 A;  3ICY A;  3VSL A;  3F1P B;  1K57 A;  4WLA A;  3ZVT A;  4DDS A;  3L9K A;  4JLF A;  1M40 A;  1LHY A;  4BEN A;  4KUO A;  1ZC2 A;  2V1Z A;  3G34 A;  4ID4 A;  5TFQ A;  1L0D A;  4WMC A;  3VSK A;  3FKV A;  4HOI A;  5HWT A;  4B4Z A;  2VEA A;  4OKP A;  1U60 A;  3EWK A;  1K56 A;  4JXW A;  3GR2 A;  2HDU A;  3LIC A;  4PKY A;  1Q2P A;  3UN7 A;  1OTA A;  1MKM A;  2IWD A;  5I5L A;  1IFQ A;  5CER A;  1BLS A;  3ZNY A;  1PZO A;  5DF9 A;  3BM6 A;  3AGF A;  1N9L A;  1QMF A;  3GDI A;  5GHZ A;  2W3F A;  3TW8 A;  3LEQ A;  2Q9M A;  2R9X A;  4S2O A;  3WS1 A;  2ZM8 A;  3H82 A;  3F1N B;  4P6Z M;  2W0N A;  1VB6 A;  3LR3 A;  1T18 A;  3M2K A;  5J7E A;  3MXQ A;  2EFX A;  3H9W A;  4QY5 A;  3A3F A;  4QWO A;  5F83 A;  2D02 A;  2VV8 A;  2Y2Q A;  3G31 A;  3PBS A;  4DKI A;  2W3H A;  3C7V A;  5AQA A;  2WAE A;  4OLG A;  4DMZ A;  2V0W A;  3OPH A;  2A49 A;  4UHU A;  2H10 A;  2H5S A;  2XLN A;  3E4Q A;  2EX8 A;  5G4Y A;  4PPR A;  1ERO A;  3SW1 A;  4CJN A;  4H8R A;  3KSI A;  3KSG A;  4JBF A;  3ZNT A;  5J4E A;  2JKF A;  3UME A;  4I3A A;  3MJQ A;  3ZG9 B;  3BW6 A;  2HDQ A;  2ZM2 A;  1OT6 A;  3LUQ A;  1L0F A;  4M3K A;  4LCM A;  1RP5 A;  1H8Y A;  3PTE A;  2KDK A;  3IX4 A;  4KZ8 A;  5K5B A;  4ZDX A;  4EV4 A;  1JWZ A;  2YKH A;  1HZO A;  4YWZ A;  3V5M A;  2Z6D A;  3N6I A;  5E43 A;  5HAI A;  5IT5 A;  1J9M A;  2HZ5 A;  2Y2G A;  1V9Y A;  2ZOI A;  4B4X A;  1FIL A;  5KZH A;  5FEF A;  3G2Z A;  1ODV A;  2VLG A;  4G3V A;  1MZU A;  4OVD A;  3IH8 A;  4Q0J A;  2VKS A;  2WGI A;  4KZ4 A;  4EBL A;  4G3W A;  3OBF A;  1NYM A;  1FSW A;  3NIA A;  3WRT A;  4K0W A;  3VFF A;  4U3T A;  1TS0 A;  5EM0 A;  2QJ5 A;  5HW3 A;  1XA1 A;  2V20 A;  1C3B A;  3ITA A;  4FOF A;  1UGU A;  2AVX A;  2J9O A;  1K4E A;  2IWC A;  4D2O A;  4DE0 A;  3FYZ A;  3CZD A;  4S2M A;  1OTB A;  2PR5 A;  5AQ7 A;  4NET A;  3KSF A;  1YAX A;  2WGV A;  1KGG A;  1G68 A;  1MC0 A;  1DRM A;  4YIN A;  3MSH A;  4WEJ A;  2OV5 A;  1D7E A;  4B9O A;  4RQ9 A;  4EWF A;  1VET B;  4CLC D;  5CHM A;  1K0K A;  2XRN A;  1LL9 A;  1IOU A;  1JTD A;  1SKO B;  4GOG A;  3I7J A;  2HPB A;  1IEM A;  4WN5 A;  3C4O A;  3BFG A;  1VEU B;  2P7J A;  4GDB A;  3LR0 A;  2B95 A;  2QWS A;  2ZJ9 A;  5CED A;  3EGD C;  4LRX C;  3A0R A;  4FD8 A;  1S67 L;  5DKL A;  1BUE A;  3ZFZ A;  3LCE A;  1GSV A;  3S7N A;  4JGO A;  3IT9 A;  2K2N A;  2ZLY A;  2W3G A;  4PAU A;  2EWW A;  4FUW A;  2ZBB A;  3DTK A;  5CEB A;  4HP4 A;  3BY9 A;  2DNS A;  4EET B;  3CIT A;  3F1P A;  2WYX A;  3CUE A;  5C5K A;  1DJC A;  5FQJ A;  2OWH A;  1OTI A;  1W63 Q;  3MF0 A;  2XD5 A;  4JXS A;  2RCX A;  1P97 A;  1EW0 A;  5HL1 A;  5BOH A;  1E25 A;  4IED A;  5JYO A;  1XJ4 A;  4NG2 A;  3SS3 A;  1MPL A;  4E3L A;  3OCL A;  5HZH A;  3Q81 A;  4Y2F A;  5FAQ A;  3MKF A;  4IBR A;  3W8K A;  3M6B A;  2PD7 A;  3BLM A;  3G2Y A;  3O5Y A;  4KZ6 A;  2BLS A;  1OT9 A;  1DJA A;  5HL6 A;  1HVB A;  1MWT A;  1PIO A;  3O87 A;  3QP5 A;  3F1N A;  3EEH A;  3BY8 A;  2P04 A;  2VA0 A;  4ETZ A;  1IEL A;  3W2Z A;  3W4Q A;  4LV3 A;  4C6Y A;  4CLC C;  4GLQ A;  4ZJ3 A;  3AGE A;  4OQH A;  1K54 A;  2W1T B;  3MQO A;  3LIA A;  2ZC7 A;  3VP4 A;  5FSR A;  1SKF A;  4HHD A;  2BTF P;  3Q07 A;  3UDX A;  4AFI A;  2Z2L B;  3MXS A;  1BT5 A;  4OH0 A;  3BLS A;  1QME A;  2GX5 A;  2Y2N A;  2H0T A;  1PRQ A;  3UB9 A;  2LB9 A;  3IBR A;  5EOE A;  5FDS A;  4G3K A;  4WMC D;  2HDR A;  3V3S A;  1S4S A;  2EX6 A;  1MXO A;  3UDI A;  4Q8I A;  5CEC A;  2JKR M;  4BLM A;  3DWK A;  3KX0 X;  4ZJ2 A;  3HLC A;  4LCL A;  1K56 D;  4MCW A;  1Z6F A;  4EBP A;  2OLV A;  4LV0 A;  4BL3 A;  1JTG A;  3ZG7 B;  4X53 A;  4YOF A;  2MJ6 A;  2XD1 A;  3ITB A;  2GNX A;  3PAE A;  3VP3 A;  2ZQ7 A;  2Y2P A;  4FSF A;  2J3T C;  3N4I A;  1LSX A;  4I39 A;  1DP9 A;  4L9E A;  2ZC3 B;  2HP5 A;  3ISG A;  1N9N A;  1XJ2 A;  5DTT A;  2JKR I;  2GZA A;  4JGP A;  1BLH A;  3KO6 A;  1UWP X;  3SZT A;  3T1X A;  3NDE A;  3GQZ A;  2WK0 A;  4QHC A;  1F5M A;  2BG1 A;  4Y0U A;  3MQ0 A;  3UE1 A;  3AGD A;  5EVI C;  1YKD A;  2I72 A;  4D60 A;  1XX2 A;  4KZ5 A;  2V1A A;  1YLW A;  5TJJ A;  1MY8 A;  3FWL A;  1ZTU A;  3JPU A;  3LID A;  4JGQ A;  3W4O A;  2V0U A;  5AQB A;  4DE1 A;  1XKZ A;  4X1L A;  4MN6 A;  4WF0 A;  3C5A A;  2PAV P;  1BTL A;  5DTS A;  4I3I A;  1KDS A;  2IA2 A;  4WYY A;  1Y4O A;  1YQS A;  5IHV A;  3UB8 A;  2WUQ A;  4UQI S;  3H7W B;  5E2F A;  3TOI A;  2QHK A;  1VET A;  2E8J A;  1NY0 A;  1GSX A;  5KIZ A;  3OC2 A;  1ES5 A;  4N9L A;  2B5R A;  4Y13 A;  4HJ4 A;  1SKO A;  3QP2 A;  2IWB A;  3OPL A;  3ZG0 A;  5EEC A;  3NDG A;  1VEU A;  3BQ8 A;  1BLC A;  2PHY A;  2VGL S;  3JVU A;  3FPV A;  2XA7 S;  2L1M A;  4DDY A;  3F1O B;  1HLU P;  2JKT M;  4K08 A;  2QKP A;  2DCF A;  1G6A A;  3VE3 A;  4E6W A;  3ZDJ A;  3Q7V B;  1DY6 A;  5F1F A;  2V9A A;  5GLD A;  3SH7 A;  4S2N A;  1SDN A;  3HUO A;  1RCJ A;  3UB5 P;  3NEC A;  2HF6 A;  1YMS A;  2ZOH A;  4QY6 A;  2WKP A;  4L0L A;  4L9F A;  2A2L A;  2NUP C;  1K55 A;  5HWV A;  1J3W A;  1CJF A;  1BSG A;  1PZP A;  4IVI A;  3UPP A;  5CGX A;  4HNB A;  3RTY A;  2L0W A;  3G6O A;  1S0W A;  1PI5 A;  4JXV A;  3N8L A;  2CC1 A;  4IUH A;  4GW9 A;  5EFW A;  3LIF A;  1FCO A;  3LYX A;  1MKI A;  1TF1 A;  3QP1 A;  4QPR A;  3LR5 A;  2JKT I;  3U4L P;  3MR0 A;  5U47 A;  4JPM A;  4DE2 A;  1S4R A;  2I9V A;  1ESU A;  4P87 A;  1NZO A;  3VFH A;  4BBU A;  1X0O A;  1IYO A;  4GHI B;  3IQA A;  3NUL A;  2PDR A;  4KZ7 A;  4R0Q A;  1W8Y A;  5DVA A;  2ZC4 B;  3V50 A;  3QP4 A;  3HRE A;  3DTE A;  4IHQ A;  1F9I A;  1XP4 A;  1V9Z A;  3K3D A;  3C38 A;  2HJ9 C;  1CQA A;  1ESI A;  2HJE A;  3GV9 A;  4UEY A;  1H8M A;  3UY6 A;  5F68 A;  1H0M A;  1KOU A;  3MXR A;  1NLZ A;  3MZF A;  1YSQ A;  5CHU A;  2W1T A;  5L09 A;  5HX9 A;  3VP2 A;  5G18 A;  4E3I A;  1LI0 A;  5HDD A;  2Y2L A;  3C30 A;  3VOL A;  3N8R A;  2X02 A;  4MNR A;  1KE4 A;  4E3K A;  2HGV A;  5HDC A;  3PBT A;  3JYI A;  4HH2 A;  5HPI A;  1M6K A;  5F1G A;  3CG5 A;  1BYW A;  2WGW B;  4FH2 A;  4EBN A;  3WS0 A;  2O9B A;  2XDM A;  2PBD P;  1K6S A;  4X6T A;  5F5Y A;  2EXA A;  4BMW A;  3UDF A;  2XF3 A;  3B33 A;  3O88 A;  2YKF A;  3RXX A;  4IVK A;  2QJ7 A;  2WKQ A;  4S2K A;  5DJT A;  2JKG A;  1IYQ A;  5HD5 A;  3T1S A;  5HAR A;  3BFE A;  4JKT A;  4C75 A;  4I5S A;  1S66 L;  4ZBE A;  3S4X A;  4OQ0 A;  1KGF A;  1FCM A;  3RFB A;  4DN0 A;  4PM9 A;  4NXE A;  1T1A A;  3CHW P;  1KDW A;  5MC7 A;  4HBT A;  2PYP A;  4LV1 A;  4LRZ E;  3R7W B;  1LL5 A;  2XRO A;  4WZ5 A;  2XFS A;  4CLC B;  1Y28 A;  2XSS A;  5KSH A;  3PXP A;  4HES A;  3C8C A;  4HJ3 A;  3EQV A;  4OOL A;  4IBX A;  2UWX A;  3ZCZ A;  5JYP A;  4I38 A;  1YM1 A;  2X01 A;  4PM5 A;  5EVE A;  4R1G A;  4KQQ A;  3T50 A;  4NK3 A;  4IUK A;  4O7D A;  3IF6 C;  3WRZ A;  3IXG A;  3SH8 A;  1DP6 A;  2Y8H A;  4E3N A;  3PHY A;  4X25 A;  2ACG A;  3TJZ C;  1ERM A;  1Q2Q A;  2Y55 A;  3T4O A;  2DRW A;  4LEN A;  3UPO A;  4KQO A;  2HP9 A;  3FV7 A;  3NOP C;  2Y2I A;  3LIE A;  1NXY A;  2NUT C;  3BFC A;  2P9V B;  1MWR A;  3GRJ A;  3H7W A;  1MBL A;  4A5R A;  1GA0 A;  3P7N A;  1YLZ A;  1ERQ A;  4B88 A;  3OPP A;  4EUV A;  4OPQ A;  3ZHH A;  1YLT A;  4XUX A;  1ONH A;  1NRJ A;  4Y0T A;  4WM9 A;  3S22 A;  3B42 A;  4KG6 A;  3F1O A;  2WKR A;  1P0Z A;  3VE4 A;  4ZJ1 A;  1FIK A;  3Q7V A;  3IBJ A;  1KE0 A;  4BBT A;  3OZH A;  2ZMF A;  1NJ4 A;  4ESP A;  4P85 A;  4ARZ B;  4N1H A;  2V2F F;  5EVI B;  2VZW A;  5HAP A;  3IWI A;  3UMD A;  2EX2 A;  2VV7 A;  4LGW A;  3P09 A;  4UQI M;  2OOL A;  1IKI A;  4X55 A;  3PBN A;  5FDH A;  3EGX C;  4O8G A;  2C6W B;  3W4P A;  4KZB A;  4MEZ A;  2Y4A A;  1ZG6 A;  3KYE A;  4S2P A;  3ULF A;  4E04 A;  5EM1 A;  4OON A;  2J8Y A;  2XA7 M;  4QD4 A;  5DFY A;  4S2I A;  5FQM A;  1XFN A;  1P9W A;  5GHY A;  4KEN B;  4B93 A;  3QP8 A;  2XEP A;  1PNE A;  4GHI A;  1ES4 A;  2KX6 A;  3G32 A;  2O0Y A;  4JGR A;  3S7P A;  3EOI A;  1FOF A;  3UE6 A;  4Y5F A;  4GD8 A;  2VK3 A;  3WS4 A;  4QU3 A;  5EUA A;  3PYP A;  3GMW A;  1I2S A;  1SZV A;  1LSW A;  3DTI A;  4R4R A;  1LSV A;  2JN7 A;  3C4P A;  2Y2K A;  5HFO A;  1K4F A;  4BWI A;  1W79 A;  3T1Q B;  4PM7 A;  4EU0 A;  1VHM A;  2H28 A;  4HH3 A;  5DF8 A;  3A3I A;  4E6X A;  1LI9 A;  3DBA A;  5FL3 A;  3GEC A;  3S7Q A;  3TG9 A;  1VQQ A;  1WYC A;  1YSP A;  2O9C A;  4PM6 A;  1XFQ A;  3V67 A;  1K38 A;  4HIA A;  4OPY A;  1LLB A;  2PBY A;  5EOO A;  1N9B A;  3HVF A;  1XGJ A;  5FQI A;  2WGW A;  1XA7 A;  4FTX A;  3C7U A;  4F94 A;  4Y17 A;  4KZ3 A;  5CRF A;  5EV0 A;  5M18 A;  2RL3 A;  4K91 A;  3IX8 A;  3HLF A;  1XPB A;  4PHT A;  4LRY C;  2L4R A;  3CMZ A;  5DJU A;  3JVV A;  3SH9 A;  5A8B A;  3E98 A;  1ES2 A;  4RYE A;  4ZRR A;  5F69 A;  2OSU A;  1PFL A;  1YMX A;  2PU2 A;  3R7W A;  2O99 A;  2EXB A;  4EQI A;  5FAO A;  5FI7 A;  2DMW A;  1P9R A;  4H6J B;  1L3L A;  4RX2 A;  5DFX A;  3VMA A;  4MN5 A;  1VM1 A;  3HL9 A;  5G4Z A;  2A24 B;  2M7V A;  4HI4 A;  4KUK A;  1SCW A;  3M6H A;  3E2L A;  3BJN A;  3HUN A;  2QMI A;  3LY4 A;  3HLD A;  1PW8 A;  3A3J A;  2M7U A;  5FQQ A;  1H3Q A;  4WBG A;  3SOI A;  2ZQC A;  3SS4 A;  4YNR A;  2J9P A;  1TS8 A;  3LEZ A;  1G28 A;  1E3U A;  1TEM A;  1BUL A;  3T4Q A;  2M1C A;  3PBO A;  4DJ3 A;  2ZM0 A;  3E0Y A;  5DKK A;  5CTN A;  2OWJ A;  3CAX A;  5KMW A;  1Z09 A;  4JF4 A;  3A0S A;  3A3D A;  3D9Y A;  2Y2J A;  2P9V A;  2W3D A;  1K55 C;  2Y2M A;  1AWI A;  1G5U A;  4RA7 A;  2G2W A;  3NY4 A;  3T4S A;  4WEK A;  2WKE A;  1KGE A;  2JC7 A;  1TS6 A;  3P01 A;  3U2A A;  4LLO B;  1K57 C;  5HPF A;  2Q9N A;  2FFY A;  5GL9 A;  2QYB A;  3IWO A;  3CJM A;  2K31 A;  4XUZ A;  2KLI A;  2W27 A;  1IYS A;  4MDZ A;  3UNW A;  3T12 B;  3CWF A;  1WYB A;  3NJA A;  3MFD A;  3HLG A;  3UE0 A;  4CPK A;  1S1Y A;  5HDS A;  3BRM A;  5A91 A;  4ARZ A;  1ES3 A;  2A3U A;  1TS7 A;  2VGJ A;  4DF6 A;  4HQA A;  4S2J A;  5EVI A;  1NWZ A;  4ETX A;  1L0G A;  1JVJ A;  3IF6 B;  4NXF A;  4I3J A;  4R4S A;  3ZGA B;  4R23 A;  3VOY A;  3VP1 A;  4F3L B;  1OTE A;  5EVL A;  4LV2 A;  3LO7 A;  1MWS A;  4Q0H A;  3WS5 A;  2G2U A;  3PBQ A;  4XT2 B;  5EE8 A;  5EPH A;  1AXB A;  4KQD A;  2HV1 A;  3PAG A;  3D3O A;  4IJG A;  4GNU A;  4HJ6 A;  3HJK A;  2O9A A;  4GB7 A;  3FZC A;  1CEF A;  2JCH A;  1GSW A;  4U0T A;  3NI9 A;  5AVE A;  3O3V A;  1O07 A;  4OP8 A;  5GHX A;  4E3M A;  3V3R A;  4K0X A;  1K25 A;  4QJG A;  2K7S A;  2XQZ A;  4PMA A;  3MS6 A;  5CX7 A;  4DE3 A;  1OJG A;  2V8F A;  3RXW A;  4WL9 A;  3EEA A;  3K2N A;  3R4K A;  3K3C A;  1GHM A;  2GJ3 A;  4DRT A;  4E3O A;  3DWZ A;  3S1Y A;  2PD8 A;  1I5Q A;  1S6R A;  3HLB A;  1SHV A;  4Y3I A;  1WA9 A;  1FQG A;  2VJW A;  1GHI A;  1T1B A;  2J80 A;  4ZAM A;  1O7E A;  5L07 A;  5E2G A;  1PWG A;  2ZQ9 A;  5AQ9 A;  1EWZ A;  4II7 A;  4X68 A;  3HCY A;  2OAQ 1;  2OLU A;  5M1A A;  1DJB A;  1N4O A;  4GDN A;  1K6R A;  4U0X A;  5HD3 A;  4JF5 A;  4WZ5 C;  4CQH A;  4BD0 A;  3UO9 A;  3LI9 A;  3UPN A;  4FH4 A;  4RX3 A;  3A0V A;  4HBU A;  5IU1 A;  2EFU A;  2OAP 1;  3N8S A;  2R9W A;  1I2W A;  2E8I A;  1BLP A;  4HY8 A;  5HWW A;  4GCZ A;  1XXM A;  3Q1F A;  2Z2M B;  3GSG A;  5FAT A;  2ZMA A;  1BZA A;  3HBR A;  1FR1 A;  5A90 A;  3HLW A;  3NOT C;  3ZYT A;  1L0E A;  3FKW A;  2QZ6 A;  2JHE A;  3T1R A;  4DXB A;  4P0M A;  5J8X A;  1NLY A;  4E3J A;  2Y2H A;  2Y91 A;  4MLL A;  4KQR A;  3T4L A;  1W5D A;  4H6J A;  3WWX A;  3B3X A;  3QHY A;  2Q0O A;  2JBF A;  4KG2 A;  3M2J A;  3TE8 A;  1T1C A;  1UWN X;  3IF5 A;  3HJI A;  4MBH A;  4O0P A;  2A24 A;  1OPX A;  1CEG A;  3E4O A;  3Q82 A;  2WAF A;  1W8Q A;  1LT0 A;  3V39 A;  3QNC A;  5TR7 A;  2QPN A;  1DP8 A;  4GD6 A;  3E4P A;  3UB7 A;  4C3Q A;  5L10 A;  2EX9 A;  3IXH A;  3GVB A;  2V1B A;  4O01 A;  4EER A;  5E2E A;  4M4X A;  4MBF A;  1TDG A;  1E4D A;  2ZC5 B;  3HLE A;  3E2K A;  5KSC A;  3FC7 A;  4KZ9 A;  1PI4 A;  1NRF A;  5DF7 A;  3RH8 B;  3IH9 A;  1GA9 A;  1JWV A;  3P98 A;  4ME4 A;  3A3E A;  2EWV A;  2WAD A;  3NBL A;  4PM8 A;  2ZL1 B;  3LR4 A;  2CMN A;  3LIB A;  3QNB A;  5CTM A;  3VV4 A;  1RGZ A;  2Y79 A;  1NZU A;  1IYP A;  3NCK A;  1YPR A;  3CUE C;  3T4T A;  2WZX A;  3FPW A;  4OOM A;  1ALQ A;  4EEU A;  1ACF A;  1HD8 A;  5FEG A;  5CHJ A;  5HAQ A;  2P08 A;  5A92 A;  3CPT B;  4FCF A;  4DJ2 A;  1F2K A;  2PT7 A;  2R78 A;  3G35 A;  1W63 M;  2ZMV A;  4N92 A;  2VX8 A;  2LB5 A;  1KE3 A;  2PU4 A;  2Y2O A;  4NXB A;  5FAP A;  4EQ1 A;  5IS1 A;  4MN7 A;  1PWC A;  1SDE A;  3OLO A;  4R3J A;  5GLC A;  4HEF A;  5TGF A;  3IF6 A;  4MBK A;  1T19 A;  4HP9 A;  2GDN A;  1YLJ A;  1CI8 A;  2VV6 A;  4F3L A;  5J3W A;  4R70 A;  4OQI A;  5FQ9 A;  1WE4 A;  3IS2 B;  1PWD A;  1CF0 A;  1NYY A;  3L7H A;  3MFX A;  4XT2 A;  1HTZ A;  4EW7 A;  1CI9 A;  1E3U D;  2INW A;  3WS2 A;  1IKG A;  4KG5 A;  2WZZ A;  5FI6 A;  1Y54 A;  4OLD A;  5AVF A;  3DW0 A;  3UB6 A;  2VGL M;  3D72 A;  1STZ A;  1K54 C;  1H8Z A;  5TBM B;  2C5W B;  2PR6 A;  4RVA A;  4GS9 B;  4P6Z S;  2B02 A;  2PRF A;  3SS5 A;  3NHQ A;  4X69 A;  4CLC E;  2J7V A;  1CK3 A;  2ZQD A;  4Z1W A;  4Z9Q A;  3FG8 A;  3ZVW A;  2V8C A;  4N9K A;  3IXB A;  3MBZ A;  4R6L A;  4ZTK A;  2J3T D;  1F98 A;  4UA9 A;  4P6B A;  4JF6 A;  4LFU A;  1L2S A;  3BQA A;  3KYZ A;  3IX3 A;  4WUJ A;  4MMN A;  3S7O A;  3QP6 A;  3OOV A;  2FH5 A;  1RGY A;  5GLB A;  1FCN A;  1OME A;  2HP6 A;  4EXO A;  4GKU A;  3UE3 A;  3BFF A;  4NEE D;  5EVI D;  4OPR A;  2J3W A;  1GCE A;  1JNU A;  2BAS A;  4BQM A;  3H82 B;  2EA9 A;  4Y15 A;  4X56 A;  3BYD A;  4JXG A;  3KSH A;  2ZQA A;  2W1R A;  4R3B A;  5F6A A;  5M19 A;  1FR6 A;  1XJ3 A;  5FA7 A;  3TRC A;  4R3A A;  5DTK A;  3KYQ A;  2WKI A;  4X1M A;  4L9G A;  4OQG A;  4EUZ A;  1MWU A;  3BEB A;  3BWL A;  3IHB A;  1OTD A;  5E2H A;  2UV0 E;  4UA7 A;  4R38 A;  1W7F A;  5L8M A;  5LBR A;  1PYY A;  2JE5 A;  1TD5 A;  2XH9 A;  4NXG A;  2ZQ8 A;  3G4P A;  4BL2 A;  1FSY A;  1ZKJ A;  3VOZ A;  2H0Y A;  3LY3 A;  4DXC A;  3EQU A;  5F82 A;  4KZA A;  1G6O A;  5CGS A;  1JWP A;  4EES A;  2D01 A;  4CLC A;  3MQQ A;  3G30 A;  3OCN A;  3IXD A;  3DTM A;  2ZC6 B;  4Y7P A;  4N1X A;  3BFD A;  5I94 A;  3T4K A;  1GHP A;  2B18 A;  3MZD A;  3ZG8 B;  4OOY A;  1PW1 A;  4LPZ A;  2Z6C A;  4BBV A;  1YT4 A;  4WEL A;  1ZG4 A;  1XGI A;  3IWQ A;  4QB8 A;  1YLP A;  2XR0 A;  3TSG A;  4S2L A;  4S2N C;  2P74 A;  5AJG A;  1ONG A;  2KOI A;  3HUM A;  2ZL1 A;  3PBR A;  3CLO A;  2FFF B;  2HDS A;  2G7U A;  1ZHH B;  4YFM A;  1H5X A;  1LL8 A;  3LFV A;  1OJ5 A;  1D1J A;  4EEP A;  1YLY A;  3NC8 A;  5HSQ A;  2PYR A;  3PR6 A;  4PKY G;  4BJP A;  3GTC A;  3MKE A;  3O86 A;  3RJU A;  3VP0 A;  3CPT A;  3ZG5 A;  3B47 A;  4XXR A;  5CGW A;  1TVF A;  1D06 A;  4UA6 A;  4BD1 A;  2FZ0 A;  3C2W A;  3BEC A;  3T4J A;  3MMH A;  4Y0O A; 
#chains in the Genus database with same CATH homology
 3F1O A;  1N9O A;  2WKR A;  1P0Z A;  2GX5 A;  4HY8 A;  3VE4 A;  5HWW A;  4GCZ A;  1XJ6 A;  3UB9 A;  3IBJ A;  4BBT A;  2LB9 A;  1S1Z A;  3LI8 A;  2ZMF A;  3IBR A;  4G3K A;  4ARZ B;  3NOU C;  3CI6 A;  3IS2 A;  1S4S A;  2JKR M;  2VZW A;  2W3E A;  4GJ4 A;  3KX0 X;  3UMD A;  2VV7 A;  3NOT C;  3ZYT A;  4MCW A;  4UQI M;  2OOL A;  2JHE A;  3PBN A;  1NLY A;  3EGX C;  4O8G A;  4YOF A;  2MJ6 A;  3T4L A;  4H6J A;  4NKP A;  2GNX A;  3TE8 A;  1T1C A;  4FSF A;  1UWN X;  5TBM A;  4Q0I A;  3ZQ5 A;  3HJI A;  2J3T C;  4GS9 A;  1LSX A;  3ICY A;  4O0P A;  3F1P B;  4I39 A;  1DP9 A;  3ULF A;  4WLA A;  4E04 A;  2A24 A;  4L9E A;  1N9N A;  1OPX A;  1XJ2 A;  3E4O A;  2XA7 M;  4KUO A;  5DFY A;  2JKR I;  2GZA A;  1LT0 A;  4JGP A;  3KO6 A;  1DP8 A;  1XFN A;  1P9W A;  1UWP X;  4HOI A;  3E4P A;  5HWT A;  3UB7 A;  4B93 A;  2VEA A;  4O01 A;  2V1B A;  4EER A;  4GHI A;  1F5M A;  4M4X A;  3EWK A;  3MQ0 A;  2KX6 A;  2O0Y A;  4JGR A;  3S7P A;  3LIC A;  4PKY A;  3EOI A;  1OTA A;  1YKD A;  1MKM A;  3FC7 A;  3UE6 A;  4Y5F A;  5I5L A;  1IFQ A;  2V1A A;  3PYP A;  5DF9 A;  5TJJ A;  3RH8 B;  1N9L A;  3GDI A;  1ZTU A;  1LSW A;  3LID A;  2W3F A;  4JGQ A;  4ME4 A;  3TW8 A;  2V0U A;  1LSV A;  2JN7 A;  2EWV A;  3LR4 A;  4MN6 A;  4WF0 A;  4BWI A;  2CMN A;  4I3I A;  3H82 A;  3F1N B;  3LIB A;  2W0N A;  4P6Z M;  2IA2 A;  3VV4 A;  4EU0 A;  1VHM A;  2H28 A;  4HH3 A;  1VB6 A;  2Y79 A;  3DBA A;  3GEC A;  5FL3 A;  3S7Q A;  3UB8 A;  3LR3 A;  1T18 A;  3CUE C;  1YSP A;  3T4T A;  2O9C A;  4UQI S;  3H7W B;  3FPW A;  4OOM A;  5J7E A;  3MXQ A;  2QHK A;  4EEU A;  1GSX A;  1XFQ A;  3H9W A;  3V67 A;  5KIZ A;  3OC2 A;  4HIA A;  2P08 A;  2D02 A;  2VV8 A;  4HJ4 A;  4DJ2 A;  2PT7 A;  2R78 A;  3PBS A;  1W63 M;  2ZMV A;  2VX8 A;  2LB5 A;  2W3H A;  4NXB A;  3BQ8 A;  4DMZ A;  4EQ1 A;  2PHY A;  2VGL S;  3JVU A;  3FPV A;  2XA7 S;  2L1M A;  2V0W A;  5IS1 A;  3F1O B;  4MN7 A;  3OLO A;  2JKT M;  4K08 A;  2QKP A;  3VE3 A;  1T19 A;  3E4Q A;  4HP9 A;  2V9A A;  5G4Y A;  2VV6 A;  4F3L A;  3SW1 A;  5J3W A;  4R70 A;  3KSI A;  3KSG A;  4PHT A;  2HF6 A;  4LRY C;  3IS2 B;  2L4R A;  5DJU A;  5J4E A;  3JVV A;  2ZOH A;  2WKP A;  4L0L A;  4L9F A;  2A2L A;  3UME A;  3MFX A;  4I3A A;  2NUP C;  3MJQ A;  4XT2 A;  5A8B A;  3E98 A;  5HWV A;  3BW6 A;  4ZRR A;  5F69 A;  4EW7 A;  2INW A;  1OT6 A;  3LUQ A;  4HNB A;  3RTY A;  2L0W A;  3G6O A;  3R7W A;  2KDK A;  2O99 A;  4IUH A;  5K5B A;  2DMW A;  4GW9 A;  1P9R A;  5AVF A;  4H6J B;  5EFW A;  3UB6 A;  3LIF A;  2VGL M;  2YKH A;  3D72 A;  3LYX A;  4YWZ A;  1STZ A;  1TF1 A;  2Z6D A;  4QPR A;  3LR5 A;  5DFX A;  5TBM B;  2JKT I;  4MN5 A;  2PR6 A;  3MR0 A;  5IT5 A;  4GS9 B;  4P6Z S;  2B02 A;  5G4Z A;  3NHQ A;  4CLC E;  2A24 B;  4Z1W A;  4HI4 A;  2M7V A;  1V9Y A;  3FG8 A;  4KUK A;  2ZOI A;  1S4R A;  3BJN A;  2I9V A;  1ODV A;  2VLG A;  4G3V A;  1MZU A;  4R6L A;  2J3T D;  1F98 A;  4Q0J A;  2M7U A;  2VKS A;  1H3Q A;  4G3W A;  4BBU A;  3OBF A;  1X0O A;  3BQA A;  3KYZ A;  4YNR A;  1TS8 A;  4GHI B;  1G28 A;  1TS0 A;  2QJ5 A;  4MMN A;  4WUJ A;  3S7O A;  2PDR A;  4FOF A;  3OOV A;  1UGU A;  3T4Q A;  2FH5 A;  2M1C A;  3PBO A;  4IHQ A;  1F9I A;  4DJ3 A;  3E0Y A;  5DKK A;  1V9Z A;  3K3D A;  3C38 A;  1OTB A;  2HJ9 C;  2PR5 A;  4EXO A;  2OWJ A;  3CAX A;  3UE3 A;  3A0S A;  4NEE D;  2HJE A;  2W3D A;  2J3W A;  1JNU A;  4UEY A;  1H8M A;  2BAS A;  3KSF A;  1YAX A;  3T4S A;  4WEK A;  5F68 A;  3H82 B;  1KOU A;  1NLZ A;  2EA9 A;  1MC0 A;  1YSQ A;  1TS6 A;  3P01 A;  3U2A A;  1DRM A;  4LLO B;  2W1T A;  3KSH A;  5HPF A;  5HDD A;  3C30 A;  4WEJ A;  3VOL A;  2QYB A;  2W1R A;  1D7E A;  4B9O A;  4RQ9 A;  5F6A A;  2HGV A;  4CLC D;  2K31 A;  5HDC A;  2KLI A;  2W27 A;  3PBT A;  4MDZ A;  1XJ3 A;  4HH2 A;  5HPI A;  3TRC A;  4R3A A;  2XRN A;  3KYQ A;  3CWF A;  1IOU A;  3NJA A;  4L9G A;  1BYW A;  1S1Y A;  3BWL A;  2O9B A;  1OTD A;  5HDS A;  4WN5 A;  4R38 A;  4ARZ A;  1TS7 A;  2P7J A;  5F5Y A;  5L8M A;  4HQA A;  5LBR A;  4BMW A;  3LR0 A;  3B33 A;  2QWS A;  2YKF A;  1NWZ A;  2QJ7 A;  3EGD C;  2WKQ A;  4LRX C;  1TD5 A;  3A0R A;  4ETX A;  4NXG A;  1S67 L;  4NXF A;  5DKL A;  4I3J A;  5DJT A;  5HD5 A;  4F3L B;  4I5S A;  1GSV A;  3S7N A;  1S66 L;  4JGO A;  2K2N A;  1OTE A;  2W3G A;  3EQU A;  4PAU A;  2EWW A;  3RFB A;  1G6O A;  4DN0 A;  4NXE A;  4EES A;  4Q0H A;  1T1A A;  3PBQ A;  4XT2 B;  5MC7 A;  2D01 A;  2ZBB A;  4CLC A;  3MQQ A;  4HP4 A;  3BY9 A;  4KQD A;  4EET B;  2PYP A;  3CIT A;  4LRZ E;  2HV1 A;  3R7W B;  3F1P A;  3OCN A;  2XRO A;  3D3O A;  3CUE A;  4IJG A;  4HJ6 A;  3HJK A;  2O9A A;  5C5K A;  4CLC B;  2OWH A;  1OTI A;  1W63 Q;  1Y28 A;  3T4K A;  2XSS A;  2B18 A;  3MF0 A;  5KSH A;  3PXP A;  1GSW A;  3C8C A;  4HJ3 A;  3EQV A;  5AVE A;  4OOL A;  1P97 A;  1EW0 A;  4LPZ A;  4I38 A;  2Z6C A;  2K7S A;  4BBV A;  3T50 A;  4WEL A;  5CX7 A;  1XJ4 A;  4IUK A;  1OJG A;  3OCL A;  4WL9 A;  3EEA A;  5HZH A;  3K2N A;  3R4K A;  3K3C A;  4Y2F A;  2GJ3 A;  1DP6 A;  2Y8H A;  2PD7 A;  2PD8 A;  5AJG A;  3PHY A;  3O5Y A;  4Y3I A;  1OT9 A;  2KOI A;  1WA9 A;  5HL6 A;  2VJW A;  3TJZ C;  3PBR A;  3T4O A;  3CLO A;  1T1B A;  2G7U A;  1ZHH B;  3F1N A;  2J80 A;  3EEH A;  4KQO A;  3NOP C;  1LL8 A;  3LFV A;  1OJ5 A;  3BY8 A;  2P04 A;  2VA0 A;  4ETZ A;  3W2Z A;  4EEP A;  3LIE A;  2NUT C;  3H7W A;  4II7 A;  5HSQ A;  4CLC C;  3HCY A;  2OAQ 1;  3P7N A;  4GLQ A;  2PYR A;  3PR6 A;  4PKY G;  4BJP A;  5HD3 A;  4EUV A;  2W1T B;  4CQH A;  3MQO A;  3LI9 A;  3LIA A;  3B47 A;  1D06 A;  1NRJ A;  3A0V A;  4HHD A;  2FZ0 A;  3C2W A;  5IU1 A;  3B42 A;  2OAP 1;  4AFI A;  3T4J A;  3MMH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...