3D3OA

Crystal structure of the effector domain of the putative transcriptional regulator iclr from acinetobacter sp. adp1
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
176
structure length
176
Chain Sequence
SNALFSSRDILEVLQDIHMETGETVAIATKNDIYLQYIQIIESVHALRFHVDENAIRPLTMSSNGWMLMSTMNDKAIDNTVRRANTITQKDGIRFEVDDMMARIRQVREQGYASAEHIPFVGGGTICVLLPMTIQGQPVTMGLGGALDRIKQNYDRYLELLLNGVQQLKKSDSFHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Effector Domain of the Putative Transcriptional Regulator IclR from Acinetobacter sp. ADP1.
rcsb
source organism Acinetobacter sp.
molecule tags Transcription regulator
molecule keywords Putative transcriptional regulator, IcIR family
total genus 53
structure length 176
sequence length 176
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3d3oA00
3MQ0A 4Q0IA 2Y8HA 4IUHA 4E04A 4G3VA 3IBJA 1YSPA 2GX5A 3D3OA 2VJWA 3MF0A 2M7VA 2W1TA 4GW9A 5L8MA 2QYBA 2VKSA 5HPFA 4ETZA 4O8GA 4ME4A 1MC0A 1STZA 2ZMFA 5DFXA 3NHQA 2O9AA 3KSFA 1MKMA 3TRCA 4BWIA 4Y3IA 3G6OA 1YSQA 3IBRA 3BJNA 4IUKA 1YKDA 4YNRA 1TD5A 3RFBA 2LB5A 2XRNA 4Q0JA 4LRYC 3KSHA 4QPRA 4G3WA 4EUVA 3KO6A 2B18A 4MCWA 3ZQ5A 5C5KA 2W3GA 3E0YA 5LBRA 4Y5FA 4YOFA 3S7QA 4CQHA 2VEAA 3S7NA 4RQ9A 5AJGA 4IJGA 2KOIA 2W1TB 3W2ZA 3OBFA 3VV4A 3OOVA 2G7UA 4EU0A 2W3FA 4ETXA 1VHMA 1TF1A 2O9BA 4Z1WA 5HPIA 2O99A 2KLIA 4LRXC 5DFYA 4DN0A 5K5BA 4PAUA 4ZRRA 2O9CA 3NOTC 1F5MA 2M7UA 3E98A 2O0YA 3S7OA 3C2WA 3LFVA 2W3HA 4MN7A 3K2NA 3EEAA 4Q0HA 4DMZA 2K31A 2VZWA 5TJJA 5HSQA 4R70A 2LB9A 3CI6A 1ZTUA 4MDZA 3KSIA 2HGVA 3NOUC 2OOLA 4R6LA 3R4KA 4GLQA 4O0PA 3CITA 4G3KA 5HL6A 2IA2A 3DBAA 4FOFA 3KSGA 2K2NA 4MMNA 2W3EA 3O5YA 3HCYA 2Y79A 3NOPC 2W1RA 4Y2FA 3S7PA 3MMHA 5I5LA 2XROA 2XSSA 2W3DA 4LRZE 4O01A
chains in the Genus database with same CATH superfamily
3IS2B 1Q2QA 1K4FA 3UPOA 5FAQA 3TE8A 4I3IA 4R1GA 2HDUA 5DKKA 3N8LA 2R9XA 5TR7A 4FSFA 1LL5A 4IBRA 1FSYA 4BBVA 1PI5A 1TVFA 2VGJA 3QP5A 2Z6DA 1IYSA 4WEJA 3KYEA 2PHYA 5FQQA 3WS4A 2JN7A 4OLDA 2NUPC 4YOFA 2VEAA 3IHBA 1BLSA 4FH4A 1ZG6A 3IH8A 2XD1A 4E3KA 2WYXA 2J3WA 1KGFA 1U60A 1HTZA 2W3FA 2XLNA 1ONHA 3LR3A 5G4YA 2BTFP 2XQZA 3LO7A 4WLAA 3IWIA 5FI7A 2XGNA 4WZ4A 5F69A 2M7UA 1CQAA 5HWVA 5CGWA 2FFFB 5CERA 4KZ4A 4S2NA 4WZ5A 1KE4A 5FDSA 5CX7A 2EXBA 4R70A 3QHYA 4X6TA 4JGRA 4KZ6A 4DXCA 3E4QA 4H6JB 3N8SA 4S2PA 3PHYA 1E3UD 3LGOA 5TBMB 4XT2A 2R78A 2IA2A 3PXPA 2W3EA 1NY0A 3BQ8A 1YLJA 5HD3A 4JPMA 2XROA 2D01A 3P01A 3MQQA 3NC8A 4MBKA 1H0MA 5FQMA 2XK1A 3MQ0A 4IUHA 3AGEA 1SDNA 5AQ7A 1MWUA 5DKLA 3A3EA 1CF0A 3MZDA 3W4PA 1XXMA 3DTEA 1JWPA 3G32A 1TS6A 4PM5A 4OOMA 3HVFA 3ZVTA 4PM6A 3UDIA 3B3XA 2HDRA 4KZAA 1MKIA 4Q0JA 4NXGA 4KQRA 1PYYA 5J4EA 3HLFA 4HBTA 4CLCB 1KE0A 4KZ9A 3MR0A 4AFIA 3S7QA 3WRTA 4RQ9A 5DTTA 1DY6A 4CLCD 5EFWA 2KOIA 3R7WA 5E43A 1YAXA 4X56A 1T1BA 4WL9A 3BQAA 4UQIS 4E3MA 3OOVA 3C5AA 3LIBA 4U3TA 1WE4A 5GL9A 2O9BA 5HPIA 1ERMA 2PD7A 1F2KA 1F5MA 3VSLA 4KZ8A 2GDNA 2Y2MA 3UDXA 3KYQA 3H82B 2P9VA 3ZG0A 3AGFA 2CC1A 4HBUA 4EV4A 1RGYA 1ZTUA 3A3DA 1TEMA 3PBOA 2L0WA 2OAP1 2FH5A 2V9AA 5I94A 4X55A 1K55A 4B93A 5A8BA 5FQJA 4JLFA 1XJ6A 5HAPA 1G5UA 1XA1A 1ACFA 4HP9A 4B4XA 1T19A 3Q7VB 1TS0A 3FPWA 2PU2A 3Q82A 4G3VA 1BT5A 1A0KA 3MXQA 4ID4A 1BLPA 2OLVA 3MS6A 4KG6A 2Z2LB 3NY4A 5DFXA 5FAOA 2PBYA 1GHIA 1KGEA 4X69A 4DF6A 4PM8A 2V2FF 4WELA 3C8CA 1IFQA 1L2SA 3IBRA 4OPQA 1OTAA 4XXRA 2B5RA 2PR6A 2ZBBA 4L9FA 2XEPA 2XRNA 3PBQA 1I2WA 3JVVA 4X53A 5LBRA 5A91A 1GSXA 2Y2LA 4GD8A 2WAEA 3ITAA 4WBGA 4CPKA 2ZC6B 2K7SA 1XFNA 2KDKA 2G7UA 2WKRA 3RXWA 1NLZA 2FFYA 3W4OA 4UAAA 3SZTA 2EFXA 5KSHA 5EM0A 3NBLA 2PDRA 4ZRRA 1UGUA 1W79A 3TJZC 1TDLA 1IYPA 1AXBA 1YLPA 1PZPA 5KMWA 3C7UA 3ZG7B 3BFGA 1ZG4A 3B33A 2WADA 4EETB 4EBNA 3HLCA 1RCJA 1Y4OA 3V3RA 3UN7A 2ZC3B 1DJAA 5TGFA 1K6SA 1UWNX 2HDQA 3LIEA 4IVKA 3BW6A 4OLGA 4S2IA 4LRZE 1EI5A 1CJFA 2Y8HA 2EFUA 1K4EA 1LSVA 3MSHA 2I72A 4S2KA 5L8MA 3H7WB 2VKSA 5HPFA 3SOIA 1N4OA 4JGOA 5CHUA 1L0FA 3BRMA 4LV3A 1NWZA 3T1QB 2UV0E 2V8CA 4G3WA 2IWCA 4FCFA 2OWJA 1N9NA 3KO6A 3NI9A 3A0SA 3T4OA 3OPLA 3T4JA 1I5QA 4LPZA 4YFMA 4BQMA 4DE3A 3UB5P 1VETB 2B02A 4WMCD 3CWFA 4QB8A 3ZG9B 1PW1A 3OBFA 4BLMA 1PWCA 4UA9A 1FQGA 2P08A 5FQIA 4WMCA 4E6WA 1K54C 4DN0A 5DTSA 5GHZA 2WGIA 3A0RA 2VV8A 1KE3A 1H5XA 3M2KA 3T4SA 4KUOA 3VMAA 4LV2A 5TBMA 5HW3A 3G4PA 4UQIM 4ZJ2A 3Q7VA 2DRWA 5TJJA 1JWZA 1S4SA 4C3QA 3KYZA 4O0PA 1V9ZA 3IWQA 1XPBA 3DTKA 4HJ3A 2IWDA 3T4QA 3O5YA 3ZYTA 3PBSA 4N9LA 3QNCA 3O3VA 3MZEA 3MMHA 2A24B 2J3TD 4RX3A 1YLWA 3Q81A 2WK0A 4QU3A 1XJ3A 4A5RA 2OSUA 4DDYA 3UMDA 1D7EA 2Y2NA 4DRTA 4HNBA 1ES5A 3G6OA 2GZAA 4BENA 4D2OA 1KDSA 4H8RA 1Z09A 3QP1A 2MJ6A 4WEKA 3LI8A 2ZC4B 3GDIA 5J7EA 2W3GA 4F94A 5F68A 1L0DA 3MZFA 2UWXA 5AVEA 1VEUB 3F1OB 3TSGA 5EM1A 1PI4A 4N9KA 4HH2A 4HESA 5D3OA 4PKYG 4C6YA 2KLIA 2BG1A 4NXEA 3V67A 5FSRA 2V0UA 3MXRA 4GJ4A 3U2AA 3JYIA 5IU1A 2XR0A 3CG5A 2E8JA 3NJAA 5FI2A 3SH7A 5F5YA 4Y0UA 2WKPA 2E8IA 4GLQA 3U4LP 3LR5A 1PZOA 5HL6A 3DBAA 2GJ3A 3GRJA 3GV9A 3O86A 3LIAA 3S1YA 2VK3A 4EUZA 5TFQA 1RGZA 4KQDA 3F1NA 1K54A 4LCMA 4LCLA 2XSSA 1GA0A 3L9KA 3T50A 1RP5A 2Y2OA 2YKHA 5AQAA 3VE4A 5CTMA 1L0EA 2WZXA 3ZG8B 1OT9A 2VLGA 2ZC5B 2X02A 3KSFA 1VETA 1GCEA 5AQ9A 3C4PA 4IUKA 2ZJ9A 3NULA 1FSWA 3S22A 4JF6A 3VP4A 4LRYC 3KSHA 1LSXA 3PBNA 3UB9A 4EUVA 5DJTA 4CLCE 4F3LA 3UDFA 5EVID 4IVIA 3S7NA 1YQSA 2HP9A 4E3NA 1LT0A 5EVIB 1FIKA 1K6RA 2JKTI 4HHDA 1CEFA 4KQOA 1XX2A 4JKTA 1JTDA 4LRXC 4MLLA 1SKFA 4RX2A 4OP5A 5FATA 3RJUA 2O0YA 2JBFA 3S7OA 3C2WA 5CRFA 5DF8A 5FA7A 4EEPA 2VGKA 3GMWA 3C7VA 5GHYA 4BJPA 2V8FA 1BTLA 3D9YA 5HD5A 1G28A 3CAXA 4C75A 3IXBA 4N1XA 1G68A 5E2HA 2JKRI 3BLSA 3ZNYA 3CMZA 1SHVA 4JXGA 4UA6A 2OWHA 3MFDA 3ZGAB 3I7JA 3AGDA 3JVUA 3VSKA 3V39A 4L0LA 4GW9A 5HX9A 4DKIA 3VOZA 1KDWA 1J9MA 4JF4A 1XP4A 1YLYA 2O9AA 4GNUA 2XH9A 1YSQA 1Y28A 4KENB 4BL3A 4ARZA 1LL8A 1XFQA 1PW8A 3LUQA 1TS7A 2ACGA 3G30A 5FEGA 2LB5A 1T1AA 3IF6A 1WYCA 5AQBA 4CJNA 1ERQA 3PAEA 2EX6A 4QPRA 1OJ5A 5CEDA 3SS5A 1GSWA 4R4RA 3N8RA 2OAQ1 1VM1A 5EVIC 3B47A 5EECA 4ZJ1A 2H10A 2I9VA 2W0NA 1T1CA 2W1TB 3UPPA 3LI9A 1W8YA 3A0VA 1LHYA 4PKYA 2QJ5A 3DW0A 1MWRA 2ZL1A 4DE0A 5F82A 4MEZA 1SZVA 3LCEA 4JGQA 3V3SA 1FR6A 2WUQA 4GKUA 2HPBA 3LY3A 3CPTB 4PPRA 4I5SA 4GB7A 5CEBA 3HLEA 1IKIA 3T4TA 5BOHA 4QHCA 2INWA 3SS3A 2HP6A 1Q2PA 4MMNA 5F1FA 1W8QA 3DAVA 2J9PA 1JNUA 3ZG5A 3NDEA 3GQZA 4X68A 5GHXA 2PAVP 3D4FA 3E2KA 2V1AA 3HREA 4II7A 4OQHA 4F3LB 4LGWA 1H8YA 4ETZA 3VP3A 1LI0A 4JXSA 3UNWA 4OQIA 4BWIA 2PR5A 2A24A 3ZCZA 1MY8A 2ZM0A 3RXXA 5HAQA 3G2ZA 1XJ4A 1OTBA 1TD5A 3PBRA 3ZNTA 2ZMAA 3BFCA 1PFLA 3UB7A 3IWOA 4HJ4A 2WKIA 4KG2A 3BECA 3HJIA 1BZAA 3QP8A 2Y2HA 5GLAA 1I2SA 1HZOA 3MFXA 3OPHA 5EOEA 4Y17A 4EW7A 2A49A 1SKOA 5M19A 3TG9A 3NIAA 4R3BA 3UB6A 4GDBA 3WS0A 5DF9A 3L7HA 1W63Q 4UHUA 2XA7M 4EQ1A 1DRMA 5FL3A 4BD1A 3N4IA 2QJ7A 2O9CA 4Y0TA 3WRZA 2HV1A 1MPLA 5CXWA 2Y2IA 2Y59A 4XUZA 1H8MA 2OV5A 1XJ2A 4HI4A 4DMZA 1CI9A 3N6IA 4PM9A 1MZUA 1S1ZA 4X25A 2VV7A 4OOYA 3PTEA 4K91A 2OOLA 3SH8A 2RCXA 5DJUA 2EXAA 5CHJA 4FOFA 2EX9A 4WM9A 3LICA 2B95A 3MBZA 4Y2FA 1N9BA 5KZHA 1V9YA 1GSVA 3DTIA 1SCWA 4XUXA 3VOYA 2JKFA 5HDCA 1XKZA 2FZ0A 2Y2GA 4ZAMA 5GLDA 5JYOA 1DP8A 3FG8A 4GHIA 2P7JA 3R7WB 1E3UA 3IT9A 4OP8A 4Y0OA 2JHEA 3NHQA 2Y2KA 2V1ZA 2QZ6A 4FH2A 2VX8A 1F98A 4Z9QA 2EA9A 4KZBA 3UPNA 2ZD8A 1BUEA 5EPHA 3CUEC 4P0MA 1G6AA 1OTDA 3OCLA 2PD8A 4CQHA 4WUJA 5HWTA 2C5WB 4IJGA 3T4KA 5CGSA 3F1PA 5HWWA 5FQKA 2WAFA 3W2ZA 1OTEA 4OQGA 1ESIA 1GHPA 2DMWA 4DXBA 1XA7A 4GS9B 4NXBA 1K0KA 2Y2PA 2H0TA 3EEHA 1NJ4A 1DJBA 4HEFA 4Q0HA 1NZUA 3FZCA 4GDNA 1WYBA 1LSWA 2LB9A 3JPUA 3B42A 4X1MA 4HY8A 3HUOA 1KVMA 3HLBA 1HD8A 2C6WB 3IF5A 2WKEA 2ZLYA 1VQQA 4JGPA 3UMEA 3H82A 3C4OA 1P9RA 3CPTA 4IEDA 4K0XA 3V50A 4EQIA 3T12B 2QWSA 1N9OA 1DP9A 2X71A 3EQUA 2W1TA 3T1RA 3UE6A 3W8KA 5EVLA 1MC0A 3WWXA 3IF6B 1L0GA 5E2GA 2JC7A 4OPYA 1FOFA 1K38A 5E2FA 4ZDXA 3Q07A 5HARA 4OKPA 3VFFA 3N7WA 3BFFA 3DWKA 2ZOHA 3C38A 1IKGA 3WS5A 5C5KA 3T1XA 1W63M 3LR0A 2P74A 4NKPA 1PNEA 3UE3A 1YMSA 4BD0A 1MBLA 1LLBA 2ZL1B 3GVBA 4GHIB 4BBUA 1H3QA 1UWPX 3HJKA 3C30A 4O7DA 4ZBEA 3PR6A 3ZDJA 4JF5A 3SS4A 2XFSA 2O99A 3QP2A 2Y2QA 2J9OA 3F1PB 4RYEA 2ZQAA 5IT5A 1EROA 4IHQA 2WKQA 3EGDC 4GN2A 3LFVA 3LR4A 1YM1A 2V0WA 3BYDA 3UB8A 3EEAA 4P87A 4R3JA 2Q9MA 4NETA 5FI6A 5G4ZA 1P0ZA 2WKHA 4FUWA 1CK3A 4P85A 4OPZA 1D1JA 2ZQ9A 3HCYA 4PM7A 1IYQA 2GNXA 3VP1A 3Q7ZA 4Y13A 3DTMA 3H7WA 4XT2B 2P04A 4O01A 1XGJA 5EVEA 5FDHA 4E04A 1YSPA 3ISGA 3D3OA 2M7VA 1K57C 3BY8A 4K0WA 2DNSA 3FYZA 2Y2JA 1CI8A 3OPPA 5G18A 3NECA 1MKMA 1OJGA 2JE5A 4Y3IA 5EVIA 4KG5A 2HZ5A 3GSGA 1OT6A 1YKDA 2Y55A 3PBTA 3VFHA 3BFDA 1ES2A 1NRJA 4S2LA 3ZQ5A 4P6ZS 5MC7A 1QMEA 5A90A 4NXFA 5F83A 1ZHHB 3H9WA 4D60A 3PAGA 3EWKA 2ZC7A 4CLCA 4ETXA 4GOGA 4H6JA 3CZDA 4U0TA 1D06A 3UY6A 3O88A 5DFYA 3OCNA 4P6BA 2XFTA 4EERA 4QJGA 4QY6A 3F1NB 3K2NA 2WGVA 1DP6A 5L07A 3IX4A 2ZQ8A 2HJ9C 2P9VB 2W27A 5J3WA 4ESPA 4M4XA 4R4SA 3EOIA 3KSGA 1NYMA 1W5DA 4L9GA 4I3JA 5HZHA 2ZM2A 1HLUP 3NCKA 3FPVA 2W3DA 2G2WA 3UE0A 5CTNA 3D72A 2EX8A 2Z2MB 4B4ZA 2CMNA 4BMWA 4M3KA 4ME4A 2H28A 3MKEA 3BFEA 1S4RA 1YT4A 3GECA 2EX2A 1BLHA 2QMIA 1ES3A 2Z6CA 1ODVA 2J7VA 4UEYA 1SDEA 4HOIA 3IXDA 4HH3A 3G35A 5HFOA 4I39A 3HUMA 4MCWA 2B18A 2Y91A 2J3TC 1YLZA 3G2YA 4Y5FA 3T1SA 1S1YA 1M40A 4QY5A 3FKVA 1IYOA 4MBHA 3VP0A 1S66L 1EWZA 1FCNA 1BULA 2EWVA 1Y54A 1NXYA 4N1HA 3VV4A 4EU0A 5CECA 2L1MA 2XF3A 2H5SA 4OONA 5CHMA 4JBFA 2VA0A 5GLCA 3T4LA 1J3WA 3G34A 5HSQA 4LV0A 5A93A 1KGGA 4R6LA 3OPRA 2K2NA 3HLDA 3M6BA 1YMXA 5J8XA 4WN5A 4ARZB 4Y15A 5HDDA 2A2LA 4HQAA 3BLMA 1K56D 4OPRA 4Q0IA 5L09A 1N9LA 3IX3A 1G6OA 3IBJA 4WZ5C 2VJWA 3MF0A 1BYWA 1NLYA 1S67L 3RTYA 2ZOIA 1TS8A 2QYBA 2VV6A 3WS2A 5FASA 1STZA 2BLSA 2ZMFA 4L9EA 3TRCA 1O07A 4KZ5A 4I38A 2D02A 1K55C 2HJEA 4KUKA 4OH0A 1S0WA 4Q8IA 3E2LA 3TOIA 3SW1A 2JCHA 3O87A 3IF6C 1F9IA 2JKRM 2AVXA 1FR1A 4PHTA 1HVBA 3E0YA 2H0YA 4GD6A 5M18A 4E6XA 1GA9A 2QHKA 5AJGA 4KZ3A 3S4XA 2YKFA 3SH9A 1DJCA 2HP5A 1E4DA 5DF7A 4FTXA 5DVAA 1OPXA 4MN5A 3OZHA 2G2UA 2V20A 3FC7A 4PAUA 2ZMVA 4Y7PA 2EWWA 3RH8B 4MN7A 3TW8A 1K57A 4OVDA 3IH9A 4KQQA 5HL1A 2VZWA 1K56A 4E3JA 3K3DA 4MDZA 3ULFA 4B9OA 4U0XA 2JKTM 1K25A 4YINA 3EGXC 2A3UA 2OLUA 4N92A 2Y79A 4MN6A 3S7PA 2ZQ7A 1JVJA 3FWLA 3IXGA 5CGXA 1NRFA 3PYPA 1LI9A 1P9WA 1PRQA 2RL3A 2XD5A 3Q1FA 4HJ6A 4EXOA 4E3IA 2VGLM 1ES4A 3IS2A 1PIOA 3LIDA 1W7FA 4YNRA 5HAIA 4DE2A 3V5MA 5E2EA 4QD4A 3VOLA 5L2FA 4GS9A 1BLCA 1E25A 2IWBA 1L3LA 1X0OA 2PRFA 4KZ7A 4DDSA 2QKPA 4DE1A 4R3AA 3IXHA 1IOUA 3HLWA 4R38A 4R23A 1AWIA 4UA7A 2Q0OA 1VHMA 4X1LA 1FCOA 4OQ0A 1TF1A 3CJMA 3VE3A 2X01A 1VEUA 1GHMA 1XGIA 3CHWP 3P7NA 4WYYA 5GLBA 1CEGA 2ZQDA 3CUEA 4MBFA 2K31A 1ZKJA 5U47A 4RA7A 3LEZA 4LENA 1QMFA 1MXOA 1IEMA 3LYXA 5IS1A 2M1CA 3NOPC 5EV0A 3MXSA 1YPRA 2R9WA 4EBLA 4OOLA 2GX5A 4LLOB 4CLCC 3BM6A 4S2NC 3MQOA 5EUAA 3OLOA 2PT7A 5AVFA 3HL9A 3ICYA 4O8GA 3K3CA 2V1BA 1FILA 5F1GA 1M6KA 3E4OA 3QNBA 1H8ZA 2J8YA 3IX8A 4E3LA 4DJ3A 5KIZA 4BBTA 3CLOA 3ITBA 3NDGA 4NK3A 4LV1A 1SKOB 1PWDA 3DWZA 3MJQA 5L10A 4EEUA 4EBPA 1NZOA 3BY9A 4HP4A 2KX6A 3LY4A 3UE1A 2PYRA 1C3BA 4MNRA 3IQAA 3MKFA 4JXWA 5JYPA 1YLTA 4FD8A 3QP4A 4Z1WA 3OC2A 3ZVWA 3G31A 3W4QA 2NUTC 3E98A 3A3FA 4YWZA 2W3HA 4R0QA 1O7EA 1P97A 3P98A 2WGWA 3FV7A 3F1OA 3UO9A 3HBRA 2QPNA 3CI6A 1FCMA 3BEBA 3M2JA 3KSIA 5FQ9A 4B88A 1LL9A 4G3KA 1OMEA 2ZQCA 3ZHHA 4HIAA 1KVLA 4S2OA 4QWOA 2Q9NA 5I5LA 3LIFA 4IBXA 4RVAA 4E3OA 4BL2A 3ZFZA 1TDGA 3IHAA 5M1AA 3P09A 1ONGA 5FAPA 3FKWA 2Y4AA 4S2MA 1KOUA 1NYYA 2HF6A 2XDMA 3QP6A 5IHVA 5HDSA 1PWGA 5FEFA 3GTCA 4ZJ3A 1T18A 1S6RA 1ESUA 2VGLS 3WS1A 2BASA 4NG2A 3BJNA 4JXVA 3EQVA 1Z6FA 1EW0A 4EESA 5DTKA 3RFBA 4S2JA 5A92A 1JWVA 3HUNA 1JTGA 4LFUA 1MWTA 3A3JA 3KX0X 2ZM8A 4GCZA 4DJ2A 1IELA 3GR2A 3E4PA 3M6HA 1MWSA 4P6ZM 5K5BA 5EOOA 1WA9A 3NOTC 2DCFA 4PMAA 3VP2A 2PU4A 3HLGA 5EE8A 5KSCA 2PYPA 4EWFA 2HDSA 4WF0A 1OTIA 1ZC2A 3BWLA 2PBDP 3A3IA 2J80A 2JKGA 2HGVA 2L4RA 3NOUC 2XA7S 3R4KA 5F6AA 3CITA 4ZTKA 4K08A 2WGWB 1BSGA 3LEQA 2W1RA 4I3AA 1ALQA 4GZBA 4NEED 2WZZA 1VB6A
chains in the Genus database with same CATH topology
5HDCA 2FZ0A 3IS2B 4Q0IA 1N9LA 1G6OA 1XJ3A 3IBJA 1DP8A 3FG8A 2VJWA 3MF0A 4GHIA 1BYWA 2P7JA 3R7WB 1NLYA 1S67L 3RTYA 2ZOIA 1TS8A 2QYBA 2VV6A 3TE8A 3UMDA 4I3IA 1D7EA 1STZA 2ZMFA 2JHEA 3NHQA 5DKKA 4HNBA 4L9EA 3TRCA 3G6OA 2GZAA 4I38A 2D02A 2VX8A 2HJEA 4KUKA 4FSFA 4BBVA 1F98A 3SW1A 2EA9A 2MJ6A 4WEKA 1F9IA 2JKRM 3LI8A 2Z6DA 3CUEC 4WEJA 4PHTA 3GDIA 2PHYA 5J7EA 2W3GA 3E0YA 1OTDA 2JN7A 2PD8A 3OCLA 5F68A 2NUPC 4YOFA 4CQHA 2VEAA 4WUJA 5HWTA 2QHKA 5AJGA 2YKFA 4IJGA 3T4KA 2J3WA 5AVEA 3F1PA 5HWWA 3W2ZA 3F1OB 1OPXA 4MN5A 2W3FA 1OTEA 2DMWA 4HH2A 3LR3A 5G4YA 4PKYG 4GS9B 4NXBA 2KLIA 3FC7A 4WLAA 4PAUA 4NXEA 2ZMVA 3V67A 2V0UA 5F69A 2M7UA 2EWWA 4GJ4A 3EEHA 3RH8B 3U2AA 4MN7A 3TW8A 5HWVA 5IU1A 4Q0HA 2VZWA 5CX7A 4R70A 1LSWA 2LB9A 4JGRA 3NJAA 3K3DA 4MDZA 3ULFA 3B42A 3E4QA 4H6JB 5F5YA 4B9OA 4HY8A 2WKPA 3PHYA 4GLQA 5TBMB 2JKTM 3LR5A 3EGXC 4XT2A 5HL6A 2R78A 2IA2A 3DBAA 2GJ3A 3PXPA 2W3EA 3BQ8A 2Y79A 4JGPA 3LIAA 3UMEA 4MN6A 3S7PA 5HD3A 3H82A 1P9RA 3F1NA 4KQDA 2XROA 2D01A 3P01A 3MQQA 2XSSA 2QWSA 3PYPA 1N9OA 1DP9A 3T50A 3MQ0A 4IUHA 1P9WA 2YKHA 3EQUA 5DKLA 2W1TA 3VE4A 3UE6A 4HJ6A 4EXOA 1MC0A 1OT9A 2VLGA 1TS6A 2VGLM 3KSFA 3IS2A 4OOMA 3LIDA 4IUKA 4YNRA 4Q0JA 4NXGA 4LRYC 3KSHA 1LSXA 3PBNA 3UB9A 3VOLA 4EUVA 2ZOHA 5J4EA 3C38A 5DJTA 4CLCE 4F3LA 5C5KA 4GS9A 1W63M 3LR0A 4NKPA 1X0OA 4CLCB 4AFIA 3MR0A 2QKPA 3S7QA 3UE3A 3S7NA 4RQ9A 4R3AA 1LT0A 4CLCD 1IOUA 5EFWA 2KOIA 4GHIB 3R7WA 1YAXA 4R38A 4BBUA 1H3QA 1UWPX 3HJKA 3C30A 1T1BA 4WL9A 2JKTI 3BQAA 4HHDA 4UQIS 3OOVA 3PR6A 4KQOA 1VHMA 3LIBA 1TF1A 3VE3A 2O9BA 5HPIA 2O99A 4LRXC 3F1PB 2PD7A 5IT5A 3P7NA 1F5MA 2O0YA 4IHQA 2WKQA 3S7OA 3EGDC 3C2WA 3KYQA 3H82B 3LFVA 3LR4A 2V0WA 4EEPA 3UB8A 3EEAA 3CUEA 2K31A 1ZTUA 3PBOA 5G4ZA 4BJPA 1P0ZA 2L0WA 2OAP1 2FH5A 2V9AA 5HD5A 3LYXA 4B93A 1G28A 3CAXA 5A8BA 3HCYA 5IS1A 2M1CA 3NOPC 1XJ6A 2GNXA 2JKRI 3H7WA 4HP9A 4XT2B 2P04A 4O01A 1T19A 1TS0A 4OOLA 2OWHA 3FPWA 4E04A 4G3VA 1YSPA 3JVUA 2GX5A 4LLOB 4CLCC 3D3OA 3MXQA 2M7VA 3MQOA 3OLOA 4L0LA 2PT7A 3BY8A 4GW9A 5AVFA 3ICYA 4O8GA 3K3CA 2V1BA 5DFXA 3E4OA 2O9AA 1MKMA 1OJGA 4Y3IA 1YSQA 4WELA 1Y28A 1IFQA 3C8CA 3IBRA 4ARZA 1OTAA 1LL8A 1XFQA 1OT6A 1YKDA 1TS7A 3LUQA 2PR6A 3PBTA 2ZBBA 2LB5A 1T1AA 4L9FA 4DJ3A 5KIZA 2XRNA 3PBQA 4BBTA 4QPRA 1OJ5A 3CLOA 1NRJA 3ZQ5A 1GSWA 4P6ZS 3JVVA 2OAQ1 5MC7A 5LBRA 3B47A 1GSXA 2I9VA 2W0NA 4NXFA 3MJQA 1T1CA 4EEUA 2W1TB 1ZHHB 3BY9A 3H9WA 3LI9A 4HP4A 2K7SA 2KX6A 3EWKA 1XFNA 2KDKA 4CLCA 2PYRA 2G7UA 2WKRA 3A0VA 4ETXA 4PKYA 2QJ5A 4H6JA 1NLZA 5KSHA 4Z1WA 1D06A 3OC2A 5DFYA 3OCNA 2PDRA 4ZRRA 4JGQA 2NUTC 3E98A 1UGUA 4EERA 3TJZC 2W3HA 3F1NB 4YWZA 3K2NA 4I5SA 1P97A 1DP6A 3F1OA 3T4TA 3B33A 2HJ9C 3CI6A 4EETB 2INWA 3KSIA 2W27A 5J3WA 4M4XA 4G3KA 3EOIA 3KSGA 4MMNA 4HIAA 4L9GA 5I5LA 1JNUA 1UWNX 4I3JA 5HZHA 3LIFA 3LIEA 3BW6A 3FPVA 2W3DA 4LRZE 2V1AA 4II7A 3D72A 2Y8HA 1KOUA 2HF6A 4F3LB 1LSVA 2CMNA 5L8MA 3H7WB 4BMWA 2VKSA 5HPFA 4ETZA 4ME4A 5HDSA 2H28A 1S4RA 4BWIA 2PR5A 4JGOA 2A24A 1T18A 3GECA 2VGLS 2BASA 3BJNA 2Z6CA 1ODVA 1NWZA 4UEYA 1XJ4A 1OTBA 3EQVA 1EW0A 1TD5A 4HOIA 4EESA 3RFBA 3PBRA 4HH3A 4I39A 4G3WA 3UB7A 2OWJA 1N9NA 3KO6A 4HJ4A 2B18A 4MCWA 2J3TC 3A0SA 3HJIA 3T4OA 3T4JA 4Y5FA 4LPZA 1S1YA 3KX0X 3MFXA 1S66L 4GCZA 4EW7A 2B02A 4DJ2A 3CWFA 2EWVA 3OBFA 3VV4A 4EU0A 3UB6A 3E4PA 5DF9A 4P6ZM 2P08A 2L1MA 1W63Q 4DN0A 4EQ1A 2XA7M 5K5BA 1DRMA 5FL3A 2QJ7A 2O9CA 1WA9A 2HV1A 3NOTC 3A0RA 2VA0A 2VV8A 3T4SA 4KUOA 1H8MA 5TBMA 3T4LA 1XJ2A 4HI4A 4UQIM 4DMZA 5TJJA 5HSQA 1MZUA 2PYPA 1S1ZA 2VV7A 4WF0A 1OTIA 3BWLA 1S4SA 2J80A 2HGVA 2L4RA 3NOUC 2OOLA 3KYZA 4R6LA 2XA7S 3R4KA 4O0PA 5F6AA 1V9ZA 3CITA 5DJUA 4K08A 4HJ3A 4FOFA 3T4QA 2K2NA 3LICA 3O5YA 3ZYTA 3PBSA 2W1RA 4Y2FA 4WN5A 4I3AA 3MMHA 2A24B 2J3TD 1V9YA 1GSVA 4ARZB 4NEED 1VB6A 5HDDA 2A2LA 4HQAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MQ0 A;  4Q0I A;  2Y8H A;  4IUH A;  4E04 A;  4G3V A;  3IBJ A;  1YSP A;  2GX5 A;  3D3O A;  2VJW A;  3MF0 A;  2M7V A;  2W1T A;  4GW9 A;  5L8M A;  2QYB A;  2VKS A;  5HPF A;  4ETZ A;  4O8G A;  4ME4 A;  1MC0 A;  1STZ A;  2ZMF A;  5DFX A;  3NHQ A;  2O9A A;  3KSF A;  1MKM A;  3TRC A;  4BWI A;  4Y3I A;  3G6O A;  1YSQ A;  3IBR A;  3BJN A;  4IUK A;  1YKD A;  4YNR A;  1TD5 A;  3RFB A;  2LB5 A;  2XRN A;  4Q0J A;  4LRY C;  3KSH A;  4QPR A;  4G3W A;  4EUV A;  3KO6 A;  2B18 A;  4MCW A;  3ZQ5 A;  5C5K A;  2W3G A;  3E0Y A;  5LBR A;  4Y5F A;  4YOF A;  3S7Q A;  4CQH A;  2VEA A;  3S7N A;  4RQ9 A;  5AJG A;  4IJG A;  2KOI A;  2W1T B;  3W2Z A;  3OBF A;  3VV4 A;  3OOV A;  2G7U A;  4EU0 A;  2W3F A;  4ETX A;  1VHM A;  1TF1 A;  2O9B A;  4Z1W A;  5HPI A;  2O99 A;  2KLI A;  4LRX C;  5DFY A;  4DN0 A;  5K5B A;  4PAU A;  4ZRR A;  2O9C A;  3NOT C;  1F5M A;  2M7U A;  3E98 A;  2O0Y A;  3S7O A;  3C2W A;  3LFV A;  2W3H A;  4MN7 A;  3K2N A;  3EEA A;  4Q0H A;  4DMZ A;  2K31 A;  2VZW A;  5TJJ A;  5HSQ A;  4R70 A;  2LB9 A;  3CI6 A;  1ZTU A;  4MDZ A;  3KSI A;  2HGV A;  3NOU C;  2OOL A;  4R6L A;  3R4K A;  4GLQ A;  4O0P A;  3CIT A;  4G3K A;  5HL6 A;  2IA2 A;  3DBA A;  4FOF A;  3KSG A;  2K2N A;  4MMN A;  2W3E A;  3O5Y A;  3HCY A;  2Y79 A;  3NOP C;  2W1R A;  4Y2F A;  3S7P A;  3MMH A;  5I5L A;  2XRO A;  2XSS A;  2W3D A;  4LRZ E;  4O01 A; 
#chains in the Genus database with same CATH topology
 3IS2 B;  1Q2Q A;  1K4F A;  3UPO A;  5FAQ A;  3TE8 A;  4I3I A;  4R1G A;  2HDU A;  5DKK A;  3N8L A;  2R9X A;  5TR7 A;  4FSF A;  1LL5 A;  4IBR A;  1FSY A;  4BBV A;  1PI5 A;  1TVF A;  2VGJ A;  3QP5 A;  2Z6D A;  1IYS A;  4WEJ A;  3KYE A;  2PHY A;  5FQQ A;  3WS4 A;  2JN7 A;  4OLD A;  2NUP C;  4YOF A;  2VEA A;  3IHB A;  1BLS A;  4FH4 A;  1ZG6 A;  3IH8 A;  2XD1 A;  4E3K A;  2WYX A;  2J3W A;  1KGF A;  1U60 A;  1HTZ A;  2W3F A;  2XLN A;  1ONH A;  3LR3 A;  5G4Y A;  2BTF P;  2XQZ A;  3LO7 A;  4WLA A;  3IWI A;  5FI7 A;  2XGN A;  4WZ4 A;  5F69 A;  2M7U A;  1CQA A;  5HWV A;  5CGW A;  2FFF B;  5CER A;  4KZ4 A;  4S2N A;  4WZ5 A;  1KE4 A;  5FDS A;  5CX7 A;  2EXB A;  4R70 A;  3QHY A;  4X6T A;  4JGR A;  4KZ6 A;  4DXC A;  3E4Q A;  4H6J B;  3N8S A;  4S2P A;  3PHY A;  1E3U D;  3LGO A;  5TBM B;  4XT2 A;  2R78 A;  2IA2 A;  3PXP A;  2W3E A;  1NY0 A;  3BQ8 A;  1YLJ A;  5HD3 A;  4JPM A;  2XRO A;  2D01 A;  3P01 A;  3MQQ A;  3NC8 A;  4MBK A;  1H0M A;  5FQM A;  2XK1 A;  3MQ0 A;  4IUH A;  3AGE A;  1SDN A;  5AQ7 A;  1MWU A;  5DKL A;  3A3E A;  1CF0 A;  3MZD A;  3W4P A;  1XXM A;  3DTE A;  1JWP A;  3G32 A;  1TS6 A;  4PM5 A;  4OOM A;  3HVF A;  3ZVT A;  4PM6 A;  3UDI A;  3B3X A;  2HDR A;  4KZA A;  1MKI A;  4Q0J A;  4NXG A;  4KQR A;  1PYY A;  5J4E A;  3HLF A;  4HBT A;  4CLC B;  1KE0 A;  4KZ9 A;  3MR0 A;  4AFI A;  3S7Q A;  3WRT A;  4RQ9 A;  5DTT A;  1DY6 A;  4CLC D;  5EFW A;  2KOI A;  3R7W A;  5E43 A;  1YAX A;  4X56 A;  1T1B A;  4WL9 A;  3BQA A;  4UQI S;  4E3M A;  3OOV A;  3C5A A;  3LIB A;  4U3T A;  1WE4 A;  5GL9 A;  2O9B A;  5HPI A;  1ERM A;  2PD7 A;  1F2K A;  1F5M A;  3VSL A;  4KZ8 A;  2GDN A;  2Y2M A;  3UDX A;  3KYQ A;  3H82 B;  2P9V A;  3ZG0 A;  3AGF A;  2CC1 A;  4HBU A;  4EV4 A;  1RGY A;  1ZTU A;  3A3D A;  1TEM A;  3PBO A;  2L0W A;  2OAP 1;  2FH5 A;  2V9A A;  5I94 A;  4X55 A;  1K55 A;  4B93 A;  5A8B A;  5FQJ A;  4JLF A;  1XJ6 A;  5HAP A;  1G5U A;  1XA1 A;  1ACF A;  4HP9 A;  4B4X A;  1T19 A;  3Q7V B;  1TS0 A;  3FPW A;  2PU2 A;  3Q82 A;  4G3V A;  1BT5 A;  1A0K A;  3MXQ A;  4ID4 A;  1BLP A;  2OLV A;  3MS6 A;  4KG6 A;  2Z2L B;  3NY4 A;  5DFX A;  5FAO A;  2PBY A;  1GHI A;  1KGE A;  4X69 A;  4DF6 A;  4PM8 A;  2V2F F;  4WEL A;  3C8C A;  1IFQ A;  1L2S A;  3IBR A;  4OPQ A;  1OTA A;  4XXR A;  2B5R A;  2PR6 A;  2ZBB A;  4L9F A;  2XEP A;  2XRN A;  3PBQ A;  1I2W A;  3JVV A;  4X53 A;  5LBR A;  5A91 A;  1GSX A;  2Y2L A;  4GD8 A;  2WAE A;  3ITA A;  4WBG A;  4CPK A;  2ZC6 B;  2K7S A;  1XFN A;  2KDK A;  2G7U A;  2WKR A;  3RXW A;  1NLZ A;  2FFY A;  3W4O A;  4UAA A;  3SZT A;  2EFX A;  5KSH A;  5EM0 A;  3NBL A;  2PDR A;  4ZRR A;  1UGU A;  1W79 A;  3TJZ C;  1TDL A;  1IYP A;  1AXB A;  1YLP A;  1PZP A;  5KMW A;  3C7U A;  3ZG7 B;  3BFG A;  1ZG4 A;  3B33 A;  2WAD A;  4EET B;  4EBN A;  3HLC A;  1RCJ A;  1Y4O A;  3V3R A;  3UN7 A;  2ZC3 B;  1DJA A;  5TGF A;  1K6S A;  1UWN X;  2HDQ A;  3LIE A;  4IVK A;  3BW6 A;  4OLG A;  4S2I A;  4LRZ E;  1EI5 A;  1CJF A;  2Y8H A;  2EFU A;  1K4E A;  1LSV A;  3MSH A;  2I72 A;  4S2K A;  5L8M A;  3H7W B;  2VKS A;  5HPF A;  3SOI A;  1N4O A;  4JGO A;  5CHU A;  1L0F A;  3BRM A;  4LV3 A;  1NWZ A;  3T1Q B;  2UV0 E;  2V8C A;  4G3W A;  2IWC A;  4FCF A;  2OWJ A;  1N9N A;  3KO6 A;  3NI9 A;  3A0S A;  3T4O A;  3OPL A;  3T4J A;  1I5Q A;  4LPZ A;  4YFM A;  4BQM A;  4DE3 A;  3UB5 P;  1VET B;  2B02 A;  4WMC D;  3CWF A;  4QB8 A;  3ZG9 B;  1PW1 A;  3OBF A;  4BLM A;  1PWC A;  4UA9 A;  1FQG A;  2P08 A;  5FQI A;  4WMC A;  4E6W A;  1K54 C;  4DN0 A;  5DTS A;  5GHZ A;  2WGI A;  3A0R A;  2VV8 A;  1KE3 A;  1H5X A;  3M2K A;  3T4S A;  4KUO A;  3VMA A;  4LV2 A;  5TBM A;  5HW3 A;  3G4P A;  4UQI M;  4ZJ2 A;  3Q7V A;  2DRW A;  5TJJ A;  1JWZ A;  1S4S A;  4C3Q A;  3KYZ A;  4O0P A;  1V9Z A;  3IWQ A;  1XPB A;  3DTK A;  4HJ3 A;  2IWD A;  3T4Q A;  3O5Y A;  3ZYT A;  3PBS A;  4N9L A;  3QNC A;  3O3V A;  3MZE A;  3MMH A;  2A24 B;  2J3T D;  4RX3 A;  1YLW A;  3Q81 A;  2WK0 A;  4QU3 A;  1XJ3 A;  4A5R A;  2OSU A;  4DDY A;  3UMD A;  1D7E A;  2Y2N A;  4DRT A;  4HNB A;  1ES5 A;  3G6O A;  2GZA A;  4BEN A;  4D2O A;  1KDS A;  4H8R A;  1Z09 A;  3QP1 A;  2MJ6 A;  4WEK A;  3LI8 A;  2ZC4 B;  3GDI A;  5J7E A;  2W3G A;  4F94 A;  5F68 A;  1L0D A;  3MZF A;  2UWX A;  5AVE A;  1VEU B;  3F1O B;  3TSG A;  5EM1 A;  1PI4 A;  4N9K A;  4HH2 A;  4HES A;  5D3O A;  4PKY G;  4C6Y A;  2KLI A;  2BG1 A;  4NXE A;  3V67 A;  5FSR A;  2V0U A;  3MXR A;  4GJ4 A;  3U2A A;  3JYI A;  5IU1 A;  2XR0 A;  3CG5 A;  2E8J A;  3NJA A;  5FI2 A;  3SH7 A;  5F5Y A;  4Y0U A;  2WKP A;  2E8I A;  4GLQ A;  3U4L P;  3LR5 A;  1PZO A;  5HL6 A;  3DBA A;  2GJ3 A;  3GRJ A;  3GV9 A;  3O86 A;  3LIA A;  3S1Y A;  2VK3 A;  4EUZ A;  5TFQ A;  1RGZ A;  4KQD A;  3F1N A;  1K54 A;  4LCM A;  4LCL A;  2XSS A;  1GA0 A;  3L9K A;  3T50 A;  1RP5 A;  2Y2O A;  2YKH A;  5AQA A;  3VE4 A;  5CTM A;  1L0E A;  2WZX A;  3ZG8 B;  1OT9 A;  2VLG A;  2ZC5 B;  2X02 A;  3KSF A;  1VET A;  1GCE A;  5AQ9 A;  3C4P A;  4IUK A;  2ZJ9 A;  3NUL A;  1FSW A;  3S22 A;  4JF6 A;  3VP4 A;  4LRY C;  3KSH A;  1LSX A;  3PBN A;  3UB9 A;  4EUV A;  5DJT A;  4CLC E;  4F3L A;  3UDF A;  5EVI D;  4IVI A;  3S7N A;  1YQS A;  2HP9 A;  4E3N A;  1LT0 A;  5EVI B;  1FIK A;  1K6R A;  2JKT I;  4HHD A;  1CEF A;  4KQO A;  1XX2 A;  4JKT A;  1JTD A;  4LRX C;  4MLL A;  1SKF A;  4RX2 A;  4OP5 A;  5FAT A;  3RJU A;  2O0Y A;  2JBF A;  3S7O A;  3C2W A;  5CRF A;  5DF8 A;  5FA7 A;  4EEP A;  2VGK A;  3GMW A;  3C7V A;  5GHY A;  4BJP A;  2V8F A;  1BTL A;  3D9Y A;  5HD5 A;  1G28 A;  3CAX A;  4C75 A;  3IXB A;  4N1X A;  1G68 A;  5E2H A;  2JKR I;  3BLS A;  3ZNY A;  3CMZ A;  1SHV A;  4JXG A;  4UA6 A;  2OWH A;  3MFD A;  3ZGA B;  3I7J A;  3AGD A;  3JVU A;  3VSK A;  3V39 A;  4L0L A;  4GW9 A;  5HX9 A;  4DKI A;  3VOZ A;  1KDW A;  1J9M A;  4JF4 A;  1XP4 A;  1YLY A;  2O9A A;  4GNU A;  2XH9 A;  1YSQ A;  1Y28 A;  4KEN B;  4BL3 A;  4ARZ A;  1LL8 A;  1XFQ A;  1PW8 A;  3LUQ A;  1TS7 A;  2ACG A;  3G30 A;  5FEG A;  2LB5 A;  1T1A A;  3IF6 A;  1WYC A;  5AQB A;  4CJN A;  1ERQ A;  3PAE A;  2EX6 A;  4QPR A;  1OJ5 A;  5CED A;  3SS5 A;  1GSW A;  4R4R A;  3N8R A;  2OAQ 1;  1VM1 A;  5EVI C;  3B47 A;  5EEC A;  4ZJ1 A;  2H10 A;  2I9V A;  2W0N A;  1T1C A;  2W1T B;  3UPP A;  3LI9 A;  1W8Y A;  3A0V A;  1LHY A;  4PKY A;  2QJ5 A;  3DW0 A;  1MWR A;  2ZL1 A;  4DE0 A;  5F82 A;  4MEZ A;  1SZV A;  3LCE A;  4JGQ A;  3V3S A;  1FR6 A;  2WUQ A;  4GKU A;  2HPB A;  3LY3 A;  3CPT B;  4PPR A;  4I5S A;  4GB7 A;  5CEB A;  3HLE A;  1IKI A;  3T4T A;  5BOH A;  4QHC A;  2INW A;  3SS3 A;  2HP6 A;  1Q2P A;  4MMN A;  5F1F A;  1W8Q A;  3DAV A;  2J9P A;  1JNU A;  3ZG5 A;  3NDE A;  3GQZ A;  4X68 A;  5GHX A;  2PAV P;  3D4F A;  3E2K A;  2V1A A;  3HRE A;  4II7 A;  4OQH A;  4F3L B;  4LGW A;  1H8Y A;  4ETZ A;  3VP3 A;  1LI0 A;  4JXS A;  3UNW A;  4OQI A;  4BWI A;  2PR5 A;  2A24 A;  3ZCZ A;  1MY8 A;  2ZM0 A;  3RXX A;  5HAQ A;  3G2Z A;  1XJ4 A;  1OTB A;  1TD5 A;  3PBR A;  3ZNT A;  2ZMA A;  3BFC A;  1PFL A;  3UB7 A;  3IWO A;  4HJ4 A;  2WKI A;  4KG2 A;  3BEC A;  3HJI A;  1BZA A;  3QP8 A;  2Y2H A;  5GLA A;  1I2S A;  1HZO A;  3MFX A;  3OPH A;  5EOE A;  4Y17 A;  4EW7 A;  2A49 A;  1SKO A;  5M19 A;  3TG9 A;  3NIA A;  4R3B A;  3UB6 A;  4GDB A;  3WS0 A;  5DF9 A;  3L7H A;  1W63 Q;  4UHU A;  2XA7 M;  4EQ1 A;  1DRM A;  5FL3 A;  4BD1 A;  3N4I A;  2QJ7 A;  2O9C A;  4Y0T A;  3WRZ A;  2HV1 A;  1MPL A;  5CXW A;  2Y2I A;  2Y59 A;  4XUZ A;  1H8M A;  2OV5 A;  1XJ2 A;  4HI4 A;  4DMZ A;  1CI9 A;  3N6I A;  4PM9 A;  1MZU A;  1S1Z A;  4X25 A;  2VV7 A;  4OOY A;  3PTE A;  4K91 A;  2OOL A;  3SH8 A;  2RCX A;  5DJU A;  2EXA A;  5CHJ A;  4FOF A;  2EX9 A;  4WM9 A;  3LIC A;  2B95 A;  3MBZ A;  4Y2F A;  1N9B A;  5KZH A;  1V9Y A;  1GSV A;  3DTI A;  1SCW A;  4XUX A;  3VOY A;  2JKF A;  5HDC A;  1XKZ A;  2FZ0 A;  2Y2G A;  4ZAM A;  5GLD A;  5JYO A;  1DP8 A;  3FG8 A;  4GHI A;  2P7J A;  3R7W B;  1E3U A;  3IT9 A;  4OP8 A;  4Y0O A;  2JHE A;  3NHQ A;  2Y2K A;  2V1Z A;  2QZ6 A;  4FH2 A;  2VX8 A;  1F98 A;  4Z9Q A;  2EA9 A;  4KZB A;  3UPN A;  2ZD8 A;  1BUE A;  5EPH A;  3CUE C;  4P0M A;  1G6A A;  1OTD A;  3OCL A;  2PD8 A;  4CQH A;  4WUJ A;  5HWT A;  2C5W B;  4IJG A;  3T4K A;  5CGS A;  3F1P A;  5HWW A;  5FQK A;  2WAF A;  3W2Z A;  1OTE A;  4OQG A;  1ESI A;  1GHP A;  2DMW A;  4DXB A;  1XA7 A;  4GS9 B;  4NXB A;  1K0K A;  2Y2P A;  2H0T A;  3EEH A;  1NJ4 A;  1DJB A;  4HEF A;  4Q0H A;  1NZU A;  3FZC A;  4GDN A;  1WYB A;  1LSW A;  2LB9 A;  3JPU A;  3B42 A;  4X1M A;  4HY8 A;  3HUO A;  1KVM A;  3HLB A;  1HD8 A;  2C6W B;  3IF5 A;  2WKE A;  2ZLY A;  1VQQ A;  4JGP A;  3UME A;  3H82 A;  3C4O A;  1P9R A;  3CPT A;  4IED A;  4K0X A;  3V50 A;  4EQI A;  3T12 B;  2QWS A;  1N9O A;  1DP9 A;  2X71 A;  3EQU A;  2W1T A;  3T1R A;  3UE6 A;  3W8K A;  5EVL A;  1MC0 A;  3WWX A;  3IF6 B;  1L0G A;  5E2G A;  2JC7 A;  4OPY A;  1FOF A;  1K38 A;  5E2F A;  4ZDX A;  3Q07 A;  5HAR A;  4OKP A;  3VFF A;  3N7W A;  3BFF A;  3DWK A;  2ZOH A;  3C38 A;  1IKG A;  3WS5 A;  5C5K A;  3T1X A;  1W63 M;  3LR0 A;  2P74 A;  4NKP A;  1PNE A;  3UE3 A;  1YMS A;  4BD0 A;  1MBL A;  1LLB A;  2ZL1 B;  3GVB A;  4GHI B;  4BBU A;  1H3Q A;  1UWP X;  3HJK A;  3C30 A;  4O7D A;  4ZBE A;  3PR6 A;  3ZDJ A;  4JF5 A;  3SS4 A;  2XFS A;  2O99 A;  3QP2 A;  2Y2Q A;  2J9O A;  3F1P B;  4RYE A;  2ZQA A;  5IT5 A;  1ERO A;  4IHQ A;  2WKQ A;  3EGD C;  4GN2 A;  3LFV A;  3LR4 A;  1YM1 A;  2V0W A;  3BYD A;  3UB8 A;  3EEA A;  4P87 A;  4R3J A;  2Q9M A;  4NET A;  5FI6 A;  5G4Z A;  1P0Z A;  2WKH A;  4FUW A;  1CK3 A;  4P85 A;  4OPZ A;  1D1J A;  2ZQ9 A;  3HCY A;  4PM7 A;  1IYQ A;  2GNX A;  3VP1 A;  3Q7Z A;  4Y13 A;  3DTM A;  3H7W A;  4XT2 B;  2P04 A;  4O01 A;  1XGJ A;  5EVE A;  5FDH A;  4E04 A;  1YSP A;  3ISG A;  3D3O A;  2M7V A;  1K57 C;  3BY8 A;  4K0W A;  2DNS A;  3FYZ A;  2Y2J A;  1CI8 A;  3OPP A;  5G18 A;  3NEC A;  1MKM A;  1OJG A;  2JE5 A;  4Y3I A;  5EVI A;  4KG5 A;  2HZ5 A;  3GSG A;  1OT6 A;  1YKD A;  2Y55 A;  3PBT A;  3VFH A;  3BFD A;  1ES2 A;  1NRJ A;  4S2L A;  3ZQ5 A;  4P6Z S;  5MC7 A;  1QME A;  5A90 A;  4NXF A;  5F83 A;  1ZHH B;  3H9W A;  4D60 A;  3PAG A;  3EWK A;  2ZC7 A;  4CLC A;  4ETX A;  4GOG A;  4H6J A;  3CZD A;  4U0T A;  1D06 A;  3UY6 A;  3O88 A;  5DFY A;  3OCN A;  4P6B A;  2XFT A;  4EER A;  4QJG A;  4QY6 A;  3F1N B;  3K2N A;  2WGV A;  1DP6 A;  5L07 A;  3IX4 A;  2ZQ8 A;  2HJ9 C;  2P9V B;  2W27 A;  5J3W A;  4ESP A;  4M4X A;  4R4S A;  3EOI A;  3KSG A;  1NYM A;  1W5D A;  4L9G A;  4I3J A;  5HZH A;  2ZM2 A;  1HLU P;  3NCK A;  3FPV A;  2W3D A;  2G2W A;  3UE0 A;  5CTN A;  3D72 A;  2EX8 A;  2Z2M B;  4B4Z A;  2CMN A;  4BMW A;  4M3K A;  4ME4 A;  2H28 A;  3MKE A;  3BFE A;  1S4R A;  1YT4 A;  3GEC A;  2EX2 A;  1BLH A;  2QMI A;  1ES3 A;  2Z6C A;  1ODV A;  2J7V A;  4UEY A;  1SDE A;  4HOI A;  3IXD A;  4HH3 A;  3G35 A;  5HFO A;  4I39 A;  3HUM A;  4MCW A;  2B18 A;  2Y91 A;  2J3T C;  1YLZ A;  3G2Y A;  4Y5F A;  3T1S A;  1S1Y A;  1M40 A;  4QY5 A;  3FKV A;  1IYO A;  4MBH A;  3VP0 A;  1S66 L;  1EWZ A;  1FCN A;  1BUL A;  2EWV A;  1Y54 A;  1NXY A;  4N1H A;  3VV4 A;  4EU0 A;  5CEC A;  2L1M A;  2XF3 A;  2H5S A;  4OON A;  5CHM A;  4JBF A;  2VA0 A;  5GLC A;  3T4L A;  1J3W A;  3G34 A;  5HSQ A;  4LV0 A;  5A93 A;  1KGG A;  4R6L A;  3OPR A;  2K2N A;  3HLD A;  3M6B A;  1YMX A;  5J8X A;  4WN5 A;  4ARZ B;  4Y15 A;  5HDD A;  2A2L A;  4HQA A;  3BLM A;  1K56 D;  4OPR A;  4Q0I A;  5L09 A;  1N9L A;  3IX3 A;  1G6O A;  3IBJ A;  4WZ5 C;  2VJW A;  3MF0 A;  1BYW A;  1NLY A;  1S67 L;  3RTY A;  2ZOI A;  1TS8 A;  2QYB A;  2VV6 A;  3WS2 A;  5FAS A;  1STZ A;  2BLS A;  2ZMF A;  4L9E A;  3TRC A;  1O07 A;  4KZ5 A;  4I38 A;  2D02 A;  1K55 C;  2HJE A;  4KUK A;  4OH0 A;  1S0W A;  4Q8I A;  3E2L A;  3TOI A;  3SW1 A;  2JCH A;  3O87 A;  3IF6 C;  1F9I A;  2JKR M;  2AVX A;  1FR1 A;  4PHT A;  1HVB A;  3E0Y A;  2H0Y A;  4GD6 A;  5M18 A;  4E6X A;  1GA9 A;  2QHK A;  5AJG A;  4KZ3 A;  3S4X A;  2YKF A;  3SH9 A;  1DJC A;  2HP5 A;  1E4D A;  5DF7 A;  4FTX A;  5DVA A;  1OPX A;  4MN5 A;  3OZH A;  2G2U A;  2V20 A;  3FC7 A;  4PAU A;  2ZMV A;  4Y7P A;  2EWW A;  3RH8 B;  4MN7 A;  3TW8 A;  1K57 A;  4OVD A;  3IH9 A;  4KQQ A;  5HL1 A;  2VZW A;  1K56 A;  4E3J A;  3K3D A;  4MDZ A;  3ULF A;  4B9O A;  4U0X A;  2JKT M;  1K25 A;  4YIN A;  3EGX C;  2A3U A;  2OLU A;  4N92 A;  2Y79 A;  4MN6 A;  3S7P A;  2ZQ7 A;  1JVJ A;  3FWL A;  3IXG A;  5CGX A;  1NRF A;  3PYP A;  1LI9 A;  1P9W A;  1PRQ A;  2RL3 A;  2XD5 A;  3Q1F A;  4HJ6 A;  4EXO A;  4E3I A;  2VGL M;  1ES4 A;  3IS2 A;  1PIO A;  3LID A;  1W7F A;  4YNR A;  5HAI A;  4DE2 A;  3V5M A;  5E2E A;  4QD4 A;  3VOL A;  5L2F A;  4GS9 A;  1BLC A;  1E25 A;  2IWB A;  1L3L A;  1X0O A;  2PRF A;  4KZ7 A;  4DDS A;  2QKP A;  4DE1 A;  4R3A A;  3IXH A;  1IOU A;  3HLW A;  4R38 A;  4R23 A;  1AWI A;  4UA7 A;  2Q0O A;  1VHM A;  4X1L A;  1FCO A;  4OQ0 A;  1TF1 A;  3CJM A;  3VE3 A;  2X01 A;  1VEU A;  1GHM A;  1XGI A;  3CHW P;  3P7N A;  4WYY A;  5GLB A;  1CEG A;  2ZQD A;  3CUE A;  4MBF A;  2K31 A;  1ZKJ A;  5U47 A;  4RA7 A;  3LEZ A;  4LEN A;  1QMF A;  1MXO A;  1IEM A;  3LYX A;  5IS1 A;  2M1C A;  3NOP C;  5EV0 A;  3MXS A;  1YPR A;  2R9W A;  4EBL A;  4OOL A;  2GX5 A;  4LLO B;  4CLC C;  3BM6 A;  4S2N C;  3MQO A;  5EUA A;  3OLO A;  2PT7 A;  5AVF A;  3HL9 A;  3ICY A;  4O8G A;  3K3C A;  2V1B A;  1FIL A;  5F1G A;  1M6K A;  3E4O A;  3QNB A;  1H8Z A;  2J8Y A;  3IX8 A;  4E3L A;  4DJ3 A;  5KIZ A;  4BBT A;  3CLO A;  3ITB A;  3NDG A;  4NK3 A;  4LV1 A;  1SKO B;  1PWD A;  3DWZ A;  3MJQ A;  5L10 A;  4EEU A;  4EBP A;  1NZO A;  3BY9 A;  4HP4 A;  2KX6 A;  3LY4 A;  3UE1 A;  2PYR A;  1C3B A;  4MNR A;  3IQA A;  3MKF A;  4JXW A;  5JYP A;  1YLT A;  4FD8 A;  3QP4 A;  4Z1W A;  3OC2 A;  3ZVW A;  3G31 A;  3W4Q A;  2NUT C;  3E98 A;  3A3F A;  4YWZ A;  2W3H A;  4R0Q A;  1O7E A;  1P97 A;  3P98 A;  2WGW A;  3FV7 A;  3F1O A;  3UO9 A;  3HBR A;  2QPN A;  3CI6 A;  1FCM A;  3BEB A;  3M2J A;  3KSI A;  5FQ9 A;  4B88 A;  1LL9 A;  4G3K A;  1OME A;  2ZQC A;  3ZHH A;  4HIA A;  1KVL A;  4S2O A;  4QWO A;  2Q9N A;  5I5L A;  3LIF A;  4IBX A;  4RVA A;  4E3O A;  4BL2 A;  3ZFZ A;  1TDG A;  3IHA A;  5M1A A;  3P09 A;  1ONG A;  5FAP A;  3FKW A;  2Y4A A;  4S2M A;  1KOU A;  1NYY A;  2HF6 A;  2XDM A;  3QP6 A;  5IHV A;  5HDS A;  1PWG A;  5FEF A;  3GTC A;  4ZJ3 A;  1T18 A;  1S6R A;  1ESU A;  2VGL S;  3WS1 A;  2BAS A;  4NG2 A;  3BJN A;  4JXV A;  3EQV A;  1Z6F A;  1EW0 A;  4EES A;  5DTK A;  3RFB A;  4S2J A;  5A92 A;  1JWV A;  3HUN A;  1JTG A;  4LFU A;  1MWT A;  3A3J A;  3KX0 X;  2ZM8 A;  4GCZ A;  4DJ2 A;  1IEL A;  3GR2 A;  3E4P A;  3M6H A;  1MWS A;  4P6Z M;  5K5B A;  5EOO A;  1WA9 A;  3NOT C;  2DCF A;  4PMA A;  3VP2 A;  2PU4 A;  3HLG A;  5EE8 A;  5KSC A;  2PYP A;  4EWF A;  2HDS A;  4WF0 A;  1OTI A;  1ZC2 A;  3BWL A;  2PBD P;  3A3I A;  2J80 A;  2JKG A;  2HGV A;  2L4R A;  3NOU C;  2XA7 S;  3R4K A;  5F6A A;  3CIT A;  4ZTK A;  4K08 A;  2WGW B;  1BSG A;  3LEQ A;  2W1R A;  4I3A A;  1ALQ A;  4GZB A;  4NEE D;  2WZZ A;  1VB6 A; 
#chains in the Genus database with same CATH homology
 5HDC A;  2FZ0 A;  3IS2 B;  4Q0I A;  1N9L A;  1G6O A;  1XJ3 A;  3IBJ A;  1DP8 A;  3FG8 A;  2VJW A;  3MF0 A;  4GHI A;  1BYW A;  2P7J A;  3R7W B;  1NLY A;  1S67 L;  3RTY A;  2ZOI A;  1TS8 A;  2QYB A;  2VV6 A;  3TE8 A;  3UMD A;  4I3I A;  1D7E A;  1STZ A;  2ZMF A;  2JHE A;  3NHQ A;  5DKK A;  4HNB A;  4L9E A;  3TRC A;  3G6O A;  2GZA A;  4I38 A;  2D02 A;  2VX8 A;  2HJE A;  4KUK A;  4FSF A;  4BBV A;  1F98 A;  3SW1 A;  2EA9 A;  2MJ6 A;  4WEK A;  1F9I A;  2JKR M;  3LI8 A;  2Z6D A;  3CUE C;  4WEJ A;  4PHT A;  3GDI A;  2PHY A;  5J7E A;  2W3G A;  3E0Y A;  1OTD A;  2JN7 A;  2PD8 A;  3OCL A;  5F68 A;  2NUP C;  4YOF A;  4CQH A;  2VEA A;  4WUJ A;  5HWT A;  2QHK A;  5AJG A;  2YKF A;  4IJG A;  3T4K A;  2J3W A;  5AVE A;  3F1P A;  5HWW A;  3W2Z A;  3F1O B;  1OPX A;  4MN5 A;  2W3F A;  1OTE A;  2DMW A;  4HH2 A;  3LR3 A;  5G4Y A;  4PKY G;  4GS9 B;  4NXB A;  2KLI A;  3FC7 A;  4WLA A;  4PAU A;  4NXE A;  2ZMV A;  3V67 A;  2V0U A;  5F69 A;  2M7U A;  2EWW A;  4GJ4 A;  3EEH A;  3RH8 B;  3U2A A;  4MN7 A;  3TW8 A;  5HWV A;  5IU1 A;  4Q0H A;  2VZW A;  5CX7 A;  4R70 A;  1LSW A;  2LB9 A;  4JGR A;  3NJA A;  3K3D A;  4MDZ A;  3ULF A;  3B42 A;  3E4Q A;  4H6J B;  5F5Y A;  4B9O A;  4HY8 A;  2WKP A;  3PHY A;  4GLQ A;  5TBM B;  2JKT M;  3LR5 A;  3EGX C;  4XT2 A;  5HL6 A;  2R78 A;  2IA2 A;  3DBA A;  2GJ3 A;  3PXP A;  2W3E A;  3BQ8 A;  2Y79 A;  4JGP A;  3LIA A;  3UME A;  4MN6 A;  3S7P A;  5HD3 A;  3H82 A;  1P9R A;  3F1N A;  4KQD A;  2XRO A;  2D01 A;  3P01 A;  3MQQ A;  2XSS A;  2QWS A;  3PYP A;  1N9O A;  1DP9 A;  3T50 A;  3MQ0 A;  4IUH A;  1P9W A;  2YKH A;  3EQU A;  5DKL A;  2W1T A;  3VE4 A;  3UE6 A;  4HJ6 A;  4EXO A;  1MC0 A;  1OT9 A;  2VLG A;  1TS6 A;  2VGL M;  3KSF A;  3IS2 A;  4OOM A;  3LID A;  4IUK A;  4YNR A;  4Q0J A;  4NXG A;  4LRY C;  3KSH A;  1LSX A;  3PBN A;  3UB9 A;  3VOL A;  4EUV A;  2ZOH A;  5J4E A;  3C38 A;  5DJT A;  4CLC E;  4F3L A;  5C5K A;  4GS9 A;  1W63 M;  3LR0 A;  4NKP A;  1X0O A;  4CLC B;  4AFI A;  3MR0 A;  2QKP A;  3S7Q A;  3UE3 A;  3S7N A;  4RQ9 A;  4R3A A;  1LT0 A;  4CLC D;  1IOU A;  5EFW A;  2KOI A;  4GHI B;  3R7W A;  1YAX A;  4R38 A;  4BBU A;  1H3Q A;  1UWP X;  3HJK A;  3C30 A;  1T1B A;  4WL9 A;  2JKT I;  3BQA A;  4HHD A;  4UQI S;  3OOV A;  3PR6 A;  4KQO A;  1VHM A;  3LIB A;  1TF1 A;  3VE3 A;  2O9B A;  5HPI A;  2O99 A;  4LRX C;  3F1P B;  2PD7 A;  5IT5 A;  3P7N A;  1F5M A;  2O0Y A;  4IHQ A;  2WKQ A;  3S7O A;  3EGD C;  3C2W A;  3KYQ A;  3H82 B;  3LFV A;  3LR4 A;  2V0W A;  4EEP A;  3UB8 A;  3EEA A;  3CUE A;  2K31 A;  1ZTU A;  3PBO A;  5G4Z A;  4BJP A;  1P0Z A;  2L0W A;  2OAP 1;  2FH5 A;  2V9A A;  5HD5 A;  3LYX A;  4B93 A;  1G28 A;  3CAX A;  5A8B A;  3HCY A;  5IS1 A;  2M1C A;  3NOP C;  1XJ6 A;  2GNX A;  2JKR I;  3H7W A;  4HP9 A;  4XT2 B;  2P04 A;  4O01 A;  1T19 A;  1TS0 A;  4OOL A;  2OWH A;  3FPW A;  4E04 A;  4G3V A;  1YSP A;  3JVU A;  2GX5 A;  4LLO B;  4CLC C;  3D3O A;  3MXQ A;  2M7V A;  3MQO A;  3OLO A;  4L0L A;  2PT7 A;  3BY8 A;  4GW9 A;  5AVF A;  3ICY A;  4O8G A;  3K3C A;  2V1B A;  5DFX A;  3E4O A;  2O9A A;  1MKM A;  1OJG A;  4Y3I A;  1YSQ A;  4WEL A;  1Y28 A;  1IFQ A;  3C8C A;  3IBR A;  4ARZ A;  1OTA A;  1LL8 A;  1XFQ A;  1OT6 A;  1YKD A;  1TS7 A;  3LUQ A;  2PR6 A;  3PBT A;  2ZBB A;  2LB5 A;  1T1A A;  4L9F A;  4DJ3 A;  5KIZ A;  2XRN A;  3PBQ A;  4BBT A;  4QPR A;  1OJ5 A;  3CLO A;  1NRJ A;  3ZQ5 A;  1GSW A;  4P6Z S;  3JVV A;  2OAQ 1;  5MC7 A;  5LBR A;  3B47 A;  1GSX A;  2I9V A;  2W0N A;  4NXF A;  3MJQ A;  1T1C A;  4EEU A;  2W1T B;  1ZHH B;  3BY9 A;  3H9W A;  3LI9 A;  4HP4 A;  2K7S A;  2KX6 A;  3EWK A;  1XFN A;  2KDK A;  4CLC A;  2PYR A;  2G7U A;  2WKR A;  3A0V A;  4ETX A;  4PKY A;  2QJ5 A;  4H6J A;  1NLZ A;  5KSH A;  4Z1W A;  1D06 A;  3OC2 A;  5DFY A;  3OCN A;  2PDR A;  4ZRR A;  4JGQ A;  2NUT C;  3E98 A;  1UGU A;  4EER A;  3TJZ C;  2W3H A;  3F1N B;  4YWZ A;  3K2N A;  4I5S A;  1P97 A;  1DP6 A;  3F1O A;  3T4T A;  3B33 A;  2HJ9 C;  3CI6 A;  4EET B;  2INW A;  3KSI A;  2W27 A;  5J3W A;  4M4X A;  4G3K A;  3EOI A;  3KSG A;  4MMN A;  4HIA A;  4L9G A;  5I5L A;  1JNU A;  1UWN X;  4I3J A;  5HZH A;  3LIF A;  3LIE A;  3BW6 A;  3FPV A;  2W3D A;  4LRZ E;  2V1A A;  4II7 A;  3D72 A;  2Y8H A;  1KOU A;  2HF6 A;  4F3L B;  1LSV A;  2CMN A;  5L8M A;  3H7W B;  4BMW A;  2VKS A;  5HPF A;  4ETZ A;  4ME4 A;  5HDS A;  2H28 A;  1S4R A;  4BWI A;  2PR5 A;  4JGO A;  2A24 A;  1T18 A;  3GEC A;  2VGL S;  2BAS A;  3BJN A;  2Z6C A;  1ODV A;  1NWZ A;  4UEY A;  1XJ4 A;  1OTB A;  3EQV A;  1EW0 A;  1TD5 A;  4HOI A;  4EES A;  3RFB A;  3PBR A;  4HH3 A;  4I39 A;  4G3W A;  3UB7 A;  2OWJ A;  1N9N A;  3KO6 A;  4HJ4 A;  2B18 A;  4MCW A;  2J3T C;  3A0S A;  3HJI A;  3T4O A;  3T4J A;  4Y5F A;  4LPZ A;  1S1Y A;  3KX0 X;  3MFX A;  1S66 L;  4GCZ A;  4EW7 A;  2B02 A;  4DJ2 A;  3CWF A;  2EWV A;  3OBF A;  3VV4 A;  4EU0 A;  3UB6 A;  3E4P A;  5DF9 A;  4P6Z M;  2P08 A;  2L1M A;  1W63 Q;  4DN0 A;  4EQ1 A;  2XA7 M;  5K5B A;  1DRM A;  5FL3 A;  2QJ7 A;  2O9C A;  1WA9 A;  2HV1 A;  3NOT C;  3A0R A;  2VA0 A;  2VV8 A;  3T4S A;  4KUO A;  1H8M A;  5TBM A;  3T4L A;  1XJ2 A;  4HI4 A;  4UQI M;  4DMZ A;  5TJJ A;  5HSQ A;  1MZU A;  2PYP A;  1S1Z A;  2VV7 A;  4WF0 A;  1OTI A;  3BWL A;  1S4S A;  2J80 A;  2HGV A;  2L4R A;  3NOU C;  2OOL A;  3KYZ A;  4R6L A;  2XA7 S;  3R4K A;  4O0P A;  5F6A A;  1V9Z A;  3CIT A;  5DJU A;  4K08 A;  4HJ3 A;  4FOF A;  3T4Q A;  2K2N A;  3LIC A;  3O5Y A;  3ZYT A;  3PBS A;  2W1R A;  4Y2F A;  4WN5 A;  4I3A A;  3MMH A;  2A24 B;  2J3T D;  1V9Y A;  1GSV A;  4ARZ B;  4NEE D;  1VB6 A;  5HDD A;  2A2L A;  4HQA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...