3D3RA

Crystal structure of the hydrogenase assembly chaperone hypc/hupf family protein from shewanella oneidensis mr-1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
83
structure length
83
Chain Sequence
ENLYFQGMCLSIPSQVVAVDNERQSVTVDTLGVRRDVSSHLMTEPLAIGDYVLIHIGFVMNKIDRNDALQSLELYQEIVSKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Hydrogenase Assembly Chaperone HypC/HupF Family Protein from Shewanella oneidensis MR-1.
rcsb
source organism Shewanella oneidensis
molecule tags Chaperone
molecule keywords Hydrogenase assembly chaperone hypC/hupF
total genus 15
structure length 83
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01455 HupF_HypC HupF/HypC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.970 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3d3rA00
3VYUA 3D3RA 2OT2A 3VYRA 3VYTA 2Z1CA 3VYSA
chains in the Genus database with same CATH superfamily
3M3YH 3CPWA 4OONA 5ELDA 4JBJA 2EZVA 3A5UA 1BUVT 3IL8A 1EIGA 1YEZA 3MXUA 4ZK9B 4X3SA 3P7JA 1YVCA 3A8IE 5IP7H 4UP8A 4IJLA 3H6MA 4DR1L 2E74C 5M9OA 3PO2B 1JB7A 3OOCA 4A3CH 1EIFA 3CP0A 1Z7TA 4MN3A 2P5ZX 3M4OB 3HOZG 5A2QE 2OQKA 1M1KC 4YCWA 3W1GA 3R2IA 1PH4A 3K7AB 4ME3A 2MO1A 5DAUA 3S1QB 1WCMB 3IKJA 3OMCA 1WTRA 3KDFB 2CCZA 1DGSA 3EJIA 4LF7L 5TSSA 3NBIA 1VQ6A 5ISRA 2HIVA 2KJXA 2VY3A 4LK1C 1X32A 2A73B 3MZ5A 4I65A 4IFDI 2L12A 4WJWA 1LO5D 1SYFA 2IX3A 5C3EH 2GVAA 3PO3B 1Q86C 1RTNA 1E1TA 1XMQL 2HDLA 3U50C 1QVGA 1NCVA 1U4MA 3TSSA 2EXZA 3CCQA 3C1FA 1STBA 4NXNQ 2C5CA 3OPOA 1PFMA 5ELCA 5K36H 5JJLA 4EGVA 1HFGA 1G51A 1NY4A 1HR0W 1VMPA 2ID0A 1W3SA 1EU3A 2L5TA 5I9OA 4L5SA 3CCRA 2R6GA 1LTID 2K04A 4JI8L 1A8VA 2DN8A 1A2TA 2KHJA 4HMJA 2ZTEA 4I7AA 2E2JB 2DNEA 1QNUA 1Y14B 4LUZA 1O7YA 4F7XA 4FF3A 4DNTB 1KIXA 1NUCA 5EPJA 4C3IH 4R4IA 4EQPA 3VYRA 1DONA 2WB1G 3FKIH 4ULLA 1VQKA 2MPMA 3NQTA 2NVXB 4DAMA 3BDLA 4LF6Q 2PQEA 3MXNB 1G91A 4QUCA 1SYDA 4JBWA 1RHPA 1G2TA 2UUBQ 3DM3A 5I6YA 2WV6D 4R4OA 2PW5A 1STHA 3R3OA 2BDNA 5ELBA 4F88A 5L37A 1JICA 1LLRD 2VB2X 4CBVA 5JEAH 2DNCA 4QIWE 4HIOA 1X54A 4B3TL 2Q2HA 3H94A 4PZ6A 3A8KE 2IL8A 2PNHA 3K7AH 3TN2A 3T1HQ 1ET9A 1G291 1L0XB 5E3FA 2EJFC 4A3KB 5D65A 2PW7A 2XVSA 1SXTA 3HOYB 4JPBW 2VQFQ 1I50B 1DM0B 3TP8A 1UAPA 1EUJA 1WOCA 4I7ZC 1Q90A 4O1NA 5IODA 1OXUA 3S2HB 2NVTH 4RMFA 2H5XA 3OMGA 3CRKC 4K14A 3G6JB 1K83H 1GXDC 4YY3L 4OGQC 4LF9Q 1PRTF 2JP1A 2K5DA 3KJPA 2PI2A 3A8JE 3ERQA 2HHHL 3CW2C 3PIO3 1F9SA 4DU9A 3J81E 3HOVH 1MKHA 3TZDA 4NDXA 4RWSC 1GKHA 5IT9L 5M3FB 3D31A 1A2UA 1PH6A 4A3BG 3HKZB 3CCSA 4UAIA 3DHQA 2OTLA 2XRSD 4TRDA 2M9VA 1X56A 5K36G 1OO9B 2RDFA 3CC4A 3ND8A 1G6PA 2D0PA 1Y1VH 3TEHB 3I72A 3J7ZC 1O80A 1I50H 2FHTA 1SFOH 2CW0C 4PZ7A 3S9WA 5CR3A 3CC2A 3QO2A 1BVSA 1UE1A 4DNIA 4X65Q 3Q6SA 2F0SA 1ZYRD 1IYUA 1MJEA 3AYHB 1CKNB 2VUMB 3HP3A 3E0JA 1ENFA 3R93A 4HIMA 4XIGS 3UDFA 1GUGA 4HMIA 4P74A 3A55A 1EYAA 1LTLA 1YNJC 4DAYA 4A3KG 3M4QA 1D5ZC 2HDMA 4N9TA 2KCCA 5FLXc 2KECA 4LFCQ 2EQSA 1GO3E 2RHSB 5M3FH 1AEXA 3U9SA 4H0LC 4DV5Q 4GOPA 1TWGH 3HOXB 4A3BB 3OWEB 2VQEQ 2ZJQA 3NELA 4XTCS 1XX8A 3D6CA 4P73A 1F2ZA 4C1NK 2B2VC 2F0JA 4CDEC 1K8OA 2ZM6Q 3I4NB 2FJ2A 4HIKA 2CQAA 2C35B 1EQQA 4A3KH 3D0FA 4PV1C 1I6VC 4P2CB 1CI3M 4IOAA 1TY0A 2R93G 3MC0B 5IY0A 2OF1A 2M00A 3M7GA 3K0XA 1XNRL 2H4OA 1A6XA 1PA6A 5HY6A 1HJPA 4RFBA 2X6LA 1PTOB 4A3GB 3CAMA 4KMUC 1HXYD 4POFA 2Y0SE 2RA4A 2NVQH 5M5XH 3FP9A 3RZOH 2N55A 4DV7Q 2IHFA 1RJTA 1VQ9A 4KJNA 2K32A 1VQDA 2D9UA 2B2VA 4R4CA 4JI5Q 2IHEA 1MSGA 1Q7YC 3CQZB 4FP5D 4OWXB 1Q82C 4WJ3M 5ELFA 2EJMA 4UHVA 1LTGD 1EY4A 1L1OC 4L63B 2F52A 3Q24A 4X6AH 1EL0A 2SNSA 1NAPA 5FK9C 1SE3A 5M5YB 1WI5A 3V2TA 3GTMB 1FD7D 3A0JA 4CJ2C 4UPAA 4B3RL 1FNVA 1YNNC 1NTGA 5C4JH 4X62Q 3PV0A 3MA2B 3DUZA 3MXGA 5LMNW 1UEAB 3CD6A 1A0IA 3H0GG 4B3MQ 3EIVA 3T1YL 1XMQQ 4K2LA 1Y1VG 4S3SA 5C4ZA 2VNUD 4Y52H 3HOXG 4DV2L 4LFAL 3W2DA 3V05A 1XMOQ 2ASBA 4OX9Q 3VR6A 4HEDA 2K4KA 1T9HA 5FKAC 2MJ8A 1IL8A 1Y1WG 4K0KQ 2JSOA 3FPPA 4JI2L 1IYVA 1IYJB 1W6KA 1YIJA 1Z6HA 4X62L 1HZBA 4X3UA 4HN7A 3BJUA 4AYBG 1HZAA 2F4VL 1HNWL 1M4VA 1O7ZA 1Q46A 5C4XB 2K5NA 2PCFB 1DJRD 3GTOB 1SYEA 4UP9A 4ZCKA 3E3XA 4P71A 2I0QA 1HNZQ 4C2MB 1PH1A 2EOTA 4R4QA 2EIFA 4LF8L 1J5EQ 2EYJA 2IT1A 3QR8A 5LMNQ 5IP7G 1U9RA 1IZ6A 1EZ6A 2F0KA 1B9NA 2NWGA 3D4RA 1II3A 4X66Q 1JJGA 4C3HG 4DKAC 5C0XJ 1Q8IA 2WAQG 3GTGB 4OIJA 1YJWA 2XN9C 1SE4A 3F2BA 3L7ZC 3S17B 3S1MB 3MFYA 4Y7NB 4QQBX 1TS2A 2CH4W 1KAWA 1PV4A 4WFN3 3C3LA 3E9IA 5CV5A 5IT9c 3K59A 2DJGC 1P8LA 3QIAA 3J7A5 5CV9A 3FMCA 3BZKA 4FXKC 1AW7A 4GN4B 2K7VA 1JOOA 2KHSA 2QCPX 1K73C 3T1HL 1KL9A 1PYBA 1V8QA 1QWYA 1XMOL 4F87A 1JQYD 2XGTA 3A7AB 1XTCD 3JAMi 4RKLA 4CKEA 4KHPQ 1Y1WB 3KF6A 1ILPA 3P1HA 2RDHA 4IN3A 5C3XA 4X3KA 3OTOL 3I91A 1YHBA 1O7LA 1EIHA 2Z6KA 3K0YA 4JOIC 2C9OA 4XT1B 3RN2A 1J5EL 3HZXA 5I2YA 2BDOA 3FPUB 4DXGA 1KNAA 1CHQD 1EZ8A 2B8FA 4ODGA 4C3JG 5KYIA 2KQ3A 4H44C 3PUVA 4A4IA 4N8X1 2PZWA 1EY5A 4L5TA 2UXDQ 4DR6L 3A7LA 2ES2A 2I46A 1HNXL 3PQIA 1HNZL 2YU9B 2J7ZA 2NVYB 4OEMB 4PZ8A 2PQAA 3VR5A 3VR4A 3TQYA 5LMUL 3RD4A 4A3LH 2YYZA 1QVCA 1U4RA 4L8JA 4FF4A 1XPOA 1BCPC 2ZJRA 4BY7G 4NXMQ 3DXJC 1TS4A 1IXRA 1SNPA 5J39A 4ZKBB 2NVQB 4M8AA 4PMWA 3GTLB 2AUKA 3VR2A 5FLMG 5LHY1 1SE2A 4K8IA 2B2TA 4AIMA 4LF4L 1IHZA 3VA5A 5IWAL 2AHOB 3GTMH 5BR8L 3C46A 1I4PA 1VQHA 1KXLA 2EPBA 2NN6G 5KEEA 3SGIA 1DZ1A 3K7UC 3D8GA 1HTPA 1HQMC 1PFNA 3NUCA 1I6HH 1AFPA 2J0TD 1BBUA 1RODA 3UE0A 3H3VC 2I5LX 1SNQA 1YHAA 1VDZA 3M9BA 1UNSA 3CMEA 4GLAC 3ICEA 3QOLA 2B2TC 3S16B 1Q8KA 4TKOB 4LFBQ 4RGOS 1C8CA 3GTQB 3I55A 1ICFB 4BY1H 4FDBA 4ME5A 1ILQA 2XIWA 3MWYW 5JAVA 4DGZA 3PUXA 1MGSA 4DV6L 1U0LA 4XT3B 1LM0A 1UE7A 5T1IA 4C3IG 5BN4A 3ULPA 3NBHB 1P16A 1ENAA 1OXXK 2AUJD 1FYCA 3NTIA 1CSQA 1PH7A 4BY1B 2Q8TA 2CWPA 4JYAQ 4M1UB 3JAML 1EY6A 1FNWA 3OW7A 4A3FB 3S2DB 3UI2A 3MHBA 1R9TH 1YJ9A 3NXWA 2R7ZG 1XNRQ 2BH8A 2LMCB 1VQMA 4LNQA 1HH2P 1LT5D 3UE1A 4LUVA 2RCNA 2PO4A 1SRUA 2ZTCA 3DWQA 5IGDA 1YNND 2CH4A 4BY7B 4YWMA 4OWTB 3O13A 2LXJA 1KDAA 3NENA 3WOFA 1OXTA 1ZEQX 1NBWA 3RZOB 2MHVA 4RGTA 5JVG3 1Q81C 4LF6L 1B7YB 1DOLA 1PTOH 3KBGA 1Y8PB 2D0OA 4H7BA 1WD1A 2ZXOA 1E24A 2F0VA 3L2PA 1N34L 1SN8A 3DWAA 3SHLA 1EOVA 5LL6S 1PZKD 3GTLH 4IO9A 4IFDG 2DGYA 3QJYA 1SE8A 1T5XD 3SVMA 1QILA 4QY7A 4EQNA 5M5XB 2R92G 1LTRD 4JI8Q 1F77A 2JJQA 1C9OA 4DV0Q 4G7HC 4HSVA 4HTHA 2HUGA 3HS0C 4UDUC 5DEHA 4A3LG 4DA2A 4GKJQ 2AMCB 2UU9L 3KF8B 4OL7A 2Q2UA 1AE2A 4FVMA 5GROA 4A3FG 3GTPB 1JORA 2NTTA 2YU9H 1IW7D 3AB9A 3D4DA 1SMYC 3D6WA 4NXNL 2FMMA 5CBEE 4QF4A 3HOYH 1VQGA 3A5ZB 2CFMA 2B2UC 4BBRB 3M85A 4IPDA 4HCSA 4JI1Q 5IYDH 2UUBL 2HCIA 2NVTB 1U4LA 3PO2G 1IBMQ 2N78A 3RLNA 3CU7A 1TWAB 3EN2A 5C3EG 3LNNA 3SEBA 1ASZA 5C5LA 2CKZB 2B3GA 3SDZA 3G71A 1HUNA 3N52A 1K83B 1VF5C 4YIJA 1KD1C 3ONAB 1Z9FA 4IPCA 5CV8A 3TS2A 3SE0A 3ZJYC 5LMNL 2WKDA 1FJGL 1QJOA 5DM73 3I73A 4QGUA 3UDGA 1XYIA 2GN5A 1QE6A 2JYOA 5IGCA 4B08A 4LMQD 3GTKB 5C0XG 1QCBD 1HCZA 2F1MA 3NWSA 5GAGC 2N49A 1GHJA 1G6ZA 1E22A 3NQIA 3HKSA 1F9RA 1HHVA 1GOZA 3M4YA 3BDOA 1IBLQ 2ZM6L 4JI4L 2WACA 2F4IA 1WCMG 1EY9A 1SBBB 2VL6A 3CKIB 1PHJA 2IWHA 4A3DH 4XYQA 4HR7B 3WWVA 4ZLTF 2K5QA 1J6QA 1F9QA 4MTKA 2B2WA 2K03A 1EEFD 1ESRA 1E1OA 5I9PA 4ZAIA 5CYUA 2DY8A 2G9DA 5IYBG 2F0WA 5M3MB 1I5FA 3BS1A 1X3FA 1CKMA 4TQUS 4LF7Q 2B2YC 5IOCA 2B2YA 1N32Q 1PFSA 4JI6L 2E2IH 3FDTA 5EKIA 1EYDA 2HQEA 4HCEA 4A76A 2R93B 3I4LA 3BU2A 2JA7H 5C3EB 4C1NI 1TWFB 1VQBA 2BE5C 3KLWA 2CW0D 2Z4IA 4B3TQ 1B2TA 1Q3LA 1CTMA 1QUQA 1WFQA 2G9HD 1K0RA 3G48A 4DR6Q 2CHBD 4IALA 4J15A 3CCJA 3J81i 2QILA 4CDDC 4POGA 2F0IA 3ULJA 1E3PA 2KUMA 2JA9A 1GUTA 4V190 2ZXPA 3BZCA 4B3RQ 2LFNA 4IJHA 1TQOA 3F8TA 1E0BA 2PYKA 5LL6X 1TIID 2Q2TA 2JA5G 2BH2A 2JEBI 5IT9E 1GD7A 1GUNA 4ZUIA 1GJXA 3M4PA 3S1MH 1X9NA 3W1BA 2K75A 3JAMc 4DR5Q 4JI4Q 1PMRA 5M5WB 2Q8IB 3S1QH 3OHXC 4RG1A 2EYHA 3Q8DA 1A15A 3STBD 1E7ZA 4IURA 2N8NA 3LWEA 4WORA 5JJIA 2D2CC 1Q1BA 2E5LL 4NMZA 4TSSA 4A3MH 4KV6A 2K52A 3D4WA 3C1EA 3J80L 3OYYA 1F2YA 1WCMH 5COYA 3K5OA 4RA8A 1MIUA 1TXYA 4XQNA 2A19A 5C5MA 1I3QB 5AJ3L 5K5PA 4LF5L 2PI2E 4HJAA 1RF2D 3MXNA 1VQNA 1SYGA 3NTKA 1W6JA 1K8AC 4A3EH 2L9HA 2E5LQ 3B6YA 1D5XC 1AP0A 2JK8A 1K28A 5IGBA 4LWCA 1VQ8A 3GO5A 1NNXA 2JA7B 2UUAQ 1VQLA 2E2JH 3EROA 4A3BH 3PF4A 2ZJPA 1DD2A 4QMGA 4X64L 4GKKL 3J7AV 2I07B 3CCLA 1VQFA 3PCOB 1SYBA 4IPGA 5IIFA 1T5EA 4DR7Q 5EAYA 1SSOA 3TBIB 5C6AA 5EKLA 2QEXA 5M5WH 2A8VA 5GAHC 3W5OA 2JA8G 4IFDJ 3G4SA 2VQEL 4X3TA 4GKKQ 1L1OB 4K5XA 1H9SB 1I4XA 3K81C 1TWAH 5I2XA 1SFOB 1B53A 1LTSD 2IJ0A 3J80E 3HFZB 4K0KL 2A69C 4LW1A 5AJ3Q 4OO1H 1BF4A 3S17H 2R92B 1D7QA 3RLOA 1XNQL 2QW7A 3K5NA 1X65A 4C2MH 2I5HA 5J3BA 1SNOA 4JC0A 3I4MB 4QUFA 1STAA 2ICIA 2Z4HA 1K3BC 1R4QB 4MHEA 1EFID 4HIDA 2A6ED 1I4HA 2Z0SA 2F0MA 4KK7A 1S5FD 2FFKB 3CRLC 4A3MG 2B63G 2KEDA 2RDGA 4RCNA 1K8GA 1LUZA 1JE5A 1E2ZA 4PQXA 4KHZA 4OX9L 1B3QA 5FO7B 4BBSB 3W3AA 5A35A 2B39A 3BZDB 4DV7L 3HOUG 4P75A 3IAYA 4K6LA 5IYBH 1CZGA 2QDBA 5HGTA 1MD2D 1HZ9A 2MP1A 2FMCA 1JE4A 4BBRH 1TS3A 2EYPA 3PMFA 4XQJA 3F2CA 4JK1C 1B9MA 4CKBA 1HPCA 3CXCA 3S1RH 2WB1E 3T13A 4RH6A 3CCEA 1JWUD 2ATWA 4DAYB 2AKWB 4F8MA 5HURA 1IBLL 2HCCA 1I4RA 1VQIA 1VF7A 4IZ8A 3K6OA 3SK4A 3A54A 1A62A 1RD9D 2KCTA 1EQTA 3GTGH 2NN6H 1B50A 2BE5D 4BWGB 2YV5A 1NMFA 3VR3A 2EXDA 2R61A 1S5CD 2R7ZH 1NSNS 3HOWG 3GDEA 3NPPA 2JA7G 2F0QA 4CKCA 1QG7A 1X3PA 3KLSA 2B2UA 1L0WA 4DK0A 4DUYQ 1CA5A 4JI2Q 1JCKB 3EFXD 4KJOA 3CF5A 1PDQA 4WJ4A 1QOHA 4PMCA 1HQRD 4H02A 4RKBA 3I4MG 3I70A 4LJZC 4HJ7A 2XNAC 4DFAA 1I4QA 1UE6A 1MSHA 3Q22A 4OWWB 3E5SA 4B3SQ 2F3IA 1XNQQ 2JA6G 4IFDH 3S16H 1UE5A 2LSSA 3PUZA 4JI5L 1PH3A 2B29A 4JOIA 4DR4Q 4BXXH 2YTVA 4KI0A 1IBKL 1XWEA 1Y8OB 4A3GG 1HUMA 3A56A 1CHPD 5FO8B 1MJCA 1DXMA 4IUQA 3I4MH 1UEBA 2SOBA 1BXTA 4OO1G 1N33L 1WYDA 5JVH3 1HTLD 1D5MC 1VQAA 3IFDA 2F03A 2R7ZB 5JJZA 4FYDA 3BVGA 5FOBB 4JI3Q 2XWJB 2RKSA 5GQOA 3NSWA 1ML0D 3J80c 4YCVA 3J81j 2UXBQ 1LT3D 2UUCQ 4A3FH 4IUVA 3S2DH 3S14B 4FO2A 2N3SA 3LGJA 3DEPA 3OIPA 2DUDA 5BN3A 2NB0A 4LF9L 3KJOA 5JEAJ 1PH9A 4NXML 1EWIA 1STNA 3U58A 3KUPA 5FLXE 3EA6A 1X3EA 2NVYH 5BN5A 1B44D 4A75A 1SYCA 1IKLA 1J9OA 1F9PA 4A3DG 4JW0A 5GAEC 4PMBA 4Z9CB 3S1RB 2EYFA 2NN6I 2BA1A 1ET6A 1BO0A 3T16A 1SNDA 1V1PA 1STEA 1TWHB 2ZTDA 1HR0Q 2M2LA 2E75C 4B9WA 3J81c 5EJWA 4YWLA 1TVXA 1R9TB 1KABA 1NE3A 4ZYSA 2MQHA 4ZQ3A 5DLQE 5A2QL 1XJVA 2JA6H 5C0XI 3GTJH 1X3QA 2TMPA 1WTQA 5IGFA 4BY7H 3K58A 3PIP3 1U5KA 1LABA 3RZDB 5FO9B 1EWHA 4DPGA 1IKMA 1H95A 3STBC 1B8AA 3PO3G 4APVA 1TR5A 4ZUJA 5J1ZA 3GV6A 3AU7A 1Y1WH 4DK1A 1VMCA 4NB3A 4L5RC 4G4KA 2RCFA 2PZUA 4KN4C 3SXHA 5F2DA 4GS3A 1ESFA 1OXSC 1HFNA 1N8RC 3BVZA 2JN4A 2A69D 4OXPA 1F2LA 1PZID 4KY6A 3A74A 3N6RA 2ENBA 2VUMG 1YJNA 1V43A 1AN8A 1XXGA 2KHIA 3I4OA 3SK8A 1UUPA 1EY7A 3NK9A 2SDFA 3T1YQ 5JEAG 2LXKA 2RBMA 2RSNA 3AFPA 3KLRA 4Y7NH 5KYLA 1LACA 1YNXA 4LF4Q 2V4DA 3DEOA 4CDFC 1PRTC 2KOLA 2EY5A 2K14A 3PIOA 2VS1A 5FJ8G 3KYHC 2F0OA 5KGUA 5IYCH 1D6EC 4TVAB 4FNFA 2AWNA 2UXCL 1DOMA 1QZGA 2AWOA 2N88A 4JVZA 1BBXC 3BVMA 4G7ZC 1AE3A 1BCPF 3RNUA 5ELEA 5IE8A 1MHWC 1PYSB 1ZYRC 1VQJA 3GD7A 3ER0A 2OEOA 3DM1A 1KDBA 3ULLA 4JBMA 4XXEA 3L9AX 4FF1A 1JT8A 4O0AA 3TS0A 4DR1Q 3RR5A 1LV9A 1YNJD 3J7AF 2MNAA 3PIPA 3HOWB 3MTSA 1DCZA 4QCLA 4XDXA 1S40A 4DV3L 4DV4Q 4DR2L 1LTBD 4JCVE 5FLMH 2OWOA 4GN3B 2ICEC 4HSPA 2Z9HA 1NJIC 4R4TA 4DV6Q 5C4JB 1F2MA 3PF5A 2FXQA 4DF7A 1S5DD 5EBCA 2WP8J 5E4WC 4UP7A 3UDXA 3CC7A 2R7FA 4P72A 3F2DA 1N36Q 5C4XH 4DXFA 1SDFA 3I3CA 4N8FA 1S72A 1RDPD 1QZHA 1VQ5A 3I7FA 4CJ0B 1BKBA 3G6EA 3KF8A 3FRPB 3CQZH 4ID6A 4ZKCB 2WIIB 5I4DA 1NMGA 1L2FA 3F1ZA 4E6IA 2F0UA 2R93H 4A93G 1JJCB 1E2WA 2LY7A 2ZXRA 3JC66 2A5HA 1IL2A 2HT1A 2SNMA 2NVXH 4KKTA 2F4VQ 1X3GA 4DV1L 1Y8NB 2EE1A 2WAQB 2L4NA 1TWCH 4C3IB 2K1BA 1KTKA 4YCUA 1JR0D 3SR1A 4UY8C 2TSSA 1TWHH 1G8ZD 1SAPA 1RTOA 1HNXQ 5KRUA 1B70B 1U4PA 1X6OA 2IX1A 2NUCA 1QB5D 2QEJC 3CCVA 4MNOA 2EYMA 1CQVA 3RUZA 5CORA 2O5JC 4JI1L 1EYCA 4Q5VA 3EVQA 1GVPA 2A6HD 4K8JA 1CT1D 2RHQB 4B3SL 2BCOA 3J80i 4ALPA 4ZRZA 3RMHA 3HOXH 4GLXA 3AFQA 4NKLA 2E2IB 4IOCA 1LT6D 1JWSD 1SLJA 5IWAQ 2QF7A 2MGSA 5HGQA 2A6EC 2EJGC 5E4XA 3K5MA 3KLSX 1L0YB 4A93B 2Q8RE 2R7DA 1CSPA 1S5ED 1GUSA 5LMUQ 3URYA 5E7NA 3TZUA 1WJJA 2ALYB 1TWGB 1C4QA 2IW3A 2K33A 3HOZH 2QKIC 2DY7A 4CJ1B 1PRTB 2B8GA 1TY2A 4DV3Q 4DV4L 2JEAI 3L0OA 1JC7A 5DNFA 1ICWA 4BA1I 4KTAA 3KOJA 1XPRA 3S1NB 1PLFA 3S24A 1KRTA 1KQSA 4AH6A 2A68C 4ILWA 1FJGQ 3HOVB 4DN4M 1SNMA 3QWNA 4IPHA 1KNEA 4RHSA 2H1EA 3OSOA 3I8ZA 5IYDG 4DV0L 3J7YW 3QOJA 4BBRG 2HQLA 1MBYA 2OCEA 3PO2H 2F0NA 2F3WA 1BDOA 1IBML 4H13C 3S15B 5JPMC 2A68D 1EFWA 2JA8B 4DV5L 1WTVA 4A3DB 4BBSG 2VW9A 1YBYA 2RF4A 3I4NH 4FXDA 5BR8Q 3I2ZA 1WTHA 1H9MA 2EY2A 3KBXA 2XRQD 4JI7L 4KN7C 1FVIA 3LX0A 1SMXA 4O2DA 5C4XG 2VXWA 4AYBE 1A3UA 1O78A 5M3FG 5C0XH 3VA7A 1L1OA 1OTCA 1AH9A 3Q23A 1C48A 3VDYA 3CPFA 4A3JH 1M8AA 2KVMA 1B3AA 4HAEA 3K80C 5CGKA 5JJKA 5GADC 4C3HB 1BR9A 1WTXA 4KD4A 1ONLA 2Y0SB 3IRBA 3TMEA 4OO1I 5H1SE 2E76C 3NWTA 1LYLA 3WOEA 4JI6Q 2OT2A 4BXXG 3K5LA 3P20A 4LF8Q 3H3VH 4YWKA 3AQQA 2NZOA 3HOZB 3BDCA 5EQ0A 3FKIG 3SK5A 3M7NA 1KLUD 2DJFC 1Y1VB 5NUCA 2F0PA 3S2HH 1HA6A 3RLFA 2V1CC 2K5HA 2L0CA 1CKNA 1BBWA 2FINB 3HOUH 1HNWQ 1D1IA 2X6GA 2F0HA 1YZ6A 2KCMA 1PXUA 1I94L 1WTPA 2UUAL 2VQFL 1GUWA 2CWAA 5C44H 1YITA 3HEJA 2JA8H 4JYAL 4BY1G 2JE6I 1HRJA 4A3CG 2OQ0A 4A3IH 4JI3L 2KENA 2O4XA 3H91A 3ZYYX 3FHWA 4DK3C 1GHKA 3I4NG 1BCPD 3KK7A 3VYTA 1WD0A 1N32L 2G5DA 4A3EB 4AQYQ 4BBSH 4LF5Q 3BG3A 1KDCA 4KY5A 4HJ9A 1KRSA 3F2UA 5IP9H 3Q0AA 2A74C 1WTOA 2MFIA 1VS0A 2B2WC 4G7OC 1A3TA 4R8IA 2WFWA 5E1FA 1PH5A 4V0BA 2PPBC 1EYGA 1I6HB 2F0TA 3P75A 2R3ZA 1K0SA 1VQPA 5C4HA 2UUCL 3OWFA 1Z47A 3BYYB 2K5WA 3BYTB 3TDQA 2RVLA 3TP6A 3PO3H 3VYSA 2CQOA 2J4XA 2NBFA 4A3JG 4C56C 5FLXL 2WAQE 1BNZA 4K5WA 3PUWA 4WRDA 3S1NH 1LTAD 2JQOA 1B1ZA 1TKWB 5CV6A 3CHBD 2F0FA 1SNCA 2RSOA 4QIWB 4EVOA 2KA7A 2XSCA 5C3WA 1I94Q 1EIYB 3T51B 1CQFA 2E2HB 1RCVD 3FKIB 1CK1A 1VCIA 4L5QA 1MI2A 2L1BA 4FXGC 4K2KA 1HA5A 2L11A 2UXBL 3HRZC 3QG1A 1YI2A 4C3JH 1AZPA 5KNCA 3H3VI 3U9OA 2HHHQ 4HJ5A 3U4ZA 3KF6B 3M4OH 4ABNA 1JB3A 4R1JA 1TU2B 3HKZE 4LFCL 1Q1EA 4GNXB 3ITPA 5T1GA 5EPLA 1TT2A 3PSIA 3CCMA 4PG3A 4C3JB 1TWFH 4KY7A 1WVLA 2NYZD 2MUYA 1STGA 4YHHQ 3E9HA 1HR0L 4RAUC 4FF2A 5ELOA 2WKCA 4DUZQ 1E2VA 3I56A 5C44B 4X64Q 5IYCG 3LWUA 1ASYA 2NZ1D 4MTNA 1KHIA 1EU4A 1SJED 2JXMB 1WTWA 4QB4A 1I3QH 4DNRB 1S3OA 2KBNA 2QDLA 1V1OA 1EEID 3H0GB 2E8GA 2R92H 4X65L 2LKVA 2VB3X 5D14A 3H09A 1CA6A 2E2HH 2XTIA 1VQCA 4A3MB 2KCNA 2L55A 3R8BA 4R9WA 1BCPB 2F3VA 2AQ2B 3HGBA 5KIXA 4N9PA 1D2BA 2WINB 2SEBD 3FEWX 4DAPA 4RCOA 1V9PA 5CMDA 3T56B 3M3YB 1LTTD 4GLVB 1V1PB 1CKOA 1D1KA 3EBEA 4QL5A 4RGNA 1RL2A 4A3EG 4U673 4R8NA 3H0GH 5IP9G 3QB3A 1C7YA 1SMYD 3NP8A 3TP7A 2OXPA 3HKZG 4IUNA 1K8MA 2MO0A 2EVBA 1KAAA 1JJ2A 4YY3Q 1FNUA 4DUZL 3KDFA 4DR5L 4BS9A 5CV7A 1KLGD 4KKSA 2UXCQ 5EPKA 1JWMD 2NTSA 1GUOA 4AYBB 4RHRA 3D3RA 4KKUA 4JI7Q 4XYOA 5DM63 1H9KA 4GZYC 4OHJA 3MXPA 2F0DA 3HOUB 2D62A 3GTJB 1XTDA 3I90A 2JA6B 5CBAE 4XQQA 2CVRA 5KNDA 3E0EA 4NW2A 1I4GA 3RZDH 3HOVG 1JOKA 2A1AA 3E6ZX 1Q12A 2Z6BA 1H9JA 5JOBA 3GTKH 1QUQB 2NZHA 2Q2IA 5KNBA 3NHHA 4X66L 1BQQT 1OXVA 4K5VA 5M3MH 2EYLA 1S4ZA 2D5DA 1A3VA 1RIPA 2HIXA 5G3LF 1FL0A 1KC8C 4YHHL 5G3LD 1N34Q 1ENCA 2IX0A 3MEHA 1SROA 3L3OC 3CCUA 2PNRC 3GP7A 2K05A 4Q0FA 4EQOA 3X3MA 5M5YH 4DUYL 4A3IG 3TP5A 3DLLA 3VYUA 4J6HA 1EQRA 3K57A 2Z8LA 3HG9A 1EQVA 4DR4L 1Y69U 5EGTA 2A6HC 4A93H 4CGYB 1VQ7A 4QJFA 4MZ9A 3C2PA 3OTOQ 1R4PB 1VQ4A 4LAAA 5AFWA 2QGQA 2AQ3B 2EY6A 1B4OA 3K8AA 2JA5H 1JMCA 4A3GH 3TRZA 3G7LA 2YTXA 1X55A 2VZAA 3FVQA 4PNYA 2O2LD 1PH2A 1SJHD 1H9RA 1EY8A 3V96A 2PMZE 4DR7L 4OIKA 1M90C 1A63A 2K6AA 2BA0A 3GTOH 1N33Q 1O7IA 3ND9A 4LUOA 5CV4A 2EYOA 4LFBL 2GA4B 3JAME 4DV2Q 4KLKA 1FR3A 1BOSA 3S15H 1PH8A 1PYWD 1S5BD 2PMZB 2YTYA 1FGUA 1VQEA 2IY5B 4A3IB 1QVFA 4GNXC 5EBDA 3DMUA 1CUKA 4GN5A 4L6TB 4DV1Q 3X3NA 3NBHA 1ZKOA 3MFGA 1J8IA 3T53B 1NR2A 2LS01 1AZQA 3NEMA 1PVOA 1STYA 1LT4D 4K6DA 5M3MG 4IUTA 4RGMA 2O5IC 1CZWA 4DR3L 5J22A 4AQYL 2VUMH 2WB1B 1JOQA 4GNXA 4B9XA 2B63B 1HZCA 2RQXA 4A3JB 1PTOC 4LFAQ 3J81L 3PGZA 4JG2A 1ZXTA 1H9SA 2F0EA 4JV5Q 3T4AC 4JI0Q 4B3ML 3R2TA 4CDCC 4CHTB 1VQOA 2IPKD 3MAQA 2F0LA 4C3HH 1GM5A 1XPUA 3AEVA 3SK6A 3HOYG 3U4VA 2K28A 4NPSA 5CC4A 1IW7C 4DR3Q 3ERSX 3PUYA 1EOTA 1PTOF 3NE5B 3H15A 5IGEA 2XWBB 3S14H 2GVBA 3IFTA 1PRTD 5FJ8H 5IGGA 3GTQH 1CM9A 1PTOD 2B63H 2QA4A 3HOWH 1RKNA 2E2DC 4IUPA 1SEBD 4GOPC 2PZTA 3DWPA 2PQAB 5I6WA 5ELNA 1EY0A 2Z1CA 4O42A 4JBKA 3CMAA 2K01A 2OTJA 5D3IB 1TWCB 2BOSA 4EX5A 2UXDL 1D8LA 2I5MX 1SR3A 4J1MA 4KD3A 2JA5B 2L15A 2UU9Q 2K5VA 3OW2A 3TREA 3OIQA 3NTHA 4KHPL 3MEFA 1G2SA 1YHQA 3AMUA 2K50A 1N9WA 2F0GA 4DAVA 4KHVA 4DK6C 4OELB 1CFMA 1EWCA 1FGBD 2KEEA 5EKKA 3GTPH 1DYQA 4NP5A 4GOPB 3WDNA 4JV5L 4BA2I 2EY1A 1QNKA 4U68A 4HJ8A 3UDIA 2Z6KC 3GV3A 3MVVA 1W2BA 1TS5A 4IQZA 1C0AA 1PFBA 5D3DA 1V1QA 4EQ5A 4J8QA 1K3RA 3EQLC 5C44G 4JI0L 1DOKA 2Y0SG 1PZJD 4G57A 4GKJL 3KFUA 1K9MC 2EDGA 1IBKQ 1N36L 2ZT9C 4DR2Q 3RN5A 1NR4A 4IUUA 3GQBA 5JPNC 1UWVA 2AQ1B 4MIUA 2HD3A 2X69A
chains in the Genus database with same CATH topology
5ELDA 2EZVA 1BUVT 3IL8A 1EIGA 3MXUA 4ZK9B 4X3SA 3P7JA 3A8IE 3H6MA 2E74C 5M9OA 3PO2B 3OOCA 1Z7TA 4MN3A 3M4OB 5A2QE 3R2IA 3K7AB 5DAUA 3S1QB 1WCMB 3IKJA 3OMCA 1WTRA 3EJIA 5TSSA 3NBIA 5ISRA 2KJXA 4LK1C 1X32A 2A73B 3MZ5A 4I65A 4IFDI 2L12A 4WJWA 1LO5D 1SYFA 2IX3A 3PO3B 1RTNA 2HDLA 1NCVA 1U4MA 3TSSA 2EXZA 3C1FA 1STBA 2C5CA 3OPOA 1PFMA 5ELCA 5K36H 4EGVA 1HFGA 1VMPA 2ID0A 1EU3A 2L5TA 5I9OA 2R6GA 1LTID 2K04A 2DN8A 1A2TA 4HMJA 2E2JB 2DNEA 1QNUA 1O7YA 4F7XA 4FF3A 4DNTB 1NUCA 5EPJA 4EQPA 3VYRA 1DONA 4ULLA 2MPMA 3NQTA 2NVXB 3BDLA 2PQEA 1G91A 4QUCA 1SYDA 4JBWA 1RHPA 1G2TA 5I6YA 2WV6D 2PW5A 1STHA 3R3OA 2BDNA 5ELBA 4F88A 1JICA 1LLRD 2VB2X 4CBVA 5JEAH 2DNCA 3H94A 3A8KE 2IL8A 3TN2A 1ET9A 1G291 1L0XB 5E3FA 2EJFC 4A3KB 5D65A 2PW7A 2XVSA 1SXTA 3HOYB 1I50B 1DM0B 3TP8A 1UAPA 4I7ZC 1Q90A 4O1NA 5IODA 1OXUA 3S2HB 3OMGA 3CRKC 4K14A 3G6JB 1GXDC 4OGQC 1PRTF 2JP1A 2K5DA 3A8JE 3ERQA 3PIO3 1F9SA 4DU9A 3J81E 3TZDA 4NDXA 4RWSC 5IT9L 5M3FB 3D31A 1A2UA 3HKZB 4UAIA 3DHQA 2XRSD 4TRDA 2M9VA 5K36G 1OO9B 2RDFA 3ND8A 3I72A 1O80A 2FHTA 2CW0C 3S9WA 5CR3A 3QO2A 2F0SA 3Q6SA 1ZYRD 1IYUA 2VUMB 3HP3A 3E0JA 1ENFA 3R93A 4XIGS 1GUGA 4HMIA 3A55A 1EYAA 4DAYA 1YNJC 1D5ZC 2HDMA 4N9TA 2KCCA 2KECA 1AEXA 3U9SA 4H0LC 3HOXB 4A3BB 3OWEB 4XTCS 1XX8A 3D6CA 4C1NK 1F2ZA 2B2VC 2F0JA 1K8OA 3I4NB 2FJ2A 2CQAA 4PV1C 1I6VC 4P2CB 1CI3M 1TY0A 3MC0B 2OF1A 2M00A 3M7GA 2H4OA 1A6XA 4RFBA 2X6LA 1PTOB 4A3GB 4KMUC 1HXYD 2RA4A 2N55A 1RJTA 4KJNA 2K32A 2D9UA 2B2VA 1MSGA 3CQZB 4FP5D 5ELFA 2EJMA 1LTGD 1EY4A 4L63B 3Q24A 1EL0A 2SNSA 1NAPA 5FK9C 1SE3A 5M5YB 3V2TA 3GTMB 1FD7D 4CJ2C 1FNVA 1YNNC 3PV0A 3MA2B 3DUZA 3MXGA 1UEAB 4K2LA 4S3SA 5C4ZA 2VNUD 3W2DA 3V05A 3VR6A 4HEDA 5FKAC 2MJ8A 1IL8A 2JSOA 3FPPA 1IYVA 1W6KA 1Z6HA 4X3UA 4HN7A 1M4VA 1O7ZA 5C4XB 2PCFB 1DJRD 3GTOB 1SYEA 4C2MB 2EOTA 2EYJA 2IT1A 1U9RA 1EZ6A 2F0KA 1B9NA 2NWGA 3D4RA 1II3A 4C3HG 5C0XJ 1Q8IA 3GTGB 4OIJA 2XN9C 1SE4A 3L7ZC 3S17B 3S1MB 3MFYA 4Y7NB 1TS2A 3C3LA 4WFN3 5CV5A 3K59A 3QIAA 5CV9A 3FMCA 4FXKC 1AW7A 2K7VA 1JOOA 2KHSA 2QCPX 1V8QA 1QWYA 4F87A 1JQYD 3A7AB 1XTCD 4RKLA 4CKEA 1Y1WB 1ILPA 3P1HA 2RDHA 4IN3A 5C3XA 4X3KA 3I91A 1O7LA 1EIHA 3K0YA 4XT1B 2C9OA 3HZXA 5I2YA 2BDOA 3FPUB 4DXGA 1KNAA 1CHQD 1EZ8A 2B8FA 4ODGA 4C3JG 5KYIA 2KQ3A 4H44C 3PUVA 2PZWA 1EY5A 3A7LA 2I46A 2YU9B 2J7ZA 2NVYB 3VR5A 3VR4A 3RD4A 2YYZA 1U4RA 4L8JA 4FF4A 1BCPC 3DXJC 1TS4A 1SNPA 5J39A 4ZKBB 2NVQB 4M8AA 4PMWA 3GTLB 2AUKA 3VR2A 5LHY1 1SE2A 4K8IA 2B2TA 1IHZA 3VA5A 3C46A 1I4PA 2EPBA 2NN6G 5KEEA 1DZ1A 3D8GA 1HTPA 1HQMC 1PFNA 3NUCA 1AFPA 2J0TD 1RODA 3H3VC 1SNQA 1VDZA 1UNSA 3QOLA 2B2TC 3S16B 4TKOB 4RGOS 1C8CA 3GTQB 4ME5A 1ILQA 2XIWA 3MWYW 5JAVA 4DGZA 3PUXA 1MGSA 4XT3B 4C3IG 5BN4A 5T1IA 1ENAA 1OXXK 2AUJD 1FYCA 3NTIA 4BY1B 2Q8TA 4M1UB 3JAML 1EY6A 1FNWA 3OW7A 4A3FB 3S2DB 3UI2A 3MHBA 3NXWA 2LMCB 1LT5D 2PO4A 3DWQA 5IGDA 1YNND 4BY7B 3O13A 3WOFA 1KDAA 1OXTA 1ZEQX 3RZOB 2MHVA 4RGTA 5JVG3 1DOLA 1PTOH 3KBGA 1Y8PB 4H7BA 1WD1A 2ZXOA 2F0VA 3DWAA 3SHLA 5LL6S 1PZKD 4IFDG 3QJYA 1T5XD 3SVMA 1QILA 5M5XB 4EQNA 1LTRD 1F77A 4G7HC 4HSVA 4HTHA 2HUGA 3HS0C 4UDUC 5DEHA 4DA2A 4OL7A 4FVMA 3GTPB 1JORA 2NTTA 1IW7D 3AB9A 3D4DA 1SMYC 3D6WA 2FMMA 5CBEE 4QF4A 2B2UC 4BBRB 3M85A 4HCSA 2HCIA 2NVTB 1U4LA 3CU7A 1TWAB 3LNNA 3SEBA 5C5LA 3SDZA 1HUNA 3N52A 1K83B 1VF5C 4YIJA 3ONAB 5CV8A 3SE0A 2WKDA 1QJOA 5DM73 3I73A 1XYIA 1QE6A 2JYOA 5IGCA 4B08A 4LMQD 3GTKB 5C0XG 1QCBD 1HCZA 2F1MA 3NWSA 1GHJA 1G6ZA 3NQIA 1F9RA 1HHVA 1GOZA 3M4YA 3BDOA 2WACA 2F4IA 1EY9A 1SBBB 3CKIB 2IWHA 4XYQA 4HR7B 4ZLTF 2K5QA 1F9QA 2B2WA 2K03A 1EEFD 1ESRA 5I9PA 4ZAIA 5CYUA 2DY8A 2G9DA 2F0WA 5M3MB 3BS1A 4TQUS 2B2YC 5IOCA 2B2YA 3FDTA 5EKIA 1EYDA 2HQEA 4HCEA 2R93B 3I4LA 5C3EB 4C1NI 1TWFB 2BE5C 2CW0D 2Z4IA 1B2TA 1Q3LA 1CTMA 2G9HD 2CHBD 4IALA 2QILA 2F0IA 2KUMA 1GUTA 4V190 2ZXPA 2LFNA 1TQOA 1E0BA 2PYKA 5LL6X 1TIID 2JEBI 5IT9E 1GUNA 4ZUIA 1GJXA 1PMRA 5M5WB 2Q8IB 3OHXC 2EYHA 1A15A 4IURA 4WORA 3LWEA 2D2CC 1Q1BA 4NMZA 4TSSA 4KV6A 3D4WA 3C1EA 3J80L 1F2YA 5COYA 3K5OA 4RA8A 4XQNA 5C5MA 1I3QB 5K5PA 1RF2D 3MXNA 1SYGA 3NTKA 1W6JA 2L9HA 1D5XC 1AP0A 5IGBA 3GO5A 2JA7B 3EROA 1DD2A 4QMGA 3J7AV 2I07B 1SYBA 5IIFA 1T5EA 1SSOA 3TBIB 5C6AA 5EKLA 4IFDJ 4X3TA 4K5XA 1H9SB 1I4XA 5I2XA 1SFOB 1B53A 1LTSD 2IJ0A 3J80E 2A69C 4OO1H 1BF4A 2R92B 3K5NA 1SNOA 3I4MB 4QUFA 1STAA 2ICIA 2Z4HA 1R4QB 4MHEA 1EFID 2A6ED 1I4HA 2F0MA 4KK7A 1S5FD 2FFKB 3CRLC 2KEDA 2RDGA 4RCNA 1E2ZA 4PQXA 4KHZA 5FO7B 4BBSB 3W3AA 5A35A 2B39A 3BZDB 3IAYA 4K6LA 1CZGA 2QDBA 5HGTA 1MD2D 2MP1A 2FMCA 1JE4A 1TS3A 2EYPA 3PMFA 4XQJA 4JK1C 1B9MA 4CKBA 1HPCA 3T13A 4RH6A 1JWUD 4F8MA 5HURA 2HCCA 1I4RA 1VF7A 4IZ8A 3K6OA 3SK4A 3A54A 1RD9D 1EQTA 2NN6H 1B50A 2BE5D 4BWGB 3VR3A 2R61A 1S5CD 1NSNS 3NPPA 2F0QA 4CKCA 1QG7A 1X3PA 3KLSA 2B2UA 4DK0A 1CA5A 1JCKB 3EFXD 4KJOA 1PDQA 1QOHA 4PMCA 1HQRD 4RKBA 3I70A 4LJZC 2XNAC 4DFAA 1I4QA 1MSHA 3Q22A 3E5SA 4IFDH 3PUZA 4KI0A 1XWEA 1Y8OB 1HUMA 3A56A 1CHPD 5FO8B 1DXMA 4IUQA 2SOBA 1BXTA 4OO1G 5JVH3 1HTLD 1D5MC 2F03A 3IFDA 2R7ZB 5JJZA 4FYDA 3BVGA 5FOBB 2XWJB 2RKSA 3NSWA 1ML0D 1LT3D 4IUVA 3S14B 4FO2A 3DEPA 3OIPA 5BN3A 2NB0A 5JEAJ 1STNA 3KUPA 5FLXE 3EA6A 5BN5A 1B44D 1SYCA 1IKLA 1J9OA 1F9PA 4PMBA 4Z9CB 3S1RB 2EYFA 2NN6I 2BA1A 1ET6A 1BO0A 3T16A 1SNDA 1V1PA 1STEA 1TWHB 2M2LA 2E75C 4B9WA 5EJWA 1R9TB 1TVXA 4ZYSA 1KABA 4ZQ3A 5A2QL 5C0XI 1X3QA 2TMPA 1WTQA 5IGFA 3K58A 3PIP3 1LABA 3RZDB 5FO9B 1EWHA 1IKMA 1TR5A 4ZUJA 5J1ZA 3GV6A 3AU7A 4DK1A 1VMCA 4G4KA 3SXHA 2PZUA 4KN4C 5F2DA 1ESFA 1OXSC 1HFNA 3BVZA 2A69D 1F2LA 1PZID 4KY6A 3N6RA 2ENBA 1V43A 1AN8A 1XXGA 3SK8A 1UUPA 1EY7A 3NK9A 2SDFA 5JEAG 2RBMA 2RSNA 3KLRA 5KYLA 1LACA 2V4DA 3DEOA 1PRTC 2KOLA 2EY5A 2F0OA 5KGUA 1D6EC 4FNFA 2AWNA 1DOMA 2AWOA 2N88A 1BBXC 3BVMA 4G7ZC 1BCPF 5ELEA 1ZYRC 3GD7A 2OEOA 3DM1A 1KDBA 4XXEA 3L9AX 4FF1A 1LV9A 1YNJD 3J7AF 3HOWB 3MTSA 1DCZA 4QCLA 4XDXA 1LTBD 2ICEC 4HSPA 5C4JB 1F2MA 4DF7A 1S5DD 5EBCA 2WP8J 5E4WC 4DXFA 1SDFA 3I3CA 1RDPD 4CJ0B 3KF8A 3FRPB 4ID6A 4ZKCB 2WIIB 5I4DA 4E6IA 2F0UA 1E2WA 2LY7A 2ZXRA 2A5HA 2SNMA 4KKTA 1Y8NB 2EE1A 2WAQB 2L4NA 4C3IB 2K1BA 1KTKA 1JR0D 3SR1A 2TSSA 1SAPA 1G8ZD 1RTOA 5KRUA 1U4PA 2IX1A 2NUCA 1QB5D 2QEJC 2EYMA 1CQVA 3RUZA 5CORA 2O5JC 1EYCA 4Q5VA 3EVQA 2A6HD 4K8JA 1CT1D 2BCOA 4ZRZA 3RMHA 4NKLA 2E2IB 1LT6D 1JWSD 2QF7A 2MGSA 2A6EC 2EJGC 5E4XA 3K5MA 3KLSX 1L0YB 4A93B 2Q8RE 1S5ED 1GUSA 3URYA 3TZUA 1TWGB 1C4QA 2IW3A 2K33A 2QKIC 2DY7A 4CJ1B 1PRTB 2B8GA 1TY2A 2JEAI 1JC7A 5DNFA 1ICWA 4BA1I 4KTAA 3S1NB 1PLFA 2A68C 4ILWA 3HOVB 4DN4M 1SNMA 3QWNA 1KNEA 4RHSA 2H1EA 3OSOA 3I8ZA 3J7YW 3QOJA 1MBYA 2F0NA 2F3WA 1BDOA 4H13C 3S15B 5JPMC 2A68D 2JA8B 1WTVA 4A3DB 4FXDA 1H9MA 2EY2A 3KBXA 2XRQD 4KN7C 3LX0A 2VXWA 1A3UA 1O78A 5C0XH 3VA7A 3Q23A 1C48A 1M8AA 2KVMA 1B3AA 4HAEA 5CGKA 4C3HB 1BR9A 1WTXA 4KD4A 1ONLA 2Y0SB 3TMEA 4OO1I 2E76C 3NWTA 3WOEA 2OT2A 3K5LA 3P20A 3HOZB 3BDCA 5EQ0A 3SK5A 3M7NA 1KLUD 5NUCA 1Y1VB 1HA6A 2F0PA 3RLFA 2L0CA 2FINB 1D1IA 2X6GA 2F0HA 1PXUA 1WTPA 1GUWA 3HEJA 2JE6I 1HRJA 2O4XA 3H91A 3ZYYX 1GHKA 1BCPD 3KK7A 3VYTA 1WD0A 4A3EB 3BG3A 1KDCA 4KY5A 3F2UA 3Q0AA 2A74C 1WTOA 2B2WC 4G7OC 1A3TA 4R8IA 5E1FA 4V0BA 2PPBC 1I6HB 2F0TA 3P75A 2R3ZA 5C4HA 3OWFA 1Z47A 3BYYB 2K5WA 3BYTB 3TDQA 2RVLA 3TP6A 3VYSA 2J4XA 2NBFA 5FLXL 4C56C 1BNZA 4K5WA 3PUWA 4WRDA 1LTAD 1B1ZA 1TKWB 5CV6A 2F0FA 3CHBD 1SNCA 2RSOA 4QIWB 4EVOA 2KA7A 2XSCA 5C3WA 3T51B 1CQFA 2E2HB 1RCVD 3FKIB 1CK1A 1VCIA 1MI2A 2L1BA 4FXGC 1HA5A 4K2KA 2L11A 3HRZC 3QG1A 1AZPA 5KNCA 3U9OA 4ABNA 1JB3A 1TU2B 1Q1EA 3ITPA 5T1GA 5EPLA 1TT2A 4C3JB 4KY7A 1WVLA 2NYZD 2MUYA 1STGA 4RAUC 4FF2A 2WKCA 1E2VA 5C44B 3LWUA 2NZ1D 1EU4A 1SJED 2JXMB 1WTWA 4QB4A 4DNRB 1V1OA 1EEID 3H0GB 2LKVA 2VB3X 5D14A 3H09A 1CA6A 4A3MB 2KCNA 2L55A 3R8BA 4R9WA 1BCPB 2F3VA 2AQ2B 3HGBA 5KIXA 4N9PA 1D2BA 2WINB 2SEBD 3FEWX 4DAPA 4RCOA 5CMDA 3T56B 3M3YB 1LTTD 1V1PB 1D1KA 4RGNA 4U673 4R8NA 3QB3A 1SMYD 3NP8A 3TP7A 2OXPA 4IUNA 1K8MA 2EVBA 1KAAA 1FNUA 4BS9A 5CV7A 1KLGD 4KKSA 5EPKA 1JWMD 2NTSA 1GUOA 4AYBB 4RHRA 3D3RA 4KKUA 4XYOA 5DM63 1H9KA 4GZYC 4OHJA 3MXPA 2F0DA 3HOUB 2D62A 3GTJB 3I90A 2JA6B 5CBAE 4XQQA 2CVRA 5KNDA 4NW2A 1I4GA 1JOKA 3E6ZX 5JOBA 1Q12A 1H9JA 5KNBA 3NHHA 1BQQT 1OXVA 4K5VA 2EYLA 1S4ZA 2D5DA 1A3VA 5G3LF 5G3LD 1ENCA 2IX0A 3MEHA 3L3OC 2PNRC 3GP7A 2K05A 4Q0FA 4EQOA 3X3MA 3TP5A 3VYUA 4J6HA 3K57A 2Z8LA 3HG9A 1EQVA 1Y69U 5EGTA 2A6HC 4CGYB 3C2PA 1R4PB 4LAAA 5AFWA 2AQ3B 2EY6A 1B4OA 3G7LA 3FVQA 4PNYA 2O2LD 1SJHD 1H9RA 1EY8A 3V96A 4OIKA 2K6AA 2BA0A 3ND9A 5CV4A 2EYOA 2GA4B 3JAME 1FR3A 1BOSA 1PYWD 1S5BD 2PMZB 4A3IB 5EBDA 3DMUA 4L6TB 3X3NA 3NBHA 1ZKOA 3MFGA 1J8IA 3T53B 1NR2A 2LS01 1AZQA 1STYA 1LT4D 4K6DA 4IUTA 4RGMA 2O5IC 1CZWA 5J22A 2WB1B 1JOQA 4B9XA 2B63B 2RQXA 4A3JB 1PTOC 3J81L 1ZXTA 1H9SA 2F0EA 3T4AC 3R2TA 4CHTB 2IPKD 3MAQA 2F0LA 3SK6A 2K28A 5CC4A 1IW7C 1EOTA 3PUYA 1PTOF 3NE5B 5IGEA 2XWBB 3IFTA 1PRTD 5IGGA 1CM9A 1PTOD 1RKNA 2E2DC 4IUPA 1SEBD 2PZTA 3DWPA 5I6WA 1EY0A 2Z1CA 4O42A 2K01A 5D3IB 1TWCB 2BOSA 2JA5B 4J1MA 4KD3A 3OIQA 3NTHA 1G2SA 3AMUA 2F0GA 4DAVA 4KHVA 1CFMA 1EWCA 1FGBD 2KEEA 5EKKA 1DYQA 4NP5A 3WDNA 4BA2I 2EY1A 1QNKA 4U68A 3GV3A 3MVVA 1TS5A 4IQZA 1PFBA 5D3DA 4J8QA 3EQLC 1DOKA 1PZJD 4G57A 2EDGA 2ZT9C 1NR4A 4IUUA 3GQBA 5JPNC 2AQ1B 4MIUA 2X69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VYU A;  3D3R A;  2OT2 A;  3VYR A;  3VYT A;  2Z1C A;  3VYS A; 
#chains in the Genus database with same CATH topology
 3M3Y H;  3CPW A;  4OON A;  5ELD A;  4JBJ A;  2EZV A;  3A5U A;  1BUV T;  3IL8 A;  1EIG A;  1YEZ A;  3MXU A;  4ZK9 B;  4X3S A;  3P7J A;  1YVC A;  3A8I E;  5IP7 H;  4UP8 A;  4IJL A;  3H6M A;  4DR1 L;  2E74 C;  5M9O A;  3PO2 B;  1JB7 A;  3OOC A;  4A3C H;  1EIF A;  3CP0 A;  1Z7T A;  4MN3 A;  2P5Z X;  3M4O B;  3HOZ G;  5A2Q E;  2OQK A;  1M1K C;  4YCW A;  3W1G A;  3R2I A;  1PH4 A;  3K7A B;  4ME3 A;  2MO1 A;  5DAU A;  3S1Q B;  1WCM B;  3IKJ A;  3OMC A;  1WTR A;  3KDF B;  2CCZ A;  1DGS A;  3EJI A;  4LF7 L;  5TSS A;  3NBI A;  1VQ6 A;  5ISR A;  2HIV A;  2KJX A;  2VY3 A;  4LK1 C;  1X32 A;  2A73 B;  3MZ5 A;  4I65 A;  4IFD I;  2L12 A;  4WJW A;  1LO5 D;  1SYF A;  2IX3 A;  5C3E H;  2GVA A;  3PO3 B;  1Q86 C;  1RTN A;  1E1T A;  1XMQ L;  2HDL A;  3U50 C;  1QVG A;  1NCV A;  1U4M A;  3TSS A;  2EXZ A;  3CCQ A;  3C1F A;  1STB A;  4NXN Q;  2C5C A;  3OPO A;  1PFM A;  5ELC A;  5K36 H;  5JJL A;  4EGV A;  1HFG A;  1G51 A;  1NY4 A;  1HR0 W;  1VMP A;  2ID0 A;  1W3S A;  1EU3 A;  2L5T A;  5I9O A;  4L5S A;  3CCR A;  2R6G A;  1LTI D;  2K04 A;  4JI8 L;  1A8V A;  2DN8 A;  1A2T A;  2KHJ A;  4HMJ A;  2ZTE A;  4I7A A;  2E2J B;  2DNE A;  1QNU A;  1Y14 B;  4LUZ A;  1O7Y A;  4F7X A;  4FF3 A;  4DNT B;  1KIX A;  1NUC A;  5EPJ A;  4C3I H;  4R4I A;  4EQP A;  3VYR A;  1DON A;  2WB1 G;  3FKI H;  4ULL A;  1VQK A;  2MPM A;  3NQT A;  2NVX B;  4DAM A;  3BDL A;  4LF6 Q;  2PQE A;  3MXN B;  1G91 A;  4QUC A;  1SYD A;  4JBW A;  1RHP A;  1G2T A;  2UUB Q;  3DM3 A;  5I6Y A;  2WV6 D;  4R4O A;  2PW5 A;  1STH A;  3R3O A;  2BDN A;  5ELB A;  4F88 A;  5L37 A;  1JIC A;  1LLR D;  2VB2 X;  4CBV A;  5JEA H;  2DNC A;  4QIW E;  4HIO A;  1X54 A;  4B3T L;  2Q2H A;  3H94 A;  4PZ6 A;  3A8K E;  2IL8 A;  2PNH A;  3K7A H;  3TN2 A;  3T1H Q;  1ET9 A;  1G29 1;  1L0X B;  5E3F A;  2EJF C;  4A3K B;  5D65 A;  2PW7 A;  2XVS A;  1SXT A;  3HOY B;  4JPB W;  2VQF Q;  1I50 B;  1DM0 B;  3TP8 A;  1UAP A;  1EUJ A;  1WOC A;  4I7Z C;  1Q90 A;  4O1N A;  5IOD A;  1OXU A;  3S2H B;  2NVT H;  4RMF A;  2H5X A;  3OMG A;  3CRK C;  4K14 A;  3G6J B;  1K83 H;  1GXD C;  4YY3 L;  4OGQ C;  4LF9 Q;  1PRT F;  2JP1 A;  2K5D A;  3KJP A;  2PI2 A;  3A8J E;  3ERQ A;  2HHH L;  3CW2 C;  3PIO 3;  1F9S A;  4DU9 A;  3J81 E;  3HOV H;  1MKH A;  3TZD A;  4NDX A;  4RWS C;  1GKH A;  5IT9 L;  5M3F B;  3D31 A;  1A2U A;  1PH6 A;  4A3B G;  3HKZ B;  3CCS A;  4UAI A;  3DHQ A;  2OTL A;  2XRS D;  4TRD A;  2M9V A;  1X56 A;  5K36 G;  1OO9 B;  2RDF A;  3CC4 A;  3ND8 A;  1G6P A;  2D0P A;  1Y1V H;  3TEH B;  3I72 A;  3J7Z C;  1O80 A;  1I50 H;  2FHT A;  1SFO H;  2CW0 C;  4PZ7 A;  3S9W A;  5CR3 A;  3CC2 A;  3QO2 A;  1BVS A;  1UE1 A;  4DNI A;  4X65 Q;  3Q6S A;  2F0S A;  1ZYR D;  1IYU A;  1MJE A;  3AYH B;  1CKN B;  2VUM B;  3HP3 A;  3E0J A;  1ENF A;  3R93 A;  4HIM A;  4XIG S;  3UDF A;  1GUG A;  4HMI A;  4P74 A;  3A55 A;  1EYA A;  1LTL A;  1YNJ C;  4DAY A;  4A3K G;  3M4Q A;  1D5Z C;  2HDM A;  4N9T A;  2KCC A;  5FLX c;  2KEC A;  4LFC Q;  2EQS A;  1GO3 E;  2RHS B;  5M3F H;  1AEX A;  3U9S A;  4H0L C;  4DV5 Q;  4GOP A;  1TWG H;  3HOX B;  4A3B B;  3OWE B;  2VQE Q;  2ZJQ A;  3NEL A;  4XTC S;  1XX8 A;  3D6C A;  4P73 A;  1F2Z A;  4C1N K;  2B2V C;  2F0J A;  4CDE C;  1K8O A;  2ZM6 Q;  3I4N B;  2FJ2 A;  4HIK A;  2CQA A;  2C35 B;  1EQQ A;  4A3K H;  3D0F A;  4PV1 C;  1I6V C;  4P2C B;  1CI3 M;  4IOA A;  1TY0 A;  2R93 G;  3MC0 B;  5IY0 A;  2OF1 A;  2M00 A;  3M7G A;  3K0X A;  1XNR L;  2H4O A;  1A6X A;  1PA6 A;  5HY6 A;  1HJP A;  4RFB A;  2X6L A;  1PTO B;  4A3G B;  3CAM A;  4KMU C;  1HXY D;  4POF A;  2Y0S E;  2RA4 A;  2NVQ H;  5M5X H;  3FP9 A;  3RZO H;  2N55 A;  4DV7 Q;  2IHF A;  1RJT A;  1VQ9 A;  4KJN A;  2K32 A;  1VQD A;  2D9U A;  2B2V A;  4R4C A;  4JI5 Q;  2IHE A;  1MSG A;  1Q7Y C;  3CQZ B;  4FP5 D;  4OWX B;  1Q82 C;  4WJ3 M;  5ELF A;  2EJM A;  4UHV A;  1LTG D;  1EY4 A;  1L1O C;  4L63 B;  2F52 A;  3Q24 A;  4X6A H;  1EL0 A;  2SNS A;  1NAP A;  5FK9 C;  1SE3 A;  5M5Y B;  1WI5 A;  3V2T A;  3GTM B;  1FD7 D;  3A0J A;  4CJ2 C;  4UPA A;  4B3R L;  1FNV A;  1YNN C;  1NTG A;  5C4J H;  4X62 Q;  3PV0 A;  3MA2 B;  3DUZ A;  3MXG A;  5LMN W;  1UEA B;  3CD6 A;  1A0I A;  3H0G G;  4B3M Q;  3EIV A;  3T1Y L;  1XMQ Q;  4K2L A;  1Y1V G;  4S3S A;  5C4Z A;  2VNU D;  4Y52 H;  3HOX G;  4DV2 L;  4LFA L;  3W2D A;  3V05 A;  1XMO Q;  2ASB A;  4OX9 Q;  3VR6 A;  4HED A;  2K4K A;  1T9H A;  5FKA C;  2MJ8 A;  1IL8 A;  1Y1W G;  4K0K Q;  2JSO A;  3FPP A;  4JI2 L;  1IYV A;  1IYJ B;  1W6K A;  1YIJ A;  1Z6H A;  4X62 L;  1HZB A;  4X3U A;  4HN7 A;  3BJU A;  4AYB G;  1HZA A;  2F4V L;  1HNW L;  1M4V A;  1O7Z A;  1Q46 A;  5C4X B;  2K5N A;  2PCF B;  1DJR D;  3GTO B;  1SYE A;  4UP9 A;  4ZCK A;  3E3X A;  4P71 A;  2I0Q A;  1HNZ Q;  4C2M B;  1PH1 A;  2EOT A;  4R4Q A;  2EIF A;  4LF8 L;  1J5E Q;  2EYJ A;  2IT1 A;  3QR8 A;  5LMN Q;  5IP7 G;  1U9R A;  1IZ6 A;  1EZ6 A;  2F0K A;  1B9N A;  2NWG A;  3D4R A;  1II3 A;  4X66 Q;  1JJG A;  4C3H G;  4DKA C;  5C0X J;  1Q8I A;  2WAQ G;  3GTG B;  4OIJ A;  1YJW A;  2XN9 C;  1SE4 A;  3F2B A;  3L7Z C;  3S17 B;  3S1M B;  3MFY A;  4Y7N B;  4QQB X;  1TS2 A;  2CH4 W;  1KAW A;  1PV4 A;  4WFN 3;  3C3L A;  3E9I A;  5CV5 A;  5IT9 c;  3K59 A;  2DJG C;  1P8L A;  3QIA A;  3J7A 5;  5CV9 A;  3FMC A;  3BZK A;  4FXK C;  1AW7 A;  4GN4 B;  2K7V A;  1JOO A;  2KHS A;  2QCP X;  1K73 C;  3T1H L;  1KL9 A;  1PYB A;  1V8Q A;  1QWY A;  1XMO L;  4F87 A;  1JQY D;  2XGT A;  3A7A B;  1XTC D;  3JAM i;  4RKL A;  4CKE A;  4KHP Q;  1Y1W B;  3KF6 A;  1ILP A;  3P1H A;  2RDH A;  4IN3 A;  5C3X A;  4X3K A;  3OTO L;  3I91 A;  1YHB A;  1O7L A;  1EIH A;  2Z6K A;  3K0Y A;  4JOI C;  2C9O A;  4XT1 B;  3RN2 A;  1J5E L;  3HZX A;  5I2Y A;  2BDO A;  3FPU B;  4DXG A;  1KNA A;  1CHQ D;  1EZ8 A;  2B8F A;  4ODG A;  4C3J G;  5KYI A;  2KQ3 A;  4H44 C;  3PUV A;  4A4I A;  4N8X 1;  2PZW A;  1EY5 A;  4L5T A;  2UXD Q;  4DR6 L;  3A7L A;  2ES2 A;  2I46 A;  1HNX L;  3PQI A;  1HNZ L;  2YU9 B;  2J7Z A;  2NVY B;  4OEM B;  4PZ8 A;  2PQA A;  3VR5 A;  3VR4 A;  3TQY A;  5LMU L;  3RD4 A;  4A3L H;  2YYZ A;  1QVC A;  1U4R A;  4L8J A;  4FF4 A;  1XPO A;  1BCP C;  2ZJR A;  4BY7 G;  4NXM Q;  3DXJ C;  1TS4 A;  1IXR A;  1SNP A;  5J39 A;  4ZKB B;  2NVQ B;  4M8A A;  4PMW A;  3GTL B;  2AUK A;  3VR2 A;  5FLM G;  5LHY 1;  1SE2 A;  4K8I A;  2B2T A;  4AIM A;  4LF4 L;  1IHZ A;  3VA5 A;  5IWA L;  2AHO B;  3GTM H;  5BR8 L;  3C46 A;  1I4P A;  1VQH A;  1KXL A;  2EPB A;  2NN6 G;  5KEE A;  3SGI A;  1DZ1 A;  3K7U C;  3D8G A;  1HTP A;  1HQM C;  1PFN A;  3NUC A;  1I6H H;  1AFP A;  2J0T D;  1BBU A;  1ROD A;  3UE0 A;  3H3V C;  2I5L X;  1SNQ A;  1YHA A;  1VDZ A;  3M9B A;  1UNS A;  3CME A;  4GLA C;  3ICE A;  3QOL A;  2B2T C;  3S16 B;  1Q8K A;  4TKO B;  4LFB Q;  4RGO S;  1C8C A;  3GTQ B;  3I55 A;  1ICF B;  4BY1 H;  4FDB A;  4ME5 A;  1ILQ A;  2XIW A;  3MWY W;  5JAV A;  4DGZ A;  3PUX A;  1MGS A;  4DV6 L;  1U0L A;  4XT3 B;  1LM0 A;  1UE7 A;  5T1I A;  4C3I G;  5BN4 A;  3ULP A;  3NBH B;  1P16 A;  1ENA A;  1OXX K;  2AUJ D;  1FYC A;  3NTI A;  1CSQ A;  1PH7 A;  4BY1 B;  2Q8T A;  2CWP A;  4JYA Q;  4M1U B;  3JAM L;  1EY6 A;  1FNW A;  3OW7 A;  4A3F B;  3S2D B;  3UI2 A;  3MHB A;  1R9T H;  1YJ9 A;  3NXW A;  2R7Z G;  1XNR Q;  2BH8 A;  2LMC B;  1VQM A;  4LNQ A;  1HH2 P;  1LT5 D;  3UE1 A;  4LUV A;  2RCN A;  2PO4 A;  1SRU A;  2ZTC A;  3DWQ A;  5IGD A;  1YNN D;  2CH4 A;  4BY7 B;  4YWM A;  4OWT B;  3O13 A;  2LXJ A;  1KDA A;  3NEN A;  3WOF A;  1OXT A;  1ZEQ X;  1NBW A;  3RZO B;  2MHV A;  4RGT A;  5JVG 3;  1Q81 C;  4LF6 L;  1B7Y B;  1DOL A;  1PTO H;  3KBG A;  1Y8P B;  2D0O A;  4H7B A;  1WD1 A;  2ZXO A;  1E24 A;  2F0V A;  3L2P A;  1N34 L;  1SN8 A;  3DWA A;  3SHL A;  1EOV A;  5LL6 S;  1PZK D;  3GTL H;  4IO9 A;  4IFD G;  2DGY A;  3QJY A;  1SE8 A;  1T5X D;  3SVM A;  1QIL A;  4QY7 A;  4EQN A;  5M5X B;  2R92 G;  1LTR D;  4JI8 Q;  1F77 A;  2JJQ A;  1C9O A;  4DV0 Q;  4G7H C;  4HSV A;  4HTH A;  2HUG A;  3HS0 C;  4UDU C;  5DEH A;  4A3L G;  4DA2 A;  4GKJ Q;  2AMC B;  2UU9 L;  3KF8 B;  4OL7 A;  2Q2U A;  1AE2 A;  4FVM A;  5GRO A;  4A3F G;  3GTP B;  1JOR A;  2NTT A;  2YU9 H;  1IW7 D;  3AB9 A;  3D4D A;  1SMY C;  3D6W A;  4NXN L;  2FMM A;  5CBE E;  4QF4 A;  3HOY H;  1VQG A;  3A5Z B;  2CFM A;  2B2U C;  4BBR B;  3M85 A;  4IPD A;  4HCS A;  4JI1 Q;  5IYD H;  2UUB L;  2HCI A;  2NVT B;  1U4L A;  3PO2 G;  1IBM Q;  2N78 A;  3RLN A;  3CU7 A;  1TWA B;  3EN2 A;  5C3E G;  3LNN A;  3SEB A;  1ASZ A;  5C5L A;  2CKZ B;  2B3G A;  3SDZ A;  3G71 A;  1HUN A;  3N52 A;  1K83 B;  1VF5 C;  4YIJ A;  1KD1 C;  3ONA B;  1Z9F A;  4IPC A;  5CV8 A;  3TS2 A;  3SE0 A;  3ZJY C;  5LMN L;  2WKD A;  1FJG L;  1QJO A;  5DM7 3;  3I73 A;  4QGU A;  3UDG A;  1XYI A;  2GN5 A;  1QE6 A;  2JYO A;  5IGC A;  4B08 A;  4LMQ D;  3GTK B;  5C0X G;  1QCB D;  1HCZ A;  2F1M A;  3NWS A;  5GAG C;  2N49 A;  1GHJ A;  1G6Z A;  1E22 A;  3NQI A;  3HKS A;  1F9R A;  1HHV A;  1GOZ A;  3M4Y A;  3BDO A;  1IBL Q;  2ZM6 L;  4JI4 L;  2WAC A;  2F4I A;  1WCM G;  1EY9 A;  1SBB B;  2VL6 A;  3CKI B;  1PHJ A;  2IWH A;  4A3D H;  4XYQ A;  4HR7 B;  3WWV A;  4ZLT F;  2K5Q A;  1J6Q A;  1F9Q A;  4MTK A;  2B2W A;  2K03 A;  1EEF D;  1ESR A;  1E1O A;  5I9P A;  4ZAI A;  5CYU A;  2DY8 A;  2G9D A;  5IYB G;  2F0W A;  5M3M B;  1I5F A;  3BS1 A;  1X3F A;  1CKM A;  4TQU S;  4LF7 Q;  2B2Y C;  5IOC A;  2B2Y A;  1N32 Q;  1PFS A;  4JI6 L;  2E2I H;  3FDT A;  5EKI A;  1EYD A;  2HQE A;  4HCE A;  4A76 A;  2R93 B;  3I4L A;  3BU2 A;  2JA7 H;  5C3E B;  4C1N I;  1TWF B;  1VQB A;  2BE5 C;  3KLW A;  2CW0 D;  2Z4I A;  4B3T Q;  1B2T A;  1Q3L A;  1CTM A;  1QUQ A;  1WFQ A;  2G9H D;  1K0R A;  3G48 A;  4DR6 Q;  2CHB D;  4IAL A;  4J15 A;  3CCJ A;  3J81 i;  2QIL A;  4CDD C;  4POG A;  2F0I A;  3ULJ A;  1E3P A;  2KUM A;  2JA9 A;  1GUT A;  4V19 0;  2ZXP A;  3BZC A;  4B3R Q;  2LFN A;  4IJH A;  1TQO A;  3F8T A;  1E0B A;  2PYK A;  5LL6 X;  1TII D;  2Q2T A;  2JA5 G;  2BH2 A;  2JEB I;  5IT9 E;  1GD7 A;  1GUN A;  4ZUI A;  1GJX A;  3M4P A;  3S1M H;  1X9N A;  3W1B A;  2K75 A;  3JAM c;  4DR5 Q;  4JI4 Q;  1PMR A;  5M5W B;  2Q8I B;  3S1Q H;  3OHX C;  4RG1 A;  2EYH A;  3Q8D A;  1A15 A;  3STB D;  1E7Z A;  4IUR A;  2N8N A;  3LWE A;  4WOR A;  5JJI A;  2D2C C;  1Q1B A;  2E5L L;  4NMZ A;  4TSS A;  4A3M H;  4KV6 A;  2K52 A;  3D4W A;  3C1E A;  3J80 L;  3OYY A;  1F2Y A;  1WCM H;  5COY A;  3K5O A;  4RA8 A;  1MIU A;  1TXY A;  4XQN A;  2A19 A;  5C5M A;  1I3Q B;  5AJ3 L;  5K5P A;  4LF5 L;  2PI2 E;  4HJA A;  1RF2 D;  3MXN A;  1VQN A;  1SYG A;  3NTK A;  1W6J A;  1K8A C;  4A3E H;  2L9H A;  2E5L Q;  3B6Y A;  1D5X C;  1AP0 A;  2JK8 A;  1K28 A;  5IGB A;  4LWC A;  1VQ8 A;  3GO5 A;  1NNX A;  2JA7 B;  2UUA Q;  1VQL A;  2E2J H;  3ERO A;  4A3B H;  3PF4 A;  2ZJP A;  1DD2 A;  4QMG A;  4X64 L;  4GKK L;  3J7A V;  2I07 B;  3CCL A;  1VQF A;  3PCO B;  1SYB A;  4IPG A;  5IIF A;  1T5E A;  4DR7 Q;  5EAY A;  1SSO A;  3TBI B;  5C6A A;  5EKL A;  2QEX A;  5M5W H;  2A8V A;  5GAH C;  3W5O A;  2JA8 G;  4IFD J;  3G4S A;  2VQE L;  4X3T A;  4GKK Q;  1L1O B;  4K5X A;  1H9S B;  1I4X A;  3K81 C;  1TWA H;  5I2X A;  1SFO B;  1B53 A;  1LTS D;  2IJ0 A;  3J80 E;  3HFZ B;  4K0K L;  2A69 C;  4LW1 A;  5AJ3 Q;  4OO1 H;  1BF4 A;  3S17 H;  2R92 B;  1D7Q A;  3RLO A;  1XNQ L;  2QW7 A;  3K5N A;  1X65 A;  4C2M H;  2I5H A;  5J3B A;  1SNO A;  4JC0 A;  3I4M B;  4QUF A;  1STA A;  2ICI A;  2Z4H A;  1K3B C;  1R4Q B;  4MHE A;  1EFI D;  4HID A;  2A6E D;  1I4H A;  2Z0S A;  2F0M A;  4KK7 A;  1S5F D;  2FFK B;  3CRL C;  4A3M G;  2B63 G;  2KED A;  2RDG A;  4RCN A;  1K8G A;  1LUZ A;  1JE5 A;  1E2Z A;  4PQX A;  4KHZ A;  4OX9 L;  1B3Q A;  5FO7 B;  4BBS B;  3W3A A;  5A35 A;  2B39 A;  3BZD B;  4DV7 L;  3HOU G;  4P75 A;  3IAY A;  4K6L A;  5IYB H;  1CZG A;  2QDB A;  5HGT A;  1MD2 D;  1HZ9 A;  2MP1 A;  2FMC A;  1JE4 A;  4BBR H;  1TS3 A;  2EYP A;  3PMF A;  4XQJ A;  3F2C A;  4JK1 C;  1B9M A;  4CKB A;  1HPC A;  3CXC A;  3S1R H;  2WB1 E;  3T13 A;  4RH6 A;  3CCE A;  1JWU D;  2ATW A;  4DAY B;  2AKW B;  4F8M A;  5HUR A;  1IBL L;  2HCC A;  1I4R A;  1VQI A;  1VF7 A;  4IZ8 A;  3K6O A;  3SK4 A;  3A54 A;  1A62 A;  1RD9 D;  2KCT A;  1EQT A;  3GTG H;  2NN6 H;  1B50 A;  2BE5 D;  4BWG B;  2YV5 A;  1NMF A;  3VR3 A;  2EXD A;  2R61 A;  1S5C D;  2R7Z H;  1NSN S;  3HOW G;  3GDE A;  3NPP A;  2JA7 G;  2F0Q A;  4CKC A;  1QG7 A;  1X3P A;  3KLS A;  2B2U A;  1L0W A;  4DK0 A;  4DUY Q;  1CA5 A;  4JI2 Q;  1JCK B;  3EFX D;  4KJO A;  3CF5 A;  1PDQ A;  4WJ4 A;  1QOH A;  4PMC A;  1HQR D;  4H02 A;  4RKB A;  3I4M G;  3I70 A;  4LJZ C;  4HJ7 A;  2XNA C;  4DFA A;  1I4Q A;  1UE6 A;  1MSH A;  3Q22 A;  4OWW B;  3E5S A;  4B3S Q;  2F3I A;  1XNQ Q;  2JA6 G;  4IFD H;  3S16 H;  1UE5 A;  2LSS A;  3PUZ A;  4JI5 L;  1PH3 A;  2B29 A;  4JOI A;  4DR4 Q;  4BXX H;  2YTV A;  4KI0 A;  1IBK L;  1XWE A;  1Y8O B;  4A3G G;  1HUM A;  3A56 A;  1CHP D;  5FO8 B;  1MJC A;  1DXM A;  4IUQ A;  3I4M H;  1UEB A;  2SOB A;  1BXT A;  4OO1 G;  1N33 L;  1WYD A;  5JVH 3;  1HTL D;  1D5M C;  1VQA A;  3IFD A;  2F03 A;  2R7Z B;  5JJZ A;  4FYD A;  3BVG A;  5FOB B;  4JI3 Q;  2XWJ B;  2RKS A;  5GQO A;  3NSW A;  1ML0 D;  3J80 c;  4YCV A;  3J81 j;  2UXB Q;  1LT3 D;  2UUC Q;  4A3F H;  4IUV A;  3S2D H;  3S14 B;  4FO2 A;  2N3S A;  3LGJ A;  3DEP A;  3OIP A;  2DUD A;  5BN3 A;  2NB0 A;  4LF9 L;  3KJO A;  5JEA J;  1PH9 A;  4NXM L;  1EWI A;  1STN A;  3U58 A;  3KUP A;  5FLX E;  3EA6 A;  1X3E A;  2NVY H;  5BN5 A;  1B44 D;  4A75 A;  1SYC A;  1IKL A;  1J9O A;  1F9P A;  4A3D G;  4JW0 A;  5GAE C;  4PMB A;  4Z9C B;  3S1R B;  2EYF A;  2NN6 I;  2BA1 A;  1ET6 A;  1BO0 A;  3T16 A;  1SND A;  1V1P A;  1STE A;  1TWH B;  2ZTD A;  1HR0 Q;  2M2L A;  2E75 C;  4B9W A;  3J81 c;  5EJW A;  4YWL A;  1TVX A;  1R9T B;  1KAB A;  1NE3 A;  4ZYS A;  2MQH A;  4ZQ3 A;  5DLQ E;  5A2Q L;  1XJV A;  2JA6 H;  5C0X I;  3GTJ H;  1X3Q A;  2TMP A;  1WTQ A;  5IGF A;  4BY7 H;  3K58 A;  3PIP 3;  1U5K A;  1LAB A;  3RZD B;  5FO9 B;  1EWH A;  4DPG A;  1IKM A;  1H95 A;  3STB C;  1B8A A;  3PO3 G;  4APV A;  1TR5 A;  4ZUJ A;  5J1Z A;  3GV6 A;  3AU7 A;  1Y1W H;  4DK1 A;  1VMC A;  4NB3 A;  4L5R C;  4G4K A;  2RCF A;  2PZU A;  4KN4 C;  3SXH A;  5F2D A;  4GS3 A;  1ESF A;  1OXS C;  1HFN A;  1N8R C;  3BVZ A;  2JN4 A;  2A69 D;  4OXP A;  1F2L A;  1PZI D;  4KY6 A;  3A74 A;  3N6R A;  2ENB A;  2VUM G;  1YJN A;  1V43 A;  1AN8 A;  1XXG A;  2KHI A;  3I4O A;  3SK8 A;  1UUP A;  1EY7 A;  3NK9 A;  2SDF A;  3T1Y Q;  5JEA G;  2LXK A;  2RBM A;  2RSN A;  3AFP A;  3KLR A;  4Y7N H;  5KYL A;  1LAC A;  1YNX A;  4LF4 Q;  2V4D A;  3DEO A;  4CDF C;  1PRT C;  2KOL A;  2EY5 A;  2K14 A;  3PIO A;  2VS1 A;  5FJ8 G;  3KYH C;  2F0O A;  5KGU A;  5IYC H;  1D6E C;  4TVA B;  4FNF A;  2AWN A;  2UXC L;  1DOM A;  1QZG A;  2AWO A;  2N88 A;  4JVZ A;  1BBX C;  3BVM A;  4G7Z C;  1AE3 A;  1BCP F;  3RNU A;  5ELE A;  5IE8 A;  1MHW C;  1PYS B;  1ZYR C;  1VQJ A;  3GD7 A;  3ER0 A;  2OEO A;  3DM1 A;  1KDB A;  3ULL A;  4JBM A;  4XXE A;  3L9A X;  4FF1 A;  1JT8 A;  4O0A A;  3TS0 A;  4DR1 Q;  3RR5 A;  1LV9 A;  1YNJ D;  3J7A F;  2MNA A;  3PIP A;  3HOW B;  3MTS A;  1DCZ A;  4QCL A;  4XDX A;  1S40 A;  4DV3 L;  4DV4 Q;  4DR2 L;  1LTB D;  4JCV E;  5FLM H;  2OWO A;  4GN3 B;  2ICE C;  4HSP A;  2Z9H A;  1NJI C;  4R4T A;  4DV6 Q;  5C4J B;  1F2M A;  3PF5 A;  2FXQ A;  4DF7 A;  1S5D D;  5EBC A;  2WP8 J;  5E4W C;  4UP7 A;  3UDX A;  3CC7 A;  2R7F A;  4P72 A;  3F2D A;  1N36 Q;  5C4X H;  4DXF A;  1SDF A;  3I3C A;  4N8F A;  1S72 A;  1RDP D;  1QZH A;  1VQ5 A;  3I7F A;  4CJ0 B;  1BKB A;  3G6E A;  3KF8 A;  3FRP B;  3CQZ H;  4ID6 A;  4ZKC B;  2WII B;  5I4D A;  1NMG A;  1L2F A;  3F1Z A;  4E6I A;  2F0U A;  2R93 H;  4A93 G;  1JJC B;  1E2W A;  2LY7 A;  2ZXR A;  3JC6 6;  2A5H A;  1IL2 A;  2HT1 A;  2SNM A;  2NVX H;  4KKT A;  2F4V Q;  1X3G A;  4DV1 L;  1Y8N B;  2EE1 A;  2WAQ B;  2L4N A;  1TWC H;  4C3I B;  2K1B A;  1KTK A;  4YCU A;  1JR0 D;  3SR1 A;  4UY8 C;  2TSS A;  1TWH H;  1G8Z D;  1SAP A;  1RTO A;  1HNX Q;  5KRU A;  1B70 B;  1U4P A;  1X6O A;  2IX1 A;  2NUC A;  1QB5 D;  2QEJ C;  3CCV A;  4MNO A;  2EYM A;  1CQV A;  3RUZ A;  5COR A;  2O5J C;  4JI1 L;  1EYC A;  4Q5V A;  3EVQ A;  1GVP A;  2A6H D;  4K8J A;  1CT1 D;  2RHQ B;  4B3S L;  2BCO A;  3J80 i;  4ALP A;  4ZRZ A;  3RMH A;  3HOX H;  4GLX A;  3AFQ A;  4NKL A;  2E2I B;  4IOC A;  1LT6 D;  1JWS D;  1SLJ A;  5IWA Q;  2QF7 A;  2MGS A;  5HGQ A;  2A6E C;  2EJG C;  5E4X A;  3K5M A;  3KLS X;  1L0Y B;  4A93 B;  2Q8R E;  2R7D A;  1CSP A;  1S5E D;  1GUS A;  5LMU Q;  3URY A;  5E7N A;  3TZU A;  1WJJ A;  2ALY B;  1TWG B;  1C4Q A;  2IW3 A;  2K33 A;  3HOZ H;  2QKI C;  2DY7 A;  4CJ1 B;  1PRT B;  2B8G A;  1TY2 A;  4DV3 Q;  4DV4 L;  2JEA I;  3L0O A;  1JC7 A;  5DNF A;  1ICW A;  4BA1 I;  4KTA A;  3KOJ A;  1XPR A;  3S1N B;  1PLF A;  3S24 A;  1KRT A;  1KQS A;  4AH6 A;  2A68 C;  4ILW A;  1FJG Q;  3HOV B;  4DN4 M;  1SNM A;  3QWN A;  4IPH A;  1KNE A;  4RHS A;  2H1E A;  3OSO A;  3I8Z A;  5IYD G;  4DV0 L;  3J7Y W;  3QOJ A;  4BBR G;  2HQL A;  1MBY A;  2OCE A;  3PO2 H;  2F0N A;  2F3W A;  1BDO A;  1IBM L;  4H13 C;  3S15 B;  5JPM C;  2A68 D;  1EFW A;  2JA8 B;  4DV5 L;  1WTV A;  4A3D B;  4BBS G;  2VW9 A;  1YBY A;  2RF4 A;  3I4N H;  4FXD A;  5BR8 Q;  3I2Z A;  1WTH A;  1H9M A;  2EY2 A;  3KBX A;  2XRQ D;  4JI7 L;  4KN7 C;  1FVI A;  3LX0 A;  1SMX A;  4O2D A;  5C4X G;  2VXW A;  4AYB E;  1A3U A;  1O78 A;  5M3F G;  5C0X H;  3VA7 A;  1L1O A;  1OTC A;  1AH9 A;  3Q23 A;  1C48 A;  3VDY A;  3CPF A;  4A3J H;  1M8A A;  2KVM A;  1B3A A;  4HAE A;  3K80 C;  5CGK A;  5JJK A;  5GAD C;  4C3H B;  1BR9 A;  1WTX A;  4KD4 A;  1ONL A;  2Y0S B;  3IRB A;  3TME A;  4OO1 I;  5H1S E;  2E76 C;  3NWT A;  1LYL A;  3WOE A;  4JI6 Q;  2OT2 A;  4BXX G;  3K5L A;  3P20 A;  4LF8 Q;  3H3V H;  4YWK A;  3AQQ A;  2NZO A;  3HOZ B;  3BDC A;  5EQ0 A;  3FKI G;  3SK5 A;  3M7N A;  1KLU D;  2DJF C;  1Y1V B;  5NUC A;  2F0P A;  3S2H H;  1HA6 A;  3RLF A;  2V1C C;  2K5H A;  2L0C A;  1CKN A;  1BBW A;  2FIN B;  3HOU H;  1HNW Q;  1D1I A;  2X6G A;  2F0H A;  1YZ6 A;  2KCM A;  1PXU A;  1I94 L;  1WTP A;  2UUA L;  2VQF L;  1GUW A;  2CWA A;  5C44 H;  1YIT A;  3HEJ A;  2JA8 H;  4JYA L;  4BY1 G;  2JE6 I;  1HRJ A;  4A3C G;  2OQ0 A;  4A3I H;  4JI3 L;  2KEN A;  2O4X A;  3H91 A;  3ZYY X;  3FHW A;  4DK3 C;  1GHK A;  3I4N G;  1BCP D;  3KK7 A;  3VYT A;  1WD0 A;  1N32 L;  2G5D A;  4A3E B;  4AQY Q;  4BBS H;  4LF5 Q;  3BG3 A;  1KDC A;  4KY5 A;  4HJ9 A;  1KRS A;  3F2U A;  5IP9 H;  3Q0A A;  2A74 C;  1WTO A;  2MFI A;  1VS0 A;  2B2W C;  4G7O C;  1A3T A;  4R8I A;  2WFW A;  5E1F A;  1PH5 A;  4V0B A;  2PPB C;  1EYG A;  1I6H B;  2F0T A;  3P75 A;  2R3Z A;  1K0S A;  1VQP A;  5C4H A;  2UUC L;  3OWF A;  1Z47 A;  3BYY B;  2K5W A;  3BYT B;  3TDQ A;  2RVL A;  3TP6 A;  3PO3 H;  3VYS A;  2CQO A;  2J4X A;  2NBF A;  4A3J G;  4C56 C;  5FLX L;  2WAQ E;  1BNZ A;  4K5W A;  3PUW A;  4WRD A;  3S1N H;  1LTA D;  2JQO A;  1B1Z A;  1TKW B;  5CV6 A;  3CHB D;  2F0F A;  1SNC A;  2RSO A;  4QIW B;  4EVO A;  2KA7 A;  2XSC A;  5C3W A;  1I94 Q;  1EIY B;  3T51 B;  1CQF A;  2E2H B;  1RCV D;  3FKI B;  1CK1 A;  1VCI A;  4L5Q A;  1MI2 A;  2L1B A;  4FXG C;  4K2K A;  1HA5 A;  2L11 A;  2UXB L;  3HRZ C;  3QG1 A;  1YI2 A;  4C3J H;  1AZP A;  5KNC A;  3H3V I;  3U9O A;  2HHH Q;  4HJ5 A;  3U4Z A;  3KF6 B;  3M4O H;  4ABN A;  1JB3 A;  4R1J A;  1TU2 B;  3HKZ E;  4LFC L;  1Q1E A;  4GNX B;  3ITP A;  5T1G A;  5EPL A;  1TT2 A;  3PSI A;  3CCM A;  4PG3 A;  4C3J B;  1TWF H;  4KY7 A;  1WVL A;  2NYZ D;  2MUY A;  1STG A;  4YHH Q;  3E9H A;  1HR0 L;  4RAU C;  4FF2 A;  5ELO A;  2WKC A;  4DUZ Q;  1E2V A;  3I56 A;  5C44 B;  4X64 Q;  5IYC G;  3LWU A;  1ASY A;  2NZ1 D;  4MTN A;  1KHI A;  1EU4 A;  1SJE D;  2JXM B;  1WTW A;  4QB4 A;  1I3Q H;  4DNR B;  1S3O A;  2KBN A;  2QDL A;  1V1O A;  1EEI D;  3H0G B;  2E8G A;  2R92 H;  4X65 L;  2LKV A;  2VB3 X;  5D14 A;  3H09 A;  1CA6 A;  2E2H H;  2XTI A;  1VQC A;  4A3M B;  2KCN A;  2L55 A;  3R8B A;  4R9W A;  1BCP B;  2F3V A;  2AQ2 B;  3HGB A;  5KIX A;  4N9P A;  1D2B A;  2WIN B;  2SEB D;  3FEW X;  4DAP A;  4RCO A;  1V9P A;  5CMD A;  3T56 B;  3M3Y B;  1LTT D;  4GLV B;  1V1P B;  1CKO A;  1D1K A;  3EBE A;  4QL5 A;  4RGN A;  1RL2 A;  4A3E G;  4U67 3;  4R8N A;  3H0G H;  5IP9 G;  3QB3 A;  1C7Y A;  1SMY D;  3NP8 A;  3TP7 A;  2OXP A;  3HKZ G;  4IUN A;  1K8M A;  2MO0 A;  2EVB A;  1KAA A;  1JJ2 A;  4YY3 Q;  1FNU A;  4DUZ L;  3KDF A;  4DR5 L;  4BS9 A;  5CV7 A;  1KLG D;  4KKS A;  2UXC Q;  5EPK A;  1JWM D;  2NTS A;  1GUO A;  4AYB B;  4RHR A;  3D3R A;  4KKU A;  4JI7 Q;  4XYO A;  5DM6 3;  1H9K A;  4GZY C;  4OHJ A;  3MXP A;  2F0D A;  3HOU B;  2D62 A;  3GTJ B;  1XTD A;  3I90 A;  2JA6 B;  5CBA E;  4XQQ A;  2CVR A;  5KND A;  3E0E A;  4NW2 A;  1I4G A;  3RZD H;  3HOV G;  1JOK A;  2A1A A;  3E6Z X;  1Q12 A;  2Z6B A;  1H9J A;  5JOB A;  3GTK H;  1QUQ B;  2NZH A;  2Q2I A;  5KNB A;  3NHH A;  4X66 L;  1BQQ T;  1OXV A;  4K5V A;  5M3M H;  2EYL A;  1S4Z A;  2D5D A;  1A3V A;  1RIP A;  2HIX A;  5G3L F;  1FL0 A;  1KC8 C;  4YHH L;  5G3L D;  1N34 Q;  1ENC A;  2IX0 A;  3MEH A;  1SRO A;  3L3O C;  3CCU A;  2PNR C;  3GP7 A;  2K05 A;  4Q0F A;  4EQO A;  3X3M A;  5M5Y H;  4DUY L;  4A3I G;  3TP5 A;  3DLL A;  3VYU A;  4J6H A;  1EQR A;  3K57 A;  2Z8L A;  3HG9 A;  1EQV A;  4DR4 L;  1Y69 U;  5EGT A;  2A6H C;  4A93 H;  4CGY B;  1VQ7 A;  4QJF A;  4MZ9 A;  3C2P A;  3OTO Q;  1R4P B;  1VQ4 A;  4LAA A;  5AFW A;  2QGQ A;  2AQ3 B;  2EY6 A;  1B4O A;  3K8A A;  2JA5 H;  1JMC A;  4A3G H;  3TRZ A;  3G7L A;  2YTX A;  1X55 A;  2VZA A;  3FVQ A;  4PNY A;  2O2L D;  1PH2 A;  1SJH D;  1H9R A;  1EY8 A;  3V96 A;  2PMZ E;  4DR7 L;  4OIK A;  1M90 C;  1A63 A;  2K6A A;  2BA0 A;  3GTO H;  1N33 Q;  1O7I A;  3ND9 A;  4LUO A;  5CV4 A;  2EYO A;  4LFB L;  2GA4 B;  3JAM E;  4DV2 Q;  4KLK A;  1FR3 A;  1BOS A;  3S15 H;  1PH8 A;  1PYW D;  1S5B D;  2PMZ B;  2YTY A;  1FGU A;  1VQE A;  2IY5 B;  4A3I B;  1QVF A;  4GNX C;  5EBD A;  3DMU A;  1CUK A;  4GN5 A;  4L6T B;  4DV1 Q;  3X3N A;  3NBH A;  1ZKO A;  3MFG A;  1J8I A;  3T53 B;  1NR2 A;  2LS0 1;  1AZQ A;  3NEM A;  1PVO A;  1STY A;  1LT4 D;  4K6D A;  5M3M G;  4IUT A;  4RGM A;  2O5I C;  1CZW A;  4DR3 L;  5J22 A;  4AQY L;  2VUM H;  2WB1 B;  1JOQ A;  4GNX A;  4B9X A;  2B63 B;  1HZC A;  2RQX A;  4A3J B;  1PTO C;  4LFA Q;  3J81 L;  3PGZ A;  4JG2 A;  1ZXT A;  1H9S A;  2F0E A;  4JV5 Q;  3T4A C;  4JI0 Q;  4B3M L;  3R2T A;  4CDC C;  4CHT B;  1VQO A;  2IPK D;  3MAQ A;  2F0L A;  4C3H H;  1GM5 A;  1XPU A;  3AEV A;  3SK6 A;  3HOY G;  3U4V A;  2K28 A;  4NPS A;  5CC4 A;  1IW7 C;  4DR3 Q;  3ERS X;  3PUY A;  1EOT A;  1PTO F;  3NE5 B;  3H15 A;  5IGE A;  2XWB B;  3S14 H;  2GVB A;  3IFT A;  1PRT D;  5FJ8 H;  5IGG A;  3GTQ H;  1CM9 A;  1PTO D;  2B63 H;  2QA4 A;  3HOW H;  1RKN A;  2E2D C;  4IUP A;  1SEB D;  4GOP C;  2PZT A;  3DWP A;  2PQA B;  5I6W A;  5ELN A;  1EY0 A;  2Z1C A;  4O42 A;  4JBK A;  3CMA A;  2K01 A;  2OTJ A;  5D3I B;  1TWC B;  2BOS A;  4EX5 A;  2UXD L;  1D8L A;  2I5M X;  1SR3 A;  4J1M A;  4KD3 A;  2JA5 B;  2L15 A;  2UU9 Q;  2K5V A;  3OW2 A;  3TRE A;  3OIQ A;  3NTH A;  4KHP L;  3MEF A;  1G2S A;  1YHQ A;  3AMU A;  2K50 A;  1N9W A;  2F0G A;  4DAV A;  4KHV A;  4DK6 C;  4OEL B;  1CFM A;  1EWC A;  1FGB D;  2KEE A;  5EKK A;  3GTP H;  1DYQ A;  4NP5 A;  4GOP B;  3WDN A;  4JV5 L;  4BA2 I;  2EY1 A;  1QNK A;  4U68 A;  4HJ8 A;  3UDI A;  2Z6K C;  3GV3 A;  3MVV A;  1W2B A;  1TS5 A;  4IQZ A;  1C0A A;  1PFB A;  5D3D A;  1V1Q A;  4EQ5 A;  4J8Q A;  1K3R A;  3EQL C;  5C44 G;  4JI0 L;  1DOK A;  2Y0S G;  1PZJ D;  4G57 A;  4GKJ L;  3KFU A;  1K9M C;  2EDG A;  1IBK Q;  1N36 L;  2ZT9 C;  4DR2 Q;  3RN5 A;  1NR4 A;  4IUU A;  3GQB A;  5JPN C;  1UWV A;  2AQ1 B;  4MIU A;  2HD3 A;  2X69 A; 
#chains in the Genus database with same CATH homology
 5ELD A;  2EZV A;  1BUV T;  3IL8 A;  1EIG A;  3MXU A;  4ZK9 B;  4X3S A;  3P7J A;  3A8I E;  3H6M A;  2E74 C;  5M9O A;  3PO2 B;  3OOC A;  1Z7T A;  4MN3 A;  3M4O B;  5A2Q E;  3R2I A;  3K7A B;  5DAU A;  3S1Q B;  1WCM B;  3IKJ A;  3OMC A;  1WTR A;  3EJI A;  5TSS A;  3NBI A;  5ISR A;  2KJX A;  4LK1 C;  1X32 A;  2A73 B;  3MZ5 A;  4I65 A;  4IFD I;  2L12 A;  4WJW A;  1LO5 D;  1SYF A;  2IX3 A;  3PO3 B;  1RTN A;  2HDL A;  1NCV A;  1U4M A;  3TSS A;  2EXZ A;  3C1F A;  1STB A;  2C5C A;  3OPO A;  1PFM A;  5ELC A;  5K36 H;  4EGV A;  1HFG A;  1VMP A;  2ID0 A;  1EU3 A;  2L5T A;  5I9O A;  2R6G A;  1LTI D;  2K04 A;  2DN8 A;  1A2T A;  4HMJ A;  2E2J B;  2DNE A;  1QNU A;  1O7Y A;  4F7X A;  4FF3 A;  4DNT B;  1NUC A;  5EPJ A;  4EQP A;  3VYR A;  1DON A;  4ULL A;  2MPM A;  3NQT A;  2NVX B;  3BDL A;  2PQE A;  1G91 A;  4QUC A;  1SYD A;  4JBW A;  1RHP A;  1G2T A;  5I6Y A;  2WV6 D;  2PW5 A;  1STH A;  3R3O A;  2BDN A;  5ELB A;  4F88 A;  1JIC A;  1LLR D;  2VB2 X;  4CBV A;  5JEA H;  2DNC A;  3H94 A;  3A8K E;  2IL8 A;  3TN2 A;  1ET9 A;  1G29 1;  1L0X B;  5E3F A;  2EJF C;  4A3K B;  5D65 A;  2PW7 A;  2XVS A;  1SXT A;  3HOY B;  1I50 B;  1DM0 B;  3TP8 A;  1UAP A;  4I7Z C;  1Q90 A;  4O1N A;  5IOD A;  1OXU A;  3S2H B;  3OMG A;  3CRK C;  4K14 A;  3G6J B;  1GXD C;  4OGQ C;  1PRT F;  2JP1 A;  2K5D A;  3A8J E;  3ERQ A;  3PIO 3;  1F9S A;  4DU9 A;  3J81 E;  3TZD A;  4NDX A;  4RWS C;  5IT9 L;  5M3F B;  3D31 A;  1A2U A;  3HKZ B;  4UAI A;  3DHQ A;  2XRS D;  4TRD A;  2M9V A;  5K36 G;  1OO9 B;  2RDF A;  3ND8 A;  3I72 A;  1O80 A;  2FHT A;  2CW0 C;  3S9W A;  5CR3 A;  3QO2 A;  2F0S A;  3Q6S A;  1ZYR D;  1IYU A;  2VUM B;  3HP3 A;  3E0J A;  1ENF A;  3R93 A;  4XIG S;  1GUG A;  4HMI A;  3A55 A;  1EYA A;  4DAY A;  1YNJ C;  1D5Z C;  2HDM A;  4N9T A;  2KCC A;  2KEC A;  1AEX A;  3U9S A;  4H0L C;  3HOX B;  4A3B B;  3OWE B;  4XTC S;  1XX8 A;  3D6C A;  4C1N K;  1F2Z A;  2B2V C;  2F0J A;  1K8O A;  3I4N B;  2FJ2 A;  2CQA A;  4PV1 C;  1I6V C;  4P2C B;  1CI3 M;  1TY0 A;  3MC0 B;  2OF1 A;  2M00 A;  3M7G A;  2H4O A;  1A6X A;  4RFB A;  2X6L A;  1PTO B;  4A3G B;  4KMU C;  1HXY D;  2RA4 A;  2N55 A;  1RJT A;  4KJN A;  2K32 A;  2D9U A;  2B2V A;  1MSG A;  3CQZ B;  4FP5 D;  5ELF A;  2EJM A;  1LTG D;  1EY4 A;  4L63 B;  3Q24 A;  1EL0 A;  2SNS A;  1NAP A;  5FK9 C;  1SE3 A;  5M5Y B;  3V2T A;  3GTM B;  1FD7 D;  4CJ2 C;  1FNV A;  1YNN C;  3PV0 A;  3MA2 B;  3DUZ A;  3MXG A;  1UEA B;  4K2L A;  4S3S A;  5C4Z A;  2VNU D;  3W2D A;  3V05 A;  3VR6 A;  4HED A;  5FKA C;  2MJ8 A;  1IL8 A;  2JSO A;  3FPP A;  1IYV A;  1W6K A;  1Z6H A;  4X3U A;  4HN7 A;  1M4V A;  1O7Z A;  5C4X B;  2PCF B;  1DJR D;  3GTO B;  1SYE A;  4C2M B;  2EOT A;  2EYJ A;  2IT1 A;  1U9R A;  1EZ6 A;  2F0K A;  1B9N A;  2NWG A;  3D4R A;  1II3 A;  4C3H G;  5C0X J;  1Q8I A;  3GTG B;  4OIJ A;  2XN9 C;  1SE4 A;  3L7Z C;  3S17 B;  3S1M B;  3MFY A;  4Y7N B;  1TS2 A;  3C3L A;  4WFN 3;  5CV5 A;  3K59 A;  3QIA A;  5CV9 A;  3FMC A;  4FXK C;  1AW7 A;  2K7V A;  1JOO A;  2KHS A;  2QCP X;  1V8Q A;  1QWY A;  4F87 A;  1JQY D;  3A7A B;  1XTC D;  4RKL A;  4CKE A;  1Y1W B;  1ILP A;  3P1H A;  2RDH A;  4IN3 A;  5C3X A;  4X3K A;  3I91 A;  1O7L A;  1EIH A;  3K0Y A;  4XT1 B;  2C9O A;  3HZX A;  5I2Y A;  2BDO A;  3FPU B;  4DXG A;  1KNA A;  1CHQ D;  1EZ8 A;  2B8F A;  4ODG A;  4C3J G;  5KYI A;  2KQ3 A;  4H44 C;  3PUV A;  2PZW A;  1EY5 A;  3A7L A;  2I46 A;  2YU9 B;  2J7Z A;  2NVY B;  3VR5 A;  3VR4 A;  3RD4 A;  2YYZ A;  1U4R A;  4L8J A;  4FF4 A;  1BCP C;  3DXJ C;  1TS4 A;  1SNP A;  5J39 A;  4ZKB B;  2NVQ B;  4M8A A;  4PMW A;  3GTL B;  2AUK A;  3VR2 A;  5LHY 1;  1SE2 A;  4K8I A;  2B2T A;  1IHZ A;  3VA5 A;  3C46 A;  1I4P A;  2EPB A;  2NN6 G;  5KEE A;  1DZ1 A;  3D8G A;  1HTP A;  1HQM C;  1PFN A;  3NUC A;  1AFP A;  2J0T D;  1ROD A;  3H3V C;  1SNQ A;  1VDZ A;  1UNS A;  3QOL A;  2B2T C;  3S16 B;  4TKO B;  4RGO S;  1C8C A;  3GTQ B;  4ME5 A;  1ILQ A;  2XIW A;  3MWY W;  5JAV A;  4DGZ A;  3PUX A;  1MGS A;  4XT3 B;  4C3I G;  5BN4 A;  5T1I A;  1ENA A;  1OXX K;  2AUJ D;  1FYC A;  3NTI A;  4BY1 B;  2Q8T A;  4M1U B;  3JAM L;  1EY6 A;  1FNW A;  3OW7 A;  4A3F B;  3S2D B;  3UI2 A;  3MHB A;  3NXW A;  2LMC B;  1LT5 D;  2PO4 A;  3DWQ A;  5IGD A;  1YNN D;  4BY7 B;  3O13 A;  3WOF A;  1KDA A;  1OXT A;  1ZEQ X;  3RZO B;  2MHV A;  4RGT A;  5JVG 3;  1DOL A;  1PTO H;  3KBG A;  1Y8P B;  4H7B A;  1WD1 A;  2ZXO A;  2F0V A;  3DWA A;  3SHL A;  5LL6 S;  1PZK D;  4IFD G;  3QJY A;  1T5X D;  3SVM A;  1QIL A;  5M5X B;  4EQN A;  1LTR D;  1F77 A;  4G7H C;  4HSV A;  4HTH A;  2HUG A;  3HS0 C;  4UDU C;  5DEH A;  4DA2 A;  4OL7 A;  4FVM A;  3GTP B;  1JOR A;  2NTT A;  1IW7 D;  3AB9 A;  3D4D A;  1SMY C;  3D6W A;  2FMM A;  5CBE E;  4QF4 A;  2B2U C;  4BBR B;  3M85 A;  4HCS A;  2HCI A;  2NVT B;  1U4L A;  3CU7 A;  1TWA B;  3LNN A;  3SEB A;  5C5L A;  3SDZ A;  1HUN A;  3N52 A;  1K83 B;  1VF5 C;  4YIJ A;  3ONA B;  5CV8 A;  3SE0 A;  2WKD A;  1QJO A;  5DM7 3;  3I73 A;  1XYI A;  1QE6 A;  2JYO A;  5IGC A;  4B08 A;  4LMQ D;  3GTK B;  5C0X G;  1QCB D;  1HCZ A;  2F1M A;  3NWS A;  1GHJ A;  1G6Z A;  3NQI A;  1F9R A;  1HHV A;  1GOZ A;  3M4Y A;  3BDO A;  2WAC A;  2F4I A;  1EY9 A;  1SBB B;  3CKI B;  2IWH A;  4XYQ A;  4HR7 B;  4ZLT F;  2K5Q A;  1F9Q A;  2B2W A;  2K03 A;  1EEF D;  1ESR A;  5I9P A;  4ZAI A;  5CYU A;  2DY8 A;  2G9D A;  2F0W A;  5M3M B;  3BS1 A;  4TQU S;  2B2Y C;  5IOC A;  2B2Y A;  3FDT A;  5EKI A;  1EYD A;  2HQE A;  4HCE A;  2R93 B;  3I4L A;  5C3E B;  4C1N I;  1TWF B;  2BE5 C;  2CW0 D;  2Z4I A;  1B2T A;  1Q3L A;  1CTM A;  2G9H D;  2CHB D;  4IAL A;  2QIL A;  2F0I A;  2KUM A;  1GUT A;  4V19 0;  2ZXP A;  2LFN A;  1TQO A;  1E0B A;  2PYK A;  5LL6 X;  1TII D;  2JEB I;  5IT9 E;  1GUN A;  4ZUI A;  1GJX A;  1PMR A;  5M5W B;  2Q8I B;  3OHX C;  2EYH A;  1A15 A;  4IUR A;  4WOR A;  3LWE A;  2D2C C;  1Q1B A;  4NMZ A;  4TSS A;  4KV6 A;  3D4W A;  3C1E A;  3J80 L;  1F2Y A;  5COY A;  3K5O A;  4RA8 A;  4XQN A;  5C5M A;  1I3Q B;  5K5P A;  1RF2 D;  3MXN A;  1SYG A;  3NTK A;  1W6J A;  2L9H A;  1D5X C;  1AP0 A;  5IGB A;  3GO5 A;  2JA7 B;  3ERO A;  1DD2 A;  4QMG A;  3J7A V;  2I07 B;  1SYB A;  5IIF A;  1T5E A;  1SSO A;  3TBI B;  5C6A A;  5EKL A;  4IFD J;  4X3T A;  4K5X A;  1H9S B;  1I4X A;  5I2X A;  1SFO B;  1B53 A;  1LTS D;  2IJ0 A;  3J80 E;  2A69 C;  4OO1 H;  1BF4 A;  2R92 B;  3K5N A;  1SNO A;  3I4M B;  4QUF A;  1STA A;  2ICI A;  2Z4H A;  1R4Q B;  4MHE A;  1EFI D;  2A6E D;  1I4H A;  2F0M A;  4KK7 A;  1S5F D;  2FFK B;  3CRL C;  2KED A;  2RDG A;  4RCN A;  1E2Z A;  4PQX A;  4KHZ A;  5FO7 B;  4BBS B;  3W3A A;  5A35 A;  2B39 A;  3BZD B;  3IAY A;  4K6L A;  1CZG A;  2QDB A;  5HGT A;  1MD2 D;  2MP1 A;  2FMC A;  1JE4 A;  1TS3 A;  2EYP A;  3PMF A;  4XQJ A;  4JK1 C;  1B9M A;  4CKB A;  1HPC A;  3T13 A;  4RH6 A;  1JWU D;  4F8M A;  5HUR A;  2HCC A;  1I4R A;  1VF7 A;  4IZ8 A;  3K6O A;  3SK4 A;  3A54 A;  1RD9 D;  1EQT A;  2NN6 H;  1B50 A;  2BE5 D;  4BWG B;  3VR3 A;  2R61 A;  1S5C D;  1NSN S;  3NPP A;  2F0Q A;  4CKC A;  1QG7 A;  1X3P A;  3KLS A;  2B2U A;  4DK0 A;  1CA5 A;  1JCK B;  3EFX D;  4KJO A;  1PDQ A;  1QOH A;  4PMC A;  1HQR D;  4RKB A;  3I70 A;  4LJZ C;  2XNA C;  4DFA A;  1I4Q A;  1MSH A;  3Q22 A;  3E5S A;  4IFD H;  3PUZ A;  4KI0 A;  1XWE A;  1Y8O B;  1HUM A;  3A56 A;  1CHP D;  5FO8 B;  1DXM A;  4IUQ A;  2SOB A;  1BXT A;  4OO1 G;  5JVH 3;  1HTL D;  1D5M C;  2F03 A;  3IFD A;  2R7Z B;  5JJZ A;  4FYD A;  3BVG A;  5FOB B;  2XWJ B;  2RKS A;  3NSW A;  1ML0 D;  1LT3 D;  4IUV A;  3S14 B;  4FO2 A;  3DEP A;  3OIP A;  5BN3 A;  2NB0 A;  5JEA J;  1STN A;  3KUP A;  5FLX E;  3EA6 A;  5BN5 A;  1B44 D;  1SYC A;  1IKL A;  1J9O A;  1F9P A;  4PMB A;  4Z9C B;  3S1R B;  2EYF A;  2NN6 I;  2BA1 A;  1ET6 A;  1BO0 A;  3T16 A;  1SND A;  1V1P A;  1STE A;  1TWH B;  2M2L A;  2E75 C;  4B9W A;  5EJW A;  1R9T B;  1TVX A;  4ZYS A;  1KAB A;  4ZQ3 A;  5A2Q L;  5C0X I;  1X3Q A;  2TMP A;  1WTQ A;  5IGF A;  3K58 A;  3PIP 3;  1LAB A;  3RZD B;  5FO9 B;  1EWH A;  1IKM A;  1TR5 A;  4ZUJ A;  5J1Z A;  3GV6 A;  3AU7 A;  4DK1 A;  1VMC A;  4G4K A;  3SXH A;  2PZU A;  4KN4 C;  5F2D A;  1ESF A;  1OXS C;  1HFN A;  3BVZ A;  2A69 D;  1F2L A;  1PZI D;  4KY6 A;  3N6R A;  2ENB A;  1V43 A;  1AN8 A;  1XXG A;  3SK8 A;  1UUP A;  1EY7 A;  3NK9 A;  2SDF A;  5JEA G;  2RBM A;  2RSN A;  3KLR A;  5KYL A;  1LAC A;  2V4D A;  3DEO A;  1PRT C;  2KOL A;  2EY5 A;  2F0O A;  5KGU A;  1D6E C;  4FNF A;  2AWN A;  1DOM A;  2AWO A;  2N88 A;  1BBX C;  3BVM A;  4G7Z C;  1BCP F;  5ELE A;  1ZYR C;  3GD7 A;  2OEO A;  3DM1 A;  1KDB A;  4XXE A;  3L9A X;  4FF1 A;  1LV9 A;  1YNJ D;  3J7A F;  3HOW B;  3MTS A;  1DCZ A;  4QCL A;  4XDX A;  1LTB D;  2ICE C;  4HSP A;  5C4J B;  1F2M A;  4DF7 A;  1S5D D;  5EBC A;  2WP8 J;  5E4W C;  4DXF A;  1SDF A;  3I3C A;  1RDP D;  4CJ0 B;  3KF8 A;  3FRP B;  4ID6 A;  4ZKC B;  2WII B;  5I4D A;  4E6I A;  2F0U A;  1E2W A;  2LY7 A;  2ZXR A;  2A5H A;  2SNM A;  4KKT A;  1Y8N B;  2EE1 A;  2WAQ B;  2L4N A;  4C3I B;  2K1B A;  1KTK A;  1JR0 D;  3SR1 A;  2TSS A;  1SAP A;  1G8Z D;  1RTO A;  5KRU A;  1U4P A;  2IX1 A;  2NUC A;  1QB5 D;  2QEJ C;  2EYM A;  1CQV A;  3RUZ A;  5COR A;  2O5J C;  1EYC A;  4Q5V A;  3EVQ A;  2A6H D;  4K8J A;  1CT1 D;  2BCO A;  4ZRZ A;  3RMH A;  4NKL A;  2E2I B;  1LT6 D;  1JWS D;  2QF7 A;  2MGS A;  2A6E C;  2EJG C;  5E4X A;  3K5M A;  3KLS X;  1L0Y B;  4A93 B;  2Q8R E;  1S5E D;  1GUS A;  3URY A;  3TZU A;  1TWG B;  1C4Q A;  2IW3 A;  2K33 A;  2QKI C;  2DY7 A;  4CJ1 B;  1PRT B;  2B8G A;  1TY2 A;  2JEA I;  1JC7 A;  5DNF A;  1ICW A;  4BA1 I;  4KTA A;  3S1N B;  1PLF A;  2A68 C;  4ILW A;  3HOV B;  4DN4 M;  1SNM A;  3QWN A;  1KNE A;  4RHS A;  2H1E A;  3OSO A;  3I8Z A;  3J7Y W;  3QOJ A;  1MBY A;  2F0N A;  2F3W A;  1BDO A;  4H13 C;  3S15 B;  5JPM C;  2A68 D;  2JA8 B;  1WTV A;  4A3D B;  4FXD A;  1H9M A;  2EY2 A;  3KBX A;  2XRQ D;  4KN7 C;  3LX0 A;  2VXW A;  1A3U A;  1O78 A;  5C0X H;  3VA7 A;  3Q23 A;  1C48 A;  1M8A A;  2KVM A;  1B3A A;  4HAE A;  5CGK A;  4C3H B;  1BR9 A;  1WTX A;  4KD4 A;  1ONL A;  2Y0S B;  3TME A;  4OO1 I;  2E76 C;  3NWT A;  3WOE A;  2OT2 A;  3K5L A;  3P20 A;  3HOZ B;  3BDC A;  5EQ0 A;  3SK5 A;  3M7N A;  1KLU D;  5NUC A;  1Y1V B;  1HA6 A;  2F0P A;  3RLF A;  2L0C A;  2FIN B;  1D1I A;  2X6G A;  2F0H A;  1PXU A;  1WTP A;  1GUW A;  3HEJ A;  2JE6 I;  1HRJ A;  2O4X A;  3H91 A;  3ZYY X;  1GHK A;  1BCP D;  3KK7 A;  3VYT A;  1WD0 A;  4A3E B;  3BG3 A;  1KDC A;  4KY5 A;  3F2U A;  3Q0A A;  2A74 C;  1WTO A;  2B2W C;  4G7O C;  1A3T A;  4R8I A;  5E1F A;  4V0B A;  2PPB C;  1I6H B;  2F0T A;  3P75 A;  2R3Z A;  5C4H A;  3OWF A;  1Z47 A;  3BYY B;  2K5W A;  3BYT B;  3TDQ A;  2RVL A;  3TP6 A;  3VYS A;  2J4X A;  2NBF A;  5FLX L;  4C56 C;  1BNZ A;  4K5W A;  3PUW A;  4WRD A;  1LTA D;  1B1Z A;  1TKW B;  5CV6 A;  2F0F A;  3CHB D;  1SNC A;  2RSO A;  4QIW B;  4EVO A;  2KA7 A;  2XSC A;  5C3W A;  3T51 B;  1CQF A;  2E2H B;  1RCV D;  3FKI B;  1CK1 A;  1VCI A;  1MI2 A;  2L1B A;  4FXG C;  1HA5 A;  4K2K A;  2L11 A;  3HRZ C;  3QG1 A;  1AZP A;  5KNC A;  3U9O A;  4ABN A;  1JB3 A;  1TU2 B;  1Q1E A;  3ITP A;  5T1G A;  5EPL A;  1TT2 A;  4C3J B;  4KY7 A;  1WVL A;  2NYZ D;  2MUY A;  1STG A;  4RAU C;  4FF2 A;  2WKC A;  1E2V A;  5C44 B;  3LWU A;  2NZ1 D;  1EU4 A;  1SJE D;  2JXM B;  1WTW A;  4QB4 A;  4DNR B;  1V1O A;  1EEI D;  3H0G B;  2LKV A;  2VB3 X;  5D14 A;  3H09 A;  1CA6 A;  4A3M B;  2KCN A;  2L55 A;  3R8B A;  4R9W A;  1BCP B;  2F3V A;  2AQ2 B;  3HGB A;  5KIX A;  4N9P A;  1D2B A;  2WIN B;  2SEB D;  3FEW X;  4DAP A;  4RCO A;  5CMD A;  3T56 B;  3M3Y B;  1LTT D;  1V1P B;  1D1K A;  4RGN A;  4U67 3;  4R8N A;  3QB3 A;  1SMY D;  3NP8 A;  3TP7 A;  2OXP A;  4IUN A;  1K8M A;  2EVB A;  1KAA A;  1FNU A;  4BS9 A;  5CV7 A;  1KLG D;  4KKS A;  5EPK A;  1JWM D;  2NTS A;  1GUO A;  4AYB B;  4RHR A;  3D3R A;  4KKU A;  4XYO A;  5DM6 3;  1H9K A;  4GZY C;  4OHJ A;  3MXP A;  2F0D A;  3HOU B;  2D62 A;  3GTJ B;  3I90 A;  2JA6 B;  5CBA E;  4XQQ A;  2CVR A;  5KND A;  4NW2 A;  1I4G A;  1JOK A;  3E6Z X;  5JOB A;  1Q12 A;  1H9J A;  5KNB A;  3NHH A;  1BQQ T;  1OXV A;  4K5V A;  2EYL A;  1S4Z A;  2D5D A;  1A3V A;  5G3L F;  5G3L D;  1ENC A;  2IX0 A;  3MEH A;  3L3O C;  2PNR C;  3GP7 A;  2K05 A;  4Q0F A;  4EQO A;  3X3M A;  3TP5 A;  3VYU A;  4J6H A;  3K57 A;  2Z8L A;  3HG9 A;  1EQV A;  1Y69 U;  5EGT A;  2A6H C;  4CGY B;  3C2P A;  1R4P B;  4LAA A;  5AFW A;  2AQ3 B;  2EY6 A;  1B4O A;  3G7L A;  3FVQ A;  4PNY A;  2O2L D;  1SJH D;  1H9R A;  1EY8 A;  3V96 A;  4OIK A;  2K6A A;  2BA0 A;  3ND9 A;  5CV4 A;  2EYO A;  2GA4 B;  3JAM E;  1FR3 A;  1BOS A;  1PYW D;  1S5B D;  2PMZ B;  4A3I B;  5EBD A;  3DMU A;  4L6T B;  3X3N A;  3NBH A;  1ZKO A;  3MFG A;  1J8I A;  3T53 B;  1NR2 A;  2LS0 1;  1AZQ A;  1STY A;  1LT4 D;  4K6D A;  4IUT A;  4RGM A;  2O5I C;  1CZW A;  5J22 A;  2WB1 B;  1JOQ A;  4B9X A;  2B63 B;  2RQX A;  4A3J B;  1PTO C;  3J81 L;  1ZXT A;  1H9S A;  2F0E A;  3T4A C;  3R2T A;  4CHT B;  2IPK D;  3MAQ A;  2F0L A;  3SK6 A;  2K28 A;  5CC4 A;  1IW7 C;  1EOT A;  3PUY A;  1PTO F;  3NE5 B;  5IGE A;  2XWB B;  3IFT A;  1PRT D;  5IGG A;  1CM9 A;  1PTO D;  1RKN A;  2E2D C;  4IUP A;  1SEB D;  2PZT A;  3DWP A;  5I6W A;  1EY0 A;  2Z1C A;  4O42 A;  2K01 A;  5D3I B;  1TWC B;  2BOS A;  2JA5 B;  4J1M A;  4KD3 A;  3OIQ A;  3NTH A;  1G2S A;  3AMU A;  2F0G A;  4DAV A;  4KHV A;  1CFM A;  1EWC A;  1FGB D;  2KEE A;  5EKK A;  1DYQ A;  4NP5 A;  3WDN A;  4BA2 I;  2EY1 A;  1QNK A;  4U68 A;  3GV3 A;  3MVV A;  1TS5 A;  4IQZ A;  1PFB A;  5D3D A;  4J8Q A;  3EQL C;  1DOK A;  1PZJ D;  4G57 A;  2EDG A;  2ZT9 C;  1NR4 A;  4IUU A;  3GQB A;  5JPN C;  2AQ1 B;  4MIU A;  2X69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...